F485482

General Info

Members Datasets Scaffolds Average Seq Length
911 233 1822 125

Family's Representative Sequence

Representative Sequence 3300049687|Ga0501258_010189|Ga0501258_010189_120_479
Length 119
Sequence MRKTILLILALSVATPAAAAPPGTAQNFLDRANRLKAKGPLALFDGDYGRLKAEAIGDDRIAAERAGRPILYCSPKARAKLGSYEFIDGLTAIPAVERQHMSLKDAMIRVLQKKYPCKR

Samples

Sample ID Description Type Environment
1 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
167 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
225 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
229 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 4.5
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 6.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501258_010189 3300049687 Bacteria 991
2 JGI24741J21665_1001682 3300001915 Bacteria 6134
3 JGI24740J21852_10017230 3300001979 Bacteria 2588
4 JGI24740J21852_10023290 3300001979 Bacteria 2118
5 JGI24739J22299_10008838 3300001989 Bacteria 3756
6 JGI24739J22299_10020155 3300001989 Bacteria 2382
7 JGI24737J22298_10000005 3300001990 Bacteria 65241
8 JGI24737J22298_10002142 3300001990 Bacteria 7037
9 JGI24737J22298_10012293 3300001990 Bacteria 2791
10 JGI24737J22298_10088707 3300001990 Bacteria 918
11 JGI24743J22301_10020531 3300001991 Bacteria 1258
12 JGI24735J21928_10008389 3300002067 Bacteria 3341
13 JGI24735J21928_10021755 3300002067 Bacteria 1956
14 JGI24735J21928_10175598 3300002067 Bacteria 620
15 JGI24738J21930_10004335 3300002075 Bacteria 3491
16 JGI24742J22300_10034834 3300002244 Bacteria 887
17 Ga0070658_10000216 3300005327 Bacteria 51121
18 Ga0070658_10045539 3300005327 Bacteria 3547
19 Ga0070658_10230643 3300005327 Bacteria 1567
20 Ga0070658_10276047 3300005327 Bacteria 1430
21 Ga0070658_10572409 3300005327 Bacteria 978
22 Ga0070658_10923151 3300005327 Bacteria 759
23 Ga0070676_10081647 3300005328 Bacteria 1962
24 Ga0070676_10247777 3300005328 Bacteria 1187
25 Ga0070676_10828621 3300005328 Bacteria 684
26 Ga0070676_10851897 3300005328 Unclassified 676
27 Ga0070683_100015844 3300005329 Bacteria 6630
28 Ga0070683_100122906 3300005329 Bacteria 2452
29 Ga0070683_100231693 3300005329 Bacteria 1756
30 Ga0070683_100239746 3300005329 Bacteria 1725
31 Ga0070683_101254604 3300005329 Unclassified 712
32 Ga0070690_100393545 3300005330 Bacteria 1016
33 Ga0070670_100007469 3300005331 Bacteria 9281
34 Ga0070670_100014399 3300005331 Bacteria 6787
35 Ga0070670_100040990 3300005331 Bacteria 3979
36 Ga0070670_100049353 3300005331 Bacteria 3618
37 Ga0070670_100091394 3300005331 Bacteria 2617
38 Ga0070670_100359581 3300005331 Bacteria 1280
39 Ga0070670_100393177 3300005331 Bacteria 1223
40 Ga0070670_100595334 3300005331 Bacteria 989
41 Ga0070670_101829981 3300005331 Bacteria 559
42 Ga0070677_10334013 3300005333 Bacteria 780
43 Ga0068869_100000003 3300005334 Bacteria 136262
44 Ga0068869_100019239 3300005334 Bacteria 4661
45 Ga0068869_100095291 3300005334 Bacteria 2246
46 Ga0068869_100366643 3300005334 Bacteria 1177
47 Ga0068869_100896891 3300005334 Bacteria 767
48 Ga0070666_10000884 3300005335 Bacteria 18202
49 Ga0070666_10006103 3300005335 Bacteria 7405
50 Ga0070666_10024530 3300005335 Bacteria 3929
51 Ga0070666_10054675 3300005335 Bacteria 2693
52 Ga0070666_10145841 3300005335 Bacteria 1650
53 Ga0070666_11173982 3300005335 Bacteria 571
54 Ga0070680_100007267 3300005336 Bacteria 8440
55 Ga0070680_100230739 3300005336 Bacteria 1563
56 Ga0070680_100353727 3300005336 Bacteria 1249
57 Ga0070680_101378477 3300005336 Bacteria 610
58 Ga0070682_100001991 3300005337 Bacteria 11391
59 Ga0070682_101084684 3300005337 Bacteria 669
60 Ga0068868_100324089 3300005338 Bacteria 1313
61 Ga0068868_100544572 3300005338 Bacteria 1022
62 Ga0068868_102075944 3300005338 Bacteria 540
63 Ga0070660_100000250 3300005339 Bacteria 35322
64 Ga0070660_100002417 3300005339 Bacteria 12831
65 Ga0070660_100026492 3300005339 Bacteria 4317
66 Ga0070660_100046126 3300005339 Bacteria 3339
67 Ga0070660_100055667 3300005339 Bacteria 3057
68 Ga0070660_100093705 3300005339 Bacteria 2372
69 Ga0070660_100170693 3300005339 Bacteria 1757
70 Ga0070660_100177943 3300005339 Bacteria 1721
71 Ga0070660_100232712 3300005339 Bacteria 1499
72 Ga0070660_100253050 3300005339 Bacteria 1437
73 Ga0070660_100340835 3300005339 Bacteria 1233
74 Ga0070660_100611987 3300005339 Bacteria 911
75 Ga0070660_100782260 3300005339 Unclassified 802
76 Ga0070660_100977193 3300005339 Bacteria 715
77 Ga0070660_101129960 3300005339 Unclassified 663
78 Ga0070660_101760559 3300005339 Bacteria 528
79 Ga0070689_100713321 3300005340 Bacteria 877
80 Ga0070691_10012295 3300005341 Bacteria 3919
81 Ga0070661_100001054 3300005344 Bacteria 19518
82 Ga0070661_100003236 3300005344 Bacteria 11223
83 Ga0070661_100022414 3300005344 Bacteria 4522
84 Ga0070661_100029090 3300005344 Bacteria 3986
85 Ga0070661_100031501 3300005344 Bacteria 3836
86 Ga0070661_100056133 3300005344 Bacteria 2885
87 Ga0070661_100126250 3300005344 Bacteria 1919
88 Ga0070661_100355253 3300005344 Bacteria 1151
89 Ga0070661_100452111 3300005344 Bacteria 1022
90 Ga0070661_100506277 3300005344 Bacteria 967
91 Ga0070692_10121306 3300005345 Bacteria 1458
92 Ga0070668_100017279 3300005347 Bacteria 5400
93 Ga0070668_100091326 3300005347 Bacteria 2400
94 Ga0070668_100363532 3300005347 Bacteria 1228
95 Ga0070668_100436094 3300005347 Bacteria 1124
96 Ga0070668_100516349 3300005347 Bacteria 1036
97 Ga0070669_100000128 3300005353 Bacteria 69625
98 Ga0070669_100493804 3300005353 Bacteria 1014
99 Ga0070675_100021830 3300005354 Bacteria 5114
100 Ga0070675_100207368 3300005354 Bacteria 1703
101 Ga0070675_100256271 3300005354 Bacteria 1532
102 Ga0070671_100001903 3300005355 Bacteria 15966
103 Ga0070671_100002164 3300005355 Bacteria 15156
104 Ga0070671_100010471 3300005355 Bacteria 7440
105 Ga0070671_100018594 3300005355 Bacteria 5646
106 Ga0070671_100026350 3300005355 Bacteria 4777
107 Ga0070671_100087854 3300005355 Bacteria 2601
108 Ga0070671_100113429 3300005355 Bacteria 2277
109 Ga0070671_100158187 3300005355 Bacteria 1915
110 Ga0070671_100181312 3300005355 Bacteria 1783
111 Ga0070671_100313718 3300005355 Bacteria 1336
112 Ga0070671_100696758 3300005355 Bacteria 881
113 Ga0070674_100043258 3300005356 Bacteria 3063
114 Ga0070674_100703569 3300005356 Bacteria 864
115 Ga0070673_100000246 3300005364 Bacteria 27366
116 Ga0070673_100004377 3300005364 Bacteria 8920
117 Ga0070673_100016187 3300005364 Bacteria 5264
118 Ga0070673_100047382 3300005364 Bacteria 3344
119 Ga0070673_100153384 3300005364 Bacteria 1953
120 Ga0070673_100157468 3300005364 Bacteria 1929
121 Ga0070673_100176444 3300005364 Bacteria 1827
122 Ga0070673_100363123 3300005364 Bacteria 1288
123 Ga0070673_100524810 3300005364 Bacteria 1073
124 Ga0070673_100570426 3300005364 Bacteria 1030
125 Ga0070673_100607457 3300005364 Bacteria 998
126 Ga0070673_100746189 3300005364 Bacteria 901
127 Ga0070673_100860824 3300005364 Bacteria 839
128 Ga0070688_100065199 3300005365 Bacteria 2314
129 Ga0070659_100000086 3300005366 Bacteria 70060
130 Ga0070659_100000220 3300005366 Bacteria 44199
131 Ga0070659_100006587 3300005366 Bacteria 8388
132 Ga0070659_100026025 3300005366 Bacteria 4500
133 Ga0070659_100056648 3300005366 Bacteria 3090
134 Ga0070659_100182889 3300005366 Unclassified 1721
135 Ga0070659_100240078 3300005366 Bacteria 1499
136 Ga0070659_100324411 3300005366 Bacteria 1288
137 Ga0070659_100404712 3300005366 Bacteria 1152
138 Ga0070659_100501467 3300005366 Bacteria 1035
139 Ga0070659_100546210 3300005366 Bacteria 991
140 Ga0070667_100001773 3300005367 Bacteria 19224
141 Ga0070667_100003156 3300005367 Bacteria 14136
142 Ga0070667_100014642 3300005367 Bacteria 6481
143 Ga0070667_100060804 3300005367 Bacteria 3197
144 Ga0070667_100237985 3300005367 Bacteria 1625
145 Ga0070667_100286079 3300005367 Bacteria 1481
146 Ga0070667_100325414 3300005367 Bacteria 1388
147 Ga0070667_100555974 3300005367 Bacteria 1055
148 Ga0070667_100650974 3300005367 Bacteria 973
149 Ga0070713_100394916 3300005436 Bacteria 1291
150 Ga0070705_100141430 3300005440 Bacteria 1584
151 Ga0070663_100006282 3300005455 Bacteria 7129
152 Ga0070663_100033054 3300005455 Bacteria 3570
153 Ga0070663_100046546 3300005455 Bacteria 3069
154 Ga0070663_100251466 3300005455 Bacteria 1399
155 Ga0070663_100261141 3300005455 Bacteria 1374
156 Ga0070663_100440491 3300005455 Bacteria 1072
157 Ga0070678_100025760 3300005456 Bacteria 3964
158 Ga0070678_100035320 3300005456 Bacteria 3488
159 Ga0070678_100154050 3300005456 Bacteria 1855
160 Ga0070678_100196013 3300005456 Bacteria 1664
161 Ga0070678_100340329 3300005456 Bacteria 1287
162 Ga0070662_100000082 3300005457 Bacteria 53245
163 Ga0070662_100008030 3300005457 Bacteria 6867
164 Ga0070662_100010506 3300005457 Bacteria 6079
165 Ga0070662_100049411 3300005457 Bacteria 3033
166 Ga0070662_100089592 3300005457 Bacteria 2308
167 Ga0070662_100091286 3300005457 Bacteria 2287
168 Ga0070662_100162330 3300005457 Bacteria 1748
169 Ga0070662_100457398 3300005457 Unclassified 1060
170 Ga0070662_100544910 3300005457 Bacteria 972
171 Ga0070662_101236611 3300005457 Unclassified 642
172 Ga0070681_10012374 3300005458 Bacteria 8462
173 Ga0070681_10057409 3300005458 Bacteria 3872
174 Ga0070681_10069197 3300005458 Bacteria 3496
175 Ga0070681_10243101 3300005458 Bacteria 1713
176 Ga0070681_11658749 3300005458 Bacteria 565
177 Ga0068867_100428811 3300005459 Bacteria 1122
178 Ga0068867_100645407 3300005459 Bacteria 928
179 Ga0068867_100979222 3300005459 Bacteria 766
180 Ga0070685_10033567 3300005466 Bacteria 2885
181 Ga0070685_10169714 3300005466 Bacteria 1397
182 Ga0070679_100018589 3300005530 Bacteria 6747
183 Ga0070679_100124162 3300005530 Bacteria 2565
184 Ga0070679_100217563 3300005530 Bacteria 1872
185 Ga0070679_100678515 3300005530 Bacteria 973
186 Ga0070684_100080161 3300005535 Bacteria 2887
187 Ga0070684_100177984 3300005535 Bacteria 1933
188 Ga0070684_100308050 3300005535 Bacteria 1454
189 Ga0068853_100000151 3300005539 Bacteria 47652
190 Ga0068853_100000445 3300005539 Bacteria 28074
191 Ga0068853_100062760 3300005539 Bacteria 3216
192 Ga0068853_100070372 3300005539 Bacteria 3045
193 Ga0068853_100071409 3300005539 Bacteria 3023
194 Ga0068853_100086350 3300005539 Bacteria 2751
195 Ga0068853_100123234 3300005539 Bacteria 2314
196 Ga0068853_100481613 3300005539 Bacteria 1170
197 Ga0068853_100657446 3300005539 Bacteria 998
198 Ga0070672_100000678 3300005543 Bacteria 20007
199 Ga0070672_100106233 3300005543 Bacteria 2284
200 Ga0070672_100112352 3300005543 Bacteria 2222
201 Ga0070672_100171845 3300005543 Bacteria 1803
202 Ga0070672_100208020 3300005543 Bacteria 1638
203 Ga0070672_100252426 3300005543 Bacteria 1486
204 Ga0070672_100861809 3300005543 Bacteria 799
205 Ga0070672_100907879 3300005543 Unclassified 778
206 Ga0070686_100369235 3300005544 Bacteria 1083
207 Ga0070696_100089348 3300005546 Bacteria 2190
208 Ga0070696_100165995 3300005546 Bacteria 1629
209 Ga0070696_100245086 3300005546 Bacteria 1353
210 Ga0070693_100001450 3300005547 Bacteria 10691
211 Ga0070693_100010518 3300005547 Bacteria 4639
212 Ga0070693_100041177 3300005547 Bacteria 2598
213 Ga0070693_100310037 3300005547 Bacteria 1067
214 Ga0070693_100509561 3300005547 Bacteria 855
215 Ga0070693_100538303 3300005547 Bacteria 834
216 Ga0070693_100552724 3300005547 Bacteria 824
217 Ga0070693_100793986 3300005547 Bacteria 701
218 Ga0070665_100000670 3300005548 Bacteria 45961
219 Ga0070665_100005768 3300005548 Bacteria 12717
220 Ga0070665_100016152 3300005548 Bacteria 7493
221 Ga0070665_100404089 3300005548 Bacteria 1374
222 Ga0068855_100000742 3300005563 Bacteria 40114
223 Ga0068855_100024023 3300005563 Bacteria 7298
224 Ga0068855_100083536 3300005563 Bacteria 3699
225 Ga0068855_100111850 3300005563 Bacteria 3134
226 Ga0068855_100119558 3300005563 Bacteria 3016
227 Ga0068855_100122939 3300005563 Bacteria 2969
228 Ga0068855_100722685 3300005563 Bacteria 1064
229 Ga0068855_100940332 3300005563 Bacteria 911
230 Ga0070664_100000113 3300005564 Bacteria 53220
231 Ga0070664_100001064 3300005564 Bacteria 21598
232 Ga0070664_100002825 3300005564 Bacteria 14048
233 Ga0070664_100005653 3300005564 Bacteria 10065
234 Ga0070664_100006778 3300005564 Bacteria 9236
235 Ga0070664_100014102 3300005564 Bacteria 6519
236 Ga0070664_100059305 3300005564 Bacteria 3256
237 Ga0070664_100082459 3300005564 Bacteria 2773
238 Ga0070664_100175682 3300005564 Bacteria 1901
239 Ga0070664_100183145 3300005564 Bacteria 1863
240 Ga0070664_100261746 3300005564 Bacteria 1556
241 Ga0070664_100314010 3300005564 Bacteria 1419
242 Ga0070664_100911527 3300005564 Bacteria 824
243 Ga0068857_100000026 3300005577 Bacteria 83525
244 Ga0068857_100002666 3300005577 Bacteria 14652
245 Ga0068857_100054437 3300005577 Bacteria 3550
246 Ga0068857_100163878 3300005577 Bacteria 2018
247 Ga0068857_100164615 3300005577 Bacteria 2013
248 Ga0068857_100243664 3300005577 Bacteria 1646
249 Ga0068857_100374714 3300005577 Bacteria 1321
250 Ga0068857_100428936 3300005577 Bacteria 1233
251 Ga0068857_100739490 3300005577 Bacteria 936
252 Ga0068854_100000204 3300005578 Bacteria 40135
253 Ga0068854_100018213 3300005578 Bacteria 4712
254 Ga0068854_100049580 3300005578 Bacteria 3000
255 Ga0068854_100068041 3300005578 Bacteria 2597
256 Ga0068854_100087267 3300005578 Bacteria 2314
257 Ga0068854_100135205 3300005578 Bacteria 1887
258 Ga0068854_100175924 3300005578 Bacteria 1668
259 Ga0068854_100540343 3300005578 Bacteria 987
260 Ga0068854_102140081 3300005578 Unclassified 517
261 Ga0068856_100000159 3300005614 Bacteria 70023
262 Ga0068856_100015626 3300005614 Bacteria 7339
263 Ga0068856_100020782 3300005614 Bacteria 6380
264 Ga0068856_100124031 3300005614 Bacteria 2585
265 Ga0068856_100582725 3300005614 Bacteria 1140
266 Ga0068856_100608922 3300005614 Bacteria 1113
267 Ga0070702_101156370 3300005615 Bacteria 621
268 Ga0068852_100001609 3300005616 Bacteria 15379
269 Ga0068852_100002795 3300005616 Bacteria 12094
270 Ga0068852_100005356 3300005616 Bacteria 9167
271 Ga0068852_100007134 3300005616 Bacteria 8142
272 Ga0068852_100018018 3300005616 Bacteria 5554
273 Ga0068852_100127873 3300005616 Bacteria 2336
274 Ga0068852_100148134 3300005616 Unclassified 2179
275 Ga0068852_100163416 3300005616 Bacteria 2081
276 Ga0068852_100252736 3300005616 Bacteria 1689
277 Ga0068852_100365763 3300005616 Bacteria 1412
278 Ga0068852_100444417 3300005616 Bacteria 1282
279 Ga0068852_100503233 3300005616 Bacteria 1206
280 Ga0068859_100000088 3300005617 Bacteria 84390
281 Ga0068859_100033189 3300005617 Bacteria 5184
282 Ga0068859_100053844 3300005617 Bacteria 4046
283 Ga0068859_100158637 3300005617 Bacteria 2341
284 Ga0068859_100426855 3300005617 Bacteria 1422
285 Ga0068864_100000047 3300005618 Bacteria 150798
286 Ga0068864_100000136 3300005618 Bacteria 70797
287 Ga0068864_100002002 3300005618 Bacteria 16780
288 Ga0068864_100026287 3300005618 Bacteria 4909
289 Ga0068864_100030216 3300005618 Bacteria 4592
290 Ga0068864_100078328 3300005618 Bacteria 2892
291 Ga0068864_100106047 3300005618 Bacteria 2498
292 Ga0068864_100386912 3300005618 Bacteria 1327
293 Ga0068864_100387989 3300005618 Bacteria 1325
294 Ga0068864_100515142 3300005618 Bacteria 1152
295 Ga0068864_100715232 3300005618 Bacteria 979
296 Ga0068866_10013190 3300005718 Bacteria 3618
297 Ga0068861_100190840 3300005719 Bacteria 1713
298 Ga0068861_100213043 3300005719 Bacteria 1628
299 Ga0068851_10022453 3300005834 Bacteria 3074
300 Ga0068851_10116146 3300005834 Bacteria 1434
301 Ga0068851_10209711 3300005834 Bacteria 1090
302 Ga0068870_10481884 3300005840 Unclassified 823
303 Ga0068863_100000289 3300005841 Bacteria 52032
304 Ga0068863_100000384 3300005841 Bacteria 44825
305 Ga0068863_100026719 3300005841 Bacteria 5504
306 Ga0068863_100069439 3300005841 Bacteria 3331
307 Ga0068863_100118542 3300005841 Bacteria 2523
308 Ga0068863_100191488 3300005841 Bacteria 1965
309 Ga0068863_100405460 3300005841 Bacteria 1334
310 Ga0068863_100560101 3300005841 Bacteria 1129
311 Ga0068863_100653844 3300005841 Bacteria 1043
312 Ga0068863_100719154 3300005841 Bacteria 993
313 Ga0068858_100000063 3300005842 Bacteria 111811
314 Ga0068858_100000425 3300005842 Bacteria 43961
315 Ga0068858_100031041 3300005842 Bacteria 4962
316 Ga0068858_100237313 3300005842 Bacteria 1729
317 Ga0068858_100247150 3300005842 Bacteria 1694
318 Ga0068858_101445295 3300005842 Bacteria 678
319 Ga0068860_100000607 3300005843 Bacteria 42670
320 Ga0068860_100012203 3300005843 Bacteria 8464
321 Ga0068860_100441416 3300005843 Bacteria 1293
322 Ga0068860_100692598 3300005843 Bacteria 1028
323 Ga0068860_101400986 3300005843 Unclassified 720
324 Ga0068862_100013784 3300005844 Bacteria 6700
325 Ga0068862_100041919 3300005844 Bacteria 3896
326 Ga0068862_100120945 3300005844 Bacteria 2308
327 Ga0068862_100190207 3300005844 Bacteria 1846
328 Ga0068862_101556119 3300005844 Unclassified 667
329 Ga0097621_100054470 3300006237 Bacteria 3263
330 Ga0097621_100091987 3300006237 Bacteria 2540
331 Ga0097621_100920426 3300006237 Bacteria 815
332 Ga0097621_100977072 3300006237 Bacteria 791
333 Ga0068871_100049999 3300006358 Bacteria 3381
334 Ga0068871_100057213 3300006358 Bacteria 3172
335 Ga0068871_100145476 3300006358 Bacteria 2018
336 Ga0068871_100241724 3300006358 Bacteria 1570
337 Ga0068865_100003059 3300006881 Bacteria 10004
338 Ga0097620_100000088 3300006931 Bacteria 84390
339 Ga0097620_100033190 3300006931 Bacteria 5184
340 Ga0097620_100053841 3300006931 Bacteria 4046
341 Ga0097620_100158625 3300006931 Bacteria 2341
342 Ga0097620_100426840 3300006931 Bacteria 1422
343 Ga0105240_10018703 3300009093 Bacteria 9282
344 Ga0105245_10000062 3300009098 Bacteria 115179
345 Ga0105245_12240733 3300009098 Bacteria 600
346 Ga0105247_10472138 3300009101 Unclassified 909
347 Ga0105243_10170496 3300009148 Bacteria 1884
348 Ga0105243_10459793 3300009148 Bacteria 1196
349 Ga0105243_10497326 3300009148 Bacteria 1154
350 Ga0105241_10027471 3300009174 Bacteria 4239
351 Ga0105241_10299643 3300009174 Bacteria 1379
352 Ga0105241_10372702 3300009174 Bacteria 1245
353 Ga0105242_10148825 3300009176 Bacteria 2040
354 Ga0105248_10000169 3300009177 Bacteria 75948
355 Ga0105248_10000213 3300009177 Bacteria 66972
356 Ga0105248_10003561 3300009177 Bacteria 17260
357 Ga0105248_10014260 3300009177 Bacteria 8749
358 Ga0105248_10024200 3300009177 Bacteria 6750
359 Ga0105248_10026764 3300009177 Bacteria 6414
360 Ga0105248_10132611 3300009177 Bacteria 2811
361 Ga0105248_10587743 3300009177 Bacteria 1256
362 Ga0105237_10255973 3300009545 Bacteria 1753
363 Ga0105237_10428760 3300009545 Bacteria 1328
364 Ga0105238_10039950 3300009551 Bacteria 4755
365 Ga0105238_10061055 3300009551 Bacteria 3773
366 Ga0105238_10135058 3300009551 Bacteria 2445
367 Ga0105238_10147620 3300009551 Bacteria 2328
368 Ga0105238_10436461 3300009551 Bacteria 1305
369 Ga0105238_12144720 3300009551 Unclassified 593
370 Ga0105249_10015607 3300009553 Bacteria 6723
371 Ga0105249_10299878 3300009553 Bacteria 1611
372 Ga0105249_10449128 3300009553 Bacteria 1327
373 Ga0105239_10020230 3300010375 Bacteria 7343
374 Ga0105239_10212149 3300010375 Bacteria 2171
375 Ga0105239_10298011 3300010375 Bacteria 1816
376 Ga0105246_10385049 3300011119 Bacteria 1160
377 Ga0157327_1008256 3300012512 Bacteria 929
378 Ga0157373_10010575 3300013100 Bacteria 6789
379 Ga0157373_10010638 3300013100 Bacteria 6771
380 Ga0157373_10010857 3300013100 Bacteria 6703
381 Ga0157373_10020523 3300013100 Bacteria 4801
382 Ga0157373_10064533 3300013100 Bacteria 2592
383 Ga0157373_10072993 3300013100 Bacteria 2422
384 Ga0157373_10118111 3300013100 Bacteria 1864
385 Ga0157373_10169489 3300013100 Bacteria 1536
386 Ga0157373_10311534 3300013100 Bacteria 1118
387 Ga0157371_10000144 3300013102 Bacteria 103512
388 Ga0157371_10008185 3300013102 Bacteria 8359
389 Ga0157371_10041479 3300013102 Bacteria 3283
390 Ga0157371_10086947 3300013102 Bacteria 2214
391 Ga0157371_10142892 3300013102 Bacteria 1705
392 Ga0157371_10216211 3300013102 Bacteria 1376
393 Ga0157370_10092018 3300013104 Bacteria 2847
394 Ga0157370_10167483 3300013104 Bacteria 2043
395 Ga0157370_10903006 3300013104 Bacteria 802
396 Ga0157370_11055054 3300013104 Bacteria 735
397 Ga0157369_10003544 3300013105 Bacteria 18538
398 Ga0157369_10030010 3300013105 Bacteria 6000
399 Ga0157369_10224944 3300013105 Bacteria 1963
400 Ga0157369_11485635 3300013105 Bacteria 689
401 Ga0157369_11485637 3300013105 Bacteria 689
402 Ga0157369_12165407 3300013105 Unclassified 564
403 Ga0157374_10004105 3300013296 Bacteria 12227
404 Ga0157374_10100278 3300013296 Bacteria 2776
405 Ga0157374_12772287 3300013296 Unclassified 518
406 Ga0157378_10006458 3300013297 Bacteria 10256
407 Ga0157378_10155159 3300013297 Bacteria 2136
408 Ga0157378_10619512 3300013297 Bacteria 1095
409 Ga0157378_11138296 3300013297 Bacteria 818
410 Ga0163162_10003404 3300013306 Bacteria 15182
411 Ga0163162_10056144 3300013306 Bacteria 3966
412 Ga0163162_10197697 3300013306 Bacteria 2139
413 Ga0157372_10046487 3300013307 Bacteria 4819
414 Ga0157372_10076912 3300013307 Bacteria 3769
415 Ga0157372_10095796 3300013307 Bacteria 3382
416 Ga0157372_10171629 3300013307 Bacteria 2509
417 Ga0157372_10351838 3300013307 Bacteria 1716
418 Ga0157372_12041713 3300013307 Bacteria 659
419 Ga0157375_10023721 3300013308 Bacteria 5666
420 Ga0157375_10202677 3300013308 Bacteria 2140
421 Ga0157375_11557776 3300013308 Bacteria 781
422 Ga0163163_10000170 3300014325 Bacteria 68377
423 Ga0163163_10007199 3300014325 Bacteria 9799
424 Ga0163163_10038859 3300014325 Bacteria 4641
425 Ga0163163_13064281 3300014325 Unclassified 521
426 Ga0157377_10042293 3300014745 Bacteria 2530
427 Ga0157377_10190557 3300014745 Bacteria 1296
428 Ga0157379_10014561 3300014968 Bacteria 6901
429 Ga0157379_10026488 3300014968 Bacteria 5162
430 Ga0207697_10000235 3300025315 Bacteria 30187
431 Ga0207656_10013768 3300025321 Bacteria 3100
432 Ga0207682_10033696 3300025893 Bacteria 2062
433 Ga0207682_10059578 3300025893 Bacteria 1595
434 Ga0207682_10230947 3300025893 Unclassified 858
435 Ga0207682_10523793 3300025893 Bacteria 561
436 Ga0207642_10018076 3300025899 Bacteria 2698
437 Ga0207688_10000105 3300025901 Bacteria 33639
438 Ga0207688_10011623 3300025901 Bacteria 4787
439 Ga0207688_10269388 3300025901 Bacteria 1036
440 Ga0207680_10001036 3300025903 Bacteria 13117
441 Ga0207680_10005854 3300025903 Bacteria 5899
442 Ga0207680_10051498 3300025903 Bacteria 2463
443 Ga0207647_10000317 3300025904 Bacteria 40172
444 Ga0207647_10022150 3300025904 Bacteria 4226
445 Ga0207647_10048752 3300025904 Bacteria 2630
446 Ga0207647_10066631 3300025904 Bacteria 2183
447 Ga0207647_10191669 3300025904 Bacteria 1184
448 Ga0207645_10169552 3300025907 Bacteria 1430
449 Ga0207645_10170611 3300025907 Bacteria 1426
450 Ga0207645_10186659 3300025907 Bacteria 1361
451 Ga0207645_10433965 3300025907 Bacteria 886
452 Ga0207705_10002520 3300025909 Bacteria 14113
453 Ga0207705_10005118 3300025909 Bacteria 9831
454 Ga0207705_10015546 3300025909 Bacteria 5461
455 Ga0207705_10023169 3300025909 Bacteria 4429
456 Ga0207705_10049129 3300025909 Bacteria 3036
457 Ga0207705_10543453 3300025909 Bacteria 903
458 Ga0207705_10669455 3300025909 Bacteria 807
459 Ga0207654_10012959 3300025911 Bacteria 4278
460 Ga0207654_10033550 3300025911 Bacteria 2846
461 Ga0207654_10124473 3300025911 Bacteria 1623
462 Ga0207654_11333117 3300025911 Unclassified 523
463 Ga0207707_10004641 3300025912 Bacteria 12067
464 Ga0207707_10048221 3300025912 Bacteria 3710
465 Ga0207707_10053006 3300025912 Bacteria 3531
466 Ga0207707_10060221 3300025912 Bacteria 3303
467 Ga0207695_10079126 3300025913 Bacteria 3333
468 Ga0207671_10168607 3300025914 Bacteria 1699
469 Ga0207671_10305702 3300025914 Bacteria 1257
470 Ga0207660_10014425 3300025917 Bacteria 5198
471 Ga0207660_10017918 3300025917 Bacteria 4714
472 Ga0207660_10113186 3300025917 Bacteria 2045
473 Ga0207657_10000276 3300025919 Bacteria 54727
474 Ga0207657_10006981 3300025919 Bacteria 11626
475 Ga0207657_10008965 3300025919 Bacteria 10108
476 Ga0207657_10009721 3300025919 Bacteria 9645
477 Ga0207657_10021115 3300025919 Bacteria 6134
478 Ga0207657_10022038 3300025919 Bacteria 5981
479 Ga0207657_10100151 3300025919 Bacteria 2406
480 Ga0207657_10116219 3300025919 Bacteria 2204
481 Ga0207657_10134148 3300025919 Bacteria 2027
482 Ga0207657_10419134 3300025919 Bacteria 1052
483 Ga0207657_10531051 3300025919 Bacteria 920
484 Ga0207649_10000277 3300025920 Bacteria 40521
485 Ga0207649_10016582 3300025920 Bacteria 4158
486 Ga0207649_10043598 3300025920 Bacteria 2744
487 Ga0207649_10074078 3300025920 Bacteria 2184
488 Ga0207649_10074123 3300025920 Bacteria 2183
489 Ga0207649_10083948 3300025920 Bacteria 2069
490 Ga0207649_10095425 3300025920 Bacteria 1957
491 Ga0207649_10180989 3300025920 Bacteria 1475
492 Ga0207649_10287694 3300025920 Bacteria 1197
493 Ga0207652_10067087 3300025921 Bacteria 3110
494 Ga0207652_10088836 3300025921 Bacteria 2712
495 Ga0207652_10174820 3300025921 Bacteria 1928
496 Ga0207652_10933216 3300025921 Unclassified 765
497 Ga0207681_10000464 3300025923 Bacteria 28460
498 Ga0207681_10293636 3300025923 Bacteria 1284
499 Ga0207681_10350771 3300025923 Bacteria 1181
500 Ga0207694_10000665 3300025924 Bacteria 30841
501 Ga0207694_10007008 3300025924 Bacteria 8558
502 Ga0207694_10012855 3300025924 Bacteria 6304
503 Ga0207694_10111508 3300025924 Bacteria 2176
504 Ga0207694_10141210 3300025924 Bacteria 1937
505 Ga0207694_10629975 3300025924 Bacteria 903
506 Ga0207650_10003341 3300025925 Bacteria 11039
507 Ga0207650_10032359 3300025925 Bacteria 3782
508 Ga0207650_10055415 3300025925 Bacteria 2943
509 Ga0207650_10154951 3300025925 Bacteria 1811
510 Ga0207650_10164594 3300025925 Bacteria 1759
511 Ga0207650_10194317 3300025925 Bacteria 1623
512 Ga0207659_10015621 3300025926 Bacteria 4925
513 Ga0207659_10031942 3300025926 Bacteria 3609
514 Ga0207659_10166557 3300025926 Bacteria 1735
515 Ga0207659_10534284 3300025926 Bacteria 995
516 Ga0207659_11007409 3300025926 Bacteria 717
517 Ga0207700_10095291 3300025928 Bacteria 2360
518 Ga0207700_10335241 3300025928 Unclassified 1314
519 Ga0207664_10039226 3300025929 Bacteria 3677
520 Ga0207644_10000135 3300025931 Bacteria 53131
521 Ga0207644_10011667 3300025931 Bacteria 5820
522 Ga0207644_10014273 3300025931 Bacteria 5313
523 Ga0207644_10022800 3300025931 Bacteria 4280
524 Ga0207644_10036398 3300025931 Bacteria 3454
525 Ga0207644_10038966 3300025931 Bacteria 3352
526 Ga0207644_10058370 3300025931 Bacteria 2789
527 Ga0207644_10092874 3300025931 Bacteria 2252
528 Ga0207644_10136773 3300025931 Bacteria 1882
529 Ga0207644_10180558 3300025931 Bacteria 1654
530 Ga0207644_10773020 3300025931 Unclassified 803
531 Ga0207690_10000100 3300025932 Bacteria 71510
532 Ga0207690_10012213 3300025932 Bacteria 5140
533 Ga0207690_10013151 3300025932 Bacteria 4967
534 Ga0207690_10059551 3300025932 Bacteria 2588
535 Ga0207690_10061648 3300025932 Bacteria 2550
536 Ga0207690_10061924 3300025932 Bacteria 2545
537 Ga0207690_10229938 3300025932 Unclassified 1423
538 Ga0207690_10240902 3300025932 Bacteria 1393
539 Ga0207690_10302261 3300025932 Bacteria 1252
540 Ga0207690_10358011 3300025932 Bacteria 1155
541 Ga0207690_10478718 3300025932 Bacteria 1004
542 Ga0207706_10000020 3300025933 Bacteria 162063
543 Ga0207706_10000599 3300025933 Bacteria 38339
544 Ga0207706_10001396 3300025933 Bacteria 24136
545 Ga0207706_10007937 3300025933 Bacteria 9797
546 Ga0207706_10012892 3300025933 Bacteria 7608
547 Ga0207706_10037064 3300025933 Bacteria 4330
548 Ga0207706_10038918 3300025933 Bacteria 4218
549 Ga0207706_10087567 3300025933 Bacteria 2739
550 Ga0207706_10114742 3300025933 Bacteria 2369
551 Ga0207706_10172552 3300025933 Bacteria 1900
552 Ga0207706_10502143 3300025933 Bacteria 1047
553 Ga0207706_10718404 3300025933 Bacteria 853
554 Ga0207706_11230616 3300025933 Unclassified 621
555 Ga0207706_11411261 3300025933 Bacteria 571
556 Ga0207686_10296363 3300025934 Bacteria 1199
557 Ga0207709_10185110 3300025935 Bacteria 1474
558 Ga0207669_10811738 3300025937 Unclassified 776
559 Ga0207691_10006983 3300025940 Bacteria 10893
560 Ga0207691_10056858 3300025940 Bacteria 3562
561 Ga0207691_10171393 3300025940 Bacteria 1900
562 Ga0207691_10248112 3300025940 Bacteria 1537
563 Ga0207691_10569563 3300025940 Bacteria 960
564 Ga0207691_10653754 3300025940 Bacteria 888
565 Ga0207691_10980731 3300025940 Bacteria 706
566 Ga0207711_10000039 3300025941 Bacteria 162974
567 Ga0207711_10001037 3300025941 Bacteria 26586
568 Ga0207711_10002235 3300025941 Bacteria 17366
569 Ga0207711_10003908 3300025941 Bacteria 12822
570 Ga0207711_10003962 3300025941 Bacteria 12735
571 Ga0207711_10005938 3300025941 Bacteria 10321
572 Ga0207711_10008931 3300025941 Bacteria 8379
573 Ga0207711_10868906 3300025941 Bacteria 839
574 Ga0207689_10000002 3300025942 Bacteria 198437
575 Ga0207689_10139236 3300025942 Bacteria 1999
576 Ga0207661_10021061 3300025944 Bacteria 4883
577 Ga0207661_10113999 3300025944 Bacteria 2291
578 Ga0207661_10590768 3300025944 Bacteria 1019
579 Ga0207661_10834039 3300025944 Unclassified 849
580 Ga0207679_10002666 3300025945 Bacteria 11018
581 Ga0207679_10002737 3300025945 Bacteria 10906
582 Ga0207679_10003893 3300025945 Bacteria 9259
583 Ga0207679_10004468 3300025945 Bacteria 8717
584 Ga0207679_10022589 3300025945 Bacteria 4286
585 Ga0207679_10119088 3300025945 Bacteria 2098
586 Ga0207679_10123142 3300025945 Bacteria 2068
587 Ga0207679_10136232 3300025945 Bacteria 1978
588 Ga0207679_10170241 3300025945 Bacteria 1792
589 Ga0207679_10397105 3300025945 Bacteria 1212
590 Ga0207679_10564716 3300025945 Bacteria 1022
591 Ga0207679_10646223 3300025945 Bacteria 956
592 Ga0207679_10717919 3300025945 Bacteria 908
593 Ga0207667_10012308 3300025949 Bacteria 9871
594 Ga0207667_10025048 3300025949 Bacteria 6540
595 Ga0207667_10058193 3300025949 Bacteria 4055
596 Ga0207667_10188359 3300025949 Bacteria 2118
597 Ga0207667_10219258 3300025949 Bacteria 1949
598 Ga0207667_10297661 3300025949 Bacteria 1648
599 Ga0207667_11446982 3300025949 Bacteria 659
600 Ga0207651_10000129 3300025960 Bacteria 32451
601 Ga0207651_10001862 3300025960 Bacteria 9857
602 Ga0207651_10043848 3300025960 Bacteria 2988
603 Ga0207651_10052238 3300025960 Bacteria 2785
604 Ga0207651_10061772 3300025960 Bacteria 2608
605 Ga0207651_10068648 3300025960 Bacteria 2500
606 Ga0207651_10120019 3300025960 Bacteria 1992
607 Ga0207651_10147961 3300025960 Bacteria 1824
608 Ga0207651_10305223 3300025960 Bacteria 1325
609 Ga0207651_10325773 3300025960 Bacteria 1286
610 Ga0207651_11160651 3300025960 Unclassified 693
611 Ga0207712_10009376 3300025961 Bacteria 6193
612 Ga0207668_10008198 3300025972 Bacteria 6222
613 Ga0207668_10191945 3300025972 Bacteria 1619
614 Ga0207668_10336638 3300025972 Bacteria 1257
615 Ga0207668_10494610 3300025972 Bacteria 1051
616 Ga0207668_10515937 3300025972 Bacteria 1030
617 Ga0207668_10856099 3300025972 Bacteria 807
618 Ga0207640_10011803 3300025981 Bacteria 4958
619 Ga0207640_10012805 3300025981 Bacteria 4790
620 Ga0207640_10019760 3300025981 Bacteria 3986
621 Ga0207640_10049427 3300025981 Bacteria 2723
622 Ga0207640_10543544 3300025981 Bacteria 975
623 Ga0207640_10611879 3300025981 Bacteria 924
624 Ga0207640_11153836 3300025981 Bacteria 687
625 Ga0207640_11354219 3300025981 Bacteria 637
626 Ga0207640_11482844 3300025981 Unclassified 609
627 Ga0207658_10002756 3300025986 Bacteria 12666
628 Ga0207658_10003522 3300025986 Bacteria 11046
629 Ga0207658_10011278 3300025986 Bacteria 6086
630 Ga0207658_10016582 3300025986 Bacteria 5070
631 Ga0207658_10023565 3300025986 Bacteria 4299
632 Ga0207658_10044234 3300025986 Bacteria 3241
633 Ga0207658_10835681 3300025986 Bacteria 837
634 Ga0207658_11154719 3300025986 Bacteria 708
635 Ga0207658_11450075 3300025986 Bacteria 628
636 Ga0207677_10000730 3300026023 Bacteria 19217
637 Ga0207677_10296696 3300026023 Bacteria 1334
638 Ga0207677_10695336 3300026023 Bacteria 902
639 Ga0207677_11585693 3300026023 Bacteria 606
640 Ga0207703_10000327 3300026035 Bacteria 51797
641 Ga0207703_10002423 3300026035 Bacteria 16178
642 Ga0207703_10044106 3300026035 Bacteria 3582
643 Ga0207703_10044171 3300026035 Bacteria 3580
644 Ga0207703_10370726 3300026035 Bacteria 1322
645 Ga0207703_10853035 3300026035 Unclassified 871
646 Ga0207639_10000162 3300026041 Bacteria 51395
647 Ga0207639_10000987 3300026041 Bacteria 19374
648 Ga0207639_10002509 3300026041 Bacteria 12311
649 Ga0207639_10022710 3300026041 Bacteria 4521
650 Ga0207639_10061546 3300026041 Bacteria 2900
651 Ga0207639_10076481 3300026041 Bacteria 2636
652 Ga0207639_10266233 3300026041 Bacteria 1501
653 Ga0207639_10435418 3300026041 Bacteria 1188
654 Ga0207639_10503359 3300026041 Bacteria 1107
655 Ga0207678_10002193 3300026067 Bacteria 17637
656 Ga0207678_10006809 3300026067 Bacteria 10136
657 Ga0207678_10018272 3300026067 Bacteria 6158
658 Ga0207678_10021004 3300026067 Bacteria 5722
659 Ga0207678_10557129 3300026067 Bacteria 1003
660 Ga0207702_10000208 3300026078 Bacteria 69979
661 Ga0207702_10003777 3300026078 Bacteria 13675
662 Ga0207702_10141460 3300026078 Bacteria 2178
663 Ga0207702_10192854 3300026078 Bacteria 1884
664 Ga0207702_10395461 3300026078 Bacteria 1332
665 Ga0207641_10000138 3300026088 Bacteria 106531
666 Ga0207641_10005315 3300026088 Bacteria 10996
667 Ga0207641_10006307 3300026088 Bacteria 10025
668 Ga0207641_10142768 3300026088 Bacteria 2162
669 Ga0207641_11582390 3300026088 Unclassified 657
670 Ga0207648_10000088 3300026089 Bacteria 86596
671 Ga0207648_10084467 3300026089 Bacteria 2769
672 Ga0207648_10124112 3300026089 Bacteria 2271
673 Ga0207648_10563743 3300026089 Bacteria 1047
674 Ga0207648_10697362 3300026089 Bacteria 941
675 Ga0207648_11488926 3300026089 Bacteria 636
676 Ga0207676_10000515 3300026095 Bacteria 32509
677 Ga0207676_10000983 3300026095 Bacteria 21929
678 Ga0207676_10004548 3300026095 Bacteria 9819
679 Ga0207676_10012563 3300026095 Bacteria 6071
680 Ga0207676_10027546 3300026095 Bacteria 4233
681 Ga0207676_10029511 3300026095 Bacteria 4108
682 Ga0207676_10038715 3300026095 Bacteria 3641
683 Ga0207676_10449007 3300026095 Unclassified 1215
684 Ga0207676_11229049 3300026095 Bacteria 743
685 Ga0207674_10000280 3300026116 Bacteria 64258
686 Ga0207674_10004467 3300026116 Bacteria 16817
687 Ga0207674_10010727 3300026116 Bacteria 10342
688 Ga0207674_10025071 3300026116 Bacteria 6364
689 Ga0207674_10065380 3300026116 Bacteria 3666
690 Ga0207674_10194973 3300026116 Bacteria 1975
691 Ga0207674_10287039 3300026116 Bacteria 1594
692 Ga0207674_10558963 3300026116 Bacteria 1105
693 Ga0207675_100188829 3300026118 Bacteria 1975
694 Ga0207675_100274207 3300026118 Bacteria 1638
695 Ga0207683_10004836 3300026121 Bacteria 11597
696 Ga0207683_10025793 3300026121 Bacteria 5071
697 Ga0207683_10088040 3300026121 Bacteria 2762
698 Ga0207698_10000985 3300026142 Bacteria 16510
699 Ga0207698_10001063 3300026142 Bacteria 15973
700 Ga0207698_10003393 3300026142 Bacteria 9589
701 Ga0207698_10005551 3300026142 Bacteria 7800
702 Ga0207698_10007116 3300026142 Bacteria 7007
703 Ga0207698_10062459 3300026142 Bacteria 2909
704 Ga0207698_10110846 3300026142 Bacteria 2299
705 Ga0207698_10315812 3300026142 Bacteria 1461
706 Ga0207698_10402532 3300026142 Bacteria 1308
707 Ga0207698_10515583 3300026142 Unclassified 1166
708 Ga0207698_11066088 3300026142 Bacteria 820
709 Ga0207698_11786903 3300026142 Unclassified 630
710 Ga0207698_12464535 3300026142 Unclassified 531
711 Ga0268266_10000332 3300028379 Bacteria 74181
712 Ga0268266_10009906 3300028379 Bacteria 8374
713 Ga0268266_10032749 3300028379 Bacteria 4416
714 Ga0268265_10035676 3300028380 Bacteria 3636
715 Ga0268265_10091884 3300028380 Bacteria 2428
716 Ga0268265_10158346 3300028380 Bacteria 1919
717 Ga0268265_10761730 3300028380 Bacteria 940
718 Ga0268265_11037318 3300028380 Bacteria 811
719 Ga0268264_10002587 3300028381 Bacteria 15829
720 Ga0268264_10145488 3300028381 Bacteria 2119
721 Ga0268264_10154248 3300028381 Bacteria 2062
722 Ga0268264_10568549 3300028381 Unclassified 1114
723 Ga0307515_10317854 3300028794 Bacteria 1226
724 Ga0307408_100071025 3300031548 Bacteria 2572
725 Ga0307408_100222388 3300031548 Bacteria 1541
726 Ga0307405_10004772 3300031731 Bacteria 6461
727 Ga0307405_10015897 3300031731 Bacteria 4089
728 Ga0307405_10502095 3300031731 Bacteria 972
729 Ga0307413_10078906 3300031824 Bacteria 2102
730 Ga0307413_10251420 3300031824 Bacteria 1311
731 Ga0307413_10330340 3300031824 Bacteria 1168
732 Ga0307410_10012782 3300031852 Bacteria 4870
733 Ga0307410_10432754 3300031852 Bacteria 1070
734 Ga0307410_10653000 3300031852 Bacteria 882
735 Ga0307410_11058791 3300031852 Bacteria 701
736 Ga0307406_10045708 3300031901 Bacteria 2750
737 Ga0307406_10283110 3300031901 Bacteria 1265
738 Ga0307407_10010121 3300031903 Bacteria 4432
739 Ga0307407_10024606 3300031903 Bacteria 3160
740 Ga0307407_10317852 3300031903 Bacteria 1091
741 Ga0307407_10581587 3300031903 Bacteria 831
742 Ga0307412_10016705 3300031911 Bacteria 4377
743 Ga0307409_100037764 3300031995 Bacteria 3563
744 Ga0307409_100076204 3300031995 Bacteria 2688
745 Ga0307409_100490003 3300031995 Bacteria 1195
746 Ga0307416_100010716 3300032002 Bacteria 6073
747 Ga0307416_101379483 3300032002 Bacteria 810
748 Ga0307414_10182934 3300032004 Bacteria 1687
749 Ga0307414_10924352 3300032004 Unclassified 800
750 Ga0307411_10001565 3300032005 Bacteria 9478
751 Ga0307411_10012502 3300032005 Bacteria 4635
752 Ga0307415_100097787 3300032126 Bacteria 2143
753 Ga0307415_100343679 3300032126 Bacteria 1253
754 Ga0373930_0040371 3300034816 Bacteria 992
755 Ga0373948_0214873 3300034817 Unclassified 507
756 Ga0373938_0161388 3300034957 Unclassified 602
757 Ga0373944_0065293 3300035089 Bacteria 1175
758 Ga0373951_0067067 3300035091 Bacteria 908
759 Ga0373952_0218903 3300035092 Bacteria 565
760 Ga0373939_0152799 3300035114 Bacteria 841
761 Ga0373943_0023701 3300035170 Bacteria 2855
762 Ga0373946_0105032 3300035171 Unclassified 1271
763 Ga0373931_0094634 3300035691 Bacteria 1670
764 Ga0373935_0559202 3300035692 Unclassified 834
765 Ga0373935_0943100 3300035692 Unclassified 640
766 Ga0373947_0061772 3300035725 Bacteria 2278
767 Ga0373925_0004938 3300037068 Bacteria 10027
768 Ga0395899_0005947 3300037312 Bacteria 9476
769 Ga0395899_0025846 3300037312 Bacteria 4432
770 Ga0395899_0040911 3300037312 Bacteria 3465
771 Ga0395899_0087927 3300037312 Bacteria 2255
772 Ga0395899_0622881 3300037312 Unclassified 685
773 Ga0395900_0004188 3300037418 Bacteria 15315
774 Ga0395900_0041963 3300037418 Bacteria 4713
775 Ga0395900_0089971 3300037418 Bacteria 3155
776 Ga0395900_0133096 3300037418 Bacteria 2547
777 Ga0395900_0157960 3300037418 Bacteria 2315
778 Ga0395900_0194513 3300037418 Bacteria 2055
779 Ga0395900_0196352 3300037418 Bacteria 2044
780 Ga0395900_0588172 3300037418 Bacteria 1054
781 Ga0395900_0829770 3300037418 Bacteria 851
782 Ga0395900_1602317 3300037418 Unclassified 562
783 Ga0395898_0002464 3300037466 Bacteria 21836
784 Ga0395898_0074464 3300037466 Bacteria 3279
785 Ga0395898_0195822 3300037466 Bacteria 1930
786 Ga0395898_0319842 3300037466 Bacteria 1480
787 Ga0395898_0464615 3300037466 Bacteria 1205
788 Ga0395898_1009185 3300037466 Bacteria 768
789 Ga0395898_1072135 3300037466 Unclassified 740
790 Ga0395905_0000793 3300037471 Bacteria 41518
791 Ga0395905_0006083 3300037471 Bacteria 12197
792 Ga0395905_0011949 3300037471 Bacteria 8372
793 Ga0395905_0030147 3300037471 Bacteria 5112
794 Ga0395905_0041658 3300037471 Bacteria 4309
795 Ga0395905_0096225 3300037471 Bacteria 2780
796 Ga0395905_0108963 3300037471 Bacteria 2600
797 Ga0395905_0123877 3300037471 Bacteria 2430
798 Ga0395905_0221463 3300037471 Bacteria 1771
799 Ga0395905_0302356 3300037471 Bacteria 1487
800 Ga0395905_1143108 3300037471 Unclassified 682
801 Ga0395905_1658494 3300037471 Bacteria 544
802 Ga0395901_0001342 3300038443 Bacteria 25807
803 Ga0395901_0009569 3300038443 Bacteria 9834
804 Ga0395901_0062317 3300038443 Bacteria 3881
805 Ga0395901_0138959 3300038443 Bacteria 2553
806 Ga0395901_0476637 3300038443 Bacteria 1273
807 Ga0395901_0623926 3300038443 Bacteria 1084
808 Ga0395901_1034702 3300038443 Bacteria 795
809 Ga0395901_1088137 3300038443 Bacteria 770
810 Ga0395901_1928565 3300038443 Unclassified 538
811 Ga0439465_0012417 3300041413 Bacteria 2664
812 Ga0439432_023572 3300042006 Bacteria 2026
813 Ga0439449_0037503 3300042007 Bacteria 1803
814 Ga0439449_0054843 3300042007 Bacteria 1472
815 Ga0450907_037840 3300042146 Unclassified 825
816 Ga0466972_0201891 3300044658 Bacteria 931
817 Ga0466966_0647012 3300044684 Bacteria 637
818 Ga0466961_0159328 3300044693 Bacteria 1407
819 Ga0466963_0018071 3300044694 Bacteria 4401
820 Ga0466963_0021917 3300044694 Bacteria 4039
821 Ga0466963_0655660 3300044694 Unclassified 741
822 Ga0466970_0103452 3300044765 Bacteria 1552
823 Ga0466967_0015359 3300045976 Bacteria 5998
824 Ga0466967_0039950 3300045976 Bacteria 4037
825 Ga0466967_0210389 3300045976 Bacteria 1844
826 Ga0466967_0231031 3300045976 Bacteria 1761
827 Ga0466967_0288420 3300045976 Bacteria 1576
828 Ga0466967_0399300 3300045976 Bacteria 1337
829 Ga0466967_0419180 3300045976 Bacteria 1305
830 Ga0466967_1003665 3300045976 Bacteria 831
831 Ga0466967_1193846 3300045976 Unclassified 758
832 Ga0495583_0416501 3300046506 Unclassified 527
833 Ga0495616_0188684 3300046513 Bacteria 912
834 Ga0495620_0038672 3300046515 Bacteria 2116
835 Ga0495620_0053881 3300046515 Bacteria 1702
836 Ga0495644_0094071 3300046523 Bacteria 1132
837 Ga0495663_0008602 3300046525 Bacteria 2831
838 Ga0495663_0153216 3300046525 Bacteria 788
839 Ga0495663_0170517 3300046525 Bacteria 750
840 Ga0495654_0138062 3300046530 Bacteria 1089
841 Ga0495598_0146296 3300046537 Unclassified 821
842 Ga0495621_0000081 3300046539 Bacteria 19404
843 Ga0495633_0003855 3300046558 Bacteria 9803
844 Ga0495668_0027708 3300046616 Bacteria 3210
845 Ga0495669_0003519 3300046684 Bacteria 6459
846 Ga0495669_0004827 3300046684 Bacteria 5594
847 Ga0495669_0013108 3300046684 Bacteria 3530
848 Ga0495669_0024004 3300046684 Bacteria 2656
849 Ga0495669_0063897 3300046684 Bacteria 1670
850 Ga0495669_0066073 3300046684 Bacteria 1642
851 Ga0495669_0304934 3300046684 Bacteria 768
852 Ga0495670_0042925 3300046691 Bacteria 2256
853 Ga0495670_0465262 3300046691 Unclassified 685
854 Ga0495677_0372127 3300047445 Unclassified 565
855 Ga0495686_0466094 3300047472 Bacteria 669
856 Ga0496100_0034686 3300048903 Bacteria 3168
857 Ga0496101_0006012 3300048904 Bacteria 7783
858 Ga0496101_0007732 3300048904 Bacteria 6985
859 Ga0496101_0415642 3300048904 Bacteria 1060
860 Ga0496101_1201197 3300048904 Unclassified 594
861 Ga0496102_0083844 3300048905 Bacteria 2941
862 Ga0496102_0213582 3300048905 Bacteria 1819
863 Ga0496102_0612647 3300048905 Bacteria 1012
864 Ga0496102_0764849 3300048905 Bacteria 889
865 Ga0496103_0384765 3300048906 Bacteria 901
866 Ga0496103_0662478 3300048906 Bacteria 663
867 Ga0496103_0828020 3300048906 Unclassified 583
868 Ga0496104_1056373 3300048907 Unclassified 716
869 Ga0496106_0030158 3300048909 Bacteria 4043
870 Ga0496106_0055483 3300048909 Bacteria 2995
871 Ga0496106_0412212 3300048909 Bacteria 1086
872 Ga0496107_0002320 3300048910 Bacteria 12289
873 Ga0496107_0006889 3300048910 Bacteria 7828
874 Ga0496107_0020757 3300048910 Bacteria 4642
875 Ga0496107_0264826 3300048910 Bacteria 1279
876 Ga0496107_0595063 3300048910 Unclassified 818
877 Ga0496108_0009077 3300048911 Bacteria 8054
878 Ga0496108_0041075 3300048911 Bacteria 3859
879 Ga0496108_0211033 3300048911 Bacteria 1686
880 Ga0496109_0012385 3300048912 Bacteria 7364
881 Ga0496109_0297248 3300048912 Bacteria 1522
882 Ga0496109_1901005 3300048912 Unclassified 528
883 Ga0496110_0009316 3300048913 Bacteria 7943
884 Ga0496110_0247026 3300048913 Bacteria 1624
885 Ga0496111_0017785 3300048914 Bacteria 4916
886 Ga0496111_0220040 3300048914 Unclassified 1411
887 Ga0496111_0391437 3300048914 Bacteria 1027
888 Ga0496112_0004475 3300048915 Bacteria 11855
889 Ga0496112_0049174 3300048915 Bacteria 4133
890 Ga0496112_0063648 3300048915 Bacteria 3638
891 Ga0496112_0084404 3300048915 Bacteria 3141
892 Ga0496112_0144826 3300048915 Bacteria 2344
893 Ga0496113_0004532 3300048916 Bacteria 8555
894 Ga0496113_0067246 3300048916 Bacteria 2716
895 Ga0496113_0622152 3300048916 Bacteria 864
896 Ga0496114_0033622 3300048917 Bacteria 4226
897 Ga0501047_1010089 3300049581 Bacteria 645
898 Ga0501068_0186055 3300049584 Unclassified 1314
899 Ga0501068_0325761 3300049584 Bacteria 985
900 Ga0501074_0673470 3300049590 Unclassified 730
901 Ga0501227_055108 3300049665 Bacteria 1010
902 Ga0501225_0024071 3300049705 Bacteria 1677
903 Ga0501080_0018194 3300049742 Bacteria 6504
904 Ga0501083_0553993 3300049744 Unclassified 748
905 Ga0501273_002541 3300049770 Bacteria 1865
906 Ga0501204_064642 3300049850 Bacteria 590
907 Ga0495655_0019217 3300053083 Bacteria 1514
908 Ga0495655_0047159 3300053083 Bacteria 1126
909 Ga0500658_0000022 3300053134 Bacteria 129341
910 Ga0590071_066406 3300059421 Bacteria 886
911 Ga0466962_0244668 3300061719 Bacteria 881
912 Ga0501258_010189
913 JGI24741J21665_1001682
914 JGI24740J21852_10017230
915 JGI24740J21852_10023290
916 JGI24739J22299_10008838
917 JGI24739J22299_10020155
918 JGI24737J22298_10000005
919 JGI24737J22298_10002142
920 JGI24737J22298_10012293
921 JGI24737J22298_10088707
922 JGI24743J22301_10020531
923 JGI24735J21928_10008389
924 JGI24735J21928_10021755
925 JGI24735J21928_10175598
926 JGI24738J21930_10004335
927 JGI24742J22300_10034834
928 Ga0070658_10000216
929 Ga0070658_10045539
930 Ga0070658_10230643
931 Ga0070658_10276047
932 Ga0070658_10572409
933 Ga0070658_10923151
934 Ga0070676_10081647
935 Ga0070676_10247777
936 Ga0070676_10828621
937 Ga0070676_10851897
938 Ga0070683_100015844
939 Ga0070683_100122906
940 Ga0070683_100231693
941 Ga0070683_100239746
942 Ga0070683_101254604
943 Ga0070690_100393545
944 Ga0070670_100007469
945 Ga0070670_100014399
946 Ga0070670_100040990
947 Ga0070670_100049353
948 Ga0070670_100091394
949 Ga0070670_100359581
950 Ga0070670_100393177
951 Ga0070670_100595334
952 Ga0070670_101829981
953 Ga0070677_10334013
954 Ga0068869_100000003
955 Ga0068869_100019239
956 Ga0068869_100095291
957 Ga0068869_100366643
958 Ga0068869_100896891
959 Ga0070666_10000884
960 Ga0070666_10006103
961 Ga0070666_10024530
962 Ga0070666_10054675
963 Ga0070666_10145841
964 Ga0070666_11173982
965 Ga0070680_100007267
966 Ga0070680_100230739
967 Ga0070680_100353727
968 Ga0070680_101378477
969 Ga0070682_100001991
970 Ga0070682_101084684
971 Ga0068868_100324089
972 Ga0068868_100544572
973 Ga0068868_102075944
974 Ga0070660_100000250
975 Ga0070660_100002417
976 Ga0070660_100026492
977 Ga0070660_100046126
978 Ga0070660_100055667
979 Ga0070660_100093705
980 Ga0070660_100170693
981 Ga0070660_100177943
982 Ga0070660_100232712
983 Ga0070660_100253050
984 Ga0070660_100340835
985 Ga0070660_100611987
986 Ga0070660_100782260
987 Ga0070660_100977193
988 Ga0070660_101129960
989 Ga0070660_101760559
990 Ga0070689_100713321
991 Ga0070691_10012295
992 Ga0070661_100001054
993 Ga0070661_100003236
994 Ga0070661_100022414
995 Ga0070661_100029090
996 Ga0070661_100031501
997 Ga0070661_100056133
998 Ga0070661_100126250
999 Ga0070661_100355253
1000 Ga0070661_100452111
1001 Ga0070661_100506277
1002 Ga0070692_10121306
1003 Ga0070668_100017279
1004 Ga0070668_100091326
1005 Ga0070668_100363532
1006 Ga0070668_100436094
1007 Ga0070668_100516349
1008 Ga0070669_100000128
1009 Ga0070669_100493804
1010 Ga0070675_100021830
1011 Ga0070675_100207368
1012 Ga0070675_100256271
1013 Ga0070671_100001903
1014 Ga0070671_100002164
1015 Ga0070671_100010471
1016 Ga0070671_100018594
1017 Ga0070671_100026350
1018 Ga0070671_100087854
1019 Ga0070671_100113429
1020 Ga0070671_100158187
1021 Ga0070671_100181312
1022 Ga0070671_100313718
1023 Ga0070671_100696758
1024 Ga0070674_100043258
1025 Ga0070674_100703569
1026 Ga0070673_100000246
1027 Ga0070673_100004377
1028 Ga0070673_100016187
1029 Ga0070673_100047382
1030 Ga0070673_100153384
1031 Ga0070673_100157468
1032 Ga0070673_100176444
1033 Ga0070673_100363123
1034 Ga0070673_100524810
1035 Ga0070673_100570426
1036 Ga0070673_100607457
1037 Ga0070673_100746189
1038 Ga0070673_100860824
1039 Ga0070688_100065199
1040 Ga0070659_100000086
1041 Ga0070659_100000220
1042 Ga0070659_100006587
1043 Ga0070659_100026025
1044 Ga0070659_100056648
1045 Ga0070659_100182889
1046 Ga0070659_100240078
1047 Ga0070659_100324411
1048 Ga0070659_100404712
1049 Ga0070659_100501467
1050 Ga0070659_100546210
1051 Ga0070667_100001773
1052 Ga0070667_100003156
1053 Ga0070667_100014642
1054 Ga0070667_100060804
1055 Ga0070667_100237985
1056 Ga0070667_100286079
1057 Ga0070667_100325414
1058 Ga0070667_100555974
1059 Ga0070667_100650974
1060 Ga0070713_100394916
1061 Ga0070705_100141430
1062 Ga0070663_100006282
1063 Ga0070663_100033054
1064 Ga0070663_100046546
1065 Ga0070663_100251466
1066 Ga0070663_100261141
1067 Ga0070663_100440491
1068 Ga0070678_100025760
1069 Ga0070678_100035320
1070 Ga0070678_100154050
1071 Ga0070678_100196013
1072 Ga0070678_100340329
1073 Ga0070662_100000082
1074 Ga0070662_100008030
1075 Ga0070662_100010506
1076 Ga0070662_100049411
1077 Ga0070662_100089592
1078 Ga0070662_100091286
1079 Ga0070662_100162330
1080 Ga0070662_100457398
1081 Ga0070662_100544910
1082 Ga0070662_101236611
1083 Ga0070681_10012374
1084 Ga0070681_10057409
1085 Ga0070681_10069197
1086 Ga0070681_10243101
1087 Ga0070681_11658749
1088 Ga0068867_100428811
1089 Ga0068867_100645407
1090 Ga0068867_100979222
1091 Ga0070685_10033567
1092 Ga0070685_10169714
1093 Ga0070679_100018589
1094 Ga0070679_100124162
1095 Ga0070679_100217563
1096 Ga0070679_100678515
1097 Ga0070684_100080161
1098 Ga0070684_100177984
1099 Ga0070684_100308050
1100 Ga0068853_100000151
1101 Ga0068853_100000445
1102 Ga0068853_100062760
1103 Ga0068853_100070372
1104 Ga0068853_100071409
1105 Ga0068853_100086350
1106 Ga0068853_100123234
1107 Ga0068853_100481613
1108 Ga0068853_100657446
1109 Ga0070672_100000678
1110 Ga0070672_100106233
1111 Ga0070672_100112352
1112 Ga0070672_100171845
1113 Ga0070672_100208020
1114 Ga0070672_100252426
1115 Ga0070672_100861809
1116 Ga0070672_100907879
1117 Ga0070686_100369235
1118 Ga0070696_100089348
1119 Ga0070696_100165995
1120 Ga0070696_100245086
1121 Ga0070693_100001450
1122 Ga0070693_100010518
1123 Ga0070693_100041177
1124 Ga0070693_100310037
1125 Ga0070693_100509561
1126 Ga0070693_100538303
1127 Ga0070693_100552724
1128 Ga0070693_100793986
1129 Ga0070665_100000670
1130 Ga0070665_100005768
1131 Ga0070665_100016152
1132 Ga0070665_100404089
1133 Ga0068855_100000742
1134 Ga0068855_100024023
1135 Ga0068855_100083536
1136 Ga0068855_100111850
1137 Ga0068855_100119558
1138 Ga0068855_100122939
1139 Ga0068855_100722685
1140 Ga0068855_100940332
1141 Ga0070664_100000113
1142 Ga0070664_100001064
1143 Ga0070664_100002825
1144 Ga0070664_100005653
1145 Ga0070664_100006778
1146 Ga0070664_100014102
1147 Ga0070664_100059305
1148 Ga0070664_100082459
1149 Ga0070664_100175682
1150 Ga0070664_100183145
1151 Ga0070664_100261746
1152 Ga0070664_100314010
1153 Ga0070664_100911527
1154 Ga0068857_100000026
1155 Ga0068857_100002666
1156 Ga0068857_100054437
1157 Ga0068857_100163878
1158 Ga0068857_100164615
1159 Ga0068857_100243664
1160 Ga0068857_100374714
1161 Ga0068857_100428936
1162 Ga0068857_100739490
1163 Ga0068854_100000204
1164 Ga0068854_100018213
1165 Ga0068854_100049580
1166 Ga0068854_100068041
1167 Ga0068854_100087267
1168 Ga0068854_100135205
1169 Ga0068854_100175924
1170 Ga0068854_100540343
1171 Ga0068854_102140081
1172 Ga0068856_100000159
1173 Ga0068856_100015626
1174 Ga0068856_100020782
1175 Ga0068856_100124031
1176 Ga0068856_100582725
1177 Ga0068856_100608922
1178 Ga0070702_101156370
1179 Ga0068852_100001609
1180 Ga0068852_100002795
1181 Ga0068852_100005356
1182 Ga0068852_100007134
1183 Ga0068852_100018018
1184 Ga0068852_100127873
1185 Ga0068852_100148134
1186 Ga0068852_100163416
1187 Ga0068852_100252736
1188 Ga0068852_100365763
1189 Ga0068852_100444417
1190 Ga0068852_100503233
1191 Ga0068859_100000088
1192 Ga0068859_100033189
1193 Ga0068859_100053844
1194 Ga0068859_100158637
1195 Ga0068859_100426855
1196 Ga0068864_100000047
1197 Ga0068864_100000136
1198 Ga0068864_100002002
1199 Ga0068864_100026287
1200 Ga0068864_100030216
1201 Ga0068864_100078328
1202 Ga0068864_100106047
1203 Ga0068864_100386912
1204 Ga0068864_100387989
1205 Ga0068864_100515142
1206 Ga0068864_100715232
1207 Ga0068866_10013190
1208 Ga0068861_100190840
1209 Ga0068861_100213043
1210 Ga0068851_10022453
1211 Ga0068851_10116146
1212 Ga0068851_10209711
1213 Ga0068870_10481884
1214 Ga0068863_100000289
1215 Ga0068863_100000384
1216 Ga0068863_100026719
1217 Ga0068863_100069439
1218 Ga0068863_100118542
1219 Ga0068863_100191488
1220 Ga0068863_100405460
1221 Ga0068863_100560101
1222 Ga0068863_100653844
1223 Ga0068863_100719154
1224 Ga0068858_100000063
1225 Ga0068858_100000425
1226 Ga0068858_100031041
1227 Ga0068858_100237313
1228 Ga0068858_100247150
1229 Ga0068858_101445295
1230 Ga0068860_100000607
1231 Ga0068860_100012203
1232 Ga0068860_100441416
1233 Ga0068860_100692598
1234 Ga0068860_101400986
1235 Ga0068862_100013784
1236 Ga0068862_100041919
1237 Ga0068862_100120945
1238 Ga0068862_100190207
1239 Ga0068862_101556119
1240 Ga0097621_100054470
1241 Ga0097621_100091987
1242 Ga0097621_100920426
1243 Ga0097621_100977072
1244 Ga0068871_100049999
1245 Ga0068871_100057213
1246 Ga0068871_100145476
1247 Ga0068871_100241724
1248 Ga0068865_100003059
1249 Ga0097620_100000088
1250 Ga0097620_100033190
1251 Ga0097620_100053841
1252 Ga0097620_100158625
1253 Ga0097620_100426840
1254 Ga0105240_10018703
1255 Ga0105245_10000062
1256 Ga0105245_12240733
1257 Ga0105247_10472138
1258 Ga0105243_10170496
1259 Ga0105243_10459793
1260 Ga0105243_10497326
1261 Ga0105241_10027471
1262 Ga0105241_10299643
1263 Ga0105241_10372702
1264 Ga0105242_10148825
1265 Ga0105248_10000169
1266 Ga0105248_10000213
1267 Ga0105248_10003561
1268 Ga0105248_10014260
1269 Ga0105248_10024200
1270 Ga0105248_10026764
1271 Ga0105248_10132611
1272 Ga0105248_10587743
1273 Ga0105237_10255973
1274 Ga0105237_10428760
1275 Ga0105238_10039950
1276 Ga0105238_10061055
1277 Ga0105238_10135058
1278 Ga0105238_10147620
1279 Ga0105238_10436461
1280 Ga0105238_12144720
1281 Ga0105249_10015607
1282 Ga0105249_10299878
1283 Ga0105249_10449128
1284 Ga0105239_10020230
1285 Ga0105239_10212149
1286 Ga0105239_10298011
1287 Ga0105246_10385049
1288 Ga0157327_1008256
1289 Ga0157373_10010575
1290 Ga0157373_10010638
1291 Ga0157373_10010857
1292 Ga0157373_10020523
1293 Ga0157373_10064533
1294 Ga0157373_10072993
1295 Ga0157373_10118111
1296 Ga0157373_10169489
1297 Ga0157373_10311534
1298 Ga0157371_10000144
1299 Ga0157371_10008185
1300 Ga0157371_10041479
1301 Ga0157371_10086947
1302 Ga0157371_10142892
1303 Ga0157371_10216211
1304 Ga0157370_10092018
1305 Ga0157370_10167483
1306 Ga0157370_10903006
1307 Ga0157370_11055054
1308 Ga0157369_10003544
1309 Ga0157369_10030010
1310 Ga0157369_10224944
1311 Ga0157369_11485635
1312 Ga0157369_11485637
1313 Ga0157369_12165407
1314 Ga0157374_10004105
1315 Ga0157374_10100278
1316 Ga0157374_12772287
1317 Ga0157378_10006458
1318 Ga0157378_10155159
1319 Ga0157378_10619512
1320 Ga0157378_11138296
1321 Ga0163162_10003404
1322 Ga0163162_10056144
1323 Ga0163162_10197697
1324 Ga0157372_10046487
1325 Ga0157372_10076912
1326 Ga0157372_10095796
1327 Ga0157372_10171629
1328 Ga0157372_10351838
1329 Ga0157372_12041713
1330 Ga0157375_10023721
1331 Ga0157375_10202677
1332 Ga0157375_11557776
1333 Ga0163163_10000170
1334 Ga0163163_10007199
1335 Ga0163163_10038859
1336 Ga0163163_13064281
1337 Ga0157377_10042293
1338 Ga0157377_10190557
1339 Ga0157379_10014561
1340 Ga0157379_10026488
1341 Ga0207697_10000235
1342 Ga0207656_10013768
1343 Ga0207682_10033696
1344 Ga0207682_10059578
1345 Ga0207682_10230947
1346 Ga0207682_10523793
1347 Ga0207642_10018076
1348 Ga0207688_10000105
1349 Ga0207688_10011623
1350 Ga0207688_10269388
1351 Ga0207680_10001036
1352 Ga0207680_10005854
1353 Ga0207680_10051498
1354 Ga0207647_10000317
1355 Ga0207647_10022150
1356 Ga0207647_10048752
1357 Ga0207647_10066631
1358 Ga0207647_10191669
1359 Ga0207645_10169552
1360 Ga0207645_10170611
1361 Ga0207645_10186659
1362 Ga0207645_10433965
1363 Ga0207705_10002520
1364 Ga0207705_10005118
1365 Ga0207705_10015546
1366 Ga0207705_10023169
1367 Ga0207705_10049129
1368 Ga0207705_10543453
1369 Ga0207705_10669455
1370 Ga0207654_10012959
1371 Ga0207654_10033550
1372 Ga0207654_10124473
1373 Ga0207654_11333117
1374 Ga0207707_10004641
1375 Ga0207707_10048221
1376 Ga0207707_10053006
1377 Ga0207707_10060221
1378 Ga0207695_10079126
1379 Ga0207671_10168607
1380 Ga0207671_10305702
1381 Ga0207660_10014425
1382 Ga0207660_10017918
1383 Ga0207660_10113186
1384 Ga0207657_10000276
1385 Ga0207657_10006981
1386 Ga0207657_10008965
1387 Ga0207657_10009721
1388 Ga0207657_10021115
1389 Ga0207657_10022038
1390 Ga0207657_10100151
1391 Ga0207657_10116219
1392 Ga0207657_10134148
1393 Ga0207657_10419134
1394 Ga0207657_10531051
1395 Ga0207649_10000277
1396 Ga0207649_10016582
1397 Ga0207649_10043598
1398 Ga0207649_10074078
1399 Ga0207649_10074123
1400 Ga0207649_10083948
1401 Ga0207649_10095425
1402 Ga0207649_10180989
1403 Ga0207649_10287694
1404 Ga0207652_10067087
1405 Ga0207652_10088836
1406 Ga0207652_10174820
1407 Ga0207652_10933216
1408 Ga0207681_10000464
1409 Ga0207681_10293636
1410 Ga0207681_10350771
1411 Ga0207694_10000665
1412 Ga0207694_10007008
1413 Ga0207694_10012855
1414 Ga0207694_10111508
1415 Ga0207694_10141210
1416 Ga0207694_10629975
1417 Ga0207650_10003341
1418 Ga0207650_10032359
1419 Ga0207650_10055415
1420 Ga0207650_10154951
1421 Ga0207650_10164594
1422 Ga0207650_10194317
1423 Ga0207659_10015621
1424 Ga0207659_10031942
1425 Ga0207659_10166557
1426 Ga0207659_10534284
1427 Ga0207659_11007409
1428 Ga0207700_10095291
1429 Ga0207700_10335241
1430 Ga0207664_10039226
1431 Ga0207644_10000135
1432 Ga0207644_10011667
1433 Ga0207644_10014273
1434 Ga0207644_10022800
1435 Ga0207644_10036398
1436 Ga0207644_10038966
1437 Ga0207644_10058370
1438 Ga0207644_10092874
1439 Ga0207644_10136773
1440 Ga0207644_10180558
1441 Ga0207644_10773020
1442 Ga0207690_10000100
1443 Ga0207690_10012213
1444 Ga0207690_10013151
1445 Ga0207690_10059551
1446 Ga0207690_10061648
1447 Ga0207690_10061924
1448 Ga0207690_10229938
1449 Ga0207690_10240902
1450 Ga0207690_10302261
1451 Ga0207690_10358011
1452 Ga0207690_10478718
1453 Ga0207706_10000020
1454 Ga0207706_10000599
1455 Ga0207706_10001396
1456 Ga0207706_10007937
1457 Ga0207706_10012892
1458 Ga0207706_10037064
1459 Ga0207706_10038918
1460 Ga0207706_10087567
1461 Ga0207706_10114742
1462 Ga0207706_10172552
1463 Ga0207706_10502143
1464 Ga0207706_10718404
1465 Ga0207706_11230616
1466 Ga0207706_11411261
1467 Ga0207686_10296363
1468 Ga0207709_10185110
1469 Ga0207669_10811738
1470 Ga0207691_10006983
1471 Ga0207691_10056858
1472 Ga0207691_10171393
1473 Ga0207691_10248112
1474 Ga0207691_10569563
1475 Ga0207691_10653754
1476 Ga0207691_10980731
1477 Ga0207711_10000039
1478 Ga0207711_10001037
1479 Ga0207711_10002235
1480 Ga0207711_10003908
1481 Ga0207711_10003962
1482 Ga0207711_10005938
1483 Ga0207711_10008931
1484 Ga0207711_10868906
1485 Ga0207689_10000002
1486 Ga0207689_10139236
1487 Ga0207661_10021061
1488 Ga0207661_10113999
1489 Ga0207661_10590768
1490 Ga0207661_10834039
1491 Ga0207679_10002666
1492 Ga0207679_10002737
1493 Ga0207679_10003893
1494 Ga0207679_10004468
1495 Ga0207679_10022589
1496 Ga0207679_10119088
1497 Ga0207679_10123142
1498 Ga0207679_10136232
1499 Ga0207679_10170241
1500 Ga0207679_10397105
1501 Ga0207679_10564716
1502 Ga0207679_10646223
1503 Ga0207679_10717919
1504 Ga0207667_10012308
1505 Ga0207667_10025048
1506 Ga0207667_10058193
1507 Ga0207667_10188359
1508 Ga0207667_10219258
1509 Ga0207667_10297661
1510 Ga0207667_11446982
1511 Ga0207651_10000129
1512 Ga0207651_10001862
1513 Ga0207651_10043848
1514 Ga0207651_10052238
1515 Ga0207651_10061772
1516 Ga0207651_10068648
1517 Ga0207651_10120019
1518 Ga0207651_10147961
1519 Ga0207651_10305223
1520 Ga0207651_10325773
1521 Ga0207651_11160651
1522 Ga0207712_10009376
1523 Ga0207668_10008198
1524 Ga0207668_10191945
1525 Ga0207668_10336638
1526 Ga0207668_10494610
1527 Ga0207668_10515937
1528 Ga0207668_10856099
1529 Ga0207640_10011803
1530 Ga0207640_10012805
1531 Ga0207640_10019760
1532 Ga0207640_10049427
1533 Ga0207640_10543544
1534 Ga0207640_10611879
1535 Ga0207640_11153836
1536 Ga0207640_11354219
1537 Ga0207640_11482844
1538 Ga0207658_10002756
1539 Ga0207658_10003522
1540 Ga0207658_10011278
1541 Ga0207658_10016582
1542 Ga0207658_10023565
1543 Ga0207658_10044234
1544 Ga0207658_10835681
1545 Ga0207658_11154719
1546 Ga0207658_11450075
1547 Ga0207677_10000730
1548 Ga0207677_10296696
1549 Ga0207677_10695336
1550 Ga0207677_11585693
1551 Ga0207703_10000327
1552 Ga0207703_10002423
1553 Ga0207703_10044106
1554 Ga0207703_10044171
1555 Ga0207703_10370726
1556 Ga0207703_10853035
1557 Ga0207639_10000162
1558 Ga0207639_10000987
1559 Ga0207639_10002509
1560 Ga0207639_10022710
1561 Ga0207639_10061546
1562 Ga0207639_10076481
1563 Ga0207639_10266233
1564 Ga0207639_10435418
1565 Ga0207639_10503359
1566 Ga0207678_10002193
1567 Ga0207678_10006809
1568 Ga0207678_10018272
1569 Ga0207678_10021004
1570 Ga0207678_10557129
1571 Ga0207702_10000208
1572 Ga0207702_10003777
1573 Ga0207702_10141460
1574 Ga0207702_10192854
1575 Ga0207702_10395461
1576 Ga0207641_10000138
1577 Ga0207641_10005315
1578 Ga0207641_10006307
1579 Ga0207641_10142768
1580 Ga0207641_11582390
1581 Ga0207648_10000088
1582 Ga0207648_10084467
1583 Ga0207648_10124112
1584 Ga0207648_10563743
1585 Ga0207648_10697362
1586 Ga0207648_11488926
1587 Ga0207676_10000515
1588 Ga0207676_10000983
1589 Ga0207676_10004548
1590 Ga0207676_10012563
1591 Ga0207676_10027546
1592 Ga0207676_10029511
1593 Ga0207676_10038715
1594 Ga0207676_10449007
1595 Ga0207676_11229049
1596 Ga0207674_10000280
1597 Ga0207674_10004467
1598 Ga0207674_10010727
1599 Ga0207674_10025071
1600 Ga0207674_10065380
1601 Ga0207674_10194973
1602 Ga0207674_10287039
1603 Ga0207674_10558963
1604 Ga0207675_100188829
1605 Ga0207675_100274207
1606 Ga0207683_10004836
1607 Ga0207683_10025793
1608 Ga0207683_10088040
1609 Ga0207698_10000985
1610 Ga0207698_10001063
1611 Ga0207698_10003393
1612 Ga0207698_10005551
1613 Ga0207698_10007116
1614 Ga0207698_10062459
1615 Ga0207698_10110846
1616 Ga0207698_10315812
1617 Ga0207698_10402532
1618 Ga0207698_10515583
1619 Ga0207698_11066088
1620 Ga0207698_11786903
1621 Ga0207698_12464535
1622 Ga0268266_10000332
1623 Ga0268266_10009906
1624 Ga0268266_10032749
1625 Ga0268265_10035676
1626 Ga0268265_10091884
1627 Ga0268265_10158346
1628 Ga0268265_10761730
1629 Ga0268265_11037318
1630 Ga0268264_10002587
1631 Ga0268264_10145488
1632 Ga0268264_10154248
1633 Ga0268264_10568549
1634 Ga0307515_10317854
1635 Ga0307408_100071025
1636 Ga0307408_100222388
1637 Ga0307405_10004772
1638 Ga0307405_10015897
1639 Ga0307405_10502095
1640 Ga0307413_10078906
1641 Ga0307413_10251420
1642 Ga0307413_10330340
1643 Ga0307410_10012782
1644 Ga0307410_10432754
1645 Ga0307410_10653000
1646 Ga0307410_11058791
1647 Ga0307406_10045708
1648 Ga0307406_10283110
1649 Ga0307407_10010121
1650 Ga0307407_10024606
1651 Ga0307407_10317852
1652 Ga0307407_10581587
1653 Ga0307412_10016705
1654 Ga0307409_100037764
1655 Ga0307409_100076204
1656 Ga0307409_100490003
1657 Ga0307416_100010716
1658 Ga0307416_101379483
1659 Ga0307414_10182934
1660 Ga0307414_10924352
1661 Ga0307411_10001565
1662 Ga0307411_10012502
1663 Ga0307415_100097787
1664 Ga0307415_100343679
1665 Ga0373930_0040371
1666 Ga0373948_0214873
1667 Ga0373938_0161388
1668 Ga0373944_0065293
1669 Ga0373951_0067067
1670 Ga0373952_0218903
1671 Ga0373939_0152799
1672 Ga0373943_0023701
1673 Ga0373946_0105032
1674 Ga0373931_0094634
1675 Ga0373935_0559202
1676 Ga0373935_0943100
1677 Ga0373947_0061772
1678 Ga0373925_0004938
1679 Ga0395899_0005947
1680 Ga0395899_0025846
1681 Ga0395899_0040911
1682 Ga0395899_0087927
1683 Ga0395899_0622881
1684 Ga0395900_0004188
1685 Ga0395900_0041963
1686 Ga0395900_0089971
1687 Ga0395900_0133096
1688 Ga0395900_0157960
1689 Ga0395900_0194513
1690 Ga0395900_0196352
1691 Ga0395900_0588172
1692 Ga0395900_0829770
1693 Ga0395900_1602317
1694 Ga0395898_0002464
1695 Ga0395898_0074464
1696 Ga0395898_0195822
1697 Ga0395898_0319842
1698 Ga0395898_0464615
1699 Ga0395898_1009185
1700 Ga0395898_1072135
1701 Ga0395905_0000793
1702 Ga0395905_0006083
1703 Ga0395905_0011949
1704 Ga0395905_0030147
1705 Ga0395905_0041658
1706 Ga0395905_0096225
1707 Ga0395905_0108963
1708 Ga0395905_0123877
1709 Ga0395905_0221463
1710 Ga0395905_0302356
1711 Ga0395905_1143108
1712 Ga0395905_1658494
1713 Ga0395901_0001342
1714 Ga0395901_0009569
1715 Ga0395901_0062317
1716 Ga0395901_0138959
1717 Ga0395901_0476637
1718 Ga0395901_0623926
1719 Ga0395901_1034702
1720 Ga0395901_1088137
1721 Ga0395901_1928565
1722 Ga0439465_0012417
1723 Ga0439432_023572
1724 Ga0439449_0037503
1725 Ga0439449_0054843
1726 Ga0450907_037840
1727 Ga0466972_0201891
1728 Ga0466966_0647012
1729 Ga0466961_0159328
1730 Ga0466963_0018071
1731 Ga0466963_0021917
1732 Ga0466963_0655660
1733 Ga0466970_0103452
1734 Ga0466967_0015359
1735 Ga0466967_0039950
1736 Ga0466967_0210389
1737 Ga0466967_0231031
1738 Ga0466967_0288420
1739 Ga0466967_0399300
1740 Ga0466967_0419180
1741 Ga0466967_1003665
1742 Ga0466967_1193846
1743 Ga0495583_0416501
1744 Ga0495616_0188684
1745 Ga0495620_0038672
1746 Ga0495620_0053881
1747 Ga0495644_0094071
1748 Ga0495663_0008602
1749 Ga0495663_0153216
1750 Ga0495663_0170517
1751 Ga0495654_0138062
1752 Ga0495598_0146296
1753 Ga0495621_0000081
1754 Ga0495633_0003855
1755 Ga0495668_0027708
1756 Ga0495669_0003519
1757 Ga0495669_0004827
1758 Ga0495669_0013108
1759 Ga0495669_0024004
1760 Ga0495669_0063897
1761 Ga0495669_0066073
1762 Ga0495669_0304934
1763 Ga0495670_0042925
1764 Ga0495670_0465262
1765 Ga0495677_0372127
1766 Ga0495686_0466094
1767 Ga0496100_0034686
1768 Ga0496101_0006012
1769 Ga0496101_0007732
1770 Ga0496101_0415642
1771 Ga0496101_1201197
1772 Ga0496102_0083844
1773 Ga0496102_0213582
1774 Ga0496102_0612647
1775 Ga0496102_0764849
1776 Ga0496103_0384765
1777 Ga0496103_0662478
1778 Ga0496103_0828020
1779 Ga0496104_1056373
1780 Ga0496106_0030158
1781 Ga0496106_0055483
1782 Ga0496106_0412212
1783 Ga0496107_0002320
1784 Ga0496107_0006889
1785 Ga0496107_0020757
1786 Ga0496107_0264826
1787 Ga0496107_0595063
1788 Ga0496108_0009077
1789 Ga0496108_0041075
1790 Ga0496108_0211033
1791 Ga0496109_0012385
1792 Ga0496109_0297248
1793 Ga0496109_1901005
1794 Ga0496110_0009316
1795 Ga0496110_0247026
1796 Ga0496111_0017785
1797 Ga0496111_0220040
1798 Ga0496111_0391437
1799 Ga0496112_0004475
1800 Ga0496112_0049174
1801 Ga0496112_0063648
1802 Ga0496112_0084404
1803 Ga0496112_0144826
1804 Ga0496113_0004532
1805 Ga0496113_0067246
1806 Ga0496113_0622152
1807 Ga0496114_0033622
1808 Ga0501047_1010089
1809 Ga0501068_0186055
1810 Ga0501068_0325761
1811 Ga0501074_0673470
1812 Ga0501227_055108
1813 Ga0501225_0024071
1814 Ga0501080_0018194
1815 Ga0501083_0553993
1816 Ga0501273_002541
1817 Ga0501204_064642
1818 Ga0495655_0019217
1819 Ga0495655_0047159
1820 Ga0500658_0000022
1821 Ga0590071_066406
1822 Ga0466962_0244668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ijf-assembly1.cif.gz_A crystal structure of the type vi effector-immunity complex (tae4-tai4) from agrobacterium tumefaciens 0.5382 23 124
3zfi-assembly1.cif.gz_B rap1a protein (sma2260) from serratia marcescens 0.5338 13 124
3zfi-assembly1.cif.gz_B rap1a protein (sma2260) from serratia marcescens 0.5206 13 124
6ijf-assembly1.cif.gz_A crystal structure of the type vi effector-immunity complex (tae4-tai4) from agrobacterium tumefaciens 0.5055 23 124
3d3p-assembly1.cif.gz_A crystal structure of pde4b catalytic domain in complex with a pyrazolopyridine inhibitor 0.4465 51 119
ID Description Score Start End Superfamily
3zfiB00 Mainly Alpha;Orthogonal Bundle;10k-s Protein, Hypothetical Protein A; Chain A; 0.5338 13 124 1.10.890.40
3zfiB00 Mainly Alpha;Orthogonal Bundle;10k-s Protein, Hypothetical Protein A; Chain A; 0.5206 13 124 1.10.890.40
3mq1B01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4638 25 123 1.20.58.970
af_K7UVJ3_176_270_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4402 25 119 1.20.58.160
af_K7MRV5_1_318_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.4396 25 118 1.10.630.10
ID Description Score Start End GO Terms
AF-A0A537M5B6-F1-model_v4 Rap1a immunity protein domain-containing protein 0.9476 24 124
AF-A0A7H0GA58-F1-model_v4 deleted 0.9462 43 124
AF-A0A519L7I4-F1-model_v4 Rap1a immunity protein domain-containing protein 0.9325 45 125
AF-A0A537M5B6-F1-model_v4 Rap1a immunity protein domain-containing protein 0.9295 24 124
AF-A0A1X7GSP5-F1-model_v4 Rap1a immunity protein domain-containing protein 0.9265 24 124

Map