F485463
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 911 | 399 | 1822 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10123310|Ga0163163_101233103 |
| Length | 175 |
| Sequence | MNDFDANLKELFQIKQVFNHPNKYFCTMNLLNLNDEYFMREALKEAKKAFDADEVPIGAVIVCKDKIIARAHNLTERLNDVTAHAEMQAFTSAANFLGGKYLEECALYVTIEPCVMCAGASYWAQIGKIIFGARDEKKGFLLTSKKILHPKTVLKSGVLEEECVILMKEFFKKKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 60 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 61 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 156 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 157 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 160 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 161 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 162 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 186 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 198 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 199 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 200 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 201 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 208 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 209 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 210 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 211 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 212 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 213 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 214 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 215 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 216 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 217 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 218 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 274 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 275 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 276 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 277 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 278 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 279 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 295 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 298 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 299 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 301 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 302 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 310 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 311 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 314 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 315 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 316 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 318 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 320 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 323 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 324 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 325 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 326 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 327 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 328 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 329 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 330 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 331 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 332 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 333 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 334 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 335 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 336 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 337 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 338 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 339 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 340 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 341 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 342 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 343 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 344 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 345 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 346 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 347 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 348 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 349 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 350 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 351 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 352 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 353 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 354 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 355 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 356 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 357 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 358 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 359 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 360 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 361 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 362 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 363 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 364 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 365 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 366 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 367 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 368 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 369 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 370 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 371 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 372 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 373 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 374 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 375 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 376 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 377 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 378 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 379 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 380 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 381 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 382 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 383 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 384 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 385 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 386 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 387 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 388 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 389 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 390 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 391 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 392 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 393 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 394 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 395 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 396 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 397 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 398 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 399 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.88 |
| Metatranscriptomes | 0 |
| Isolates | 8.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.81 |
| Nodule | 0.44 |
| Rhizoplane | 1.76 |
| Rhizosphere | 78.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163163_10123310 | 3300014325 | Bacteria | 2627 |
| 2 | SwRhRL2b_contig_1426845 | 2162886007 | Bacteria | 1125 |
| 3 | SwRhRL2b_contig_2141802 | 2162886007 | Bacteria | 1526 |
| 4 | SwRhRL2b_contig_2234511 | 2162886007 | Bacteria | 9507 |
| 5 | SwRhRL2b_contig_2737985 | 2162886007 | Bacteria | 1957 |
| 6 | SwRhRL2b_contig_3209656 | 2162886007 | Bacteria | 934 |
| 7 | JGI24736J21556_1005426 | 3300001904 | Bacteria | 2153 |
| 8 | JGI24736J21556_1005446 | 3300001904 | Bacteria | 2149 |
| 9 | JGI24740J21852_10009887 | 3300001979 | Bacteria | 3706 |
| 10 | JGI24740J21852_10032120 | 3300001979 | Bacteria | 1683 |
| 11 | JGI24740J21852_10121227 | 3300001979 | Bacteria | 655 |
| 12 | JGI24739J22299_10002365 | 3300001989 | Bacteria | 7265 |
| 13 | JGI24737J22298_10000496 | 3300001990 | Bacteria | 13684 |
| 14 | JGI24737J22298_10009284 | 3300001990 | Bacteria | 3277 |
| 15 | JGI24735J21928_10000005 | 3300002067 | Bacteria | 356755 |
| 16 | JGI24735J21928_10024511 | 3300002067 | Bacteria | 1825 |
| 17 | JGI25162J39368_1001793 | 3300002737 | Bacteria | 10128 |
| 18 | JGI25157J39369_1006041 | 3300002741 | Bacteria | 1893 |
| 19 | JGI25164J39214_1003256 | 3300002772 | Bacteria | 2124 |
| 20 | JGI25152J39213_1000080 | 3300002773 | Bacteria | 65432 |
| 21 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 22 | JGI25150J39212_1000004 | 3300002774 | Bacteria | 417320 |
| 23 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 24 | JGI25165J46597_1003249 | 3300003214 | Bacteria | 4215 |
| 25 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 26 | rootH1_10018738 | 3300003316 | Bacteria | 15789 |
| 27 | rootH2_10000823 | 3300003320 | Bacteria | 101452 |
| 28 | rootH2_10166669 | 3300003320 | Unclassified | 1153 |
| 29 | rootH2_10213711 | 3300003320 | Bacteria | 1508 |
| 30 | rootH2_10293539 | 3300003320 | Bacteria | 2432 |
| 31 | rootL2_10000170 | 3300003322 | Bacteria | 13923 |
| 32 | rootL2_10086321 | 3300003322 | Bacteria | 10746 |
| 33 | rootL2_10125855 | 3300003322 | Bacteria | 2542 |
| 34 | rootL2_10211502 | 3300003322 | Bacteria | 2285 |
| 35 | rootL2_10239455 | 3300003322 | Bacteria | 3059 |
| 36 | rootL2_10282583 | 3300003322 | Bacteria | 1700 |
| 37 | rootL2_10282620 | 3300003322 | Unclassified | 1678 |
| 38 | rootH1_10010138 | 3300003323 | Bacteria | 25280 |
| 39 | rootH1_10130033 | 3300003323 | Bacteria | 6041 |
| 40 | rootH1_10141868 | 3300003323 | Bacteria | 8019 |
| 41 | rootH1_10205903 | 3300003323 | Bacteria | 1901 |
| 42 | rootH1_10250537 | 3300003323 | Bacteria | 1411 |
| 43 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 44 | Ga0055536_1006887 | 3300003781 | Bacteria | 5188 |
| 45 | Ga0055530_10004135 | 3300003791 | Bacteria | 7681 |
| 46 | Ga0065165_1000478 | 3300005262 | Bacteria | 62182 |
| 47 | Ga0065714_10002231 | 3300005288 | Bacteria | 44866 |
| 48 | Ga0065714_10002386 | 3300005288 | Bacteria | 21249 |
| 49 | Ga0065714_10003833 | 3300005288 | Bacteria | 5996 |
| 50 | Ga0065714_10018627 | 3300005288 | Bacteria | 2049 |
| 51 | Ga0065714_10068450 | 3300005288 | Bacteria | 4718 |
| 52 | Ga0065714_10071057 | 3300005288 | Bacteria | 3685 |
| 53 | Ga0065714_10085785 | 3300005288 | Bacteria | 2119 |
| 54 | Ga0065714_10097380 | 3300005288 | Bacteria | 1737 |
| 55 | Ga0065714_10110637 | 3300005288 | Bacteria | 1482 |
| 56 | Ga0065714_10128983 | 3300005288 | Bacteria | 1261 |
| 57 | Ga0065714_10180754 | 3300005288 | Bacteria | 964 |
| 58 | Ga0065714_10234935 | 3300005288 | Bacteria | 808 |
| 59 | Ga0065714_10260939 | 3300005288 | Bacteria | 757 |
| 60 | Ga0065704_10002049 | 3300005289 | Bacteria | 7346 |
| 61 | Ga0065704_10037325 | 3300005289 | Bacteria | 795 |
| 62 | Ga0065704_10070374 | 3300005289 | Bacteria | 28734 |
| 63 | Ga0065704_10073302 | 3300005289 | Bacteria | 7332 |
| 64 | Ga0065704_10076064 | 3300005289 | Bacteria | 5281 |
| 65 | Ga0065704_10077903 | 3300005289 | Bacteria | 4587 |
| 66 | Ga0065704_10078968 | 3300005289 | Bacteria | 4290 |
| 67 | Ga0065704_10090520 | 3300005289 | Bacteria | 2780 |
| 68 | Ga0065704_10092841 | 3300005289 | Bacteria | 2631 |
| 69 | Ga0065704_10098036 | 3300005289 | Bacteria | 2368 |
| 70 | Ga0065704_10111747 | 3300005289 | Bacteria | 1918 |
| 71 | Ga0065704_10121604 | 3300005289 | Bacteria | 1763 |
| 72 | Ga0065704_10416260 | 3300005289 | Bacteria | 736 |
| 73 | Ga0065715_10094915 | 3300005293 | Bacteria | 4212 |
| 74 | Ga0065715_10189695 | 3300005293 | Bacteria | 1423 |
| 75 | Ga0065715_10406989 | 3300005293 | Bacteria | 843 |
| 76 | Ga0065715_10475229 | 3300005293 | Bacteria | 802 |
| 77 | Ga0070658_10000016 | 3300005327 | Bacteria | 228551 |
| 78 | Ga0070658_10401077 | 3300005327 | Bacteria | 1178 |
| 79 | Ga0070676_10003779 | 3300005328 | Bacteria | 7940 |
| 80 | Ga0070683_100002723 | 3300005329 | Bacteria | 14112 |
| 81 | Ga0070680_100011953 | 3300005336 | Bacteria | 6737 |
| 82 | Ga0070682_100000065 | 3300005337 | Bacteria | 100147 |
| 83 | Ga0070682_100372120 | 3300005337 | Bacteria | 1072 |
| 84 | Ga0068868_100173252 | 3300005338 | Bacteria | 1787 |
| 85 | Ga0068868_100217025 | 3300005338 | Bacteria | 1600 |
| 86 | Ga0070660_100043623 | 3300005339 | Bacteria | 3428 |
| 87 | Ga0070660_100074805 | 3300005339 | Bacteria | 2651 |
| 88 | Ga0070660_100323059 | 3300005339 | Bacteria | 1268 |
| 89 | Ga0070668_100006243 | 3300005347 | Bacteria | 8827 |
| 90 | Ga0070668_100040617 | 3300005347 | Bacteria | 3560 |
| 91 | Ga0070673_100018134 | 3300005364 | Bacteria | 5024 |
| 92 | Ga0070659_100000391 | 3300005366 | Bacteria | 33281 |
| 93 | Ga0070659_100006520 | 3300005366 | Bacteria | 8429 |
| 94 | Ga0070663_100030640 | 3300005455 | Bacteria | 3689 |
| 95 | Ga0070678_100008126 | 3300005456 | Bacteria | 6269 |
| 96 | Ga0070678_100421701 | 3300005456 | Bacteria | 1163 |
| 97 | Ga0070662_100000026 | 3300005457 | Bacteria | 83930 |
| 98 | Ga0070681_10004335 | 3300005458 | Bacteria | 13482 |
| 99 | Ga0068867_100000879 | 3300005459 | Bacteria | 20304 |
| 100 | Ga0070685_10046821 | 3300005466 | Bacteria | 2484 |
| 101 | Ga0070679_100007384 | 3300005530 | Bacteria | 10271 |
| 102 | Ga0070679_100116775 | 3300005530 | Bacteria | 2653 |
| 103 | Ga0070684_100002108 | 3300005535 | Bacteria | 14651 |
| 104 | Ga0068853_100009639 | 3300005539 | Bacteria | 7784 |
| 105 | Ga0068853_100212349 | 3300005539 | Bacteria | 1764 |
| 106 | Ga0068853_100221785 | 3300005539 | Bacteria | 1727 |
| 107 | Ga0068853_100417747 | 3300005539 | Bacteria | 1257 |
| 108 | Ga0070672_100167388 | 3300005543 | Bacteria | 1826 |
| 109 | Ga0070665_100000012 | 3300005548 | Bacteria | 508937 |
| 110 | Ga0068855_100000160 | 3300005563 | Bacteria | 86118 |
| 111 | Ga0068855_100000967 | 3300005563 | Bacteria | 35748 |
| 112 | Ga0068855_100155254 | 3300005563 | Bacteria | 2601 |
| 113 | Ga0068855_100164427 | 3300005563 | Bacteria | 2516 |
| 114 | Ga0068855_100172468 | 3300005563 | Bacteria | 2449 |
| 115 | Ga0068855_100176926 | 3300005563 | Bacteria | 2414 |
| 116 | Ga0068855_100573048 | 3300005563 | Bacteria | 1220 |
| 117 | Ga0068855_100972981 | 3300005563 | Unclassified | 893 |
| 118 | Ga0068857_100026580 | 3300005577 | Bacteria | 5102 |
| 119 | Ga0068857_101021686 | 3300005577 | Unclassified | 796 |
| 120 | Ga0068856_100000006 | 3300005614 | Bacteria | 223827 |
| 121 | Ga0068856_100010882 | 3300005614 | Bacteria | 8830 |
| 122 | Ga0068856_100027080 | 3300005614 | Bacteria | 5592 |
| 123 | Ga0068856_100066696 | 3300005614 | Bacteria | 3556 |
| 124 | Ga0068856_100153239 | 3300005614 | Bacteria | 2314 |
| 125 | Ga0068856_100686779 | 3300005614 | Bacteria | 1044 |
| 126 | Ga0068852_100000584 | 3300005616 | Bacteria | 24024 |
| 127 | Ga0068852_100160435 | 3300005616 | Bacteria | 2099 |
| 128 | Ga0075364_10429002 | 3300006051 | Bacteria | 903 |
| 129 | Ga0070716_100123943 | 3300006173 | Unclassified | 1622 |
| 130 | Ga0075362_10304524 | 3300006177 | Bacteria | 791 |
| 131 | Ga0075366_10000228 | 3300006195 | Bacteria | 24971 |
| 132 | Ga0075366_10018920 | 3300006195 | Bacteria | 3981 |
| 133 | Ga0097621_100000069 | 3300006237 | Bacteria | 52830 |
| 134 | Ga0097621_100591459 | 3300006237 | Bacteria | 1013 |
| 135 | Ga0097621_100681344 | 3300006237 | Bacteria | 945 |
| 136 | Ga0097621_101112304 | 3300006237 | Bacteria | 742 |
| 137 | Ga0075370_10704159 | 3300006353 | Bacteria | 614 |
| 138 | Ga0068871_100001572 | 3300006358 | Bacteria | 15344 |
| 139 | Ga0068865_100000098 | 3300006881 | Bacteria | 45185 |
| 140 | Ga0099824_1000108 | 3300006942 | Bacteria | 66974 |
| 141 | Ga0079104_1000028 | 3300006946 | Bacteria | 208540 |
| 142 | Ga0099826_10006584 | 3300006948 | Bacteria | 8478 |
| 143 | Ga0105251_10244344 | 3300009011 | Bacteria | 808 |
| 144 | Ga0105244_10000005 | 3300009036 | Bacteria | 481412 |
| 145 | Ga0105244_10000059 | 3300009036 | Bacteria | 127470 |
| 146 | Ga0105244_10031705 | 3300009036 | Bacteria | 2804 |
| 147 | Ga0105244_10097076 | 3300009036 | Bacteria | 1445 |
| 148 | Ga0105250_10007666 | 3300009092 | Bacteria | 4625 |
| 149 | Ga0105240_10007861 | 3300009093 | Bacteria | 15391 |
| 150 | Ga0105240_10057931 | 3300009093 | Bacteria | 4837 |
| 151 | Ga0105240_10068070 | 3300009093 | Bacteria | 4411 |
| 152 | Ga0105240_10072715 | 3300009093 | Bacteria | 4249 |
| 153 | Ga0105240_10073488 | 3300009093 | Bacteria | 4222 |
| 154 | Ga0105240_10151227 | 3300009093 | Bacteria | 2764 |
| 155 | Ga0105240_10158414 | 3300009093 | Bacteria | 2691 |
| 156 | Ga0105240_10174075 | 3300009093 | Bacteria | 2546 |
| 157 | Ga0105240_10282640 | 3300009093 | Bacteria | 1905 |
| 158 | Ga0105240_10658903 | 3300009093 | Bacteria | 1146 |
| 159 | Ga0105240_10839908 | 3300009093 | Bacteria | 992 |
| 160 | Ga0105240_12442084 | 3300009093 | Bacteria | 541 |
| 161 | Ga0105245_10119486 | 3300009098 | Bacteria | 2461 |
| 162 | Ga0105245_10659558 | 3300009098 | Bacteria | 1077 |
| 163 | Ga0105247_10251266 | 3300009101 | Bacteria | 1209 |
| 164 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 165 | Ga0105243_10000021 | 3300009148 | Bacteria | 213782 |
| 166 | Ga0105243_10049802 | 3300009148 | Bacteria | 3306 |
| 167 | Ga0105243_11981475 | 3300009148 | Bacteria | 616 |
| 168 | Ga0105241_10000693 | 3300009174 | Bacteria | 25405 |
| 169 | Ga0105241_10033174 | 3300009174 | Bacteria | 3875 |
| 170 | Ga0105241_10051932 | 3300009174 | Bacteria | 3128 |
| 171 | Ga0105241_10084819 | 3300009174 | Bacteria | 2488 |
| 172 | Ga0105241_10144455 | 3300009174 | Bacteria | 1941 |
| 173 | Ga0105241_10383099 | 3300009174 | Bacteria | 1229 |
| 174 | Ga0105241_10544132 | 3300009174 | Bacteria | 1041 |
| 175 | Ga0105242_10018006 | 3300009176 | Bacteria | 5517 |
| 176 | Ga0105242_11429575 | 3300009176 | Bacteria | 720 |
| 177 | Ga0105242_11731069 | 3300009176 | Bacteria | 662 |
| 178 | Ga0105237_10000354 | 3300009545 | Bacteria | 64712 |
| 179 | Ga0105237_10000429 | 3300009545 | Bacteria | 59643 |
| 180 | Ga0105237_10000753 | 3300009545 | Bacteria | 44372 |
| 181 | Ga0105237_10001433 | 3300009545 | Bacteria | 31542 |
| 182 | Ga0105237_10035290 | 3300009545 | Bacteria | 5060 |
| 183 | Ga0105237_10205712 | 3300009545 | Bacteria | 1969 |
| 184 | Ga0105237_10326070 | 3300009545 | Bacteria | 1539 |
| 185 | Ga0105238_10001430 | 3300009551 | Bacteria | 23940 |
| 186 | Ga0105238_10038622 | 3300009551 | Bacteria | 4847 |
| 187 | Ga0105238_10237198 | 3300009551 | Bacteria | 1801 |
| 188 | Ga0105238_10560111 | 3300009551 | Unclassified | 1148 |
| 189 | Ga0105239_10000015 | 3300010375 | Bacteria | 319892 |
| 190 | Ga0105239_10000069 | 3300010375 | Bacteria | 144493 |
| 191 | Ga0105239_10001827 | 3300010375 | Bacteria | 27874 |
| 192 | Ga0105239_10008812 | 3300010375 | Bacteria | 11416 |
| 193 | Ga0105239_10060393 | 3300010375 | Bacteria | 4161 |
| 194 | Ga0105239_10099630 | 3300010375 | Bacteria | 3213 |
| 195 | Ga0105239_10359206 | 3300010375 | Bacteria | 1645 |
| 196 | Ga0105239_10363932 | 3300010375 | Bacteria | 1634 |
| 197 | Ga0105239_10557742 | 3300010375 | Bacteria | 1305 |
| 198 | Ga0105239_11417665 | 3300010375 | Bacteria | 802 |
| 199 | Ga0105239_12202967 | 3300010375 | Bacteria | 641 |
| 200 | Ga0105246_10803668 | 3300011119 | Bacteria | 835 |
| 201 | Ga0157373_10000003 | 3300013100 | Bacteria | 454601 |
| 202 | Ga0157373_10000065 | 3300013100 | Bacteria | 93292 |
| 203 | Ga0157373_10000254 | 3300013100 | Bacteria | 43477 |
| 204 | Ga0157373_10000936 | 3300013100 | Bacteria | 22553 |
| 205 | Ga0157373_10008808 | 3300013100 | Bacteria | 7476 |
| 206 | Ga0157373_10010688 | 3300013100 | Bacteria | 6751 |
| 207 | Ga0157373_10134944 | 3300013100 | Bacteria | 1735 |
| 208 | Ga0157373_10153715 | 3300013100 | Bacteria | 1619 |
| 209 | Ga0157373_10561796 | 3300013100 | Bacteria | 828 |
| 210 | Ga0157373_10590034 | 3300013100 | Bacteria | 808 |
| 211 | Ga0157371_10000025 | 3300013102 | Bacteria | 279746 |
| 212 | Ga0157371_10000229 | 3300013102 | Bacteria | 81458 |
| 213 | Ga0157371_10000904 | 3300013102 | Bacteria | 33397 |
| 214 | Ga0157371_10005051 | 3300013102 | Bacteria | 11280 |
| 215 | Ga0157371_10006606 | 3300013102 | Bacteria | 9526 |
| 216 | Ga0157371_10007352 | 3300013102 | Bacteria | 8929 |
| 217 | Ga0157371_10024946 | 3300013102 | Bacteria | 4363 |
| 218 | Ga0157371_10048837 | 3300013102 | Bacteria | 3008 |
| 219 | Ga0157371_10058894 | 3300013102 | Bacteria | 2724 |
| 220 | Ga0157371_10114437 | 3300013102 | Bacteria | 1916 |
| 221 | Ga0157371_10647748 | 3300013102 | Bacteria | 788 |
| 222 | Ga0157371_10689570 | 3300013102 | Bacteria | 764 |
| 223 | Ga0157370_10001039 | 3300013104 | Bacteria | 34915 |
| 224 | Ga0157370_10001545 | 3300013104 | Bacteria | 28488 |
| 225 | Ga0157370_10001670 | 3300013104 | Bacteria | 27339 |
| 226 | Ga0157370_10002687 | 3300013104 | Bacteria | 21317 |
| 227 | Ga0157370_10005342 | 3300013104 | Bacteria | 14431 |
| 228 | Ga0157370_10008063 | 3300013104 | Bacteria | 11405 |
| 229 | Ga0157370_10009163 | 3300013104 | Bacteria | 10611 |
| 230 | Ga0157370_10014803 | 3300013104 | Bacteria | 7960 |
| 231 | Ga0157370_10016593 | 3300013104 | Bacteria | 7450 |
| 232 | Ga0157370_10018605 | 3300013104 | Bacteria | 6984 |
| 233 | Ga0157370_10039970 | 3300013104 | Bacteria | 4531 |
| 234 | Ga0157370_10043395 | 3300013104 | Bacteria | 4328 |
| 235 | Ga0157370_10047507 | 3300013104 | Bacteria | 4114 |
| 236 | Ga0157370_10068889 | 3300013104 | Bacteria | 3343 |
| 237 | Ga0157370_10070331 | 3300013104 | Bacteria | 3303 |
| 238 | Ga0157370_10144272 | 3300013104 | Bacteria | 2217 |
| 239 | Ga0157370_10200144 | 3300013104 | Bacteria | 1853 |
| 240 | Ga0157370_10218154 | 3300013104 | Bacteria | 1767 |
| 241 | Ga0157370_10220805 | 3300013104 | Bacteria | 1755 |
| 242 | Ga0157370_10297945 | 3300013104 | Bacteria | 1489 |
| 243 | Ga0157370_10299675 | 3300013104 | Bacteria | 1484 |
| 244 | Ga0157370_10302736 | 3300013104 | Bacteria | 1476 |
| 245 | Ga0157370_10422938 | 3300013104 | Bacteria | 1226 |
| 246 | Ga0157370_11264259 | 3300013104 | Bacteria | 665 |
| 247 | Ga0157369_10000038 | 3300013105 | Bacteria | 189078 |
| 248 | Ga0157369_10000101 | 3300013105 | Bacteria | 118683 |
| 249 | Ga0157369_10000423 | 3300013105 | Bacteria | 56029 |
| 250 | Ga0157369_10002643 | 3300013105 | Bacteria | 21393 |
| 251 | Ga0157369_10037939 | 3300013105 | Bacteria | 5271 |
| 252 | Ga0157369_10198222 | 3300013105 | Bacteria | 2107 |
| 253 | Ga0157369_10602754 | 3300013105 | Bacteria | 1134 |
| 254 | Ga0157369_10658741 | 3300013105 | Bacteria | 1079 |
| 255 | Ga0157369_10662035 | 3300013105 | Bacteria | 1076 |
| 256 | Ga0157374_10000076 | 3300013296 | Bacteria | 97502 |
| 257 | Ga0157374_10001396 | 3300013296 | Bacteria | 20499 |
| 258 | Ga0157374_10018889 | 3300013296 | Bacteria | 6094 |
| 259 | Ga0157378_10015305 | 3300013297 | Bacteria | 6719 |
| 260 | Ga0157378_10016498 | 3300013297 | Bacteria | 6469 |
| 261 | Ga0157378_10075864 | 3300013297 | Bacteria | 3028 |
| 262 | Ga0157378_10142182 | 3300013297 | Bacteria | 2229 |
| 263 | Ga0157378_10388262 | 3300013297 | Bacteria | 1373 |
| 264 | Ga0163162_10000013 | 3300013306 | Bacteria | 275366 |
| 265 | Ga0163162_10000050 | 3300013306 | Bacteria | 120151 |
| 266 | Ga0163162_10009096 | 3300013306 | Bacteria | 9656 |
| 267 | Ga0163162_10034388 | 3300013306 | Bacteria | 5044 |
| 268 | Ga0163162_10036274 | 3300013306 | Bacteria | 4912 |
| 269 | Ga0163162_10409126 | 3300013306 | Bacteria | 1489 |
| 270 | Ga0157372_10000041 | 3300013307 | Bacteria | 158494 |
| 271 | Ga0157372_10000051 | 3300013307 | Bacteria | 136437 |
| 272 | Ga0157372_10000874 | 3300013307 | Bacteria | 32723 |
| 273 | Ga0157372_10003305 | 3300013307 | Bacteria | 17413 |
| 274 | Ga0157372_10025095 | 3300013307 | Bacteria | 6477 |
| 275 | Ga0157372_10040546 | 3300013307 | Bacteria | 5144 |
| 276 | Ga0157375_10000417 | 3300013308 | Bacteria | 38744 |
| 277 | Ga0157375_10076573 | 3300013308 | Bacteria | 3373 |
| 278 | Ga0157375_10091841 | 3300013308 | Bacteria | 3098 |
| 279 | Ga0157375_10110784 | 3300013308 | Bacteria | 2843 |
| 280 | Ga0157375_10135693 | 3300013308 | Bacteria | 2584 |
| 281 | Ga0157375_10162209 | 3300013308 | Bacteria | 2378 |
| 282 | Ga0157375_10347452 | 3300013308 | Bacteria | 1649 |
| 283 | Ga0157375_10781023 | 3300013308 | Bacteria | 1105 |
| 284 | Ga0157375_10978991 | 3300013308 | Bacteria | 986 |
| 285 | Ga0163163_11044371 | 3300014325 | Bacteria | 880 |
| 286 | Ga0157380_10000022 | 3300014326 | Bacteria | 114070 |
| 287 | Ga0182008_10000005 | 3300014497 | Bacteria | 386556 |
| 288 | Ga0182008_10000025 | 3300014497 | Bacteria | 191222 |
| 289 | Ga0182008_10000052 | 3300014497 | Bacteria | 103193 |
| 290 | Ga0182008_10000058 | 3300014497 | Bacteria | 100175 |
| 291 | Ga0182008_10014892 | 3300014497 | Bacteria | 4067 |
| 292 | Ga0182008_10229604 | 3300014497 | Bacteria | 952 |
| 293 | Ga0182008_10721046 | 3300014497 | Bacteria | 571 |
| 294 | Ga0157377_10418005 | 3300014745 | Bacteria | 917 |
| 295 | Ga0157376_10193333 | 3300014969 | Bacteria | 1867 |
| 296 | Ga0157376_10480276 | 3300014969 | Bacteria | 1218 |
| 297 | Ga0182006_1000127 | 3300015261 | Bacteria | 81679 |
| 298 | Ga0182006_1000645 | 3300015261 | Bacteria | 24732 |
| 299 | Ga0182006_1001592 | 3300015261 | Bacteria | 13422 |
| 300 | Ga0182006_1006423 | 3300015261 | Bacteria | 5467 |
| 301 | Ga0182006_1008199 | 3300015261 | Bacteria | 4738 |
| 302 | Ga0182006_1038255 | 3300015261 | Bacteria | 1898 |
| 303 | Ga0182006_1107532 | 3300015261 | Unclassified | 982 |
| 304 | Ga0182007_10000024 | 3300015262 | Bacteria | 181761 |
| 305 | Ga0182007_10004566 | 3300015262 | Bacteria | 6257 |
| 306 | Ga0182007_10060916 | 3300015262 | Bacteria | 1237 |
| 307 | Ga0182007_10082546 | 3300015262 | Bacteria | 1054 |
| 308 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 309 | Ga0163161_10000014 | 3300017792 | Bacteria | 258440 |
| 310 | Ga0163161_10000136 | 3300017792 | Bacteria | 69043 |
| 311 | Ga0163161_10000628 | 3300017792 | Bacteria | 28142 |
| 312 | Ga0163161_10000979 | 3300017792 | Bacteria | 21853 |
| 313 | Ga0163161_10005705 | 3300017792 | Bacteria | 8630 |
| 314 | Ga0163161_10008888 | 3300017792 | Bacteria | 6945 |
| 315 | Ga0163161_10019883 | 3300017792 | Bacteria | 4710 |
| 316 | Ga0163161_10065973 | 3300017792 | Bacteria | 2642 |
| 317 | Ga0163161_10093528 | 3300017792 | Bacteria | 2228 |
| 318 | Ga0163161_10158712 | 3300017792 | Bacteria | 1724 |
| 319 | Ga0163161_10197638 | 3300017792 | Bacteria | 1548 |
| 320 | Ga0163161_10252369 | 3300017792 | Bacteria | 1375 |
| 321 | Ga0163161_10412790 | 3300017792 | Bacteria | 1085 |
| 322 | Ga0163161_10420758 | 3300017792 | Bacteria | 1075 |
| 323 | Ga0163161_10422061 | 3300017792 | Bacteria | 1073 |
| 324 | Ga0163161_10573934 | 3300017792 | Bacteria | 927 |
| 325 | Ga0163161_10729285 | 3300017792 | Bacteria | 827 |
| 326 | Ga0163161_11321188 | 3300017792 | Bacteria | 627 |
| 327 | Ga0213872_10019228 | 3300021361 | Bacteria | 3146 |
| 328 | Ga0209563_110589 | 3300025230 | Bacteria | 1337 |
| 329 | Ga0207427_100043 | 3300025231 | Bacteria | 249595 |
| 330 | Ga0209437_100170 | 3300025233 | Bacteria | 142489 |
| 331 | Ga0209437_100190 | 3300025233 | Bacteria | 125000 |
| 332 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 333 | Ga0209026_1000243 | 3300025250 | Bacteria | 69921 |
| 334 | Ga0209026_1004634 | 3300025250 | Bacteria | 4001 |
| 335 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 336 | Ga0209129_1018403 | 3300025258 | Bacteria | 1342 |
| 337 | Ga0209233_1000266 | 3300025261 | Bacteria | 76176 |
| 338 | Ga0209233_1001543 | 3300025261 | Bacteria | 9031 |
| 339 | Ga0209233_1009528 | 3300025261 | Bacteria | 2950 |
| 340 | Ga0209455_1002288 | 3300025272 | Bacteria | 7539 |
| 341 | Ga0209675_1000022 | 3300025291 | Bacteria | 315280 |
| 342 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 343 | Ga0209676_1000488 | 3300025292 | Bacteria | 64408 |
| 344 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 345 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 346 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 347 | Ga0207426_1096738 | 3300025302 | Bacteria | 770 |
| 348 | Ga0207696_1008616 | 3300025711 | Bacteria | 3877 |
| 349 | Ga0207655_1000003 | 3300025728 | Bacteria | 1081376 |
| 350 | Ga0207655_1000016 | 3300025728 | Bacteria | 551476 |
| 351 | Ga0207655_1029660 | 3300025728 | Bacteria | 2557 |
| 352 | Ga0207713_1148366 | 3300025735 | Bacteria | 759 |
| 353 | Ga0207713_1161976 | 3300025735 | Bacteria | 712 |
| 354 | Ga0207642_10078191 | 3300025899 | Bacteria | 1598 |
| 355 | Ga0207710_10268630 | 3300025900 | Bacteria | 856 |
| 356 | Ga0207647_10000217 | 3300025904 | Bacteria | 47035 |
| 357 | Ga0207647_10001231 | 3300025904 | Bacteria | 19711 |
| 358 | Ga0207647_10041669 | 3300025904 | Bacteria | 2885 |
| 359 | Ga0207645_10003391 | 3300025907 | Bacteria | 12114 |
| 360 | Ga0207705_10000031 | 3300025909 | Bacteria | 228571 |
| 361 | Ga0207705_10270542 | 3300025909 | Bacteria | 1299 |
| 362 | Ga0207705_10284830 | 3300025909 | Bacteria | 1265 |
| 363 | Ga0207654_10003057 | 3300025911 | Bacteria | 8487 |
| 364 | Ga0207654_10058503 | 3300025911 | Bacteria | 2244 |
| 365 | Ga0207654_10115651 | 3300025911 | Bacteria | 1676 |
| 366 | Ga0207654_10168296 | 3300025911 | Bacteria | 1421 |
| 367 | Ga0207707_10009797 | 3300025912 | Bacteria | 8310 |
| 368 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 369 | Ga0207695_10007478 | 3300025913 | Bacteria | 13876 |
| 370 | Ga0207695_10010273 | 3300025913 | Bacteria | 11471 |
| 371 | Ga0207695_10038235 | 3300025913 | Bacteria | 5169 |
| 372 | Ga0207695_10109670 | 3300025913 | Bacteria | 2741 |
| 373 | Ga0207695_10234651 | 3300025913 | Bacteria | 1737 |
| 374 | Ga0207695_10283098 | 3300025913 | Bacteria | 1551 |
| 375 | Ga0207695_10578372 | 3300025913 | Bacteria | 1004 |
| 376 | Ga0207671_10000466 | 3300025914 | Bacteria | 55435 |
| 377 | Ga0207671_10001163 | 3300025914 | Bacteria | 31375 |
| 378 | Ga0207671_10003106 | 3300025914 | Bacteria | 16894 |
| 379 | Ga0207671_10004475 | 3300025914 | Bacteria | 13334 |
| 380 | Ga0207671_10011835 | 3300025914 | Bacteria | 7060 |
| 381 | Ga0207671_10195729 | 3300025914 | Bacteria | 1577 |
| 382 | Ga0207693_10316745 | 3300025915 | Bacteria | 1221 |
| 383 | Ga0207660_10125934 | 3300025917 | Bacteria | 1945 |
| 384 | Ga0207657_10043954 | 3300025919 | Bacteria | 3931 |
| 385 | Ga0207657_10094541 | 3300025919 | Bacteria | 2489 |
| 386 | Ga0207657_10642078 | 3300025919 | Bacteria | 827 |
| 387 | Ga0207652_10007397 | 3300025921 | Bacteria | 8855 |
| 388 | Ga0207652_10297821 | 3300025921 | Bacteria | 1456 |
| 389 | Ga0207681_10299934 | 3300025923 | Bacteria | 1271 |
| 390 | Ga0207694_10043769 | 3300025924 | Bacteria | 3456 |
| 391 | Ga0207694_10048181 | 3300025924 | Bacteria | 3297 |
| 392 | Ga0207694_10174370 | 3300025924 | Bacteria | 1742 |
| 393 | Ga0207687_10073150 | 3300025927 | Bacteria | 2453 |
| 394 | Ga0207644_10001994 | 3300025931 | Bacteria | 13217 |
| 395 | Ga0207690_10000432 | 3300025932 | Bacteria | 27269 |
| 396 | Ga0207690_10019136 | 3300025932 | Bacteria | 4209 |
| 397 | Ga0207706_10000010 | 3300025933 | Bacteria | 200039 |
| 398 | Ga0207686_10111656 | 3300025934 | Bacteria | 1845 |
| 399 | Ga0207686_10611348 | 3300025934 | Bacteria | 859 |
| 400 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 401 | Ga0207709_10000281 | 3300025935 | Bacteria | 58322 |
| 402 | Ga0207709_10012162 | 3300025935 | Bacteria | 4743 |
| 403 | Ga0207704_10000334 | 3300025938 | Bacteria | 21818 |
| 404 | Ga0207691_10125785 | 3300025940 | Bacteria | 2269 |
| 405 | Ga0207661_10003479 | 3300025944 | Bacteria | 10934 |
| 406 | Ga0207661_10010032 | 3300025944 | Bacteria | 6805 |
| 407 | Ga0207667_10000033 | 3300025949 | Bacteria | 314353 |
| 408 | Ga0207667_10001021 | 3300025949 | Bacteria | 35701 |
| 409 | Ga0207667_10003221 | 3300025949 | Bacteria | 20157 |
| 410 | Ga0207667_10141964 | 3300025949 | Bacteria | 2473 |
| 411 | Ga0207667_10199641 | 3300025949 | Bacteria | 2052 |
| 412 | Ga0207667_10234194 | 3300025949 | Bacteria | 1880 |
| 413 | Ga0207667_10247530 | 3300025949 | Bacteria | 1824 |
| 414 | Ga0207667_10284586 | 3300025949 | Bacteria | 1689 |
| 415 | Ga0207667_10439863 | 3300025949 | Bacteria | 1326 |
| 416 | Ga0207667_10681425 | 3300025949 | Bacteria | 1031 |
| 417 | Ga0207667_11049400 | 3300025949 | Bacteria | 800 |
| 418 | Ga0207651_10084689 | 3300025960 | Bacteria | 2297 |
| 419 | Ga0207651_11007965 | 3300025960 | Bacteria | 744 |
| 420 | Ga0207668_10012192 | 3300025972 | Bacteria | 5254 |
| 421 | Ga0207668_10162571 | 3300025972 | Bacteria | 1741 |
| 422 | Ga0207640_11248667 | 3300025981 | Unclassified | 662 |
| 423 | Ga0207677_10174179 | 3300026023 | Bacteria | 1686 |
| 424 | Ga0207639_10003841 | 3300026041 | Bacteria | 10123 |
| 425 | Ga0207639_10080303 | 3300026041 | Bacteria | 2579 |
| 426 | Ga0207639_10103364 | 3300026041 | Bacteria | 2308 |
| 427 | Ga0207639_10275815 | 3300026041 | Bacteria | 1477 |
| 428 | Ga0207678_10048526 | 3300026067 | Bacteria | 3669 |
| 429 | Ga0207702_10000023 | 3300026078 | Bacteria | 189234 |
| 430 | Ga0207702_10011730 | 3300026078 | Bacteria | 7299 |
| 431 | Ga0207702_10119355 | 3300026078 | Bacteria | 2358 |
| 432 | Ga0207702_10389976 | 3300026078 | Bacteria | 1341 |
| 433 | Ga0207702_11400959 | 3300026078 | Bacteria | 693 |
| 434 | Ga0207648_10000990 | 3300026089 | Bacteria | 32073 |
| 435 | Ga0207674_10158235 | 3300026116 | Bacteria | 2220 |
| 436 | Ga0207674_10855106 | 3300026116 | Bacteria | 877 |
| 437 | Ga0207674_11582206 | 3300026116 | Unclassified | 624 |
| 438 | Ga0207674_11584921 | 3300026116 | Bacteria | 623 |
| 439 | Ga0207683_10017708 | 3300026121 | Bacteria | 6075 |
| 440 | Ga0207683_10408760 | 3300026121 | Bacteria | 1249 |
| 441 | Ga0207698_10008792 | 3300026142 | Bacteria | 6403 |
| 442 | Ga0207698_10078823 | 3300026142 | Bacteria | 2647 |
| 443 | Ga0207698_10240750 | 3300026142 | Bacteria | 1649 |
| 444 | Ga0209281_1000069 | 3300027111 | Bacteria | 279747 |
| 445 | Ga0209968_1001501 | 3300027526 | Bacteria | 3545 |
| 446 | Ga0210002_1029206 | 3300027617 | Bacteria | 912 |
| 447 | Ga0268266_10000080 | 3300028379 | Bacteria | 210179 |
| 448 | Ga0265337_1026609 | 3300028556 | Unclassified | 1751 |
| 449 | Ga0265326_10060373 | 3300028558 | Bacteria | 1072 |
| 450 | Ga0265334_10030858 | 3300028573 | Bacteria | 2144 |
| 451 | Ga0265322_10014427 | 3300028654 | Bacteria | 2283 |
| 452 | Ga0265336_10084740 | 3300028666 | Bacteria | 945 |
| 453 | Ga0307517_10026222 | 3300028786 | Bacteria | 7076 |
| 454 | Ga0307515_10001558 | 3300028794 | Bacteria | 51155 |
| 455 | Ga0307515_10030051 | 3300028794 | Bacteria | 9150 |
| 456 | Ga0307515_10117183 | 3300028794 | Bacteria | 3051 |
| 457 | Ga0307515_10440460 | 3300028794 | Bacteria | 920 |
| 458 | Ga0307515_10576824 | 3300028794 | Bacteria | 735 |
| 459 | Ga0265338_10480951 | 3300028800 | Bacteria | 876 |
| 460 | Ga0265324_10013449 | 3300029957 | Unclassified | 3054 |
| 461 | Ga0316176_1063745 | 3300030732 | Bacteria | 3195 |
| 462 | Ga0316183_1152562 | 3300030742 | Bacteria | 15614 |
| 463 | Ga0316181_1121975 | 3300030744 | Bacteria | 30956 |
| 464 | Ga0316182_1125350 | 3300030745 | Bacteria | 1961 |
| 465 | Ga0265330_10244326 | 3300031235 | Bacteria | 757 |
| 466 | Ga0265332_10089319 | 3300031238 | Bacteria | 1304 |
| 467 | Ga0265328_10091405 | 3300031239 | Unclassified | 1124 |
| 468 | Ga0265320_10177507 | 3300031240 | Bacteria | 955 |
| 469 | Ga0265329_10096597 | 3300031242 | Bacteria | 939 |
| 470 | Ga0265327_10001390 | 3300031251 | Bacteria | 30881 |
| 471 | Ga0265327_10044490 | 3300031251 | Bacteria | 2367 |
| 472 | Ga0265316_10001519 | 3300031344 | Bacteria | 24846 |
| 473 | Ga0265316_10111949 | 3300031344 | Unclassified | 2067 |
| 474 | Ga0265316_10115655 | 3300031344 | Unclassified | 2028 |
| 475 | Ga0265316_10311458 | 3300031344 | Bacteria | 1145 |
| 476 | Ga0307509_10283860 | 3300031507 | Bacteria | 1415 |
| 477 | Ga0307509_10293734 | 3300031507 | Bacteria | 1378 |
| 478 | Ga0307408_100000164 | 3300031548 | Bacteria | 73855 |
| 479 | Ga0307408_100000310 | 3300031548 | Bacteria | 46693 |
| 480 | Ga0307408_100000448 | 3300031548 | Bacteria | 36074 |
| 481 | Ga0307408_100000583 | 3300031548 | Bacteria | 31331 |
| 482 | Ga0307408_100003314 | 3300031548 | Bacteria | 11070 |
| 483 | Ga0307408_100142791 | 3300031548 | Bacteria | 1881 |
| 484 | Ga0265314_10000031 | 3300031711 | Bacteria | 265924 |
| 485 | Ga0316576_11034229 | 3300031727 | Unclassified | 584 |
| 486 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 487 | Ga0307405_10000011 | 3300031731 | Bacteria | 241071 |
| 488 | Ga0307405_10007180 | 3300031731 | Bacteria | 5546 |
| 489 | Ga0307405_10047027 | 3300031731 | Bacteria | 2655 |
| 490 | Ga0307405_10166489 | 3300031731 | Bacteria | 1567 |
| 491 | Ga0307405_10358810 | 3300031731 | Bacteria | 1127 |
| 492 | Ga0307413_10000003 | 3300031824 | Bacteria | 79915 |
| 493 | Ga0307413_10112152 | 3300031824 | Bacteria | 1828 |
| 494 | Ga0307410_10000065 | 3300031852 | Bacteria | 37752 |
| 495 | Ga0307406_10000017 | 3300031901 | Bacteria | 103965 |
| 496 | Ga0307407_10000018 | 3300031903 | Bacteria | 135979 |
| 497 | Ga0307407_10004270 | 3300031903 | Bacteria | 6033 |
| 498 | Ga0307407_10361015 | 3300031903 | Bacteria | 1031 |
| 499 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 500 | Ga0307412_10000058 | 3300031911 | Bacteria | 140824 |
| 501 | Ga0307412_10000704 | 3300031911 | Bacteria | 19253 |
| 502 | Ga0307412_10000825 | 3300031911 | Bacteria | 17887 |
| 503 | Ga0307412_10025701 | 3300031911 | Bacteria | 3650 |
| 504 | Ga0307412_10084084 | 3300031911 | Bacteria | 2208 |
| 505 | Ga0307412_10110967 | 3300031911 | Bacteria | 1958 |
| 506 | Ga0307412_10139508 | 3300031911 | Bacteria | 1773 |
| 507 | Ga0307412_10332057 | 3300031911 | Bacteria | 1214 |
| 508 | Ga0307412_11112953 | 3300031911 | Bacteria | 703 |
| 509 | Ga0307412_11310286 | 3300031911 | Bacteria | 652 |
| 510 | Ga0307409_101027096 | 3300031995 | Bacteria | 843 |
| 511 | Ga0307416_100000006 | 3300032002 | Bacteria | 466074 |
| 512 | Ga0307416_100000081 | 3300032002 | Bacteria | 65986 |
| 513 | Ga0307416_100000649 | 3300032002 | Bacteria | 17958 |
| 514 | Ga0307416_100020641 | 3300032002 | Bacteria | 4707 |
| 515 | Ga0307414_10000014 | 3300032004 | Bacteria | 302974 |
| 516 | Ga0307414_10000061 | 3300032004 | Bacteria | 109693 |
| 517 | Ga0307414_10000502 | 3300032004 | Bacteria | 20406 |
| 518 | Ga0307414_10000530 | 3300032004 | Bacteria | 19805 |
| 519 | Ga0307414_10000823 | 3300032004 | Bacteria | 15850 |
| 520 | Ga0307414_10002415 | 3300032004 | Bacteria | 9781 |
| 521 | Ga0307414_10007008 | 3300032004 | Bacteria | 6316 |
| 522 | Ga0307414_10010298 | 3300032004 | Bacteria | 5418 |
| 523 | Ga0307414_10011516 | 3300032004 | Bacteria | 5191 |
| 524 | Ga0307414_10031240 | 3300032004 | Bacteria | 3491 |
| 525 | Ga0307414_10032372 | 3300032004 | Bacteria | 3441 |
| 526 | Ga0307414_10048830 | 3300032004 | Bacteria | 2922 |
| 527 | Ga0307414_10107580 | 3300032004 | Bacteria | 2113 |
| 528 | Ga0307414_10119762 | 3300032004 | Bacteria | 2021 |
| 529 | Ga0307414_10123098 | 3300032004 | Bacteria | 1998 |
| 530 | Ga0307414_10123641 | 3300032004 | Bacteria | 1994 |
| 531 | Ga0307414_10130287 | 3300032004 | Bacteria | 1951 |
| 532 | Ga0307414_10157074 | 3300032004 | Bacteria | 1802 |
| 533 | Ga0307414_10444797 | 3300032004 | Bacteria | 1135 |
| 534 | Ga0307414_10470684 | 3300032004 | Bacteria | 1106 |
| 535 | Ga0307414_10700121 | 3300032004 | Bacteria | 917 |
| 536 | Ga0307414_10866620 | 3300032004 | Bacteria | 826 |
| 537 | Ga0307414_10983328 | 3300032004 | Bacteria | 776 |
| 538 | Ga0307411_10000002 | 3300032005 | Bacteria | 534807 |
| 539 | Ga0307411_10137637 | 3300032005 | Bacteria | 1795 |
| 540 | Ga0307411_10234738 | 3300032005 | Bacteria | 1432 |
| 541 | Ga0307415_101012862 | 3300032126 | Unclassified | 773 |
| 542 | Ga0307507_10000143 | 3300033179 | Bacteria | 124248 |
| 543 | Ga0307510_10000218 | 3300033180 | Bacteria | 51022 |
| 544 | Ga0307510_10031800 | 3300033180 | Bacteria | 5953 |
| 545 | Ga0373955_0930043 | 3300035172 | Bacteria | 535 |
| 546 | Ga0373942_0157809 | 3300035207 | Bacteria | 732 |
| 547 | Ga0316574_0190252 | 3300035398 | Bacteria | 1320 |
| 548 | Ga0316574_0369229 | 3300035398 | Bacteria | 906 |
| 549 | Ga0373931_0493118 | 3300035691 | Bacteria | 789 |
| 550 | Ga0316584_0506435 | 3300036712 | Bacteria | 848 |
| 551 | Ga0395899_0000021 | 3300037312 | Bacteria | 391702 |
| 552 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 553 | Ga0395899_0000050 | 3300037312 | Bacteria | 224591 |
| 554 | Ga0395899_0000648 | 3300037312 | Bacteria | 35838 |
| 555 | Ga0395899_0045232 | 3300037312 | Bacteria | 3280 |
| 556 | Ga0395899_0500104 | 3300037312 | Unclassified | 789 |
| 557 | Ga0395900_0000332 | 3300037418 | Bacteria | 69636 |
| 558 | Ga0395900_0002463 | 3300037418 | Bacteria | 20380 |
| 559 | Ga0395900_0015912 | 3300037418 | Bacteria | 7663 |
| 560 | Ga0395900_0023779 | 3300037418 | Bacteria | 6269 |
| 561 | Ga0395900_0067991 | 3300037418 | Bacteria | 3661 |
| 562 | Ga0395900_0081288 | 3300037418 | Unclassified | 3329 |
| 563 | Ga0395898_0020230 | 3300037466 | Bacteria | 6762 |
| 564 | Ga0395898_0271031 | 3300037466 | Bacteria | 1619 |
| 565 | Ga0395905_0000324 | 3300037471 | Bacteria | 68945 |
| 566 | Ga0395905_0001895 | 3300037471 | Bacteria | 24123 |
| 567 | Ga0395905_0005538 | 3300037471 | Bacteria | 12886 |
| 568 | Ga0395901_0001649 | 3300038443 | Bacteria | 23094 |
| 569 | Ga0395901_0003264 | 3300038443 | Bacteria | 16326 |
| 570 | Ga0395901_0344520 | 3300038443 | Unclassified | 1539 |
| 571 | Ga0395901_0488565 | 3300038443 | Bacteria | 1255 |
| 572 | Ga0400483_026801 | 3300039062 | Bacteria | 35196 |
| 573 | Ga0436361_0265633 | 3300039447 | Bacteria | 11560 |
| 574 | Ga0439447_001594 | 3300041407 | Bacteria | 8302 |
| 575 | Ga0439466_0000199 | 3300041411 | Bacteria | 23744 |
| 576 | Ga0451787_246046 | 3300041441 | Bacteria | 754 |
| 577 | Ga0451791_0178529 | 3300041451 | Bacteria | 1025 |
| 578 | Ga0451795_0544546 | 3300041456 | Bacteria | 504 |
| 579 | Ga0451802_1750742 | 3300041460 | Bacteria | 763 |
| 580 | Ga0451806_096330 | 3300041462 | Bacteria | 796 |
| 581 | Ga0451807_1276579 | 3300041486 | Bacteria | 1105 |
| 582 | Ga0451807_1679596 | 3300041486 | Bacteria | 556 |
| 583 | Ga0451837_0155400 | 3300041494 | Bacteria | 586 |
| 584 | Ga0451837_0846889 | 3300041494 | Bacteria | 2043 |
| 585 | Ga0451849_0840633 | 3300041505 | Bacteria | 640 |
| 586 | Ga0451855_0405943 | 3300041511 | Bacteria | 2640 |
| 587 | Ga0451855_1284336 | 3300041511 | Bacteria | 1408 |
| 588 | Ga0439445_0000824 | 3300042004 | Bacteria | 6544 |
| 589 | Ga0439445_0132131 | 3300042004 | Bacteria | 721 |
| 590 | Ga0439448_0024447 | 3300042005 | Bacteria | 1889 |
| 591 | Ga0439457_034604 | 3300042014 | Bacteria | 1123 |
| 592 | Ga0450890_021773 | 3300042127 | Bacteria | 874 |
| 593 | Ga0439434_0126579 | 3300042435 | Bacteria | 836 |
| 594 | Ga0451577_0001003 | 3300042876 | Bacteria | 41074 |
| 595 | Ga0451577_0004037 | 3300042876 | Bacteria | 15781 |
| 596 | Ga0451577_0010083 | 3300042876 | Bacteria | 9053 |
| 597 | Ga0451577_0086506 | 3300042876 | Bacteria | 2796 |
| 598 | Ga0451577_0096937 | 3300042876 | Unclassified | 2633 |
| 599 | Ga0451577_0128499 | 3300042876 | Bacteria | 2272 |
| 600 | Ga0451577_1436830 | 3300042876 | Bacteria | 611 |
| 601 | Ga0451577_1728629 | 3300042876 | Bacteria | 550 |
| 602 | Ga0466969_0116525 | 3300044656 | Bacteria | 1246 |
| 603 | Ga0453683_0000136 | 3300044673 | Bacteria | 107540 |
| 604 | Ga0453683_0003752 | 3300044673 | Bacteria | 11084 |
| 605 | Ga0453683_0012101 | 3300044673 | Bacteria | 5664 |
| 606 | Ga0453683_0763481 | 3300044673 | Bacteria | 635 |
| 607 | Ga0466966_0148684 | 3300044684 | Bacteria | 1429 |
| 608 | Ga0466961_0073916 | 3300044693 | Bacteria | 2161 |
| 609 | Ga0466963_0182860 | 3300044694 | Bacteria | 1464 |
| 610 | Ga0453684_0000212 | 3300044712 | Bacteria | 254110 |
| 611 | Ga0453684_0002050 | 3300044712 | Bacteria | 51274 |
| 612 | Ga0453684_0002803 | 3300044712 | Bacteria | 41213 |
| 613 | Ga0453684_0004510 | 3300044712 | Bacteria | 29232 |
| 614 | Ga0453684_0006442 | 3300044712 | Bacteria | 22295 |
| 615 | Ga0453684_0039458 | 3300044712 | Bacteria | 6434 |
| 616 | Ga0453684_0044669 | 3300044712 | Bacteria | 5922 |
| 617 | Ga0453684_0050525 | 3300044712 | Bacteria | 5468 |
| 618 | Ga0453684_0121465 | 3300044712 | Bacteria | 3153 |
| 619 | Ga0453684_0215875 | 3300044712 | Bacteria | 2225 |
| 620 | Ga0453684_0304376 | 3300044712 | Bacteria | 1811 |
| 621 | Ga0453684_0519594 | 3300044712 | Bacteria | 1316 |
| 622 | Ga0453684_0599918 | 3300044712 | Unclassified | 1207 |
| 623 | Ga0466959_0330022 | 3300045049 | Bacteria | 1042 |
| 624 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 625 | Ga0451576_0001418 | 3300045051 | Bacteria | 41032 |
| 626 | Ga0451576_0005467 | 3300045051 | Bacteria | 15917 |
| 627 | Ga0451576_0010696 | 3300045051 | Bacteria | 10507 |
| 628 | Ga0451576_0012348 | 3300045051 | Bacteria | 9597 |
| 629 | Ga0451576_0065240 | 3300045051 | Bacteria | 3791 |
| 630 | Ga0451576_0066127 | 3300045051 | Bacteria | 3764 |
| 631 | Ga0451576_0085869 | 3300045051 | Bacteria | 3274 |
| 632 | Ga0451576_0135118 | 3300045051 | Bacteria | 2571 |
| 633 | Ga0451576_1425923 | 3300045051 | Bacteria | 720 |
| 634 | Ga0466958_0044615 | 3300045836 | Bacteria | 2672 |
| 635 | Ga0495627_000012 | 3300046453 | Bacteria | 345654 |
| 636 | Ga0495627_001456 | 3300046453 | Bacteria | 13877 |
| 637 | Ga0495627_001699 | 3300046453 | Bacteria | 12059 |
| 638 | Ga0495629_0302207 | 3300046459 | Bacteria | 1096 |
| 639 | Ga0495638_0047103 | 3300046460 | Bacteria | 2705 |
| 640 | Ga0495638_0321347 | 3300046460 | Bacteria | 827 |
| 641 | Ga0495651_0917125 | 3300046462 | Bacteria | 535 |
| 642 | Ga0495650_0000225 | 3300046471 | Bacteria | 117898 |
| 643 | Ga0495650_0042487 | 3300046471 | Bacteria | 1935 |
| 644 | Ga0495662_0266523 | 3300046476 | Bacteria | 843 |
| 645 | Ga0495585_0000074 | 3300046492 | Bacteria | 102651 |
| 646 | Ga0495585_0000459 | 3300046492 | Bacteria | 38959 |
| 647 | Ga0495585_0382853 | 3300046492 | Bacteria | 679 |
| 648 | Ga0495596_0013858 | 3300046500 | Bacteria | 3407 |
| 649 | Ga0495596_0036677 | 3300046500 | Bacteria | 1941 |
| 650 | Ga0495607_0035026 | 3300046501 | Bacteria | 3041 |
| 651 | Ga0495583_0090456 | 3300046506 | Bacteria | 1318 |
| 652 | Ga0495583_0229397 | 3300046506 | Bacteria | 749 |
| 653 | Ga0495606_0000074 | 3300046507 | Bacteria | 170848 |
| 654 | Ga0495606_0002257 | 3300046507 | Bacteria | 22884 |
| 655 | Ga0495606_0005508 | 3300046507 | Bacteria | 12100 |
| 656 | Ga0495606_0007729 | 3300046507 | Bacteria | 9521 |
| 657 | Ga0495606_0035769 | 3300046507 | Bacteria | 3391 |
| 658 | Ga0495606_0082552 | 3300046507 | Bacteria | 1995 |
| 659 | Ga0495606_0188445 | 3300046507 | Bacteria | 1184 |
| 660 | Ga0495606_0487361 | 3300046507 | Bacteria | 625 |
| 661 | Ga0495610_0000005 | 3300046512 | Bacteria | 924111 |
| 662 | Ga0495610_0000037 | 3300046512 | Bacteria | 186354 |
| 663 | Ga0495610_0000574 | 3300046512 | Bacteria | 36619 |
| 664 | Ga0495616_0003462 | 3300046513 | Bacteria | 10103 |
| 665 | Ga0495616_0023014 | 3300046513 | Bacteria | 3357 |
| 666 | Ga0495628_1127723 | 3300046516 | Bacteria | 535 |
| 667 | Ga0495628_1209598 | 3300046516 | Bacteria | 512 |
| 668 | Ga0495631_0004748 | 3300046518 | Bacteria | 7178 |
| 669 | Ga0495631_0329036 | 3300046518 | Bacteria | 650 |
| 670 | Ga0495632_0002479 | 3300046519 | Bacteria | 14017 |
| 671 | Ga0495632_0033917 | 3300046519 | Bacteria | 2617 |
| 672 | Ga0495637_0020106 | 3300046520 | Bacteria | 3076 |
| 673 | Ga0495637_0059294 | 3300046520 | Bacteria | 1575 |
| 674 | Ga0495643_0000316 | 3300046522 | Bacteria | 66852 |
| 675 | Ga0495643_0014191 | 3300046522 | Bacteria | 4744 |
| 676 | Ga0495643_0049655 | 3300046522 | Bacteria | 2262 |
| 677 | Ga0495643_0167404 | 3300046522 | Bacteria | 1077 |
| 678 | Ga0495648_0001585 | 3300046524 | Bacteria | 22152 |
| 679 | Ga0495663_0019918 | 3300046525 | Bacteria | 1923 |
| 680 | Ga0495654_0118142 | 3300046530 | Bacteria | 1203 |
| 681 | Ga0495654_0278180 | 3300046530 | Bacteria | 689 |
| 682 | Ga0495586_0308905 | 3300046535 | Bacteria | 906 |
| 683 | Ga0495609_0000003 | 3300046538 | Bacteria | 711547 |
| 684 | Ga0495609_0001203 | 3300046538 | Bacteria | 17830 |
| 685 | Ga0495622_0051975 | 3300046557 | Bacteria | 1901 |
| 686 | Ga0495633_0000001 | 3300046558 | Bacteria | 801972 |
| 687 | Ga0495633_0000004 | 3300046558 | Bacteria | 370781 |
| 688 | Ga0495633_0012522 | 3300046558 | Bacteria | 4506 |
| 689 | Ga0495633_0026871 | 3300046558 | Bacteria | 2818 |
| 690 | Ga0495633_0060180 | 3300046558 | Bacteria | 1780 |
| 691 | Ga0495633_0153487 | 3300046558 | Bacteria | 1063 |
| 692 | Ga0495633_0332068 | 3300046558 | Bacteria | 689 |
| 693 | Ga0495668_0000121 | 3300046616 | Bacteria | 116234 |
| 694 | Ga0495668_0139848 | 3300046616 | Bacteria | 1325 |
| 695 | Ga0495634_0071997 | 3300046642 | Bacteria | 2274 |
| 696 | Ga0495625_0000040 | 3300046660 | Bacteria | 207320 |
| 697 | Ga0495625_0000067 | 3300046660 | Bacteria | 171483 |
| 698 | Ga0495625_0001612 | 3300046660 | Bacteria | 26626 |
| 699 | Ga0495625_0001746 | 3300046660 | Bacteria | 25142 |
| 700 | Ga0495625_0174707 | 3300046660 | Bacteria | 1432 |
| 701 | Ga0495625_0377831 | 3300046660 | Bacteria | 890 |
| 702 | Ga0495661_0004327 | 3300046665 | Bacteria | 10280 |
| 703 | Ga0495661_0209943 | 3300046665 | Bacteria | 1014 |
| 704 | Ga0495599_0584929 | 3300046678 | Bacteria | 651 |
| 705 | Ga0495658_0068117 | 3300046683 | Bacteria | 2060 |
| 706 | Ga0495613_0432404 | 3300046689 | Bacteria | 894 |
| 707 | Ga0495670_0505564 | 3300046691 | Bacteria | 656 |
| 708 | Ga0495671_0043184 | 3300046692 | Bacteria | 2263 |
| 709 | Ga0495649_0000054 | 3300046694 | Bacteria | 107048 |
| 710 | Ga0495649_0162829 | 3300046694 | Bacteria | 1169 |
| 711 | Ga0495589_0073307 | 3300046794 | Bacteria | 1671 |
| 712 | Ga0495660_0033687 | 3300046810 | Bacteria | 2870 |
| 713 | Ga0495660_0046383 | 3300046810 | Bacteria | 2383 |
| 714 | Ga0495672_0223843 | 3300047320 | Bacteria | 927 |
| 715 | Ga0495683_0021341 | 3300047323 | Bacteria | 3337 |
| 716 | Ga0495683_0160689 | 3300047323 | Bacteria | 1039 |
| 717 | Ga0495687_002058 | 3300047443 | Bacteria | 16916 |
| 718 | Ga0495687_002279 | 3300047443 | Bacteria | 15707 |
| 719 | Ga0495685_103521 | 3300047447 | Bacteria | 939 |
| 720 | Ga0495673_0013544 | 3300047469 | Bacteria | 4278 |
| 721 | Ga0495686_0000243 | 3300047472 | Bacteria | 98394 |
| 722 | Ga0495686_0001285 | 3300047472 | Bacteria | 28340 |
| 723 | Ga0495686_0006338 | 3300047472 | Bacteria | 9082 |
| 724 | Ga0495686_0078829 | 3300047472 | Bacteria | 2015 |
| 725 | Ga0495686_0160223 | 3300047472 | Bacteria | 1315 |
| 726 | Ga0496102_0018298 | 3300048905 | Bacteria | 6155 |
| 727 | Ga0496103_0043967 | 3300048906 | Bacteria | 2751 |
| 728 | Ga0496105_0439126 | 3300048908 | Bacteria | 1031 |
| 729 | Ga0496113_0561486 | 3300048916 | Bacteria | 915 |
| 730 | Ga0496115_0040497 | 3300048918 | Bacteria | 3704 |
| 731 | Ga0496115_0131137 | 3300048918 | Bacteria | 2066 |
| 732 | Ga0496115_0241709 | 3300048918 | Bacteria | 1488 |
| 733 | Ga0496115_0827685 | 3300048918 | Unclassified | 719 |
| 734 | Ga0496116_0000002 | 3300048919 | Bacteria | 920291 |
| 735 | Ga0496116_0000029 | 3300048919 | Bacteria | 422187 |
| 736 | Ga0496116_0002509 | 3300048919 | Bacteria | 19214 |
| 737 | Ga0496117_0000007 | 3300048920 | Bacteria | 720505 |
| 738 | Ga0496117_0022926 | 3300048920 | Bacteria | 4996 |
| 739 | Ga0496118_0000418 | 3300048921 | Bacteria | 70766 |
| 740 | Ga0496118_0145289 | 3300048921 | Bacteria | 1495 |
| 741 | Ga0496118_0154779 | 3300048921 | Bacteria | 1428 |
| 742 | Ga0496118_0182334 | 3300048921 | Bacteria | 1267 |
| 743 | Ga0496119_0000007 | 3300048922 | Bacteria | 475920 |
| 744 | Ga0496121_0029474 | 3300048924 | Bacteria | 5074 |
| 745 | Ga0496121_0259159 | 3300048924 | Bacteria | 1202 |
| 746 | Ga0496121_0536996 | 3300048924 | Bacteria | 734 |
| 747 | Ga0496122_0000089 | 3300048925 | Bacteria | 206107 |
| 748 | Ga0496122_0000151 | 3300048925 | Bacteria | 162224 |
| 749 | Ga0496122_0000153 | 3300048925 | Bacteria | 161087 |
| 750 | Ga0496122_0000668 | 3300048925 | Bacteria | 69054 |
| 751 | Ga0496122_0003324 | 3300048925 | Bacteria | 21243 |
| 752 | Ga0496122_0007777 | 3300048925 | Bacteria | 11793 |
| 753 | Ga0496123_0001537 | 3300048926 | Bacteria | 31905 |
| 754 | Ga0496123_0002751 | 3300048926 | Bacteria | 21039 |
| 755 | Ga0496123_0008187 | 3300048926 | Bacteria | 9641 |
| 756 | Ga0496123_0015155 | 3300048926 | Bacteria | 6342 |
| 757 | Ga0496123_0019968 | 3300048926 | Bacteria | 5260 |
| 758 | Ga0496123_0168752 | 3300048926 | Bacteria | 1157 |
| 759 | Ga0496123_0193897 | 3300048926 | Bacteria | 1048 |
| 760 | Ga0496124_0005848 | 3300048927 | Bacteria | 13649 |
| 761 | Ga0496124_0011820 | 3300048927 | Bacteria | 8696 |
| 762 | Ga0496124_0296594 | 3300048927 | Bacteria | 1170 |
| 763 | Ga0496125_0000007 | 3300048928 | Bacteria | 715355 |
| 764 | Ga0496125_0000024 | 3300048928 | Bacteria | 442149 |
| 765 | Ga0496125_0002520 | 3300048928 | Bacteria | 23642 |
| 766 | Ga0496125_0014776 | 3300048928 | Bacteria | 7583 |
| 767 | Ga0496125_0028703 | 3300048928 | Bacteria | 5017 |
| 768 | Ga0496125_0187666 | 3300048928 | Bacteria | 1369 |
| 769 | Ga0496125_0373304 | 3300048928 | Bacteria | 843 |
| 770 | Ga0496126_0002742 | 3300048929 | Bacteria | 23270 |
| 771 | Ga0496126_0007250 | 3300048929 | Bacteria | 12193 |
| 772 | Ga0496126_0052166 | 3300048929 | Bacteria | 3719 |
| 773 | Ga0496126_0125100 | 3300048929 | Bacteria | 2226 |
| 774 | Ga0501031_0238339 | 3300049568 | Bacteria | 1183 |
| 775 | Ga0501032_0002030 | 3300049569 | Bacteria | 15972 |
| 776 | Ga0501033_0000004 | 3300049570 | Bacteria | 441310 |
| 777 | Ga0501033_0127844 | 3300049570 | Unclassified | 1842 |
| 778 | Ga0501034_0001804 | 3300049571 | Bacteria | 27281 |
| 779 | Ga0501034_0010067 | 3300049571 | Bacteria | 9869 |
| 780 | Ga0501034_0323280 | 3300049571 | Bacteria | 1475 |
| 781 | Ga0501036_0018837 | 3300049572 | Bacteria | 5789 |
| 782 | Ga0501036_0248629 | 3300049572 | Bacteria | 1490 |
| 783 | Ga0501037_0042694 | 3300049573 | Bacteria | 3332 |
| 784 | Ga0501038_0001517 | 3300049574 | Bacteria | 21376 |
| 785 | Ga0501038_0013295 | 3300049574 | Bacteria | 7506 |
| 786 | Ga0501039_0001415 | 3300049575 | Bacteria | 17662 |
| 787 | Ga0501043_0001976 | 3300049579 | Bacteria | 17491 |
| 788 | Ga0501047_0117416 | 3300049581 | Bacteria | 2542 |
| 789 | Ga0501070_0090138 | 3300049586 | Bacteria | 2538 |
| 790 | Ga0501199_041460 | 3300049650 | Bacteria | 598 |
| 791 | Ga0501223_020965 | 3300049663 | Bacteria | 1279 |
| 792 | Ga0501223_028693 | 3300049663 | Bacteria | 1083 |
| 793 | Ga0501238_000108 | 3300049671 | Bacteria | 13310 |
| 794 | Ga0501238_027363 | 3300049671 | Bacteria | 820 |
| 795 | Ga0501240_002416 | 3300049673 | Bacteria | 1982 |
| 796 | Ga0501249_000026 | 3300049679 | Bacteria | 87882 |
| 797 | Ga0501249_000534 | 3300049679 | Bacteria | 9159 |
| 798 | Ga0501249_027083 | 3300049679 | Bacteria | 1268 |
| 799 | Ga0501241_000001 | 3300049758 | Bacteria | 233688 |
| 800 | Ga0501241_001155 | 3300049758 | Bacteria | 5488 |
| 801 | Ga0501241_005329 | 3300049758 | Bacteria | 2401 |
| 802 | Ga0501266_000001 | 3300049763 | Bacteria | 562004 |
| 803 | Ga0501269_000002 | 3300049766 | Bacteria | 118370 |
| 804 | Ga0501269_008191 | 3300049766 | Bacteria | 1264 |
| 805 | Ga0501280_000279 | 3300049776 | Bacteria | 13037 |
| 806 | Ga0501280_007847 | 3300049776 | Bacteria | 1490 |
| 807 | Ga0501035_0002702 | 3300049822 | Bacteria | 17241 |
| 808 | Ga0501035_0889397 | 3300049822 | Unclassified | 706 |
| 809 | Ga0501044_0002271 | 3300049823 | Bacteria | 21924 |
| 810 | Ga0501045_0000002 | 3300049824 | Bacteria | 94022 |
| 811 | nmdc:mga00v17_304879_c1 | 3300050491 | Bacteria | 1034 |
| 812 | nmdc:mga0k408_167_c1 | 3300050493 | Bacteria | 34645 |
| 813 | nmdc:mga0k408_54518_c1 | 3300050493 | Bacteria | 2317 |
| 814 | nmdc:mga0k408_626_c1 | 3300050493 | Bacteria | 19472 |
| 815 | nmdc:mga07m45_161635_c1 | 3300050496 | Bacteria | 1300 |
| 816 | nmdc:mga07m45_391139_c1 | 3300050496 | Bacteria | 807 |
| 817 | Ga0500635_0000533 | 3300053080 | Bacteria | 10305 |
| 818 | Ga0500635_0003110 | 3300053080 | Bacteria | 4150 |
| 819 | Ga0500646_0049739 | 3300053090 | Bacteria | 1206 |
| 820 | Ga0500647_0108448 | 3300053091 | Bacteria | 1322 |
| 821 | Ga0500641_0000015 | 3300053096 | Bacteria | 141363 |
| 822 | Ga0500641_0000058 | 3300053096 | Bacteria | 47154 |
| 823 | Ga0500641_0000620 | 3300053096 | Bacteria | 12828 |
| 824 | Ga0500594_0055627 | 3300053118 | Bacteria | 1126 |
| 825 | Ga0500608_008141 | 3300053122 | Bacteria | 4387 |
| 826 | Ga0500614_242301 | 3300053123 | Bacteria | 561 |
| 827 | Ga0500618_029208 | 3300053125 | Bacteria | 1301 |
| 828 | Ga0500642_0099938 | 3300053130 | Bacteria | 1348 |
| 829 | Ga0500658_0000001 | 3300053134 | Bacteria | 592738 |
| 830 | Ga0500559_0032450 | 3300053136 | Bacteria | 2245 |
| 831 | Ga0500564_061994 | 3300053138 | Bacteria | 1695 |
| 832 | Ga0500568_0271195 | 3300053139 | Bacteria | 617 |
| 833 | Ga0500573_0189197 | 3300053140 | Bacteria | 1101 |
| 834 | Ga0500590_352728 | 3300053148 | Bacteria | 525 |
| 835 | Ga0500622_0064325 | 3300053156 | Bacteria | 1866 |
| 836 | Ga0500622_0072749 | 3300053156 | Bacteria | 1735 |
| 837 | Ga0500584_080778 | 3300053726 | Bacteria | 1392 |
| 838 | 2513233033 | 2513020052 | Bacteria | 5120511 |
| 839 | 2520880935 | 2519899754 | Bacteria | 5336938 |
| 840 | 2522549277 | 2522125168 | Bacteria | 7376607 |
| 841 | 2586207187 | 2585427687 | Bacteria | 5544917 |
| 842 | 2599480000 | 2599185184 | Bacteria | 6430550 |
| 843 | 2644012473 | 2643221600 | Bacteria | 5530138 |
| 844 | 2644371723 | 2643221667 | Bacteria | 5627472 |
| 845 | 2644640935 | 2643221716 | Bacteria | 4986332 |
| 846 | 2644684385 | 2643221725 | Bacteria | 5087956 |
| 847 | 2722726222 | 2721755487 | Bacteria | 6357185 |
| 848 | 2738735018 | 2738541279 | Bacteria | 6149495 |
| 849 | 2738755859 | 2738541283 | Bacteria | 7222293 |
| 850 | 2738761475 | 2738541284 | Bacteria | 5199923 |
| 851 | 2738769258 | 2738541285 | Bacteria | 6150075 |
| 852 | 2738852505 | 2738541302 | Bacteria | 5944758 |
| 853 | 2739216600 | 2738543007 | Bacteria | 6149845 |
| 854 | 2739303013 | 2738543023 | Bacteria | 6767879 |
| 855 | 2739591382 | 2739367651 | Bacteria | 6359826 |
| 856 | 2739614739 | 2739367656 | Bacteria | 5152243 |
| 857 | 2739646108 | 2739367663 | Bacteria | 5040914 |
| 858 | 2739999886 | 2739367857 | Bacteria | 5433684 |
| 859 | 2740004702 | 2739367858 | Bacteria | 5432813 |
| 860 | 2776615892 | 2775506987 | Bacteria | 5373360 |
| 861 | 2802651719 | 2802428842 | Bacteria | 4926114 |
| 862 | 2817414591 | 2816332280 | Bacteria | 5109718 |
| 863 | 2819549636 | 2818991437 | Bacteria | 5805520 |
| 864 | 2833642025 | 2833640130 | Bacteria | 4858325 |
| 865 | 2842727391 | 2842722452 | Bacteria | 6263924 |
| 866 | 2842905460 | 2842903701 | Bacteria | 6986368 |
| 867 | 2842913787 | 2842909656 | Bacteria | 6185908 |
| 868 | 2849285385 | 2849281842 | Bacteria | 6065644 |
| 869 | 2852626182 | 2852623160 | Bacteria | 4376875 |
| 870 | 2852628096 | 2852627209 | Bacteria | 5896285 |
| 871 | 2857615424 | 2857613821 | Bacteria | 4917088 |
| 872 | 2857622164 | 2857618242 | Bacteria | 5635925 |
| 873 | 2857631981 | 2857627736 | Bacteria | 5625397 |
| 874 | 2881250537 | 2881247448 | Bacteria | 3717788 |
| 875 | 2881363925 | 2881359912 | Bacteria | 4935907 |
| 876 | 2884635929 | 2884634485 | Bacteria | 3928637 |
| 877 | 2884935278 | 2884933994 | Bacteria | 4535041 |
| 878 | 2890739265 | 2890737413 | Bacteria | 4269751 |
| 879 | 2896345575 | 2896344016 | Bacteria | 3811746 |
| 880 | 2898716816 | 2898713307 | Bacteria | 4110805 |
| 881 | 2902050453 | 2902048731 | Bacteria | 4976191 |
| 882 | 2903895673 | 2903895155 | Bacteria | 5258610 |
| 883 | 2904422622 | 2904419702 | Bacteria | 5166287 |
| 884 | 2904447237 | 2904445276 | Bacteria | 5310396 |
| 885 | 2904558240 | 2904555929 | Bacteria | 5218588 |
| 886 | 2904782831 | 2904780799 | Bacteria | 5840761 |
| 887 | 2910246116 | 2910245624 | Bacteria | 6935613 |
| 888 | 2911139757 | 2911138879 | Bacteria | 5811561 |
| 889 | 2919180442 | 2919177583 | Bacteria | 5641607 |
| 890 | 2919188458 | 2919186247 | Bacteria | 6244071 |
| 891 | 2919192888 | 2919191525 | Bacteria | 5765973 |
| 892 | 2919510647 | 2919509842 | Bacteria | 4104664 |
| 893 | 2919683726 | 2919683626 | Bacteria | 5534354 |
| 894 | 2919693539 | 2919692658 | Bacteria | 5943958 |
| 895 | 2928081131 | 2928078545 | Bacteria | 6534839 |
| 896 | 2928152448 | 2928147474 | Bacteria | 6512076 |
| 897 | 2929151740 | 2929150217 | Bacteria | 5462483 |
| 898 | 2932087781 | 2932082852 | Bacteria | 6563563 |
| 899 | 2939667457 | 2939664404 | Bacteria | 6364494 |
| 900 | 2945998294 | 2945997725 | Bacteria | 6404843 |
| 901 | 2954020753 | 2954016120 | Bacteria | 6446024 |
| 902 | 2958460024 | 2958458903 | Bacteria | 5301041 |
| 903 | 2958513282 | 2958512119 | Bacteria | 4528530 |
| 904 | 2965322681 | 2965320100 | Bacteria | 3975600 |
| 905 | 2977234814 | 2977232053 | Bacteria | 5485925 |
| 906 | 2977268463 | 2977268062 | Bacteria | 5243061 |
| 907 | 2993482182 | 2993480792 | Bacteria | 4022225 |
| 908 | 8054309040 | 8054307821 | Bacteria | 5212224 |
| 909 | 8055419629 | 8055419101 | Bacteria | 5289643 |
| 910 | 8055595890 | 8055592153 | Bacteria | 5961247 |
| 911 | 8056443152 | 8056440228 | Bacteria | 4946504 |
| 912 | Ga0163163_10123310 | |||
| 913 | SwRhRL2b_contig_1426845 | |||
| 914 | SwRhRL2b_contig_2141802 | |||
| 915 | SwRhRL2b_contig_2234511 | |||
| 916 | SwRhRL2b_contig_2737985 | |||
| 917 | SwRhRL2b_contig_3209656 | |||
| 918 | JGI24736J21556_1005426 | |||
| 919 | JGI24736J21556_1005446 | |||
| 920 | JGI24740J21852_10009887 | |||
| 921 | JGI24740J21852_10032120 | |||
| 922 | JGI24740J21852_10121227 | |||
| 923 | JGI24739J22299_10002365 | |||
| 924 | JGI24737J22298_10000496 | |||
| 925 | JGI24737J22298_10009284 | |||
| 926 | JGI24735J21928_10000005 | |||
| 927 | JGI24735J21928_10024511 | |||
| 928 | JGI25162J39368_1001793 | |||
| 929 | JGI25157J39369_1006041 | |||
| 930 | JGI25164J39214_1003256 | |||
| 931 | JGI25152J39213_1000080 | |||
| 932 | JGI25150J39212_1000003 | |||
| 933 | JGI25150J39212_1000004 | |||
| 934 | JGI25151J46595_10000002 | |||
| 935 | JGI25165J46597_1003249 | |||
| 936 | JGI25153J46596_10000015 | |||
| 937 | rootH1_10018738 | |||
| 938 | rootH2_10000823 | |||
| 939 | rootH2_10166669 | |||
| 940 | rootH2_10213711 | |||
| 941 | rootH2_10293539 | |||
| 942 | rootL2_10000170 | |||
| 943 | rootL2_10086321 | |||
| 944 | rootL2_10125855 | |||
| 945 | rootL2_10211502 | |||
| 946 | rootL2_10239455 | |||
| 947 | rootL2_10282583 | |||
| 948 | rootL2_10282620 | |||
| 949 | rootH1_10010138 | |||
| 950 | rootH1_10130033 | |||
| 951 | rootH1_10141868 | |||
| 952 | rootH1_10205903 | |||
| 953 | rootH1_10250537 | |||
| 954 | Ga0055536_1000002 | |||
| 955 | Ga0055536_1006887 | |||
| 956 | Ga0055530_10004135 | |||
| 957 | Ga0065165_1000478 | |||
| 958 | Ga0065714_10002231 | |||
| 959 | Ga0065714_10002386 | |||
| 960 | Ga0065714_10003833 | |||
| 961 | Ga0065714_10018627 | |||
| 962 | Ga0065714_10068450 | |||
| 963 | Ga0065714_10071057 | |||
| 964 | Ga0065714_10085785 | |||
| 965 | Ga0065714_10097380 | |||
| 966 | Ga0065714_10110637 | |||
| 967 | Ga0065714_10128983 | |||
| 968 | Ga0065714_10180754 | |||
| 969 | Ga0065714_10234935 | |||
| 970 | Ga0065714_10260939 | |||
| 971 | Ga0065704_10002049 | |||
| 972 | Ga0065704_10037325 | |||
| 973 | Ga0065704_10070374 | |||
| 974 | Ga0065704_10073302 | |||
| 975 | Ga0065704_10076064 | |||
| 976 | Ga0065704_10077903 | |||
| 977 | Ga0065704_10078968 | |||
| 978 | Ga0065704_10090520 | |||
| 979 | Ga0065704_10092841 | |||
| 980 | Ga0065704_10098036 | |||
| 981 | Ga0065704_10111747 | |||
| 982 | Ga0065704_10121604 | |||
| 983 | Ga0065704_10416260 | |||
| 984 | Ga0065715_10094915 | |||
| 985 | Ga0065715_10189695 | |||
| 986 | Ga0065715_10406989 | |||
| 987 | Ga0065715_10475229 | |||
| 988 | Ga0070658_10000016 | |||
| 989 | Ga0070658_10401077 | |||
| 990 | Ga0070676_10003779 | |||
| 991 | Ga0070683_100002723 | |||
| 992 | Ga0070680_100011953 | |||
| 993 | Ga0070682_100000065 | |||
| 994 | Ga0070682_100372120 | |||
| 995 | Ga0068868_100173252 | |||
| 996 | Ga0068868_100217025 | |||
| 997 | Ga0070660_100043623 | |||
| 998 | Ga0070660_100074805 | |||
| 999 | Ga0070660_100323059 | |||
| 1000 | Ga0070668_100006243 | |||
| 1001 | Ga0070668_100040617 | |||
| 1002 | Ga0070673_100018134 | |||
| 1003 | Ga0070659_100000391 | |||
| 1004 | Ga0070659_100006520 | |||
| 1005 | Ga0070663_100030640 | |||
| 1006 | Ga0070678_100008126 | |||
| 1007 | Ga0070678_100421701 | |||
| 1008 | Ga0070662_100000026 | |||
| 1009 | Ga0070681_10004335 | |||
| 1010 | Ga0068867_100000879 | |||
| 1011 | Ga0070685_10046821 | |||
| 1012 | Ga0070679_100007384 | |||
| 1013 | Ga0070679_100116775 | |||
| 1014 | Ga0070684_100002108 | |||
| 1015 | Ga0068853_100009639 | |||
| 1016 | Ga0068853_100212349 | |||
| 1017 | Ga0068853_100221785 | |||
| 1018 | Ga0068853_100417747 | |||
| 1019 | Ga0070672_100167388 | |||
| 1020 | Ga0070665_100000012 | |||
| 1021 | Ga0068855_100000160 | |||
| 1022 | Ga0068855_100000967 | |||
| 1023 | Ga0068855_100155254 | |||
| 1024 | Ga0068855_100164427 | |||
| 1025 | Ga0068855_100172468 | |||
| 1026 | Ga0068855_100176926 | |||
| 1027 | Ga0068855_100573048 | |||
| 1028 | Ga0068855_100972981 | |||
| 1029 | Ga0068857_100026580 | |||
| 1030 | Ga0068857_101021686 | |||
| 1031 | Ga0068856_100000006 | |||
| 1032 | Ga0068856_100010882 | |||
| 1033 | Ga0068856_100027080 | |||
| 1034 | Ga0068856_100066696 | |||
| 1035 | Ga0068856_100153239 | |||
| 1036 | Ga0068856_100686779 | |||
| 1037 | Ga0068852_100000584 | |||
| 1038 | Ga0068852_100160435 | |||
| 1039 | Ga0075364_10429002 | |||
| 1040 | Ga0070716_100123943 | |||
| 1041 | Ga0075362_10304524 | |||
| 1042 | Ga0075366_10000228 | |||
| 1043 | Ga0075366_10018920 | |||
| 1044 | Ga0097621_100000069 | |||
| 1045 | Ga0097621_100591459 | |||
| 1046 | Ga0097621_100681344 | |||
| 1047 | Ga0097621_101112304 | |||
| 1048 | Ga0075370_10704159 | |||
| 1049 | Ga0068871_100001572 | |||
| 1050 | Ga0068865_100000098 | |||
| 1051 | Ga0099824_1000108 | |||
| 1052 | Ga0079104_1000028 | |||
| 1053 | Ga0099826_10006584 | |||
| 1054 | Ga0105251_10244344 | |||
| 1055 | Ga0105244_10000005 | |||
| 1056 | Ga0105244_10000059 | |||
| 1057 | Ga0105244_10031705 | |||
| 1058 | Ga0105244_10097076 | |||
| 1059 | Ga0105250_10007666 | |||
| 1060 | Ga0105240_10007861 | |||
| 1061 | Ga0105240_10057931 | |||
| 1062 | Ga0105240_10068070 | |||
| 1063 | Ga0105240_10072715 | |||
| 1064 | Ga0105240_10073488 | |||
| 1065 | Ga0105240_10151227 | |||
| 1066 | Ga0105240_10158414 | |||
| 1067 | Ga0105240_10174075 | |||
| 1068 | Ga0105240_10282640 | |||
| 1069 | Ga0105240_10658903 | |||
| 1070 | Ga0105240_10839908 | |||
| 1071 | Ga0105240_12442084 | |||
| 1072 | Ga0105245_10119486 | |||
| 1073 | Ga0105245_10659558 | |||
| 1074 | Ga0105247_10251266 | |||
| 1075 | Ga0105243_10000009 | |||
| 1076 | Ga0105243_10000021 | |||
| 1077 | Ga0105243_10049802 | |||
| 1078 | Ga0105243_11981475 | |||
| 1079 | Ga0105241_10000693 | |||
| 1080 | Ga0105241_10033174 | |||
| 1081 | Ga0105241_10051932 | |||
| 1082 | Ga0105241_10084819 | |||
| 1083 | Ga0105241_10144455 | |||
| 1084 | Ga0105241_10383099 | |||
| 1085 | Ga0105241_10544132 | |||
| 1086 | Ga0105242_10018006 | |||
| 1087 | Ga0105242_11429575 | |||
| 1088 | Ga0105242_11731069 | |||
| 1089 | Ga0105237_10000354 | |||
| 1090 | Ga0105237_10000429 | |||
| 1091 | Ga0105237_10000753 | |||
| 1092 | Ga0105237_10001433 | |||
| 1093 | Ga0105237_10035290 | |||
| 1094 | Ga0105237_10205712 | |||
| 1095 | Ga0105237_10326070 | |||
| 1096 | Ga0105238_10001430 | |||
| 1097 | Ga0105238_10038622 | |||
| 1098 | Ga0105238_10237198 | |||
| 1099 | Ga0105238_10560111 | |||
| 1100 | Ga0105239_10000015 | |||
| 1101 | Ga0105239_10000069 | |||
| 1102 | Ga0105239_10001827 | |||
| 1103 | Ga0105239_10008812 | |||
| 1104 | Ga0105239_10060393 | |||
| 1105 | Ga0105239_10099630 | |||
| 1106 | Ga0105239_10359206 | |||
| 1107 | Ga0105239_10363932 | |||
| 1108 | Ga0105239_10557742 | |||
| 1109 | Ga0105239_11417665 | |||
| 1110 | Ga0105239_12202967 | |||
| 1111 | Ga0105246_10803668 | |||
| 1112 | Ga0157373_10000003 | |||
| 1113 | Ga0157373_10000065 | |||
| 1114 | Ga0157373_10000254 | |||
| 1115 | Ga0157373_10000936 | |||
| 1116 | Ga0157373_10008808 | |||
| 1117 | Ga0157373_10010688 | |||
| 1118 | Ga0157373_10134944 | |||
| 1119 | Ga0157373_10153715 | |||
| 1120 | Ga0157373_10561796 | |||
| 1121 | Ga0157373_10590034 | |||
| 1122 | Ga0157371_10000025 | |||
| 1123 | Ga0157371_10000229 | |||
| 1124 | Ga0157371_10000904 | |||
| 1125 | Ga0157371_10005051 | |||
| 1126 | Ga0157371_10006606 | |||
| 1127 | Ga0157371_10007352 | |||
| 1128 | Ga0157371_10024946 | |||
| 1129 | Ga0157371_10048837 | |||
| 1130 | Ga0157371_10058894 | |||
| 1131 | Ga0157371_10114437 | |||
| 1132 | Ga0157371_10647748 | |||
| 1133 | Ga0157371_10689570 | |||
| 1134 | Ga0157370_10001039 | |||
| 1135 | Ga0157370_10001545 | |||
| 1136 | Ga0157370_10001670 | |||
| 1137 | Ga0157370_10002687 | |||
| 1138 | Ga0157370_10005342 | |||
| 1139 | Ga0157370_10008063 | |||
| 1140 | Ga0157370_10009163 | |||
| 1141 | Ga0157370_10014803 | |||
| 1142 | Ga0157370_10016593 | |||
| 1143 | Ga0157370_10018605 | |||
| 1144 | Ga0157370_10039970 | |||
| 1145 | Ga0157370_10043395 | |||
| 1146 | Ga0157370_10047507 | |||
| 1147 | Ga0157370_10068889 | |||
| 1148 | Ga0157370_10070331 | |||
| 1149 | Ga0157370_10144272 | |||
| 1150 | Ga0157370_10200144 | |||
| 1151 | Ga0157370_10218154 | |||
| 1152 | Ga0157370_10220805 | |||
| 1153 | Ga0157370_10297945 | |||
| 1154 | Ga0157370_10299675 | |||
| 1155 | Ga0157370_10302736 | |||
| 1156 | Ga0157370_10422938 | |||
| 1157 | Ga0157370_11264259 | |||
| 1158 | Ga0157369_10000038 | |||
| 1159 | Ga0157369_10000101 | |||
| 1160 | Ga0157369_10000423 | |||
| 1161 | Ga0157369_10002643 | |||
| 1162 | Ga0157369_10037939 | |||
| 1163 | Ga0157369_10198222 | |||
| 1164 | Ga0157369_10602754 | |||
| 1165 | Ga0157369_10658741 | |||
| 1166 | Ga0157369_10662035 | |||
| 1167 | Ga0157374_10000076 | |||
| 1168 | Ga0157374_10001396 | |||
| 1169 | Ga0157374_10018889 | |||
| 1170 | Ga0157378_10015305 | |||
| 1171 | Ga0157378_10016498 | |||
| 1172 | Ga0157378_10075864 | |||
| 1173 | Ga0157378_10142182 | |||
| 1174 | Ga0157378_10388262 | |||
| 1175 | Ga0163162_10000013 | |||
| 1176 | Ga0163162_10000050 | |||
| 1177 | Ga0163162_10009096 | |||
| 1178 | Ga0163162_10034388 | |||
| 1179 | Ga0163162_10036274 | |||
| 1180 | Ga0163162_10409126 | |||
| 1181 | Ga0157372_10000041 | |||
| 1182 | Ga0157372_10000051 | |||
| 1183 | Ga0157372_10000874 | |||
| 1184 | Ga0157372_10003305 | |||
| 1185 | Ga0157372_10025095 | |||
| 1186 | Ga0157372_10040546 | |||
| 1187 | Ga0157375_10000417 | |||
| 1188 | Ga0157375_10076573 | |||
| 1189 | Ga0157375_10091841 | |||
| 1190 | Ga0157375_10110784 | |||
| 1191 | Ga0157375_10135693 | |||
| 1192 | Ga0157375_10162209 | |||
| 1193 | Ga0157375_10347452 | |||
| 1194 | Ga0157375_10781023 | |||
| 1195 | Ga0157375_10978991 | |||
| 1196 | Ga0163163_11044371 | |||
| 1197 | Ga0157380_10000022 | |||
| 1198 | Ga0182008_10000005 | |||
| 1199 | Ga0182008_10000025 | |||
| 1200 | Ga0182008_10000052 | |||
| 1201 | Ga0182008_10000058 | |||
| 1202 | Ga0182008_10014892 | |||
| 1203 | Ga0182008_10229604 | |||
| 1204 | Ga0182008_10721046 | |||
| 1205 | Ga0157377_10418005 | |||
| 1206 | Ga0157376_10193333 | |||
| 1207 | Ga0157376_10480276 | |||
| 1208 | Ga0182006_1000127 | |||
| 1209 | Ga0182006_1000645 | |||
| 1210 | Ga0182006_1001592 | |||
| 1211 | Ga0182006_1006423 | |||
| 1212 | Ga0182006_1008199 | |||
| 1213 | Ga0182006_1038255 | |||
| 1214 | Ga0182006_1107532 | |||
| 1215 | Ga0182007_10000024 | |||
| 1216 | Ga0182007_10004566 | |||
| 1217 | Ga0182007_10060916 | |||
| 1218 | Ga0182007_10082546 | |||
| 1219 | Ga0183373_1002 | |||
| 1220 | Ga0163161_10000014 | |||
| 1221 | Ga0163161_10000136 | |||
| 1222 | Ga0163161_10000628 | |||
| 1223 | Ga0163161_10000979 | |||
| 1224 | Ga0163161_10005705 | |||
| 1225 | Ga0163161_10008888 | |||
| 1226 | Ga0163161_10019883 | |||
| 1227 | Ga0163161_10065973 | |||
| 1228 | Ga0163161_10093528 | |||
| 1229 | Ga0163161_10158712 | |||
| 1230 | Ga0163161_10197638 | |||
| 1231 | Ga0163161_10252369 | |||
| 1232 | Ga0163161_10412790 | |||
| 1233 | Ga0163161_10420758 | |||
| 1234 | Ga0163161_10422061 | |||
| 1235 | Ga0163161_10573934 | |||
| 1236 | Ga0163161_10729285 | |||
| 1237 | Ga0163161_11321188 | |||
| 1238 | Ga0213872_10019228 | |||
| 1239 | Ga0209563_110589 | |||
| 1240 | Ga0207427_100043 | |||
| 1241 | Ga0209437_100170 | |||
| 1242 | Ga0209437_100190 | |||
| 1243 | Ga0207425_1000003 | |||
| 1244 | Ga0209026_1000243 | |||
| 1245 | Ga0209026_1004634 | |||
| 1246 | Ga0209129_1000014 | |||
| 1247 | Ga0209129_1018403 | |||
| 1248 | Ga0209233_1000266 | |||
| 1249 | Ga0209233_1001543 | |||
| 1250 | Ga0209233_1009528 | |||
| 1251 | Ga0209455_1002288 | |||
| 1252 | Ga0209675_1000022 | |||
| 1253 | Ga0209676_1000022 | |||
| 1254 | Ga0209676_1000488 | |||
| 1255 | Ga0209025_1000007 | |||
| 1256 | Ga0209758_1000012 | |||
| 1257 | Ga0209050_1000020 | |||
| 1258 | Ga0207426_1096738 | |||
| 1259 | Ga0207696_1008616 | |||
| 1260 | Ga0207655_1000003 | |||
| 1261 | Ga0207655_1000016 | |||
| 1262 | Ga0207655_1029660 | |||
| 1263 | Ga0207713_1148366 | |||
| 1264 | Ga0207713_1161976 | |||
| 1265 | Ga0207642_10078191 | |||
| 1266 | Ga0207710_10268630 | |||
| 1267 | Ga0207647_10000217 | |||
| 1268 | Ga0207647_10001231 | |||
| 1269 | Ga0207647_10041669 | |||
| 1270 | Ga0207645_10003391 | |||
| 1271 | Ga0207705_10000031 | |||
| 1272 | Ga0207705_10270542 | |||
| 1273 | Ga0207705_10284830 | |||
| 1274 | Ga0207654_10003057 | |||
| 1275 | Ga0207654_10058503 | |||
| 1276 | Ga0207654_10115651 | |||
| 1277 | Ga0207654_10168296 | |||
| 1278 | Ga0207707_10009797 | |||
| 1279 | Ga0207695_10000087 | |||
| 1280 | Ga0207695_10007478 | |||
| 1281 | Ga0207695_10010273 | |||
| 1282 | Ga0207695_10038235 | |||
| 1283 | Ga0207695_10109670 | |||
| 1284 | Ga0207695_10234651 | |||
| 1285 | Ga0207695_10283098 | |||
| 1286 | Ga0207695_10578372 | |||
| 1287 | Ga0207671_10000466 | |||
| 1288 | Ga0207671_10001163 | |||
| 1289 | Ga0207671_10003106 | |||
| 1290 | Ga0207671_10004475 | |||
| 1291 | Ga0207671_10011835 | |||
| 1292 | Ga0207671_10195729 | |||
| 1293 | Ga0207693_10316745 | |||
| 1294 | Ga0207660_10125934 | |||
| 1295 | Ga0207657_10043954 | |||
| 1296 | Ga0207657_10094541 | |||
| 1297 | Ga0207657_10642078 | |||
| 1298 | Ga0207652_10007397 | |||
| 1299 | Ga0207652_10297821 | |||
| 1300 | Ga0207681_10299934 | |||
| 1301 | Ga0207694_10043769 | |||
| 1302 | Ga0207694_10048181 | |||
| 1303 | Ga0207694_10174370 | |||
| 1304 | Ga0207687_10073150 | |||
| 1305 | Ga0207644_10001994 | |||
| 1306 | Ga0207690_10000432 | |||
| 1307 | Ga0207690_10019136 | |||
| 1308 | Ga0207706_10000010 | |||
| 1309 | Ga0207686_10111656 | |||
| 1310 | Ga0207686_10611348 | |||
| 1311 | Ga0207709_10000026 | |||
| 1312 | Ga0207709_10000281 | |||
| 1313 | Ga0207709_10012162 | |||
| 1314 | Ga0207704_10000334 | |||
| 1315 | Ga0207691_10125785 | |||
| 1316 | Ga0207661_10003479 | |||
| 1317 | Ga0207661_10010032 | |||
| 1318 | Ga0207667_10000033 | |||
| 1319 | Ga0207667_10001021 | |||
| 1320 | Ga0207667_10003221 | |||
| 1321 | Ga0207667_10141964 | |||
| 1322 | Ga0207667_10199641 | |||
| 1323 | Ga0207667_10234194 | |||
| 1324 | Ga0207667_10247530 | |||
| 1325 | Ga0207667_10284586 | |||
| 1326 | Ga0207667_10439863 | |||
| 1327 | Ga0207667_10681425 | |||
| 1328 | Ga0207667_11049400 | |||
| 1329 | Ga0207651_10084689 | |||
| 1330 | Ga0207651_11007965 | |||
| 1331 | Ga0207668_10012192 | |||
| 1332 | Ga0207668_10162571 | |||
| 1333 | Ga0207640_11248667 | |||
| 1334 | Ga0207677_10174179 | |||
| 1335 | Ga0207639_10003841 | |||
| 1336 | Ga0207639_10080303 | |||
| 1337 | Ga0207639_10103364 | |||
| 1338 | Ga0207639_10275815 | |||
| 1339 | Ga0207678_10048526 | |||
| 1340 | Ga0207702_10000023 | |||
| 1341 | Ga0207702_10011730 | |||
| 1342 | Ga0207702_10119355 | |||
| 1343 | Ga0207702_10389976 | |||
| 1344 | Ga0207702_11400959 | |||
| 1345 | Ga0207648_10000990 | |||
| 1346 | Ga0207674_10158235 | |||
| 1347 | Ga0207674_10855106 | |||
| 1348 | Ga0207674_11582206 | |||
| 1349 | Ga0207674_11584921 | |||
| 1350 | Ga0207683_10017708 | |||
| 1351 | Ga0207683_10408760 | |||
| 1352 | Ga0207698_10008792 | |||
| 1353 | Ga0207698_10078823 | |||
| 1354 | Ga0207698_10240750 | |||
| 1355 | Ga0209281_1000069 | |||
| 1356 | Ga0209968_1001501 | |||
| 1357 | Ga0210002_1029206 | |||
| 1358 | Ga0268266_10000080 | |||
| 1359 | Ga0265337_1026609 | |||
| 1360 | Ga0265326_10060373 | |||
| 1361 | Ga0265334_10030858 | |||
| 1362 | Ga0265322_10014427 | |||
| 1363 | Ga0265336_10084740 | |||
| 1364 | Ga0307517_10026222 | |||
| 1365 | Ga0307515_10001558 | |||
| 1366 | Ga0307515_10030051 | |||
| 1367 | Ga0307515_10117183 | |||
| 1368 | Ga0307515_10440460 | |||
| 1369 | Ga0307515_10576824 | |||
| 1370 | Ga0265338_10480951 | |||
| 1371 | Ga0265324_10013449 | |||
| 1372 | Ga0316176_1063745 | |||
| 1373 | Ga0316183_1152562 | |||
| 1374 | Ga0316181_1121975 | |||
| 1375 | Ga0316182_1125350 | |||
| 1376 | Ga0265330_10244326 | |||
| 1377 | Ga0265332_10089319 | |||
| 1378 | Ga0265328_10091405 | |||
| 1379 | Ga0265320_10177507 | |||
| 1380 | Ga0265329_10096597 | |||
| 1381 | Ga0265327_10001390 | |||
| 1382 | Ga0265327_10044490 | |||
| 1383 | Ga0265316_10001519 | |||
| 1384 | Ga0265316_10111949 | |||
| 1385 | Ga0265316_10115655 | |||
| 1386 | Ga0265316_10311458 | |||
| 1387 | Ga0307509_10283860 | |||
| 1388 | Ga0307509_10293734 | |||
| 1389 | Ga0307408_100000164 | |||
| 1390 | Ga0307408_100000310 | |||
| 1391 | Ga0307408_100000448 | |||
| 1392 | Ga0307408_100000583 | |||
| 1393 | Ga0307408_100003314 | |||
| 1394 | Ga0307408_100142791 | |||
| 1395 | Ga0265314_10000031 | |||
| 1396 | Ga0316576_11034229 | |||
| 1397 | Ga0307405_10000001 | |||
| 1398 | Ga0307405_10000011 | |||
| 1399 | Ga0307405_10007180 | |||
| 1400 | Ga0307405_10047027 | |||
| 1401 | Ga0307405_10166489 | |||
| 1402 | Ga0307405_10358810 | |||
| 1403 | Ga0307413_10000003 | |||
| 1404 | Ga0307413_10112152 | |||
| 1405 | Ga0307410_10000065 | |||
| 1406 | Ga0307406_10000017 | |||
| 1407 | Ga0307407_10000018 | |||
| 1408 | Ga0307407_10004270 | |||
| 1409 | Ga0307407_10361015 | |||
| 1410 | Ga0307412_10000001 | |||
| 1411 | Ga0307412_10000058 | |||
| 1412 | Ga0307412_10000704 | |||
| 1413 | Ga0307412_10000825 | |||
| 1414 | Ga0307412_10025701 | |||
| 1415 | Ga0307412_10084084 | |||
| 1416 | Ga0307412_10110967 | |||
| 1417 | Ga0307412_10139508 | |||
| 1418 | Ga0307412_10332057 | |||
| 1419 | Ga0307412_11112953 | |||
| 1420 | Ga0307412_11310286 | |||
| 1421 | Ga0307409_101027096 | |||
| 1422 | Ga0307416_100000006 | |||
| 1423 | Ga0307416_100000081 | |||
| 1424 | Ga0307416_100000649 | |||
| 1425 | Ga0307416_100020641 | |||
| 1426 | Ga0307414_10000014 | |||
| 1427 | Ga0307414_10000061 | |||
| 1428 | Ga0307414_10000502 | |||
| 1429 | Ga0307414_10000530 | |||
| 1430 | Ga0307414_10000823 | |||
| 1431 | Ga0307414_10002415 | |||
| 1432 | Ga0307414_10007008 | |||
| 1433 | Ga0307414_10010298 | |||
| 1434 | Ga0307414_10011516 | |||
| 1435 | Ga0307414_10031240 | |||
| 1436 | Ga0307414_10032372 | |||
| 1437 | Ga0307414_10048830 | |||
| 1438 | Ga0307414_10107580 | |||
| 1439 | Ga0307414_10119762 | |||
| 1440 | Ga0307414_10123098 | |||
| 1441 | Ga0307414_10123641 | |||
| 1442 | Ga0307414_10130287 | |||
| 1443 | Ga0307414_10157074 | |||
| 1444 | Ga0307414_10444797 | |||
| 1445 | Ga0307414_10470684 | |||
| 1446 | Ga0307414_10700121 | |||
| 1447 | Ga0307414_10866620 | |||
| 1448 | Ga0307414_10983328 | |||
| 1449 | Ga0307411_10000002 | |||
| 1450 | Ga0307411_10137637 | |||
| 1451 | Ga0307411_10234738 | |||
| 1452 | Ga0307415_101012862 | |||
| 1453 | Ga0307507_10000143 | |||
| 1454 | Ga0307510_10000218 | |||
| 1455 | Ga0307510_10031800 | |||
| 1456 | Ga0373955_0930043 | |||
| 1457 | Ga0373942_0157809 | |||
| 1458 | Ga0316574_0190252 | |||
| 1459 | Ga0316574_0369229 | |||
| 1460 | Ga0373931_0493118 | |||
| 1461 | Ga0316584_0506435 | |||
| 1462 | Ga0395899_0000021 | |||
| 1463 | Ga0395899_0000024 | |||
| 1464 | Ga0395899_0000050 | |||
| 1465 | Ga0395899_0000648 | |||
| 1466 | Ga0395899_0045232 | |||
| 1467 | Ga0395899_0500104 | |||
| 1468 | Ga0395900_0000332 | |||
| 1469 | Ga0395900_0002463 | |||
| 1470 | Ga0395900_0015912 | |||
| 1471 | Ga0395900_0023779 | |||
| 1472 | Ga0395900_0067991 | |||
| 1473 | Ga0395900_0081288 | |||
| 1474 | Ga0395898_0020230 | |||
| 1475 | Ga0395898_0271031 | |||
| 1476 | Ga0395905_0000324 | |||
| 1477 | Ga0395905_0001895 | |||
| 1478 | Ga0395905_0005538 | |||
| 1479 | Ga0395901_0001649 | |||
| 1480 | Ga0395901_0003264 | |||
| 1481 | Ga0395901_0344520 | |||
| 1482 | Ga0395901_0488565 | |||
| 1483 | Ga0400483_026801 | |||
| 1484 | Ga0436361_0265633 | |||
| 1485 | Ga0439447_001594 | |||
| 1486 | Ga0439466_0000199 | |||
| 1487 | Ga0451787_246046 | |||
| 1488 | Ga0451791_0178529 | |||
| 1489 | Ga0451795_0544546 | |||
| 1490 | Ga0451802_1750742 | |||
| 1491 | Ga0451806_096330 | |||
| 1492 | Ga0451807_1276579 | |||
| 1493 | Ga0451807_1679596 | |||
| 1494 | Ga0451837_0155400 | |||
| 1495 | Ga0451837_0846889 | |||
| 1496 | Ga0451849_0840633 | |||
| 1497 | Ga0451855_0405943 | |||
| 1498 | Ga0451855_1284336 | |||
| 1499 | Ga0439445_0000824 | |||
| 1500 | Ga0439445_0132131 | |||
| 1501 | Ga0439448_0024447 | |||
| 1502 | Ga0439457_034604 | |||
| 1503 | Ga0450890_021773 | |||
| 1504 | Ga0439434_0126579 | |||
| 1505 | Ga0451577_0001003 | |||
| 1506 | Ga0451577_0004037 | |||
| 1507 | Ga0451577_0010083 | |||
| 1508 | Ga0451577_0086506 | |||
| 1509 | Ga0451577_0096937 | |||
| 1510 | Ga0451577_0128499 | |||
| 1511 | Ga0451577_1436830 | |||
| 1512 | Ga0451577_1728629 | |||
| 1513 | Ga0466969_0116525 | |||
| 1514 | Ga0453683_0000136 | |||
| 1515 | Ga0453683_0003752 | |||
| 1516 | Ga0453683_0012101 | |||
| 1517 | Ga0453683_0763481 | |||
| 1518 | Ga0466966_0148684 | |||
| 1519 | Ga0466961_0073916 | |||
| 1520 | Ga0466963_0182860 | |||
| 1521 | Ga0453684_0000212 | |||
| 1522 | Ga0453684_0002050 | |||
| 1523 | Ga0453684_0002803 | |||
| 1524 | Ga0453684_0004510 | |||
| 1525 | Ga0453684_0006442 | |||
| 1526 | Ga0453684_0039458 | |||
| 1527 | Ga0453684_0044669 | |||
| 1528 | Ga0453684_0050525 | |||
| 1529 | Ga0453684_0121465 | |||
| 1530 | Ga0453684_0215875 | |||
| 1531 | Ga0453684_0304376 | |||
| 1532 | Ga0453684_0519594 | |||
| 1533 | Ga0453684_0599918 | |||
| 1534 | Ga0466959_0330022 | |||
| 1535 | Ga0451576_0000002 | |||
| 1536 | Ga0451576_0001418 | |||
| 1537 | Ga0451576_0005467 | |||
| 1538 | Ga0451576_0010696 | |||
| 1539 | Ga0451576_0012348 | |||
| 1540 | Ga0451576_0065240 | |||
| 1541 | Ga0451576_0066127 | |||
| 1542 | Ga0451576_0085869 | |||
| 1543 | Ga0451576_0135118 | |||
| 1544 | Ga0451576_1425923 | |||
| 1545 | Ga0466958_0044615 | |||
| 1546 | Ga0495627_000012 | |||
| 1547 | Ga0495627_001456 | |||
| 1548 | Ga0495627_001699 | |||
| 1549 | Ga0495629_0302207 | |||
| 1550 | Ga0495638_0047103 | |||
| 1551 | Ga0495638_0321347 | |||
| 1552 | Ga0495651_0917125 | |||
| 1553 | Ga0495650_0000225 | |||
| 1554 | Ga0495650_0042487 | |||
| 1555 | Ga0495662_0266523 | |||
| 1556 | Ga0495585_0000074 | |||
| 1557 | Ga0495585_0000459 | |||
| 1558 | Ga0495585_0382853 | |||
| 1559 | Ga0495596_0013858 | |||
| 1560 | Ga0495596_0036677 | |||
| 1561 | Ga0495607_0035026 | |||
| 1562 | Ga0495583_0090456 | |||
| 1563 | Ga0495583_0229397 | |||
| 1564 | Ga0495606_0000074 | |||
| 1565 | Ga0495606_0002257 | |||
| 1566 | Ga0495606_0005508 | |||
| 1567 | Ga0495606_0007729 | |||
| 1568 | Ga0495606_0035769 | |||
| 1569 | Ga0495606_0082552 | |||
| 1570 | Ga0495606_0188445 | |||
| 1571 | Ga0495606_0487361 | |||
| 1572 | Ga0495610_0000005 | |||
| 1573 | Ga0495610_0000037 | |||
| 1574 | Ga0495610_0000574 | |||
| 1575 | Ga0495616_0003462 | |||
| 1576 | Ga0495616_0023014 | |||
| 1577 | Ga0495628_1127723 | |||
| 1578 | Ga0495628_1209598 | |||
| 1579 | Ga0495631_0004748 | |||
| 1580 | Ga0495631_0329036 | |||
| 1581 | Ga0495632_0002479 | |||
| 1582 | Ga0495632_0033917 | |||
| 1583 | Ga0495637_0020106 | |||
| 1584 | Ga0495637_0059294 | |||
| 1585 | Ga0495643_0000316 | |||
| 1586 | Ga0495643_0014191 | |||
| 1587 | Ga0495643_0049655 | |||
| 1588 | Ga0495643_0167404 | |||
| 1589 | Ga0495648_0001585 | |||
| 1590 | Ga0495663_0019918 | |||
| 1591 | Ga0495654_0118142 | |||
| 1592 | Ga0495654_0278180 | |||
| 1593 | Ga0495586_0308905 | |||
| 1594 | Ga0495609_0000003 | |||
| 1595 | Ga0495609_0001203 | |||
| 1596 | Ga0495622_0051975 | |||
| 1597 | Ga0495633_0000001 | |||
| 1598 | Ga0495633_0000004 | |||
| 1599 | Ga0495633_0012522 | |||
| 1600 | Ga0495633_0026871 | |||
| 1601 | Ga0495633_0060180 | |||
| 1602 | Ga0495633_0153487 | |||
| 1603 | Ga0495633_0332068 | |||
| 1604 | Ga0495668_0000121 | |||
| 1605 | Ga0495668_0139848 | |||
| 1606 | Ga0495634_0071997 | |||
| 1607 | Ga0495625_0000040 | |||
| 1608 | Ga0495625_0000067 | |||
| 1609 | Ga0495625_0001612 | |||
| 1610 | Ga0495625_0001746 | |||
| 1611 | Ga0495625_0174707 | |||
| 1612 | Ga0495625_0377831 | |||
| 1613 | Ga0495661_0004327 | |||
| 1614 | Ga0495661_0209943 | |||
| 1615 | Ga0495599_0584929 | |||
| 1616 | Ga0495658_0068117 | |||
| 1617 | Ga0495613_0432404 | |||
| 1618 | Ga0495670_0505564 | |||
| 1619 | Ga0495671_0043184 | |||
| 1620 | Ga0495649_0000054 | |||
| 1621 | Ga0495649_0162829 | |||
| 1622 | Ga0495589_0073307 | |||
| 1623 | Ga0495660_0033687 | |||
| 1624 | Ga0495660_0046383 | |||
| 1625 | Ga0495672_0223843 | |||
| 1626 | Ga0495683_0021341 | |||
| 1627 | Ga0495683_0160689 | |||
| 1628 | Ga0495687_002058 | |||
| 1629 | Ga0495687_002279 | |||
| 1630 | Ga0495685_103521 | |||
| 1631 | Ga0495673_0013544 | |||
| 1632 | Ga0495686_0000243 | |||
| 1633 | Ga0495686_0001285 | |||
| 1634 | Ga0495686_0006338 | |||
| 1635 | Ga0495686_0078829 | |||
| 1636 | Ga0495686_0160223 | |||
| 1637 | Ga0496102_0018298 | |||
| 1638 | Ga0496103_0043967 | |||
| 1639 | Ga0496105_0439126 | |||
| 1640 | Ga0496113_0561486 | |||
| 1641 | Ga0496115_0040497 | |||
| 1642 | Ga0496115_0131137 | |||
| 1643 | Ga0496115_0241709 | |||
| 1644 | Ga0496115_0827685 | |||
| 1645 | Ga0496116_0000002 | |||
| 1646 | Ga0496116_0000029 | |||
| 1647 | Ga0496116_0002509 | |||
| 1648 | Ga0496117_0000007 | |||
| 1649 | Ga0496117_0022926 | |||
| 1650 | Ga0496118_0000418 | |||
| 1651 | Ga0496118_0145289 | |||
| 1652 | Ga0496118_0154779 | |||
| 1653 | Ga0496118_0182334 | |||
| 1654 | Ga0496119_0000007 | |||
| 1655 | Ga0496121_0029474 | |||
| 1656 | Ga0496121_0259159 | |||
| 1657 | Ga0496121_0536996 | |||
| 1658 | Ga0496122_0000089 | |||
| 1659 | Ga0496122_0000151 | |||
| 1660 | Ga0496122_0000153 | |||
| 1661 | Ga0496122_0000668 | |||
| 1662 | Ga0496122_0003324 | |||
| 1663 | Ga0496122_0007777 | |||
| 1664 | Ga0496123_0001537 | |||
| 1665 | Ga0496123_0002751 | |||
| 1666 | Ga0496123_0008187 | |||
| 1667 | Ga0496123_0015155 | |||
| 1668 | Ga0496123_0019968 | |||
| 1669 | Ga0496123_0168752 | |||
| 1670 | Ga0496123_0193897 | |||
| 1671 | Ga0496124_0005848 | |||
| 1672 | Ga0496124_0011820 | |||
| 1673 | Ga0496124_0296594 | |||
| 1674 | Ga0496125_0000007 | |||
| 1675 | Ga0496125_0000024 | |||
| 1676 | Ga0496125_0002520 | |||
| 1677 | Ga0496125_0014776 | |||
| 1678 | Ga0496125_0028703 | |||
| 1679 | Ga0496125_0187666 | |||
| 1680 | Ga0496125_0373304 | |||
| 1681 | Ga0496126_0002742 | |||
| 1682 | Ga0496126_0007250 | |||
| 1683 | Ga0496126_0052166 | |||
| 1684 | Ga0496126_0125100 | |||
| 1685 | Ga0501031_0238339 | |||
| 1686 | Ga0501032_0002030 | |||
| 1687 | Ga0501033_0000004 | |||
| 1688 | Ga0501033_0127844 | |||
| 1689 | Ga0501034_0001804 | |||
| 1690 | Ga0501034_0010067 | |||
| 1691 | Ga0501034_0323280 | |||
| 1692 | Ga0501036_0018837 | |||
| 1693 | Ga0501036_0248629 | |||
| 1694 | Ga0501037_0042694 | |||
| 1695 | Ga0501038_0001517 | |||
| 1696 | Ga0501038_0013295 | |||
| 1697 | Ga0501039_0001415 | |||
| 1698 | Ga0501043_0001976 | |||
| 1699 | Ga0501047_0117416 | |||
| 1700 | Ga0501070_0090138 | |||
| 1701 | Ga0501199_041460 | |||
| 1702 | Ga0501223_020965 | |||
| 1703 | Ga0501223_028693 | |||
| 1704 | Ga0501238_000108 | |||
| 1705 | Ga0501238_027363 | |||
| 1706 | Ga0501240_002416 | |||
| 1707 | Ga0501249_000026 | |||
| 1708 | Ga0501249_000534 | |||
| 1709 | Ga0501249_027083 | |||
| 1710 | Ga0501241_000001 | |||
| 1711 | Ga0501241_001155 | |||
| 1712 | Ga0501241_005329 | |||
| 1713 | Ga0501266_000001 | |||
| 1714 | Ga0501269_000002 | |||
| 1715 | Ga0501269_008191 | |||
| 1716 | Ga0501280_000279 | |||
| 1717 | Ga0501280_007847 | |||
| 1718 | Ga0501035_0002702 | |||
| 1719 | Ga0501035_0889397 | |||
| 1720 | Ga0501044_0002271 | |||
| 1721 | Ga0501045_0000002 | |||
| 1722 | nmdc:mga00v17_304879_c1 | |||
| 1723 | nmdc:mga0k408_167_c1 | |||
| 1724 | nmdc:mga0k408_54518_c1 | |||
| 1725 | nmdc:mga0k408_626_c1 | |||
| 1726 | nmdc:mga07m45_161635_c1 | |||
| 1727 | nmdc:mga07m45_391139_c1 | |||
| 1728 | Ga0500635_0000533 | |||
| 1729 | Ga0500635_0003110 | |||
| 1730 | Ga0500646_0049739 | |||
| 1731 | Ga0500647_0108448 | |||
| 1732 | Ga0500641_0000015 | |||
| 1733 | Ga0500641_0000058 | |||
| 1734 | Ga0500641_0000620 | |||
| 1735 | Ga0500594_0055627 | |||
| 1736 | Ga0500608_008141 | |||
| 1737 | Ga0500614_242301 | |||
| 1738 | Ga0500618_029208 | |||
| 1739 | Ga0500642_0099938 | |||
| 1740 | Ga0500658_0000001 | |||
| 1741 | Ga0500559_0032450 | |||
| 1742 | Ga0500564_061994 | |||
| 1743 | Ga0500568_0271195 | |||
| 1744 | Ga0500573_0189197 | |||
| 1745 | Ga0500590_352728 | |||
| 1746 | Ga0500622_0064325 | |||
| 1747 | Ga0500622_0072749 | |||
| 1748 | Ga0500584_080778 | |||
| 1749 | 2513233033 | |||
| 1750 | 2520880935 | |||
| 1751 | 2522549277 | |||
| 1752 | 2586207187 | |||
| 1753 | 2599480000 | |||
| 1754 | 2644012473 | |||
| 1755 | 2644371723 | |||
| 1756 | 2644640935 | |||
| 1757 | 2644684385 | |||
| 1758 | 2722726222 | |||
| 1759 | 2738735018 | |||
| 1760 | 2738755859 | |||
| 1761 | 2738761475 | |||
| 1762 | 2738769258 | |||
| 1763 | 2738852505 | |||
| 1764 | 2739216600 | |||
| 1765 | 2739303013 | |||
| 1766 | 2739591382 | |||
| 1767 | 2739614739 | |||
| 1768 | 2739646108 | |||
| 1769 | 2739999886 | |||
| 1770 | 2740004702 | |||
| 1771 | 2776615892 | |||
| 1772 | 2802651719 | |||
| 1773 | 2817414591 | |||
| 1774 | 2819549636 | |||
| 1775 | 2833642025 | |||
| 1776 | 2842727391 | |||
| 1777 | 2842905460 | |||
| 1778 | 2842913787 | |||
| 1779 | 2849285385 | |||
| 1780 | 2852626182 | |||
| 1781 | 2852628096 | |||
| 1782 | 2857615424 | |||
| 1783 | 2857622164 | |||
| 1784 | 2857631981 | |||
| 1785 | 2881250537 | |||
| 1786 | 2881363925 | |||
| 1787 | 2884635929 | |||
| 1788 | 2884935278 | |||
| 1789 | 2890739265 | |||
| 1790 | 2896345575 | |||
| 1791 | 2898716816 | |||
| 1792 | 2902050453 | |||
| 1793 | 2903895673 | |||
| 1794 | 2904422622 | |||
| 1795 | 2904447237 | |||
| 1796 | 2904558240 | |||
| 1797 | 2904782831 | |||
| 1798 | 2910246116 | |||
| 1799 | 2911139757 | |||
| 1800 | 2919180442 | |||
| 1801 | 2919188458 | |||
| 1802 | 2919192888 | |||
| 1803 | 2919510647 | |||
| 1804 | 2919683726 | |||
| 1805 | 2919693539 | |||
| 1806 | 2928081131 | |||
| 1807 | 2928152448 | |||
| 1808 | 2929151740 | |||
| 1809 | 2932087781 | |||
| 1810 | 2939667457 | |||
| 1811 | 2945998294 | |||
| 1812 | 2954020753 | |||
| 1813 | 2958460024 | |||
| 1814 | 2958513282 | |||
| 1815 | 2965322681 | |||
| 1816 | 2977234814 | |||
| 1817 | 2977268463 | |||
| 1818 | 2993482182 | |||
| 1819 | 8054309040 | |||
| 1820 | 8055419629 | |||
| 1821 | 8055595890 | |||
| 1822 | 8056443152 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5jfy-assembly2.cif.gz_D | crystal structure of a plant cytidine deaminase | 0.9523 | 7 | 104 |
| 2nx8-assembly1.cif.gz_A-2 | the crystal structure of the trna-specific adenosine deaminase from streptococcus pyogenes | 0.9497 | 8 | 146 |
| 2b3j-assembly2.cif.gz_D | crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna | 0.9492 | 6 | 146 |
| 1tiy-assembly1.cif.gz_A | x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160 | 0.9465 | 8 | 106 |
| 7cph-assembly1.cif.gz_A | crystal structure of trna adenosine deaminase from bacillus subtilis | 0.9451 | 6 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4IDF5_228_326_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.954 | 29 | 42 | 2.60.40.10 |
| 2nx8A00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9497 | 8 | 146 | 3.40.140.10 |
| 2b3jA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9492 | 7 | 146 | 3.40.140.10 |
| 1wwrD00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9472 | 6 | 146 | 3.40.140.10 |
| af_K7K815_1119_1301_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9431 | 7 | 146 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H9CGG6-F1-model_v4 | tRNA-specific adenosine deaminase (EC 3.5.4.33) | 0.9999 | 12 | 145 |
GO:0002100
GO:0008270 GO:0052717 |
| AF-A0A2N9P8B9-F1-model_v4 | tRNA-specific adenosine deaminase (EC 3.5.4.33) | 0.9989 | 1 | 146 |
GO:0002100
GO:0008270 GO:0052717 |
| AF-A0A519RGC0-F1-model_v4 | tRNA(adenine(34)) deaminase (EC 3.5.4.33) | 0.9989 | 1 | 123 |
GO:0002100
GO:0008270 GO:0052717 |
| AF-A0A3C0GEJ9-F1-model_v4 | tRNA(adenine(34)) deaminase (EC 3.5.4.33) | 0.9987 | 27 | 147 |
GO:0002100
GO:0008270 GO:0052717 |
| AF-A0A6V6YTL8-F1-model_v4 | tRNA-specific adenosine deaminase (EC 3.5.4.33) | 0.9974 | 1 | 147 |
GO:0002100
GO:0008270 GO:0052717 |