F485463

General Info

Members Datasets Scaffolds Average Seq Length
911 399 1822 152

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10123310|Ga0163163_101233103
Length 175
Sequence MNDFDANLKELFQIKQVFNHPNKYFCTMNLLNLNDEYFMREALKEAKKAFDADEVPIGAVIVCKDKIIARAHNLTERLNDVTAHAEMQAFTSAANFLGGKYLEECALYVTIEPCVMCAGASYWAQIGKIIFGARDEKKGFLLTSKKILHPKTVLKSGVLEEECVILMKEFFKKKR

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
151 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
159 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
160 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
161 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
202 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
203 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
204 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
205 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
208 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
209 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
210 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
213 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
237 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
295 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
296 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
297 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
298 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
299 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
300 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
301 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
302 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
309 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
310 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
311 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
314 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
315 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
316 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
317 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
318 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
321 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
322 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
323 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
326 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
327 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
328 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
329 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
330 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
331 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
332 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
333 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
334 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
335 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
336 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
337 2738541283 Pedobacter sp. OK701 Isolate Unclassified
338 2738541284 Pedobacter sp. YR016 Isolate Unclassified
339 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
340 2738541302 Pedobacter sp. CF074 Isolate Unclassified
341 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
342 2738543023 Pedobacter sp. OK628 Isolate Unclassified
343 2739367651 Pedobacter sp. OK291 Isolate Unclassified
344 2739367656 Pedobacter sp. CF523 Isolate Unclassified
345 2739367663 Pedobacter sp. YR510 Isolate Unclassified
346 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
347 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
348 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
349 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
350 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
351 2818991437 Pedobacter terrae 518 Isolate Unclassified
352 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
353 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
354 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
355 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
356 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
357 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
358 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
359 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
360 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
361 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
362 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
363 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
364 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
365 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
366 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
367 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
368 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
369 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
370 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
371 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
372 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
373 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
374 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
375 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
376 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
377 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
378 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
379 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
380 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
381 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
382 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
383 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
384 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
385 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
386 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
387 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
388 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
389 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
390 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
391 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
392 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
393 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
394 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
395 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
396 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
397 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
398 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
399 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.88
Metatranscriptomes 0
Isolates 8.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 0.44
Rhizoplane 1.76
Rhizosphere 78.81
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10123310 3300014325 Bacteria 2627
2 SwRhRL2b_contig_1426845 2162886007 Bacteria 1125
3 SwRhRL2b_contig_2141802 2162886007 Bacteria 1526
4 SwRhRL2b_contig_2234511 2162886007 Bacteria 9507
5 SwRhRL2b_contig_2737985 2162886007 Bacteria 1957
6 SwRhRL2b_contig_3209656 2162886007 Bacteria 934
7 JGI24736J21556_1005426 3300001904 Bacteria 2153
8 JGI24736J21556_1005446 3300001904 Bacteria 2149
9 JGI24740J21852_10009887 3300001979 Bacteria 3706
10 JGI24740J21852_10032120 3300001979 Bacteria 1683
11 JGI24740J21852_10121227 3300001979 Bacteria 655
12 JGI24739J22299_10002365 3300001989 Bacteria 7265
13 JGI24737J22298_10000496 3300001990 Bacteria 13684
14 JGI24737J22298_10009284 3300001990 Bacteria 3277
15 JGI24735J21928_10000005 3300002067 Bacteria 356755
16 JGI24735J21928_10024511 3300002067 Bacteria 1825
17 JGI25162J39368_1001793 3300002737 Bacteria 10128
18 JGI25157J39369_1006041 3300002741 Bacteria 1893
19 JGI25164J39214_1003256 3300002772 Bacteria 2124
20 JGI25152J39213_1000080 3300002773 Bacteria 65432
21 JGI25150J39212_1000003 3300002774 Bacteria 508651
22 JGI25150J39212_1000004 3300002774 Bacteria 417320
23 JGI25151J46595_10000002 3300003187 Bacteria 731381
24 JGI25165J46597_1003249 3300003214 Bacteria 4215
25 JGI25153J46596_10000015 3300003215 Bacteria 289820
26 rootH1_10018738 3300003316 Bacteria 15789
27 rootH2_10000823 3300003320 Bacteria 101452
28 rootH2_10166669 3300003320 Unclassified 1153
29 rootH2_10213711 3300003320 Bacteria 1508
30 rootH2_10293539 3300003320 Bacteria 2432
31 rootL2_10000170 3300003322 Bacteria 13923
32 rootL2_10086321 3300003322 Bacteria 10746
33 rootL2_10125855 3300003322 Bacteria 2542
34 rootL2_10211502 3300003322 Bacteria 2285
35 rootL2_10239455 3300003322 Bacteria 3059
36 rootL2_10282583 3300003322 Bacteria 1700
37 rootL2_10282620 3300003322 Unclassified 1678
38 rootH1_10010138 3300003323 Bacteria 25280
39 rootH1_10130033 3300003323 Bacteria 6041
40 rootH1_10141868 3300003323 Bacteria 8019
41 rootH1_10205903 3300003323 Bacteria 1901
42 rootH1_10250537 3300003323 Bacteria 1411
43 Ga0055536_1000002 3300003781 Bacteria 605605
44 Ga0055536_1006887 3300003781 Bacteria 5188
45 Ga0055530_10004135 3300003791 Bacteria 7681
46 Ga0065165_1000478 3300005262 Bacteria 62182
47 Ga0065714_10002231 3300005288 Bacteria 44866
48 Ga0065714_10002386 3300005288 Bacteria 21249
49 Ga0065714_10003833 3300005288 Bacteria 5996
50 Ga0065714_10018627 3300005288 Bacteria 2049
51 Ga0065714_10068450 3300005288 Bacteria 4718
52 Ga0065714_10071057 3300005288 Bacteria 3685
53 Ga0065714_10085785 3300005288 Bacteria 2119
54 Ga0065714_10097380 3300005288 Bacteria 1737
55 Ga0065714_10110637 3300005288 Bacteria 1482
56 Ga0065714_10128983 3300005288 Bacteria 1261
57 Ga0065714_10180754 3300005288 Bacteria 964
58 Ga0065714_10234935 3300005288 Bacteria 808
59 Ga0065714_10260939 3300005288 Bacteria 757
60 Ga0065704_10002049 3300005289 Bacteria 7346
61 Ga0065704_10037325 3300005289 Bacteria 795
62 Ga0065704_10070374 3300005289 Bacteria 28734
63 Ga0065704_10073302 3300005289 Bacteria 7332
64 Ga0065704_10076064 3300005289 Bacteria 5281
65 Ga0065704_10077903 3300005289 Bacteria 4587
66 Ga0065704_10078968 3300005289 Bacteria 4290
67 Ga0065704_10090520 3300005289 Bacteria 2780
68 Ga0065704_10092841 3300005289 Bacteria 2631
69 Ga0065704_10098036 3300005289 Bacteria 2368
70 Ga0065704_10111747 3300005289 Bacteria 1918
71 Ga0065704_10121604 3300005289 Bacteria 1763
72 Ga0065704_10416260 3300005289 Bacteria 736
73 Ga0065715_10094915 3300005293 Bacteria 4212
74 Ga0065715_10189695 3300005293 Bacteria 1423
75 Ga0065715_10406989 3300005293 Bacteria 843
76 Ga0065715_10475229 3300005293 Bacteria 802
77 Ga0070658_10000016 3300005327 Bacteria 228551
78 Ga0070658_10401077 3300005327 Bacteria 1178
79 Ga0070676_10003779 3300005328 Bacteria 7940
80 Ga0070683_100002723 3300005329 Bacteria 14112
81 Ga0070680_100011953 3300005336 Bacteria 6737
82 Ga0070682_100000065 3300005337 Bacteria 100147
83 Ga0070682_100372120 3300005337 Bacteria 1072
84 Ga0068868_100173252 3300005338 Bacteria 1787
85 Ga0068868_100217025 3300005338 Bacteria 1600
86 Ga0070660_100043623 3300005339 Bacteria 3428
87 Ga0070660_100074805 3300005339 Bacteria 2651
88 Ga0070660_100323059 3300005339 Bacteria 1268
89 Ga0070668_100006243 3300005347 Bacteria 8827
90 Ga0070668_100040617 3300005347 Bacteria 3560
91 Ga0070673_100018134 3300005364 Bacteria 5024
92 Ga0070659_100000391 3300005366 Bacteria 33281
93 Ga0070659_100006520 3300005366 Bacteria 8429
94 Ga0070663_100030640 3300005455 Bacteria 3689
95 Ga0070678_100008126 3300005456 Bacteria 6269
96 Ga0070678_100421701 3300005456 Bacteria 1163
97 Ga0070662_100000026 3300005457 Bacteria 83930
98 Ga0070681_10004335 3300005458 Bacteria 13482
99 Ga0068867_100000879 3300005459 Bacteria 20304
100 Ga0070685_10046821 3300005466 Bacteria 2484
101 Ga0070679_100007384 3300005530 Bacteria 10271
102 Ga0070679_100116775 3300005530 Bacteria 2653
103 Ga0070684_100002108 3300005535 Bacteria 14651
104 Ga0068853_100009639 3300005539 Bacteria 7784
105 Ga0068853_100212349 3300005539 Bacteria 1764
106 Ga0068853_100221785 3300005539 Bacteria 1727
107 Ga0068853_100417747 3300005539 Bacteria 1257
108 Ga0070672_100167388 3300005543 Bacteria 1826
109 Ga0070665_100000012 3300005548 Bacteria 508937
110 Ga0068855_100000160 3300005563 Bacteria 86118
111 Ga0068855_100000967 3300005563 Bacteria 35748
112 Ga0068855_100155254 3300005563 Bacteria 2601
113 Ga0068855_100164427 3300005563 Bacteria 2516
114 Ga0068855_100172468 3300005563 Bacteria 2449
115 Ga0068855_100176926 3300005563 Bacteria 2414
116 Ga0068855_100573048 3300005563 Bacteria 1220
117 Ga0068855_100972981 3300005563 Unclassified 893
118 Ga0068857_100026580 3300005577 Bacteria 5102
119 Ga0068857_101021686 3300005577 Unclassified 796
120 Ga0068856_100000006 3300005614 Bacteria 223827
121 Ga0068856_100010882 3300005614 Bacteria 8830
122 Ga0068856_100027080 3300005614 Bacteria 5592
123 Ga0068856_100066696 3300005614 Bacteria 3556
124 Ga0068856_100153239 3300005614 Bacteria 2314
125 Ga0068856_100686779 3300005614 Bacteria 1044
126 Ga0068852_100000584 3300005616 Bacteria 24024
127 Ga0068852_100160435 3300005616 Bacteria 2099
128 Ga0075364_10429002 3300006051 Bacteria 903
129 Ga0070716_100123943 3300006173 Unclassified 1622
130 Ga0075362_10304524 3300006177 Bacteria 791
131 Ga0075366_10000228 3300006195 Bacteria 24971
132 Ga0075366_10018920 3300006195 Bacteria 3981
133 Ga0097621_100000069 3300006237 Bacteria 52830
134 Ga0097621_100591459 3300006237 Bacteria 1013
135 Ga0097621_100681344 3300006237 Bacteria 945
136 Ga0097621_101112304 3300006237 Bacteria 742
137 Ga0075370_10704159 3300006353 Bacteria 614
138 Ga0068871_100001572 3300006358 Bacteria 15344
139 Ga0068865_100000098 3300006881 Bacteria 45185
140 Ga0099824_1000108 3300006942 Bacteria 66974
141 Ga0079104_1000028 3300006946 Bacteria 208540
142 Ga0099826_10006584 3300006948 Bacteria 8478
143 Ga0105251_10244344 3300009011 Bacteria 808
144 Ga0105244_10000005 3300009036 Bacteria 481412
145 Ga0105244_10000059 3300009036 Bacteria 127470
146 Ga0105244_10031705 3300009036 Bacteria 2804
147 Ga0105244_10097076 3300009036 Bacteria 1445
148 Ga0105250_10007666 3300009092 Bacteria 4625
149 Ga0105240_10007861 3300009093 Bacteria 15391
150 Ga0105240_10057931 3300009093 Bacteria 4837
151 Ga0105240_10068070 3300009093 Bacteria 4411
152 Ga0105240_10072715 3300009093 Bacteria 4249
153 Ga0105240_10073488 3300009093 Bacteria 4222
154 Ga0105240_10151227 3300009093 Bacteria 2764
155 Ga0105240_10158414 3300009093 Bacteria 2691
156 Ga0105240_10174075 3300009093 Bacteria 2546
157 Ga0105240_10282640 3300009093 Bacteria 1905
158 Ga0105240_10658903 3300009093 Bacteria 1146
159 Ga0105240_10839908 3300009093 Bacteria 992
160 Ga0105240_12442084 3300009093 Bacteria 541
161 Ga0105245_10119486 3300009098 Bacteria 2461
162 Ga0105245_10659558 3300009098 Bacteria 1077
163 Ga0105247_10251266 3300009101 Bacteria 1209
164 Ga0105243_10000009 3300009148 Bacteria 354419
165 Ga0105243_10000021 3300009148 Bacteria 213782
166 Ga0105243_10049802 3300009148 Bacteria 3306
167 Ga0105243_11981475 3300009148 Bacteria 616
168 Ga0105241_10000693 3300009174 Bacteria 25405
169 Ga0105241_10033174 3300009174 Bacteria 3875
170 Ga0105241_10051932 3300009174 Bacteria 3128
171 Ga0105241_10084819 3300009174 Bacteria 2488
172 Ga0105241_10144455 3300009174 Bacteria 1941
173 Ga0105241_10383099 3300009174 Bacteria 1229
174 Ga0105241_10544132 3300009174 Bacteria 1041
175 Ga0105242_10018006 3300009176 Bacteria 5517
176 Ga0105242_11429575 3300009176 Bacteria 720
177 Ga0105242_11731069 3300009176 Bacteria 662
178 Ga0105237_10000354 3300009545 Bacteria 64712
179 Ga0105237_10000429 3300009545 Bacteria 59643
180 Ga0105237_10000753 3300009545 Bacteria 44372
181 Ga0105237_10001433 3300009545 Bacteria 31542
182 Ga0105237_10035290 3300009545 Bacteria 5060
183 Ga0105237_10205712 3300009545 Bacteria 1969
184 Ga0105237_10326070 3300009545 Bacteria 1539
185 Ga0105238_10001430 3300009551 Bacteria 23940
186 Ga0105238_10038622 3300009551 Bacteria 4847
187 Ga0105238_10237198 3300009551 Bacteria 1801
188 Ga0105238_10560111 3300009551 Unclassified 1148
189 Ga0105239_10000015 3300010375 Bacteria 319892
190 Ga0105239_10000069 3300010375 Bacteria 144493
191 Ga0105239_10001827 3300010375 Bacteria 27874
192 Ga0105239_10008812 3300010375 Bacteria 11416
193 Ga0105239_10060393 3300010375 Bacteria 4161
194 Ga0105239_10099630 3300010375 Bacteria 3213
195 Ga0105239_10359206 3300010375 Bacteria 1645
196 Ga0105239_10363932 3300010375 Bacteria 1634
197 Ga0105239_10557742 3300010375 Bacteria 1305
198 Ga0105239_11417665 3300010375 Bacteria 802
199 Ga0105239_12202967 3300010375 Bacteria 641
200 Ga0105246_10803668 3300011119 Bacteria 835
201 Ga0157373_10000003 3300013100 Bacteria 454601
202 Ga0157373_10000065 3300013100 Bacteria 93292
203 Ga0157373_10000254 3300013100 Bacteria 43477
204 Ga0157373_10000936 3300013100 Bacteria 22553
205 Ga0157373_10008808 3300013100 Bacteria 7476
206 Ga0157373_10010688 3300013100 Bacteria 6751
207 Ga0157373_10134944 3300013100 Bacteria 1735
208 Ga0157373_10153715 3300013100 Bacteria 1619
209 Ga0157373_10561796 3300013100 Bacteria 828
210 Ga0157373_10590034 3300013100 Bacteria 808
211 Ga0157371_10000025 3300013102 Bacteria 279746
212 Ga0157371_10000229 3300013102 Bacteria 81458
213 Ga0157371_10000904 3300013102 Bacteria 33397
214 Ga0157371_10005051 3300013102 Bacteria 11280
215 Ga0157371_10006606 3300013102 Bacteria 9526
216 Ga0157371_10007352 3300013102 Bacteria 8929
217 Ga0157371_10024946 3300013102 Bacteria 4363
218 Ga0157371_10048837 3300013102 Bacteria 3008
219 Ga0157371_10058894 3300013102 Bacteria 2724
220 Ga0157371_10114437 3300013102 Bacteria 1916
221 Ga0157371_10647748 3300013102 Bacteria 788
222 Ga0157371_10689570 3300013102 Bacteria 764
223 Ga0157370_10001039 3300013104 Bacteria 34915
224 Ga0157370_10001545 3300013104 Bacteria 28488
225 Ga0157370_10001670 3300013104 Bacteria 27339
226 Ga0157370_10002687 3300013104 Bacteria 21317
227 Ga0157370_10005342 3300013104 Bacteria 14431
228 Ga0157370_10008063 3300013104 Bacteria 11405
229 Ga0157370_10009163 3300013104 Bacteria 10611
230 Ga0157370_10014803 3300013104 Bacteria 7960
231 Ga0157370_10016593 3300013104 Bacteria 7450
232 Ga0157370_10018605 3300013104 Bacteria 6984
233 Ga0157370_10039970 3300013104 Bacteria 4531
234 Ga0157370_10043395 3300013104 Bacteria 4328
235 Ga0157370_10047507 3300013104 Bacteria 4114
236 Ga0157370_10068889 3300013104 Bacteria 3343
237 Ga0157370_10070331 3300013104 Bacteria 3303
238 Ga0157370_10144272 3300013104 Bacteria 2217
239 Ga0157370_10200144 3300013104 Bacteria 1853
240 Ga0157370_10218154 3300013104 Bacteria 1767
241 Ga0157370_10220805 3300013104 Bacteria 1755
242 Ga0157370_10297945 3300013104 Bacteria 1489
243 Ga0157370_10299675 3300013104 Bacteria 1484
244 Ga0157370_10302736 3300013104 Bacteria 1476
245 Ga0157370_10422938 3300013104 Bacteria 1226
246 Ga0157370_11264259 3300013104 Bacteria 665
247 Ga0157369_10000038 3300013105 Bacteria 189078
248 Ga0157369_10000101 3300013105 Bacteria 118683
249 Ga0157369_10000423 3300013105 Bacteria 56029
250 Ga0157369_10002643 3300013105 Bacteria 21393
251 Ga0157369_10037939 3300013105 Bacteria 5271
252 Ga0157369_10198222 3300013105 Bacteria 2107
253 Ga0157369_10602754 3300013105 Bacteria 1134
254 Ga0157369_10658741 3300013105 Bacteria 1079
255 Ga0157369_10662035 3300013105 Bacteria 1076
256 Ga0157374_10000076 3300013296 Bacteria 97502
257 Ga0157374_10001396 3300013296 Bacteria 20499
258 Ga0157374_10018889 3300013296 Bacteria 6094
259 Ga0157378_10015305 3300013297 Bacteria 6719
260 Ga0157378_10016498 3300013297 Bacteria 6469
261 Ga0157378_10075864 3300013297 Bacteria 3028
262 Ga0157378_10142182 3300013297 Bacteria 2229
263 Ga0157378_10388262 3300013297 Bacteria 1373
264 Ga0163162_10000013 3300013306 Bacteria 275366
265 Ga0163162_10000050 3300013306 Bacteria 120151
266 Ga0163162_10009096 3300013306 Bacteria 9656
267 Ga0163162_10034388 3300013306 Bacteria 5044
268 Ga0163162_10036274 3300013306 Bacteria 4912
269 Ga0163162_10409126 3300013306 Bacteria 1489
270 Ga0157372_10000041 3300013307 Bacteria 158494
271 Ga0157372_10000051 3300013307 Bacteria 136437
272 Ga0157372_10000874 3300013307 Bacteria 32723
273 Ga0157372_10003305 3300013307 Bacteria 17413
274 Ga0157372_10025095 3300013307 Bacteria 6477
275 Ga0157372_10040546 3300013307 Bacteria 5144
276 Ga0157375_10000417 3300013308 Bacteria 38744
277 Ga0157375_10076573 3300013308 Bacteria 3373
278 Ga0157375_10091841 3300013308 Bacteria 3098
279 Ga0157375_10110784 3300013308 Bacteria 2843
280 Ga0157375_10135693 3300013308 Bacteria 2584
281 Ga0157375_10162209 3300013308 Bacteria 2378
282 Ga0157375_10347452 3300013308 Bacteria 1649
283 Ga0157375_10781023 3300013308 Bacteria 1105
284 Ga0157375_10978991 3300013308 Bacteria 986
285 Ga0163163_11044371 3300014325 Bacteria 880
286 Ga0157380_10000022 3300014326 Bacteria 114070
287 Ga0182008_10000005 3300014497 Bacteria 386556
288 Ga0182008_10000025 3300014497 Bacteria 191222
289 Ga0182008_10000052 3300014497 Bacteria 103193
290 Ga0182008_10000058 3300014497 Bacteria 100175
291 Ga0182008_10014892 3300014497 Bacteria 4067
292 Ga0182008_10229604 3300014497 Bacteria 952
293 Ga0182008_10721046 3300014497 Bacteria 571
294 Ga0157377_10418005 3300014745 Bacteria 917
295 Ga0157376_10193333 3300014969 Bacteria 1867
296 Ga0157376_10480276 3300014969 Bacteria 1218
297 Ga0182006_1000127 3300015261 Bacteria 81679
298 Ga0182006_1000645 3300015261 Bacteria 24732
299 Ga0182006_1001592 3300015261 Bacteria 13422
300 Ga0182006_1006423 3300015261 Bacteria 5467
301 Ga0182006_1008199 3300015261 Bacteria 4738
302 Ga0182006_1038255 3300015261 Bacteria 1898
303 Ga0182006_1107532 3300015261 Unclassified 982
304 Ga0182007_10000024 3300015262 Bacteria 181761
305 Ga0182007_10004566 3300015262 Bacteria 6257
306 Ga0182007_10060916 3300015262 Bacteria 1237
307 Ga0182007_10082546 3300015262 Bacteria 1054
308 Ga0183373_1002 3300015682 Bacteria 990153
309 Ga0163161_10000014 3300017792 Bacteria 258440
310 Ga0163161_10000136 3300017792 Bacteria 69043
311 Ga0163161_10000628 3300017792 Bacteria 28142
312 Ga0163161_10000979 3300017792 Bacteria 21853
313 Ga0163161_10005705 3300017792 Bacteria 8630
314 Ga0163161_10008888 3300017792 Bacteria 6945
315 Ga0163161_10019883 3300017792 Bacteria 4710
316 Ga0163161_10065973 3300017792 Bacteria 2642
317 Ga0163161_10093528 3300017792 Bacteria 2228
318 Ga0163161_10158712 3300017792 Bacteria 1724
319 Ga0163161_10197638 3300017792 Bacteria 1548
320 Ga0163161_10252369 3300017792 Bacteria 1375
321 Ga0163161_10412790 3300017792 Bacteria 1085
322 Ga0163161_10420758 3300017792 Bacteria 1075
323 Ga0163161_10422061 3300017792 Bacteria 1073
324 Ga0163161_10573934 3300017792 Bacteria 927
325 Ga0163161_10729285 3300017792 Bacteria 827
326 Ga0163161_11321188 3300017792 Bacteria 627
327 Ga0213872_10019228 3300021361 Bacteria 3146
328 Ga0209563_110589 3300025230 Bacteria 1337
329 Ga0207427_100043 3300025231 Bacteria 249595
330 Ga0209437_100170 3300025233 Bacteria 142489
331 Ga0209437_100190 3300025233 Bacteria 125000
332 Ga0207425_1000003 3300025245 Bacteria 1145342
333 Ga0209026_1000243 3300025250 Bacteria 69921
334 Ga0209026_1004634 3300025250 Bacteria 4001
335 Ga0209129_1000014 3300025258 Bacteria 509018
336 Ga0209129_1018403 3300025258 Bacteria 1342
337 Ga0209233_1000266 3300025261 Bacteria 76176
338 Ga0209233_1001543 3300025261 Bacteria 9031
339 Ga0209233_1009528 3300025261 Bacteria 2950
340 Ga0209455_1002288 3300025272 Bacteria 7539
341 Ga0209675_1000022 3300025291 Bacteria 315280
342 Ga0209676_1000022 3300025292 Bacteria 605659
343 Ga0209676_1000488 3300025292 Bacteria 64408
344 Ga0209025_1000007 3300025294 Bacteria 1145109
345 Ga0209758_1000012 3300025297 Bacteria 949866
346 Ga0209050_1000020 3300025298 Bacteria 605671
347 Ga0207426_1096738 3300025302 Bacteria 770
348 Ga0207696_1008616 3300025711 Bacteria 3877
349 Ga0207655_1000003 3300025728 Bacteria 1081376
350 Ga0207655_1000016 3300025728 Bacteria 551476
351 Ga0207655_1029660 3300025728 Bacteria 2557
352 Ga0207713_1148366 3300025735 Bacteria 759
353 Ga0207713_1161976 3300025735 Bacteria 712
354 Ga0207642_10078191 3300025899 Bacteria 1598
355 Ga0207710_10268630 3300025900 Bacteria 856
356 Ga0207647_10000217 3300025904 Bacteria 47035
357 Ga0207647_10001231 3300025904 Bacteria 19711
358 Ga0207647_10041669 3300025904 Bacteria 2885
359 Ga0207645_10003391 3300025907 Bacteria 12114
360 Ga0207705_10000031 3300025909 Bacteria 228571
361 Ga0207705_10270542 3300025909 Bacteria 1299
362 Ga0207705_10284830 3300025909 Bacteria 1265
363 Ga0207654_10003057 3300025911 Bacteria 8487
364 Ga0207654_10058503 3300025911 Bacteria 2244
365 Ga0207654_10115651 3300025911 Bacteria 1676
366 Ga0207654_10168296 3300025911 Bacteria 1421
367 Ga0207707_10009797 3300025912 Bacteria 8310
368 Ga0207695_10000087 3300025913 Bacteria 276412
369 Ga0207695_10007478 3300025913 Bacteria 13876
370 Ga0207695_10010273 3300025913 Bacteria 11471
371 Ga0207695_10038235 3300025913 Bacteria 5169
372 Ga0207695_10109670 3300025913 Bacteria 2741
373 Ga0207695_10234651 3300025913 Bacteria 1737
374 Ga0207695_10283098 3300025913 Bacteria 1551
375 Ga0207695_10578372 3300025913 Bacteria 1004
376 Ga0207671_10000466 3300025914 Bacteria 55435
377 Ga0207671_10001163 3300025914 Bacteria 31375
378 Ga0207671_10003106 3300025914 Bacteria 16894
379 Ga0207671_10004475 3300025914 Bacteria 13334
380 Ga0207671_10011835 3300025914 Bacteria 7060
381 Ga0207671_10195729 3300025914 Bacteria 1577
382 Ga0207693_10316745 3300025915 Bacteria 1221
383 Ga0207660_10125934 3300025917 Bacteria 1945
384 Ga0207657_10043954 3300025919 Bacteria 3931
385 Ga0207657_10094541 3300025919 Bacteria 2489
386 Ga0207657_10642078 3300025919 Bacteria 827
387 Ga0207652_10007397 3300025921 Bacteria 8855
388 Ga0207652_10297821 3300025921 Bacteria 1456
389 Ga0207681_10299934 3300025923 Bacteria 1271
390 Ga0207694_10043769 3300025924 Bacteria 3456
391 Ga0207694_10048181 3300025924 Bacteria 3297
392 Ga0207694_10174370 3300025924 Bacteria 1742
393 Ga0207687_10073150 3300025927 Bacteria 2453
394 Ga0207644_10001994 3300025931 Bacteria 13217
395 Ga0207690_10000432 3300025932 Bacteria 27269
396 Ga0207690_10019136 3300025932 Bacteria 4209
397 Ga0207706_10000010 3300025933 Bacteria 200039
398 Ga0207686_10111656 3300025934 Bacteria 1845
399 Ga0207686_10611348 3300025934 Bacteria 859
400 Ga0207709_10000026 3300025935 Bacteria 354467
401 Ga0207709_10000281 3300025935 Bacteria 58322
402 Ga0207709_10012162 3300025935 Bacteria 4743
403 Ga0207704_10000334 3300025938 Bacteria 21818
404 Ga0207691_10125785 3300025940 Bacteria 2269
405 Ga0207661_10003479 3300025944 Bacteria 10934
406 Ga0207661_10010032 3300025944 Bacteria 6805
407 Ga0207667_10000033 3300025949 Bacteria 314353
408 Ga0207667_10001021 3300025949 Bacteria 35701
409 Ga0207667_10003221 3300025949 Bacteria 20157
410 Ga0207667_10141964 3300025949 Bacteria 2473
411 Ga0207667_10199641 3300025949 Bacteria 2052
412 Ga0207667_10234194 3300025949 Bacteria 1880
413 Ga0207667_10247530 3300025949 Bacteria 1824
414 Ga0207667_10284586 3300025949 Bacteria 1689
415 Ga0207667_10439863 3300025949 Bacteria 1326
416 Ga0207667_10681425 3300025949 Bacteria 1031
417 Ga0207667_11049400 3300025949 Bacteria 800
418 Ga0207651_10084689 3300025960 Bacteria 2297
419 Ga0207651_11007965 3300025960 Bacteria 744
420 Ga0207668_10012192 3300025972 Bacteria 5254
421 Ga0207668_10162571 3300025972 Bacteria 1741
422 Ga0207640_11248667 3300025981 Unclassified 662
423 Ga0207677_10174179 3300026023 Bacteria 1686
424 Ga0207639_10003841 3300026041 Bacteria 10123
425 Ga0207639_10080303 3300026041 Bacteria 2579
426 Ga0207639_10103364 3300026041 Bacteria 2308
427 Ga0207639_10275815 3300026041 Bacteria 1477
428 Ga0207678_10048526 3300026067 Bacteria 3669
429 Ga0207702_10000023 3300026078 Bacteria 189234
430 Ga0207702_10011730 3300026078 Bacteria 7299
431 Ga0207702_10119355 3300026078 Bacteria 2358
432 Ga0207702_10389976 3300026078 Bacteria 1341
433 Ga0207702_11400959 3300026078 Bacteria 693
434 Ga0207648_10000990 3300026089 Bacteria 32073
435 Ga0207674_10158235 3300026116 Bacteria 2220
436 Ga0207674_10855106 3300026116 Bacteria 877
437 Ga0207674_11582206 3300026116 Unclassified 624
438 Ga0207674_11584921 3300026116 Bacteria 623
439 Ga0207683_10017708 3300026121 Bacteria 6075
440 Ga0207683_10408760 3300026121 Bacteria 1249
441 Ga0207698_10008792 3300026142 Bacteria 6403
442 Ga0207698_10078823 3300026142 Bacteria 2647
443 Ga0207698_10240750 3300026142 Bacteria 1649
444 Ga0209281_1000069 3300027111 Bacteria 279747
445 Ga0209968_1001501 3300027526 Bacteria 3545
446 Ga0210002_1029206 3300027617 Bacteria 912
447 Ga0268266_10000080 3300028379 Bacteria 210179
448 Ga0265337_1026609 3300028556 Unclassified 1751
449 Ga0265326_10060373 3300028558 Bacteria 1072
450 Ga0265334_10030858 3300028573 Bacteria 2144
451 Ga0265322_10014427 3300028654 Bacteria 2283
452 Ga0265336_10084740 3300028666 Bacteria 945
453 Ga0307517_10026222 3300028786 Bacteria 7076
454 Ga0307515_10001558 3300028794 Bacteria 51155
455 Ga0307515_10030051 3300028794 Bacteria 9150
456 Ga0307515_10117183 3300028794 Bacteria 3051
457 Ga0307515_10440460 3300028794 Bacteria 920
458 Ga0307515_10576824 3300028794 Bacteria 735
459 Ga0265338_10480951 3300028800 Bacteria 876
460 Ga0265324_10013449 3300029957 Unclassified 3054
461 Ga0316176_1063745 3300030732 Bacteria 3195
462 Ga0316183_1152562 3300030742 Bacteria 15614
463 Ga0316181_1121975 3300030744 Bacteria 30956
464 Ga0316182_1125350 3300030745 Bacteria 1961
465 Ga0265330_10244326 3300031235 Bacteria 757
466 Ga0265332_10089319 3300031238 Bacteria 1304
467 Ga0265328_10091405 3300031239 Unclassified 1124
468 Ga0265320_10177507 3300031240 Bacteria 955
469 Ga0265329_10096597 3300031242 Bacteria 939
470 Ga0265327_10001390 3300031251 Bacteria 30881
471 Ga0265327_10044490 3300031251 Bacteria 2367
472 Ga0265316_10001519 3300031344 Bacteria 24846
473 Ga0265316_10111949 3300031344 Unclassified 2067
474 Ga0265316_10115655 3300031344 Unclassified 2028
475 Ga0265316_10311458 3300031344 Bacteria 1145
476 Ga0307509_10283860 3300031507 Bacteria 1415
477 Ga0307509_10293734 3300031507 Bacteria 1378
478 Ga0307408_100000164 3300031548 Bacteria 73855
479 Ga0307408_100000310 3300031548 Bacteria 46693
480 Ga0307408_100000448 3300031548 Bacteria 36074
481 Ga0307408_100000583 3300031548 Bacteria 31331
482 Ga0307408_100003314 3300031548 Bacteria 11070
483 Ga0307408_100142791 3300031548 Bacteria 1881
484 Ga0265314_10000031 3300031711 Bacteria 265924
485 Ga0316576_11034229 3300031727 Unclassified 584
486 Ga0307405_10000001 3300031731 Bacteria 1731270
487 Ga0307405_10000011 3300031731 Bacteria 241071
488 Ga0307405_10007180 3300031731 Bacteria 5546
489 Ga0307405_10047027 3300031731 Bacteria 2655
490 Ga0307405_10166489 3300031731 Bacteria 1567
491 Ga0307405_10358810 3300031731 Bacteria 1127
492 Ga0307413_10000003 3300031824 Bacteria 79915
493 Ga0307413_10112152 3300031824 Bacteria 1828
494 Ga0307410_10000065 3300031852 Bacteria 37752
495 Ga0307406_10000017 3300031901 Bacteria 103965
496 Ga0307407_10000018 3300031903 Bacteria 135979
497 Ga0307407_10004270 3300031903 Bacteria 6033
498 Ga0307407_10361015 3300031903 Bacteria 1031
499 Ga0307412_10000001 3300031911 Bacteria 822691
500 Ga0307412_10000058 3300031911 Bacteria 140824
501 Ga0307412_10000704 3300031911 Bacteria 19253
502 Ga0307412_10000825 3300031911 Bacteria 17887
503 Ga0307412_10025701 3300031911 Bacteria 3650
504 Ga0307412_10084084 3300031911 Bacteria 2208
505 Ga0307412_10110967 3300031911 Bacteria 1958
506 Ga0307412_10139508 3300031911 Bacteria 1773
507 Ga0307412_10332057 3300031911 Bacteria 1214
508 Ga0307412_11112953 3300031911 Bacteria 703
509 Ga0307412_11310286 3300031911 Bacteria 652
510 Ga0307409_101027096 3300031995 Bacteria 843
511 Ga0307416_100000006 3300032002 Bacteria 466074
512 Ga0307416_100000081 3300032002 Bacteria 65986
513 Ga0307416_100000649 3300032002 Bacteria 17958
514 Ga0307416_100020641 3300032002 Bacteria 4707
515 Ga0307414_10000014 3300032004 Bacteria 302974
516 Ga0307414_10000061 3300032004 Bacteria 109693
517 Ga0307414_10000502 3300032004 Bacteria 20406
518 Ga0307414_10000530 3300032004 Bacteria 19805
519 Ga0307414_10000823 3300032004 Bacteria 15850
520 Ga0307414_10002415 3300032004 Bacteria 9781
521 Ga0307414_10007008 3300032004 Bacteria 6316
522 Ga0307414_10010298 3300032004 Bacteria 5418
523 Ga0307414_10011516 3300032004 Bacteria 5191
524 Ga0307414_10031240 3300032004 Bacteria 3491
525 Ga0307414_10032372 3300032004 Bacteria 3441
526 Ga0307414_10048830 3300032004 Bacteria 2922
527 Ga0307414_10107580 3300032004 Bacteria 2113
528 Ga0307414_10119762 3300032004 Bacteria 2021
529 Ga0307414_10123098 3300032004 Bacteria 1998
530 Ga0307414_10123641 3300032004 Bacteria 1994
531 Ga0307414_10130287 3300032004 Bacteria 1951
532 Ga0307414_10157074 3300032004 Bacteria 1802
533 Ga0307414_10444797 3300032004 Bacteria 1135
534 Ga0307414_10470684 3300032004 Bacteria 1106
535 Ga0307414_10700121 3300032004 Bacteria 917
536 Ga0307414_10866620 3300032004 Bacteria 826
537 Ga0307414_10983328 3300032004 Bacteria 776
538 Ga0307411_10000002 3300032005 Bacteria 534807
539 Ga0307411_10137637 3300032005 Bacteria 1795
540 Ga0307411_10234738 3300032005 Bacteria 1432
541 Ga0307415_101012862 3300032126 Unclassified 773
542 Ga0307507_10000143 3300033179 Bacteria 124248
543 Ga0307510_10000218 3300033180 Bacteria 51022
544 Ga0307510_10031800 3300033180 Bacteria 5953
545 Ga0373955_0930043 3300035172 Bacteria 535
546 Ga0373942_0157809 3300035207 Bacteria 732
547 Ga0316574_0190252 3300035398 Bacteria 1320
548 Ga0316574_0369229 3300035398 Bacteria 906
549 Ga0373931_0493118 3300035691 Bacteria 789
550 Ga0316584_0506435 3300036712 Bacteria 848
551 Ga0395899_0000021 3300037312 Bacteria 391702
552 Ga0395899_0000024 3300037312 Bacteria 357402
553 Ga0395899_0000050 3300037312 Bacteria 224591
554 Ga0395899_0000648 3300037312 Bacteria 35838
555 Ga0395899_0045232 3300037312 Bacteria 3280
556 Ga0395899_0500104 3300037312 Unclassified 789
557 Ga0395900_0000332 3300037418 Bacteria 69636
558 Ga0395900_0002463 3300037418 Bacteria 20380
559 Ga0395900_0015912 3300037418 Bacteria 7663
560 Ga0395900_0023779 3300037418 Bacteria 6269
561 Ga0395900_0067991 3300037418 Bacteria 3661
562 Ga0395900_0081288 3300037418 Unclassified 3329
563 Ga0395898_0020230 3300037466 Bacteria 6762
564 Ga0395898_0271031 3300037466 Bacteria 1619
565 Ga0395905_0000324 3300037471 Bacteria 68945
566 Ga0395905_0001895 3300037471 Bacteria 24123
567 Ga0395905_0005538 3300037471 Bacteria 12886
568 Ga0395901_0001649 3300038443 Bacteria 23094
569 Ga0395901_0003264 3300038443 Bacteria 16326
570 Ga0395901_0344520 3300038443 Unclassified 1539
571 Ga0395901_0488565 3300038443 Bacteria 1255
572 Ga0400483_026801 3300039062 Bacteria 35196
573 Ga0436361_0265633 3300039447 Bacteria 11560
574 Ga0439447_001594 3300041407 Bacteria 8302
575 Ga0439466_0000199 3300041411 Bacteria 23744
576 Ga0451787_246046 3300041441 Bacteria 754
577 Ga0451791_0178529 3300041451 Bacteria 1025
578 Ga0451795_0544546 3300041456 Bacteria 504
579 Ga0451802_1750742 3300041460 Bacteria 763
580 Ga0451806_096330 3300041462 Bacteria 796
581 Ga0451807_1276579 3300041486 Bacteria 1105
582 Ga0451807_1679596 3300041486 Bacteria 556
583 Ga0451837_0155400 3300041494 Bacteria 586
584 Ga0451837_0846889 3300041494 Bacteria 2043
585 Ga0451849_0840633 3300041505 Bacteria 640
586 Ga0451855_0405943 3300041511 Bacteria 2640
587 Ga0451855_1284336 3300041511 Bacteria 1408
588 Ga0439445_0000824 3300042004 Bacteria 6544
589 Ga0439445_0132131 3300042004 Bacteria 721
590 Ga0439448_0024447 3300042005 Bacteria 1889
591 Ga0439457_034604 3300042014 Bacteria 1123
592 Ga0450890_021773 3300042127 Bacteria 874
593 Ga0439434_0126579 3300042435 Bacteria 836
594 Ga0451577_0001003 3300042876 Bacteria 41074
595 Ga0451577_0004037 3300042876 Bacteria 15781
596 Ga0451577_0010083 3300042876 Bacteria 9053
597 Ga0451577_0086506 3300042876 Bacteria 2796
598 Ga0451577_0096937 3300042876 Unclassified 2633
599 Ga0451577_0128499 3300042876 Bacteria 2272
600 Ga0451577_1436830 3300042876 Bacteria 611
601 Ga0451577_1728629 3300042876 Bacteria 550
602 Ga0466969_0116525 3300044656 Bacteria 1246
603 Ga0453683_0000136 3300044673 Bacteria 107540
604 Ga0453683_0003752 3300044673 Bacteria 11084
605 Ga0453683_0012101 3300044673 Bacteria 5664
606 Ga0453683_0763481 3300044673 Bacteria 635
607 Ga0466966_0148684 3300044684 Bacteria 1429
608 Ga0466961_0073916 3300044693 Bacteria 2161
609 Ga0466963_0182860 3300044694 Bacteria 1464
610 Ga0453684_0000212 3300044712 Bacteria 254110
611 Ga0453684_0002050 3300044712 Bacteria 51274
612 Ga0453684_0002803 3300044712 Bacteria 41213
613 Ga0453684_0004510 3300044712 Bacteria 29232
614 Ga0453684_0006442 3300044712 Bacteria 22295
615 Ga0453684_0039458 3300044712 Bacteria 6434
616 Ga0453684_0044669 3300044712 Bacteria 5922
617 Ga0453684_0050525 3300044712 Bacteria 5468
618 Ga0453684_0121465 3300044712 Bacteria 3153
619 Ga0453684_0215875 3300044712 Bacteria 2225
620 Ga0453684_0304376 3300044712 Bacteria 1811
621 Ga0453684_0519594 3300044712 Bacteria 1316
622 Ga0453684_0599918 3300044712 Unclassified 1207
623 Ga0466959_0330022 3300045049 Bacteria 1042
624 Ga0451576_0000002 3300045051 Bacteria 1670975
625 Ga0451576_0001418 3300045051 Bacteria 41032
626 Ga0451576_0005467 3300045051 Bacteria 15917
627 Ga0451576_0010696 3300045051 Bacteria 10507
628 Ga0451576_0012348 3300045051 Bacteria 9597
629 Ga0451576_0065240 3300045051 Bacteria 3791
630 Ga0451576_0066127 3300045051 Bacteria 3764
631 Ga0451576_0085869 3300045051 Bacteria 3274
632 Ga0451576_0135118 3300045051 Bacteria 2571
633 Ga0451576_1425923 3300045051 Bacteria 720
634 Ga0466958_0044615 3300045836 Bacteria 2672
635 Ga0495627_000012 3300046453 Bacteria 345654
636 Ga0495627_001456 3300046453 Bacteria 13877
637 Ga0495627_001699 3300046453 Bacteria 12059
638 Ga0495629_0302207 3300046459 Bacteria 1096
639 Ga0495638_0047103 3300046460 Bacteria 2705
640 Ga0495638_0321347 3300046460 Bacteria 827
641 Ga0495651_0917125 3300046462 Bacteria 535
642 Ga0495650_0000225 3300046471 Bacteria 117898
643 Ga0495650_0042487 3300046471 Bacteria 1935
644 Ga0495662_0266523 3300046476 Bacteria 843
645 Ga0495585_0000074 3300046492 Bacteria 102651
646 Ga0495585_0000459 3300046492 Bacteria 38959
647 Ga0495585_0382853 3300046492 Bacteria 679
648 Ga0495596_0013858 3300046500 Bacteria 3407
649 Ga0495596_0036677 3300046500 Bacteria 1941
650 Ga0495607_0035026 3300046501 Bacteria 3041
651 Ga0495583_0090456 3300046506 Bacteria 1318
652 Ga0495583_0229397 3300046506 Bacteria 749
653 Ga0495606_0000074 3300046507 Bacteria 170848
654 Ga0495606_0002257 3300046507 Bacteria 22884
655 Ga0495606_0005508 3300046507 Bacteria 12100
656 Ga0495606_0007729 3300046507 Bacteria 9521
657 Ga0495606_0035769 3300046507 Bacteria 3391
658 Ga0495606_0082552 3300046507 Bacteria 1995
659 Ga0495606_0188445 3300046507 Bacteria 1184
660 Ga0495606_0487361 3300046507 Bacteria 625
661 Ga0495610_0000005 3300046512 Bacteria 924111
662 Ga0495610_0000037 3300046512 Bacteria 186354
663 Ga0495610_0000574 3300046512 Bacteria 36619
664 Ga0495616_0003462 3300046513 Bacteria 10103
665 Ga0495616_0023014 3300046513 Bacteria 3357
666 Ga0495628_1127723 3300046516 Bacteria 535
667 Ga0495628_1209598 3300046516 Bacteria 512
668 Ga0495631_0004748 3300046518 Bacteria 7178
669 Ga0495631_0329036 3300046518 Bacteria 650
670 Ga0495632_0002479 3300046519 Bacteria 14017
671 Ga0495632_0033917 3300046519 Bacteria 2617
672 Ga0495637_0020106 3300046520 Bacteria 3076
673 Ga0495637_0059294 3300046520 Bacteria 1575
674 Ga0495643_0000316 3300046522 Bacteria 66852
675 Ga0495643_0014191 3300046522 Bacteria 4744
676 Ga0495643_0049655 3300046522 Bacteria 2262
677 Ga0495643_0167404 3300046522 Bacteria 1077
678 Ga0495648_0001585 3300046524 Bacteria 22152
679 Ga0495663_0019918 3300046525 Bacteria 1923
680 Ga0495654_0118142 3300046530 Bacteria 1203
681 Ga0495654_0278180 3300046530 Bacteria 689
682 Ga0495586_0308905 3300046535 Bacteria 906
683 Ga0495609_0000003 3300046538 Bacteria 711547
684 Ga0495609_0001203 3300046538 Bacteria 17830
685 Ga0495622_0051975 3300046557 Bacteria 1901
686 Ga0495633_0000001 3300046558 Bacteria 801972
687 Ga0495633_0000004 3300046558 Bacteria 370781
688 Ga0495633_0012522 3300046558 Bacteria 4506
689 Ga0495633_0026871 3300046558 Bacteria 2818
690 Ga0495633_0060180 3300046558 Bacteria 1780
691 Ga0495633_0153487 3300046558 Bacteria 1063
692 Ga0495633_0332068 3300046558 Bacteria 689
693 Ga0495668_0000121 3300046616 Bacteria 116234
694 Ga0495668_0139848 3300046616 Bacteria 1325
695 Ga0495634_0071997 3300046642 Bacteria 2274
696 Ga0495625_0000040 3300046660 Bacteria 207320
697 Ga0495625_0000067 3300046660 Bacteria 171483
698 Ga0495625_0001612 3300046660 Bacteria 26626
699 Ga0495625_0001746 3300046660 Bacteria 25142
700 Ga0495625_0174707 3300046660 Bacteria 1432
701 Ga0495625_0377831 3300046660 Bacteria 890
702 Ga0495661_0004327 3300046665 Bacteria 10280
703 Ga0495661_0209943 3300046665 Bacteria 1014
704 Ga0495599_0584929 3300046678 Bacteria 651
705 Ga0495658_0068117 3300046683 Bacteria 2060
706 Ga0495613_0432404 3300046689 Bacteria 894
707 Ga0495670_0505564 3300046691 Bacteria 656
708 Ga0495671_0043184 3300046692 Bacteria 2263
709 Ga0495649_0000054 3300046694 Bacteria 107048
710 Ga0495649_0162829 3300046694 Bacteria 1169
711 Ga0495589_0073307 3300046794 Bacteria 1671
712 Ga0495660_0033687 3300046810 Bacteria 2870
713 Ga0495660_0046383 3300046810 Bacteria 2383
714 Ga0495672_0223843 3300047320 Bacteria 927
715 Ga0495683_0021341 3300047323 Bacteria 3337
716 Ga0495683_0160689 3300047323 Bacteria 1039
717 Ga0495687_002058 3300047443 Bacteria 16916
718 Ga0495687_002279 3300047443 Bacteria 15707
719 Ga0495685_103521 3300047447 Bacteria 939
720 Ga0495673_0013544 3300047469 Bacteria 4278
721 Ga0495686_0000243 3300047472 Bacteria 98394
722 Ga0495686_0001285 3300047472 Bacteria 28340
723 Ga0495686_0006338 3300047472 Bacteria 9082
724 Ga0495686_0078829 3300047472 Bacteria 2015
725 Ga0495686_0160223 3300047472 Bacteria 1315
726 Ga0496102_0018298 3300048905 Bacteria 6155
727 Ga0496103_0043967 3300048906 Bacteria 2751
728 Ga0496105_0439126 3300048908 Bacteria 1031
729 Ga0496113_0561486 3300048916 Bacteria 915
730 Ga0496115_0040497 3300048918 Bacteria 3704
731 Ga0496115_0131137 3300048918 Bacteria 2066
732 Ga0496115_0241709 3300048918 Bacteria 1488
733 Ga0496115_0827685 3300048918 Unclassified 719
734 Ga0496116_0000002 3300048919 Bacteria 920291
735 Ga0496116_0000029 3300048919 Bacteria 422187
736 Ga0496116_0002509 3300048919 Bacteria 19214
737 Ga0496117_0000007 3300048920 Bacteria 720505
738 Ga0496117_0022926 3300048920 Bacteria 4996
739 Ga0496118_0000418 3300048921 Bacteria 70766
740 Ga0496118_0145289 3300048921 Bacteria 1495
741 Ga0496118_0154779 3300048921 Bacteria 1428
742 Ga0496118_0182334 3300048921 Bacteria 1267
743 Ga0496119_0000007 3300048922 Bacteria 475920
744 Ga0496121_0029474 3300048924 Bacteria 5074
745 Ga0496121_0259159 3300048924 Bacteria 1202
746 Ga0496121_0536996 3300048924 Bacteria 734
747 Ga0496122_0000089 3300048925 Bacteria 206107
748 Ga0496122_0000151 3300048925 Bacteria 162224
749 Ga0496122_0000153 3300048925 Bacteria 161087
750 Ga0496122_0000668 3300048925 Bacteria 69054
751 Ga0496122_0003324 3300048925 Bacteria 21243
752 Ga0496122_0007777 3300048925 Bacteria 11793
753 Ga0496123_0001537 3300048926 Bacteria 31905
754 Ga0496123_0002751 3300048926 Bacteria 21039
755 Ga0496123_0008187 3300048926 Bacteria 9641
756 Ga0496123_0015155 3300048926 Bacteria 6342
757 Ga0496123_0019968 3300048926 Bacteria 5260
758 Ga0496123_0168752 3300048926 Bacteria 1157
759 Ga0496123_0193897 3300048926 Bacteria 1048
760 Ga0496124_0005848 3300048927 Bacteria 13649
761 Ga0496124_0011820 3300048927 Bacteria 8696
762 Ga0496124_0296594 3300048927 Bacteria 1170
763 Ga0496125_0000007 3300048928 Bacteria 715355
764 Ga0496125_0000024 3300048928 Bacteria 442149
765 Ga0496125_0002520 3300048928 Bacteria 23642
766 Ga0496125_0014776 3300048928 Bacteria 7583
767 Ga0496125_0028703 3300048928 Bacteria 5017
768 Ga0496125_0187666 3300048928 Bacteria 1369
769 Ga0496125_0373304 3300048928 Bacteria 843
770 Ga0496126_0002742 3300048929 Bacteria 23270
771 Ga0496126_0007250 3300048929 Bacteria 12193
772 Ga0496126_0052166 3300048929 Bacteria 3719
773 Ga0496126_0125100 3300048929 Bacteria 2226
774 Ga0501031_0238339 3300049568 Bacteria 1183
775 Ga0501032_0002030 3300049569 Bacteria 15972
776 Ga0501033_0000004 3300049570 Bacteria 441310
777 Ga0501033_0127844 3300049570 Unclassified 1842
778 Ga0501034_0001804 3300049571 Bacteria 27281
779 Ga0501034_0010067 3300049571 Bacteria 9869
780 Ga0501034_0323280 3300049571 Bacteria 1475
781 Ga0501036_0018837 3300049572 Bacteria 5789
782 Ga0501036_0248629 3300049572 Bacteria 1490
783 Ga0501037_0042694 3300049573 Bacteria 3332
784 Ga0501038_0001517 3300049574 Bacteria 21376
785 Ga0501038_0013295 3300049574 Bacteria 7506
786 Ga0501039_0001415 3300049575 Bacteria 17662
787 Ga0501043_0001976 3300049579 Bacteria 17491
788 Ga0501047_0117416 3300049581 Bacteria 2542
789 Ga0501070_0090138 3300049586 Bacteria 2538
790 Ga0501199_041460 3300049650 Bacteria 598
791 Ga0501223_020965 3300049663 Bacteria 1279
792 Ga0501223_028693 3300049663 Bacteria 1083
793 Ga0501238_000108 3300049671 Bacteria 13310
794 Ga0501238_027363 3300049671 Bacteria 820
795 Ga0501240_002416 3300049673 Bacteria 1982
796 Ga0501249_000026 3300049679 Bacteria 87882
797 Ga0501249_000534 3300049679 Bacteria 9159
798 Ga0501249_027083 3300049679 Bacteria 1268
799 Ga0501241_000001 3300049758 Bacteria 233688
800 Ga0501241_001155 3300049758 Bacteria 5488
801 Ga0501241_005329 3300049758 Bacteria 2401
802 Ga0501266_000001 3300049763 Bacteria 562004
803 Ga0501269_000002 3300049766 Bacteria 118370
804 Ga0501269_008191 3300049766 Bacteria 1264
805 Ga0501280_000279 3300049776 Bacteria 13037
806 Ga0501280_007847 3300049776 Bacteria 1490
807 Ga0501035_0002702 3300049822 Bacteria 17241
808 Ga0501035_0889397 3300049822 Unclassified 706
809 Ga0501044_0002271 3300049823 Bacteria 21924
810 Ga0501045_0000002 3300049824 Bacteria 94022
811 nmdc:mga00v17_304879_c1 3300050491 Bacteria 1034
812 nmdc:mga0k408_167_c1 3300050493 Bacteria 34645
813 nmdc:mga0k408_54518_c1 3300050493 Bacteria 2317
814 nmdc:mga0k408_626_c1 3300050493 Bacteria 19472
815 nmdc:mga07m45_161635_c1 3300050496 Bacteria 1300
816 nmdc:mga07m45_391139_c1 3300050496 Bacteria 807
817 Ga0500635_0000533 3300053080 Bacteria 10305
818 Ga0500635_0003110 3300053080 Bacteria 4150
819 Ga0500646_0049739 3300053090 Bacteria 1206
820 Ga0500647_0108448 3300053091 Bacteria 1322
821 Ga0500641_0000015 3300053096 Bacteria 141363
822 Ga0500641_0000058 3300053096 Bacteria 47154
823 Ga0500641_0000620 3300053096 Bacteria 12828
824 Ga0500594_0055627 3300053118 Bacteria 1126
825 Ga0500608_008141 3300053122 Bacteria 4387
826 Ga0500614_242301 3300053123 Bacteria 561
827 Ga0500618_029208 3300053125 Bacteria 1301
828 Ga0500642_0099938 3300053130 Bacteria 1348
829 Ga0500658_0000001 3300053134 Bacteria 592738
830 Ga0500559_0032450 3300053136 Bacteria 2245
831 Ga0500564_061994 3300053138 Bacteria 1695
832 Ga0500568_0271195 3300053139 Bacteria 617
833 Ga0500573_0189197 3300053140 Bacteria 1101
834 Ga0500590_352728 3300053148 Bacteria 525
835 Ga0500622_0064325 3300053156 Bacteria 1866
836 Ga0500622_0072749 3300053156 Bacteria 1735
837 Ga0500584_080778 3300053726 Bacteria 1392
838 2513233033 2513020052 Bacteria 5120511
839 2520880935 2519899754 Bacteria 5336938
840 2522549277 2522125168 Bacteria 7376607
841 2586207187 2585427687 Bacteria 5544917
842 2599480000 2599185184 Bacteria 6430550
843 2644012473 2643221600 Bacteria 5530138
844 2644371723 2643221667 Bacteria 5627472
845 2644640935 2643221716 Bacteria 4986332
846 2644684385 2643221725 Bacteria 5087956
847 2722726222 2721755487 Bacteria 6357185
848 2738735018 2738541279 Bacteria 6149495
849 2738755859 2738541283 Bacteria 7222293
850 2738761475 2738541284 Bacteria 5199923
851 2738769258 2738541285 Bacteria 6150075
852 2738852505 2738541302 Bacteria 5944758
853 2739216600 2738543007 Bacteria 6149845
854 2739303013 2738543023 Bacteria 6767879
855 2739591382 2739367651 Bacteria 6359826
856 2739614739 2739367656 Bacteria 5152243
857 2739646108 2739367663 Bacteria 5040914
858 2739999886 2739367857 Bacteria 5433684
859 2740004702 2739367858 Bacteria 5432813
860 2776615892 2775506987 Bacteria 5373360
861 2802651719 2802428842 Bacteria 4926114
862 2817414591 2816332280 Bacteria 5109718
863 2819549636 2818991437 Bacteria 5805520
864 2833642025 2833640130 Bacteria 4858325
865 2842727391 2842722452 Bacteria 6263924
866 2842905460 2842903701 Bacteria 6986368
867 2842913787 2842909656 Bacteria 6185908
868 2849285385 2849281842 Bacteria 6065644
869 2852626182 2852623160 Bacteria 4376875
870 2852628096 2852627209 Bacteria 5896285
871 2857615424 2857613821 Bacteria 4917088
872 2857622164 2857618242 Bacteria 5635925
873 2857631981 2857627736 Bacteria 5625397
874 2881250537 2881247448 Bacteria 3717788
875 2881363925 2881359912 Bacteria 4935907
876 2884635929 2884634485 Bacteria 3928637
877 2884935278 2884933994 Bacteria 4535041
878 2890739265 2890737413 Bacteria 4269751
879 2896345575 2896344016 Bacteria 3811746
880 2898716816 2898713307 Bacteria 4110805
881 2902050453 2902048731 Bacteria 4976191
882 2903895673 2903895155 Bacteria 5258610
883 2904422622 2904419702 Bacteria 5166287
884 2904447237 2904445276 Bacteria 5310396
885 2904558240 2904555929 Bacteria 5218588
886 2904782831 2904780799 Bacteria 5840761
887 2910246116 2910245624 Bacteria 6935613
888 2911139757 2911138879 Bacteria 5811561
889 2919180442 2919177583 Bacteria 5641607
890 2919188458 2919186247 Bacteria 6244071
891 2919192888 2919191525 Bacteria 5765973
892 2919510647 2919509842 Bacteria 4104664
893 2919683726 2919683626 Bacteria 5534354
894 2919693539 2919692658 Bacteria 5943958
895 2928081131 2928078545 Bacteria 6534839
896 2928152448 2928147474 Bacteria 6512076
897 2929151740 2929150217 Bacteria 5462483
898 2932087781 2932082852 Bacteria 6563563
899 2939667457 2939664404 Bacteria 6364494
900 2945998294 2945997725 Bacteria 6404843
901 2954020753 2954016120 Bacteria 6446024
902 2958460024 2958458903 Bacteria 5301041
903 2958513282 2958512119 Bacteria 4528530
904 2965322681 2965320100 Bacteria 3975600
905 2977234814 2977232053 Bacteria 5485925
906 2977268463 2977268062 Bacteria 5243061
907 2993482182 2993480792 Bacteria 4022225
908 8054309040 8054307821 Bacteria 5212224
909 8055419629 8055419101 Bacteria 5289643
910 8055595890 8055592153 Bacteria 5961247
911 8056443152 8056440228 Bacteria 4946504
912 Ga0163163_10123310
913 SwRhRL2b_contig_1426845
914 SwRhRL2b_contig_2141802
915 SwRhRL2b_contig_2234511
916 SwRhRL2b_contig_2737985
917 SwRhRL2b_contig_3209656
918 JGI24736J21556_1005426
919 JGI24736J21556_1005446
920 JGI24740J21852_10009887
921 JGI24740J21852_10032120
922 JGI24740J21852_10121227
923 JGI24739J22299_10002365
924 JGI24737J22298_10000496
925 JGI24737J22298_10009284
926 JGI24735J21928_10000005
927 JGI24735J21928_10024511
928 JGI25162J39368_1001793
929 JGI25157J39369_1006041
930 JGI25164J39214_1003256
931 JGI25152J39213_1000080
932 JGI25150J39212_1000003
933 JGI25150J39212_1000004
934 JGI25151J46595_10000002
935 JGI25165J46597_1003249
936 JGI25153J46596_10000015
937 rootH1_10018738
938 rootH2_10000823
939 rootH2_10166669
940 rootH2_10213711
941 rootH2_10293539
942 rootL2_10000170
943 rootL2_10086321
944 rootL2_10125855
945 rootL2_10211502
946 rootL2_10239455
947 rootL2_10282583
948 rootL2_10282620
949 rootH1_10010138
950 rootH1_10130033
951 rootH1_10141868
952 rootH1_10205903
953 rootH1_10250537
954 Ga0055536_1000002
955 Ga0055536_1006887
956 Ga0055530_10004135
957 Ga0065165_1000478
958 Ga0065714_10002231
959 Ga0065714_10002386
960 Ga0065714_10003833
961 Ga0065714_10018627
962 Ga0065714_10068450
963 Ga0065714_10071057
964 Ga0065714_10085785
965 Ga0065714_10097380
966 Ga0065714_10110637
967 Ga0065714_10128983
968 Ga0065714_10180754
969 Ga0065714_10234935
970 Ga0065714_10260939
971 Ga0065704_10002049
972 Ga0065704_10037325
973 Ga0065704_10070374
974 Ga0065704_10073302
975 Ga0065704_10076064
976 Ga0065704_10077903
977 Ga0065704_10078968
978 Ga0065704_10090520
979 Ga0065704_10092841
980 Ga0065704_10098036
981 Ga0065704_10111747
982 Ga0065704_10121604
983 Ga0065704_10416260
984 Ga0065715_10094915
985 Ga0065715_10189695
986 Ga0065715_10406989
987 Ga0065715_10475229
988 Ga0070658_10000016
989 Ga0070658_10401077
990 Ga0070676_10003779
991 Ga0070683_100002723
992 Ga0070680_100011953
993 Ga0070682_100000065
994 Ga0070682_100372120
995 Ga0068868_100173252
996 Ga0068868_100217025
997 Ga0070660_100043623
998 Ga0070660_100074805
999 Ga0070660_100323059
1000 Ga0070668_100006243
1001 Ga0070668_100040617
1002 Ga0070673_100018134
1003 Ga0070659_100000391
1004 Ga0070659_100006520
1005 Ga0070663_100030640
1006 Ga0070678_100008126
1007 Ga0070678_100421701
1008 Ga0070662_100000026
1009 Ga0070681_10004335
1010 Ga0068867_100000879
1011 Ga0070685_10046821
1012 Ga0070679_100007384
1013 Ga0070679_100116775
1014 Ga0070684_100002108
1015 Ga0068853_100009639
1016 Ga0068853_100212349
1017 Ga0068853_100221785
1018 Ga0068853_100417747
1019 Ga0070672_100167388
1020 Ga0070665_100000012
1021 Ga0068855_100000160
1022 Ga0068855_100000967
1023 Ga0068855_100155254
1024 Ga0068855_100164427
1025 Ga0068855_100172468
1026 Ga0068855_100176926
1027 Ga0068855_100573048
1028 Ga0068855_100972981
1029 Ga0068857_100026580
1030 Ga0068857_101021686
1031 Ga0068856_100000006
1032 Ga0068856_100010882
1033 Ga0068856_100027080
1034 Ga0068856_100066696
1035 Ga0068856_100153239
1036 Ga0068856_100686779
1037 Ga0068852_100000584
1038 Ga0068852_100160435
1039 Ga0075364_10429002
1040 Ga0070716_100123943
1041 Ga0075362_10304524
1042 Ga0075366_10000228
1043 Ga0075366_10018920
1044 Ga0097621_100000069
1045 Ga0097621_100591459
1046 Ga0097621_100681344
1047 Ga0097621_101112304
1048 Ga0075370_10704159
1049 Ga0068871_100001572
1050 Ga0068865_100000098
1051 Ga0099824_1000108
1052 Ga0079104_1000028
1053 Ga0099826_10006584
1054 Ga0105251_10244344
1055 Ga0105244_10000005
1056 Ga0105244_10000059
1057 Ga0105244_10031705
1058 Ga0105244_10097076
1059 Ga0105250_10007666
1060 Ga0105240_10007861
1061 Ga0105240_10057931
1062 Ga0105240_10068070
1063 Ga0105240_10072715
1064 Ga0105240_10073488
1065 Ga0105240_10151227
1066 Ga0105240_10158414
1067 Ga0105240_10174075
1068 Ga0105240_10282640
1069 Ga0105240_10658903
1070 Ga0105240_10839908
1071 Ga0105240_12442084
1072 Ga0105245_10119486
1073 Ga0105245_10659558
1074 Ga0105247_10251266
1075 Ga0105243_10000009
1076 Ga0105243_10000021
1077 Ga0105243_10049802
1078 Ga0105243_11981475
1079 Ga0105241_10000693
1080 Ga0105241_10033174
1081 Ga0105241_10051932
1082 Ga0105241_10084819
1083 Ga0105241_10144455
1084 Ga0105241_10383099
1085 Ga0105241_10544132
1086 Ga0105242_10018006
1087 Ga0105242_11429575
1088 Ga0105242_11731069
1089 Ga0105237_10000354
1090 Ga0105237_10000429
1091 Ga0105237_10000753
1092 Ga0105237_10001433
1093 Ga0105237_10035290
1094 Ga0105237_10205712
1095 Ga0105237_10326070
1096 Ga0105238_10001430
1097 Ga0105238_10038622
1098 Ga0105238_10237198
1099 Ga0105238_10560111
1100 Ga0105239_10000015
1101 Ga0105239_10000069
1102 Ga0105239_10001827
1103 Ga0105239_10008812
1104 Ga0105239_10060393
1105 Ga0105239_10099630
1106 Ga0105239_10359206
1107 Ga0105239_10363932
1108 Ga0105239_10557742
1109 Ga0105239_11417665
1110 Ga0105239_12202967
1111 Ga0105246_10803668
1112 Ga0157373_10000003
1113 Ga0157373_10000065
1114 Ga0157373_10000254
1115 Ga0157373_10000936
1116 Ga0157373_10008808
1117 Ga0157373_10010688
1118 Ga0157373_10134944
1119 Ga0157373_10153715
1120 Ga0157373_10561796
1121 Ga0157373_10590034
1122 Ga0157371_10000025
1123 Ga0157371_10000229
1124 Ga0157371_10000904
1125 Ga0157371_10005051
1126 Ga0157371_10006606
1127 Ga0157371_10007352
1128 Ga0157371_10024946
1129 Ga0157371_10048837
1130 Ga0157371_10058894
1131 Ga0157371_10114437
1132 Ga0157371_10647748
1133 Ga0157371_10689570
1134 Ga0157370_10001039
1135 Ga0157370_10001545
1136 Ga0157370_10001670
1137 Ga0157370_10002687
1138 Ga0157370_10005342
1139 Ga0157370_10008063
1140 Ga0157370_10009163
1141 Ga0157370_10014803
1142 Ga0157370_10016593
1143 Ga0157370_10018605
1144 Ga0157370_10039970
1145 Ga0157370_10043395
1146 Ga0157370_10047507
1147 Ga0157370_10068889
1148 Ga0157370_10070331
1149 Ga0157370_10144272
1150 Ga0157370_10200144
1151 Ga0157370_10218154
1152 Ga0157370_10220805
1153 Ga0157370_10297945
1154 Ga0157370_10299675
1155 Ga0157370_10302736
1156 Ga0157370_10422938
1157 Ga0157370_11264259
1158 Ga0157369_10000038
1159 Ga0157369_10000101
1160 Ga0157369_10000423
1161 Ga0157369_10002643
1162 Ga0157369_10037939
1163 Ga0157369_10198222
1164 Ga0157369_10602754
1165 Ga0157369_10658741
1166 Ga0157369_10662035
1167 Ga0157374_10000076
1168 Ga0157374_10001396
1169 Ga0157374_10018889
1170 Ga0157378_10015305
1171 Ga0157378_10016498
1172 Ga0157378_10075864
1173 Ga0157378_10142182
1174 Ga0157378_10388262
1175 Ga0163162_10000013
1176 Ga0163162_10000050
1177 Ga0163162_10009096
1178 Ga0163162_10034388
1179 Ga0163162_10036274
1180 Ga0163162_10409126
1181 Ga0157372_10000041
1182 Ga0157372_10000051
1183 Ga0157372_10000874
1184 Ga0157372_10003305
1185 Ga0157372_10025095
1186 Ga0157372_10040546
1187 Ga0157375_10000417
1188 Ga0157375_10076573
1189 Ga0157375_10091841
1190 Ga0157375_10110784
1191 Ga0157375_10135693
1192 Ga0157375_10162209
1193 Ga0157375_10347452
1194 Ga0157375_10781023
1195 Ga0157375_10978991
1196 Ga0163163_11044371
1197 Ga0157380_10000022
1198 Ga0182008_10000005
1199 Ga0182008_10000025
1200 Ga0182008_10000052
1201 Ga0182008_10000058
1202 Ga0182008_10014892
1203 Ga0182008_10229604
1204 Ga0182008_10721046
1205 Ga0157377_10418005
1206 Ga0157376_10193333
1207 Ga0157376_10480276
1208 Ga0182006_1000127
1209 Ga0182006_1000645
1210 Ga0182006_1001592
1211 Ga0182006_1006423
1212 Ga0182006_1008199
1213 Ga0182006_1038255
1214 Ga0182006_1107532
1215 Ga0182007_10000024
1216 Ga0182007_10004566
1217 Ga0182007_10060916
1218 Ga0182007_10082546
1219 Ga0183373_1002
1220 Ga0163161_10000014
1221 Ga0163161_10000136
1222 Ga0163161_10000628
1223 Ga0163161_10000979
1224 Ga0163161_10005705
1225 Ga0163161_10008888
1226 Ga0163161_10019883
1227 Ga0163161_10065973
1228 Ga0163161_10093528
1229 Ga0163161_10158712
1230 Ga0163161_10197638
1231 Ga0163161_10252369
1232 Ga0163161_10412790
1233 Ga0163161_10420758
1234 Ga0163161_10422061
1235 Ga0163161_10573934
1236 Ga0163161_10729285
1237 Ga0163161_11321188
1238 Ga0213872_10019228
1239 Ga0209563_110589
1240 Ga0207427_100043
1241 Ga0209437_100170
1242 Ga0209437_100190
1243 Ga0207425_1000003
1244 Ga0209026_1000243
1245 Ga0209026_1004634
1246 Ga0209129_1000014
1247 Ga0209129_1018403
1248 Ga0209233_1000266
1249 Ga0209233_1001543
1250 Ga0209233_1009528
1251 Ga0209455_1002288
1252 Ga0209675_1000022
1253 Ga0209676_1000022
1254 Ga0209676_1000488
1255 Ga0209025_1000007
1256 Ga0209758_1000012
1257 Ga0209050_1000020
1258 Ga0207426_1096738
1259 Ga0207696_1008616
1260 Ga0207655_1000003
1261 Ga0207655_1000016
1262 Ga0207655_1029660
1263 Ga0207713_1148366
1264 Ga0207713_1161976
1265 Ga0207642_10078191
1266 Ga0207710_10268630
1267 Ga0207647_10000217
1268 Ga0207647_10001231
1269 Ga0207647_10041669
1270 Ga0207645_10003391
1271 Ga0207705_10000031
1272 Ga0207705_10270542
1273 Ga0207705_10284830
1274 Ga0207654_10003057
1275 Ga0207654_10058503
1276 Ga0207654_10115651
1277 Ga0207654_10168296
1278 Ga0207707_10009797
1279 Ga0207695_10000087
1280 Ga0207695_10007478
1281 Ga0207695_10010273
1282 Ga0207695_10038235
1283 Ga0207695_10109670
1284 Ga0207695_10234651
1285 Ga0207695_10283098
1286 Ga0207695_10578372
1287 Ga0207671_10000466
1288 Ga0207671_10001163
1289 Ga0207671_10003106
1290 Ga0207671_10004475
1291 Ga0207671_10011835
1292 Ga0207671_10195729
1293 Ga0207693_10316745
1294 Ga0207660_10125934
1295 Ga0207657_10043954
1296 Ga0207657_10094541
1297 Ga0207657_10642078
1298 Ga0207652_10007397
1299 Ga0207652_10297821
1300 Ga0207681_10299934
1301 Ga0207694_10043769
1302 Ga0207694_10048181
1303 Ga0207694_10174370
1304 Ga0207687_10073150
1305 Ga0207644_10001994
1306 Ga0207690_10000432
1307 Ga0207690_10019136
1308 Ga0207706_10000010
1309 Ga0207686_10111656
1310 Ga0207686_10611348
1311 Ga0207709_10000026
1312 Ga0207709_10000281
1313 Ga0207709_10012162
1314 Ga0207704_10000334
1315 Ga0207691_10125785
1316 Ga0207661_10003479
1317 Ga0207661_10010032
1318 Ga0207667_10000033
1319 Ga0207667_10001021
1320 Ga0207667_10003221
1321 Ga0207667_10141964
1322 Ga0207667_10199641
1323 Ga0207667_10234194
1324 Ga0207667_10247530
1325 Ga0207667_10284586
1326 Ga0207667_10439863
1327 Ga0207667_10681425
1328 Ga0207667_11049400
1329 Ga0207651_10084689
1330 Ga0207651_11007965
1331 Ga0207668_10012192
1332 Ga0207668_10162571
1333 Ga0207640_11248667
1334 Ga0207677_10174179
1335 Ga0207639_10003841
1336 Ga0207639_10080303
1337 Ga0207639_10103364
1338 Ga0207639_10275815
1339 Ga0207678_10048526
1340 Ga0207702_10000023
1341 Ga0207702_10011730
1342 Ga0207702_10119355
1343 Ga0207702_10389976
1344 Ga0207702_11400959
1345 Ga0207648_10000990
1346 Ga0207674_10158235
1347 Ga0207674_10855106
1348 Ga0207674_11582206
1349 Ga0207674_11584921
1350 Ga0207683_10017708
1351 Ga0207683_10408760
1352 Ga0207698_10008792
1353 Ga0207698_10078823
1354 Ga0207698_10240750
1355 Ga0209281_1000069
1356 Ga0209968_1001501
1357 Ga0210002_1029206
1358 Ga0268266_10000080
1359 Ga0265337_1026609
1360 Ga0265326_10060373
1361 Ga0265334_10030858
1362 Ga0265322_10014427
1363 Ga0265336_10084740
1364 Ga0307517_10026222
1365 Ga0307515_10001558
1366 Ga0307515_10030051
1367 Ga0307515_10117183
1368 Ga0307515_10440460
1369 Ga0307515_10576824
1370 Ga0265338_10480951
1371 Ga0265324_10013449
1372 Ga0316176_1063745
1373 Ga0316183_1152562
1374 Ga0316181_1121975
1375 Ga0316182_1125350
1376 Ga0265330_10244326
1377 Ga0265332_10089319
1378 Ga0265328_10091405
1379 Ga0265320_10177507
1380 Ga0265329_10096597
1381 Ga0265327_10001390
1382 Ga0265327_10044490
1383 Ga0265316_10001519
1384 Ga0265316_10111949
1385 Ga0265316_10115655
1386 Ga0265316_10311458
1387 Ga0307509_10283860
1388 Ga0307509_10293734
1389 Ga0307408_100000164
1390 Ga0307408_100000310
1391 Ga0307408_100000448
1392 Ga0307408_100000583
1393 Ga0307408_100003314
1394 Ga0307408_100142791
1395 Ga0265314_10000031
1396 Ga0316576_11034229
1397 Ga0307405_10000001
1398 Ga0307405_10000011
1399 Ga0307405_10007180
1400 Ga0307405_10047027
1401 Ga0307405_10166489
1402 Ga0307405_10358810
1403 Ga0307413_10000003
1404 Ga0307413_10112152
1405 Ga0307410_10000065
1406 Ga0307406_10000017
1407 Ga0307407_10000018
1408 Ga0307407_10004270
1409 Ga0307407_10361015
1410 Ga0307412_10000001
1411 Ga0307412_10000058
1412 Ga0307412_10000704
1413 Ga0307412_10000825
1414 Ga0307412_10025701
1415 Ga0307412_10084084
1416 Ga0307412_10110967
1417 Ga0307412_10139508
1418 Ga0307412_10332057
1419 Ga0307412_11112953
1420 Ga0307412_11310286
1421 Ga0307409_101027096
1422 Ga0307416_100000006
1423 Ga0307416_100000081
1424 Ga0307416_100000649
1425 Ga0307416_100020641
1426 Ga0307414_10000014
1427 Ga0307414_10000061
1428 Ga0307414_10000502
1429 Ga0307414_10000530
1430 Ga0307414_10000823
1431 Ga0307414_10002415
1432 Ga0307414_10007008
1433 Ga0307414_10010298
1434 Ga0307414_10011516
1435 Ga0307414_10031240
1436 Ga0307414_10032372
1437 Ga0307414_10048830
1438 Ga0307414_10107580
1439 Ga0307414_10119762
1440 Ga0307414_10123098
1441 Ga0307414_10123641
1442 Ga0307414_10130287
1443 Ga0307414_10157074
1444 Ga0307414_10444797
1445 Ga0307414_10470684
1446 Ga0307414_10700121
1447 Ga0307414_10866620
1448 Ga0307414_10983328
1449 Ga0307411_10000002
1450 Ga0307411_10137637
1451 Ga0307411_10234738
1452 Ga0307415_101012862
1453 Ga0307507_10000143
1454 Ga0307510_10000218
1455 Ga0307510_10031800
1456 Ga0373955_0930043
1457 Ga0373942_0157809
1458 Ga0316574_0190252
1459 Ga0316574_0369229
1460 Ga0373931_0493118
1461 Ga0316584_0506435
1462 Ga0395899_0000021
1463 Ga0395899_0000024
1464 Ga0395899_0000050
1465 Ga0395899_0000648
1466 Ga0395899_0045232
1467 Ga0395899_0500104
1468 Ga0395900_0000332
1469 Ga0395900_0002463
1470 Ga0395900_0015912
1471 Ga0395900_0023779
1472 Ga0395900_0067991
1473 Ga0395900_0081288
1474 Ga0395898_0020230
1475 Ga0395898_0271031
1476 Ga0395905_0000324
1477 Ga0395905_0001895
1478 Ga0395905_0005538
1479 Ga0395901_0001649
1480 Ga0395901_0003264
1481 Ga0395901_0344520
1482 Ga0395901_0488565
1483 Ga0400483_026801
1484 Ga0436361_0265633
1485 Ga0439447_001594
1486 Ga0439466_0000199
1487 Ga0451787_246046
1488 Ga0451791_0178529
1489 Ga0451795_0544546
1490 Ga0451802_1750742
1491 Ga0451806_096330
1492 Ga0451807_1276579
1493 Ga0451807_1679596
1494 Ga0451837_0155400
1495 Ga0451837_0846889
1496 Ga0451849_0840633
1497 Ga0451855_0405943
1498 Ga0451855_1284336
1499 Ga0439445_0000824
1500 Ga0439445_0132131
1501 Ga0439448_0024447
1502 Ga0439457_034604
1503 Ga0450890_021773
1504 Ga0439434_0126579
1505 Ga0451577_0001003
1506 Ga0451577_0004037
1507 Ga0451577_0010083
1508 Ga0451577_0086506
1509 Ga0451577_0096937
1510 Ga0451577_0128499
1511 Ga0451577_1436830
1512 Ga0451577_1728629
1513 Ga0466969_0116525
1514 Ga0453683_0000136
1515 Ga0453683_0003752
1516 Ga0453683_0012101
1517 Ga0453683_0763481
1518 Ga0466966_0148684
1519 Ga0466961_0073916
1520 Ga0466963_0182860
1521 Ga0453684_0000212
1522 Ga0453684_0002050
1523 Ga0453684_0002803
1524 Ga0453684_0004510
1525 Ga0453684_0006442
1526 Ga0453684_0039458
1527 Ga0453684_0044669
1528 Ga0453684_0050525
1529 Ga0453684_0121465
1530 Ga0453684_0215875
1531 Ga0453684_0304376
1532 Ga0453684_0519594
1533 Ga0453684_0599918
1534 Ga0466959_0330022
1535 Ga0451576_0000002
1536 Ga0451576_0001418
1537 Ga0451576_0005467
1538 Ga0451576_0010696
1539 Ga0451576_0012348
1540 Ga0451576_0065240
1541 Ga0451576_0066127
1542 Ga0451576_0085869
1543 Ga0451576_0135118
1544 Ga0451576_1425923
1545 Ga0466958_0044615
1546 Ga0495627_000012
1547 Ga0495627_001456
1548 Ga0495627_001699
1549 Ga0495629_0302207
1550 Ga0495638_0047103
1551 Ga0495638_0321347
1552 Ga0495651_0917125
1553 Ga0495650_0000225
1554 Ga0495650_0042487
1555 Ga0495662_0266523
1556 Ga0495585_0000074
1557 Ga0495585_0000459
1558 Ga0495585_0382853
1559 Ga0495596_0013858
1560 Ga0495596_0036677
1561 Ga0495607_0035026
1562 Ga0495583_0090456
1563 Ga0495583_0229397
1564 Ga0495606_0000074
1565 Ga0495606_0002257
1566 Ga0495606_0005508
1567 Ga0495606_0007729
1568 Ga0495606_0035769
1569 Ga0495606_0082552
1570 Ga0495606_0188445
1571 Ga0495606_0487361
1572 Ga0495610_0000005
1573 Ga0495610_0000037
1574 Ga0495610_0000574
1575 Ga0495616_0003462
1576 Ga0495616_0023014
1577 Ga0495628_1127723
1578 Ga0495628_1209598
1579 Ga0495631_0004748
1580 Ga0495631_0329036
1581 Ga0495632_0002479
1582 Ga0495632_0033917
1583 Ga0495637_0020106
1584 Ga0495637_0059294
1585 Ga0495643_0000316
1586 Ga0495643_0014191
1587 Ga0495643_0049655
1588 Ga0495643_0167404
1589 Ga0495648_0001585
1590 Ga0495663_0019918
1591 Ga0495654_0118142
1592 Ga0495654_0278180
1593 Ga0495586_0308905
1594 Ga0495609_0000003
1595 Ga0495609_0001203
1596 Ga0495622_0051975
1597 Ga0495633_0000001
1598 Ga0495633_0000004
1599 Ga0495633_0012522
1600 Ga0495633_0026871
1601 Ga0495633_0060180
1602 Ga0495633_0153487
1603 Ga0495633_0332068
1604 Ga0495668_0000121
1605 Ga0495668_0139848
1606 Ga0495634_0071997
1607 Ga0495625_0000040
1608 Ga0495625_0000067
1609 Ga0495625_0001612
1610 Ga0495625_0001746
1611 Ga0495625_0174707
1612 Ga0495625_0377831
1613 Ga0495661_0004327
1614 Ga0495661_0209943
1615 Ga0495599_0584929
1616 Ga0495658_0068117
1617 Ga0495613_0432404
1618 Ga0495670_0505564
1619 Ga0495671_0043184
1620 Ga0495649_0000054
1621 Ga0495649_0162829
1622 Ga0495589_0073307
1623 Ga0495660_0033687
1624 Ga0495660_0046383
1625 Ga0495672_0223843
1626 Ga0495683_0021341
1627 Ga0495683_0160689
1628 Ga0495687_002058
1629 Ga0495687_002279
1630 Ga0495685_103521
1631 Ga0495673_0013544
1632 Ga0495686_0000243
1633 Ga0495686_0001285
1634 Ga0495686_0006338
1635 Ga0495686_0078829
1636 Ga0495686_0160223
1637 Ga0496102_0018298
1638 Ga0496103_0043967
1639 Ga0496105_0439126
1640 Ga0496113_0561486
1641 Ga0496115_0040497
1642 Ga0496115_0131137
1643 Ga0496115_0241709
1644 Ga0496115_0827685
1645 Ga0496116_0000002
1646 Ga0496116_0000029
1647 Ga0496116_0002509
1648 Ga0496117_0000007
1649 Ga0496117_0022926
1650 Ga0496118_0000418
1651 Ga0496118_0145289
1652 Ga0496118_0154779
1653 Ga0496118_0182334
1654 Ga0496119_0000007
1655 Ga0496121_0029474
1656 Ga0496121_0259159
1657 Ga0496121_0536996
1658 Ga0496122_0000089
1659 Ga0496122_0000151
1660 Ga0496122_0000153
1661 Ga0496122_0000668
1662 Ga0496122_0003324
1663 Ga0496122_0007777
1664 Ga0496123_0001537
1665 Ga0496123_0002751
1666 Ga0496123_0008187
1667 Ga0496123_0015155
1668 Ga0496123_0019968
1669 Ga0496123_0168752
1670 Ga0496123_0193897
1671 Ga0496124_0005848
1672 Ga0496124_0011820
1673 Ga0496124_0296594
1674 Ga0496125_0000007
1675 Ga0496125_0000024
1676 Ga0496125_0002520
1677 Ga0496125_0014776
1678 Ga0496125_0028703
1679 Ga0496125_0187666
1680 Ga0496125_0373304
1681 Ga0496126_0002742
1682 Ga0496126_0007250
1683 Ga0496126_0052166
1684 Ga0496126_0125100
1685 Ga0501031_0238339
1686 Ga0501032_0002030
1687 Ga0501033_0000004
1688 Ga0501033_0127844
1689 Ga0501034_0001804
1690 Ga0501034_0010067
1691 Ga0501034_0323280
1692 Ga0501036_0018837
1693 Ga0501036_0248629
1694 Ga0501037_0042694
1695 Ga0501038_0001517
1696 Ga0501038_0013295
1697 Ga0501039_0001415
1698 Ga0501043_0001976
1699 Ga0501047_0117416
1700 Ga0501070_0090138
1701 Ga0501199_041460
1702 Ga0501223_020965
1703 Ga0501223_028693
1704 Ga0501238_000108
1705 Ga0501238_027363
1706 Ga0501240_002416
1707 Ga0501249_000026
1708 Ga0501249_000534
1709 Ga0501249_027083
1710 Ga0501241_000001
1711 Ga0501241_001155
1712 Ga0501241_005329
1713 Ga0501266_000001
1714 Ga0501269_000002
1715 Ga0501269_008191
1716 Ga0501280_000279
1717 Ga0501280_007847
1718 Ga0501035_0002702
1719 Ga0501035_0889397
1720 Ga0501044_0002271
1721 Ga0501045_0000002
1722 nmdc:mga00v17_304879_c1
1723 nmdc:mga0k408_167_c1
1724 nmdc:mga0k408_54518_c1
1725 nmdc:mga0k408_626_c1
1726 nmdc:mga07m45_161635_c1
1727 nmdc:mga07m45_391139_c1
1728 Ga0500635_0000533
1729 Ga0500635_0003110
1730 Ga0500646_0049739
1731 Ga0500647_0108448
1732 Ga0500641_0000015
1733 Ga0500641_0000058
1734 Ga0500641_0000620
1735 Ga0500594_0055627
1736 Ga0500608_008141
1737 Ga0500614_242301
1738 Ga0500618_029208
1739 Ga0500642_0099938
1740 Ga0500658_0000001
1741 Ga0500559_0032450
1742 Ga0500564_061994
1743 Ga0500568_0271195
1744 Ga0500573_0189197
1745 Ga0500590_352728
1746 Ga0500622_0064325
1747 Ga0500622_0072749
1748 Ga0500584_080778
1749 2513233033
1750 2520880935
1751 2522549277
1752 2586207187
1753 2599480000
1754 2644012473
1755 2644371723
1756 2644640935
1757 2644684385
1758 2722726222
1759 2738735018
1760 2738755859
1761 2738761475
1762 2738769258
1763 2738852505
1764 2739216600
1765 2739303013
1766 2739591382
1767 2739614739
1768 2739646108
1769 2739999886
1770 2740004702
1771 2776615892
1772 2802651719
1773 2817414591
1774 2819549636
1775 2833642025
1776 2842727391
1777 2842905460
1778 2842913787
1779 2849285385
1780 2852626182
1781 2852628096
1782 2857615424
1783 2857622164
1784 2857631981
1785 2881250537
1786 2881363925
1787 2884635929
1788 2884935278
1789 2890739265
1790 2896345575
1791 2898716816
1792 2902050453
1793 2903895673
1794 2904422622
1795 2904447237
1796 2904558240
1797 2904782831
1798 2910246116
1799 2911139757
1800 2919180442
1801 2919188458
1802 2919192888
1803 2919510647
1804 2919683726
1805 2919693539
1806 2928081131
1807 2928152448
1808 2929151740
1809 2932087781
1810 2939667457
1811 2945998294
1812 2954020753
1813 2958460024
1814 2958513282
1815 2965322681
1816 2977234814
1817 2977268463
1818 2993482182
1819 8054309040
1820 8055419629
1821 8055595890
1822 8056443152

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

33

133

0.97

PF14437

MafB19-deam

MafB19-like deaminase

33

175

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jfy-assembly2.cif.gz_D crystal structure of a plant cytidine deaminase 0.9523 7 104
2nx8-assembly1.cif.gz_A-2 the crystal structure of the trna-specific adenosine deaminase from streptococcus pyogenes 0.9497 8 146
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9492 6 146
1tiy-assembly1.cif.gz_A x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160 0.9465 8 106
7cph-assembly1.cif.gz_A crystal structure of trna adenosine deaminase from bacillus subtilis 0.9451 6 146
ID Description Score Start End Superfamily
af_A0A0R4IDF5_228_326_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.954 29 42 2.60.40.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9497 8 146 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9492 7 146 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9472 6 146 3.40.140.10
af_K7K815_1119_1301_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9431 7 146 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A1H9CGG6-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9999 12 145 GO:0002100
GO:0008270
GO:0052717
AF-A0A2N9P8B9-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9989 1 146 GO:0002100
GO:0008270
GO:0052717
AF-A0A519RGC0-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9989 1 123 GO:0002100
GO:0008270
GO:0052717
AF-A0A3C0GEJ9-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9987 27 147 GO:0002100
GO:0008270
GO:0052717
AF-A0A6V6YTL8-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9974 1 147 GO:0002100
GO:0008270
GO:0052717

Map