F485485
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 911 | 379 | 1822 | 438 |
Family's Representative Sequence
| Representative Sequence | 3300053092|Ga0500583_0000164|Ga0500583_0000164_19545_20978 |
| Length | 477 |
| Sequence | VGIKKVPYLIVTSHLHSVARSVYFLLIASFLKNFFSMNQKLHFETLQLHAGQQIDPTTKARAVPIYQTTSYGFDSSAHAADLFGLRTFGNIYTRIMNPTTDVFEQRMAALEGGVAALATSSGQAAQFLALNNIMQAGDNFVSTSYLYGGTYNQFKISFKRLGIDARFVEGDDAENFVKHIDKNTKAIYLETIGNPRLNIPDFEKFAQLAKDYDLPLIVDNTFGAGGYLFRPLEHGAHVVVESATKWIGGHGTAIGGVIIDGGNYNWGNGKFPQFTEPSEGYHGLKFWDVFGEGNPLGLPNIAFAIRARVEGLRDFGPSLSPFNSFLLLQGLETLSLRVQRHVDNALTLATWLQEHPQVEFVEYPGLNTSPYNDLARKYLTNGFGGILNFGIKGEKEKASAFIDSLKLASHLANVGDAKTLVIHPASTTHEQLSAEEQLVAGVRPNQIRISVGIEHIEDIKADFEQAFEKVFANQLVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 179 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 197 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 211 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 216 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 217 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 225 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 228 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 229 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 235 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 280 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 306 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 309 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 310 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 324 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 325 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 327 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 329 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 330 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 332 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 333 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 338 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 339 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 340 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 341 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 342 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 343 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 344 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 345 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 346 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 347 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 348 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 349 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 350 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 351 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 352 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 353 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 354 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 355 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 356 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 357 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 358 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 359 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 360 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 361 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 362 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 363 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 364 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 365 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 366 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 367 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 368 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 369 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 370 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 371 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 372 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 373 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 374 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 375 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 376 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 377 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 378 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 379 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.73 |
| Metatranscriptomes | 0.66 |
| Isolates | 4.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.83 |
| Nodule | 0 |
| Rhizoplane | 0.55 |
| Rhizosphere | 88.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500583_0000164 | 3300053092 | Bacteria | 27548 |
| 2 | SwRhRL2b_contig_308077 | 2162886007 | Bacteria | 7601 |
| 3 | MBSR1b_contig_6741876 | 2162886012 | Bacteria | 1699 |
| 4 | JGI24737J22298_10000733 | 3300001990 | Bacteria | 11561 |
| 5 | JGI24735J21928_10000014 | 3300002067 | Bacteria | 186670 |
| 6 | JGI25162J39368_1000020 | 3300002737 | Bacteria | 254723 |
| 7 | JGI25162J39368_1001888 | 3300002737 | Bacteria | 9626 |
| 8 | JGI25164J39214_1002648 | 3300002772 | Bacteria | 2607 |
| 9 | JGI25165J46597_1000898 | 3300003214 | Bacteria | 20764 |
| 10 | rootH1_10001098 | 3300003316 | Bacteria | 10436 |
| 11 | rootH2_10002858 | 3300003320 | Bacteria | 54174 |
| 12 | rootH2_10035181 | 3300003320 | Bacteria | 29518 |
| 13 | rootL2_10163790 | 3300003322 | Bacteria | 2135 |
| 14 | rootH1_10003699 | 3300003323 | Bacteria | 25103 |
| 15 | rootH1_10017423 | 3300003323 | Bacteria | 3453 |
| 16 | rootH1_10126862 | 3300003323 | Bacteria | 4549 |
| 17 | JGI25160J50197_1003564 | 3300003354 | Bacteria | 6924 |
| 18 | Ga0055536_1013049 | 3300003781 | Bacteria | 3029 |
| 19 | Ga0065165_1000169 | 3300005262 | Bacteria | 115398 |
| 20 | Ga0065165_1001340 | 3300005262 | Bacteria | 27256 |
| 21 | Ga0065714_10002361 | 3300005288 | Bacteria | 37849 |
| 22 | Ga0065714_10002919 | 3300005288 | Bacteria | 20677 |
| 23 | Ga0065704_10000238 | 3300005289 | Bacteria | 87424 |
| 24 | Ga0065704_10001141 | 3300005289 | Bacteria | 9730 |
| 25 | Ga0065712_10001455 | 3300005290 | Bacteria | 6332 |
| 26 | Ga0070658_10000011 | 3300005327 | Bacteria | 294396 |
| 27 | Ga0070658_10037328 | 3300005327 | Bacteria | 3916 |
| 28 | Ga0070658_10073847 | 3300005327 | Bacteria | 2797 |
| 29 | Ga0070658_10088639 | 3300005327 | Bacteria | 2548 |
| 30 | Ga0070676_10001211 | 3300005328 | Bacteria | 12929 |
| 31 | Ga0070676_10002877 | 3300005328 | Bacteria | 8890 |
| 32 | Ga0070683_100018837 | 3300005329 | Bacteria | 6123 |
| 33 | Ga0070683_100159915 | 3300005329 | Bacteria | 2137 |
| 34 | Ga0070670_100027222 | 3300005331 | Bacteria | 4918 |
| 35 | Ga0070670_100038903 | 3300005331 | Bacteria | 4090 |
| 36 | Ga0070670_100063646 | 3300005331 | Bacteria | 3166 |
| 37 | Ga0070670_100078187 | 3300005331 | Bacteria | 2842 |
| 38 | Ga0070670_100147645 | 3300005331 | Bacteria | 2035 |
| 39 | Ga0068869_100016541 | 3300005334 | Bacteria | 4973 |
| 40 | Ga0068869_100031202 | 3300005334 | Bacteria | 3748 |
| 41 | Ga0068869_100038954 | 3300005334 | Bacteria | 3390 |
| 42 | Ga0070666_10001123 | 3300005335 | Bacteria | 16300 |
| 43 | Ga0070666_10006658 | 3300005335 | Bacteria | 7104 |
| 44 | Ga0070680_100005777 | 3300005336 | Bacteria | 9391 |
| 45 | Ga0070680_100041291 | 3300005336 | Bacteria | 3740 |
| 46 | Ga0070680_100059914 | 3300005336 | Bacteria | 3115 |
| 47 | Ga0070680_100068002 | 3300005336 | Bacteria | 2923 |
| 48 | Ga0070680_100131695 | 3300005336 | Bacteria | 2093 |
| 49 | Ga0070682_100003177 | 3300005337 | Bacteria | 9097 |
| 50 | Ga0068868_100014216 | 3300005338 | Bacteria | 5862 |
| 51 | Ga0068868_100136348 | 3300005338 | Bacteria | 2012 |
| 52 | Ga0070660_100029365 | 3300005339 | Bacteria | 4120 |
| 53 | Ga0070660_100052356 | 3300005339 | Bacteria | 3147 |
| 54 | Ga0070660_100086977 | 3300005339 | Bacteria | 2460 |
| 55 | Ga0070660_100123237 | 3300005339 | Bacteria | 2070 |
| 56 | Ga0070691_10000930 | 3300005341 | Bacteria | 11888 |
| 57 | Ga0070687_100030867 | 3300005343 | Bacteria | 2623 |
| 58 | Ga0070687_100052188 | 3300005343 | Bacteria | 2121 |
| 59 | Ga0070661_100018952 | 3300005344 | Bacteria | 4900 |
| 60 | Ga0070692_10103083 | 3300005345 | Bacteria | 1567 |
| 61 | Ga0070668_100004450 | 3300005347 | Bacteria | 10396 |
| 62 | Ga0070669_100008200 | 3300005353 | Bacteria | 7461 |
| 63 | Ga0070675_100007148 | 3300005354 | Bacteria | 8599 |
| 64 | Ga0070675_100012647 | 3300005354 | Bacteria | 6621 |
| 65 | Ga0070671_100094133 | 3300005355 | Bacteria | 2511 |
| 66 | Ga0070671_100122779 | 3300005355 | Bacteria | 2186 |
| 67 | Ga0070673_100001702 | 3300005364 | Bacteria | 13067 |
| 68 | Ga0070673_100003548 | 3300005364 | Bacteria | 9732 |
| 69 | Ga0070673_100029933 | 3300005364 | Bacteria | 4067 |
| 70 | Ga0070673_100040799 | 3300005364 | Bacteria | 3563 |
| 71 | Ga0070673_100117815 | 3300005364 | Bacteria | 2211 |
| 72 | Ga0070688_100005858 | 3300005365 | Bacteria | 6504 |
| 73 | Ga0070659_100021644 | 3300005366 | Bacteria | 4900 |
| 74 | Ga0070659_100026196 | 3300005366 | Bacteria | 4485 |
| 75 | Ga0070659_100042229 | 3300005366 | Bacteria | 3565 |
| 76 | Ga0070659_100046953 | 3300005366 | Bacteria | 3385 |
| 77 | Ga0070659_100247454 | 3300005366 | Bacteria | 1477 |
| 78 | Ga0070667_100024412 | 3300005367 | Bacteria | 5021 |
| 79 | Ga0070667_100077159 | 3300005367 | Bacteria | 2845 |
| 80 | Ga0070667_100222451 | 3300005367 | Bacteria | 1680 |
| 81 | Ga0070663_100028577 | 3300005455 | Bacteria | 3798 |
| 82 | Ga0070663_100144121 | 3300005455 | Bacteria | 1821 |
| 83 | Ga0070678_100007368 | 3300005456 | Bacteria | 6522 |
| 84 | Ga0070662_100004667 | 3300005457 | Bacteria | 8690 |
| 85 | Ga0070681_10142682 | 3300005458 | Bacteria | 2324 |
| 86 | Ga0070681_10261627 | 3300005458 | Bacteria | 1642 |
| 87 | Ga0068867_100006003 | 3300005459 | Bacteria | 8611 |
| 88 | Ga0068867_100016922 | 3300005459 | Bacteria | 5181 |
| 89 | Ga0068867_100028131 | 3300005459 | Bacteria | 4045 |
| 90 | Ga0070679_100001254 | 3300005530 | Bacteria | 22385 |
| 91 | Ga0070679_100010318 | 3300005530 | Bacteria | 8855 |
| 92 | Ga0070679_100015447 | 3300005530 | Bacteria | 7337 |
| 93 | Ga0070679_100199057 | 3300005530 | Bacteria | 1970 |
| 94 | Ga0070684_100104674 | 3300005535 | Bacteria | 2532 |
| 95 | Ga0070684_100119774 | 3300005535 | Bacteria | 2367 |
| 96 | Ga0070684_100217623 | 3300005535 | Bacteria | 1742 |
| 97 | Ga0068853_100016543 | 3300005539 | Bacteria | 6073 |
| 98 | Ga0068853_100024401 | 3300005539 | Bacteria | 5069 |
| 99 | Ga0068853_100068924 | 3300005539 | Bacteria | 3076 |
| 100 | Ga0070672_100022405 | 3300005543 | Bacteria | 4640 |
| 101 | Ga0070695_100112949 | 3300005545 | Bacteria | 1846 |
| 102 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 103 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 104 | Ga0068855_100000727 | 3300005563 | Bacteria | 40453 |
| 105 | Ga0068855_100000998 | 3300005563 | Bacteria | 35254 |
| 106 | Ga0068855_100002579 | 3300005563 | Bacteria | 22327 |
| 107 | Ga0068855_100010877 | 3300005563 | Bacteria | 10983 |
| 108 | Ga0068855_100056698 | 3300005563 | Bacteria | 4595 |
| 109 | Ga0068855_100094815 | 3300005563 | Bacteria | 3441 |
| 110 | Ga0068855_100144948 | 3300005563 | Bacteria | 2704 |
| 111 | Ga0068855_100180723 | 3300005563 | Bacteria | 2385 |
| 112 | Ga0068855_100242163 | 3300005563 | Bacteria | 2015 |
| 113 | Ga0068855_100378740 | 3300005563 | Bacteria | 1554 |
| 114 | Ga0068857_100004830 | 3300005577 | Bacteria | 11421 |
| 115 | Ga0068854_100031522 | 3300005578 | Bacteria | 3685 |
| 116 | Ga0068856_100000259 | 3300005614 | Bacteria | 57810 |
| 117 | Ga0068856_100003419 | 3300005614 | Bacteria | 16056 |
| 118 | Ga0068856_100012928 | 3300005614 | Bacteria | 8080 |
| 119 | Ga0068856_100110022 | 3300005614 | Bacteria | 2752 |
| 120 | Ga0068852_100003639 | 3300005616 | Bacteria | 10799 |
| 121 | Ga0068852_100005665 | 3300005616 | Bacteria | 8958 |
| 122 | Ga0068852_100008807 | 3300005616 | Bacteria | 7466 |
| 123 | Ga0068852_100024969 | 3300005616 | Bacteria | 4836 |
| 124 | Ga0068852_100025420 | 3300005616 | Bacteria | 4798 |
| 125 | Ga0068852_100068319 | 3300005616 | Bacteria | 3110 |
| 126 | Ga0068852_100077757 | 3300005616 | Bacteria | 2934 |
| 127 | Ga0068859_100000023 | 3300005617 | Bacteria | 221914 |
| 128 | Ga0068859_100010680 | 3300005617 | Bacteria | 9241 |
| 129 | Ga0068859_100020142 | 3300005617 | Bacteria | 6697 |
| 130 | Ga0068859_100318554 | 3300005617 | Bacteria | 1649 |
| 131 | Ga0068864_100000733 | 3300005618 | Bacteria | 27467 |
| 132 | Ga0068864_100009349 | 3300005618 | Bacteria | 8085 |
| 133 | Ga0068864_100043103 | 3300005618 | Bacteria | 3863 |
| 134 | Ga0068866_10003738 | 3300005718 | Bacteria | 6241 |
| 135 | Ga0068861_100040252 | 3300005719 | Bacteria | 3494 |
| 136 | Ga0068861_100099963 | 3300005719 | Bacteria | 2305 |
| 137 | Ga0068861_100189055 | 3300005719 | Bacteria | 1720 |
| 138 | Ga0068851_10022987 | 3300005834 | Bacteria | 3044 |
| 139 | Ga0068863_100027572 | 3300005841 | Bacteria | 5418 |
| 140 | Ga0068863_100028175 | 3300005841 | Bacteria | 5362 |
| 141 | Ga0068858_100003125 | 3300005842 | Bacteria | 16572 |
| 142 | Ga0068858_100003981 | 3300005842 | Bacteria | 14582 |
| 143 | Ga0068858_100098620 | 3300005842 | Bacteria | 2724 |
| 144 | Ga0068858_100146325 | 3300005842 | Bacteria | 2219 |
| 145 | Ga0068860_100000059 | 3300005843 | Bacteria | 196400 |
| 146 | Ga0068860_100001384 | 3300005843 | Bacteria | 26311 |
| 147 | Ga0068860_100024605 | 3300005843 | Bacteria | 5814 |
| 148 | Ga0068860_100040343 | 3300005843 | Bacteria | 4462 |
| 149 | Ga0068862_100004782 | 3300005844 | Bacteria | 11396 |
| 150 | Ga0068862_100027564 | 3300005844 | Bacteria | 4782 |
| 151 | Ga0068862_100213640 | 3300005844 | Bacteria | 1744 |
| 152 | Ga0075366_10007290 | 3300006195 | Bacteria | 6099 |
| 153 | Ga0075366_10032558 | 3300006195 | Bacteria | 3069 |
| 154 | Ga0097621_100000020 | 3300006237 | Bacteria | 86226 |
| 155 | Ga0097621_100000487 | 3300006237 | Bacteria | 27766 |
| 156 | Ga0097621_100051390 | 3300006237 | Bacteria | 3355 |
| 157 | Ga0097621_100064504 | 3300006237 | Bacteria | 3012 |
| 158 | Ga0097621_100088581 | 3300006237 | Bacteria | 2586 |
| 159 | Ga0097621_100115725 | 3300006237 | Bacteria | 2270 |
| 160 | Ga0097621_100267105 | 3300006237 | Unclassified | 1502 |
| 161 | Ga0068871_100000416 | 3300006358 | Bacteria | 29438 |
| 162 | Ga0068871_100000598 | 3300006358 | Bacteria | 24790 |
| 163 | Ga0068871_100013343 | 3300006358 | Bacteria | 6098 |
| 164 | Ga0068871_100021887 | 3300006358 | Bacteria | 4922 |
| 165 | Ga0068871_100027178 | 3300006358 | Bacteria | 4472 |
| 166 | Ga0075431_100057971 | 3300006847 | Bacteria | 3994 |
| 167 | Ga0075429_100049891 | 3300006880 | Bacteria | 3641 |
| 168 | Ga0068865_100000208 | 3300006881 | Bacteria | 32611 |
| 169 | Ga0068865_100004850 | 3300006881 | Bacteria | 8134 |
| 170 | Ga0068865_100011685 | 3300006881 | Bacteria | 5501 |
| 171 | Ga0097620_100000023 | 3300006931 | Bacteria | 221914 |
| 172 | Ga0097620_100010683 | 3300006931 | Bacteria | 9241 |
| 173 | Ga0097620_100020142 | 3300006931 | Bacteria | 6697 |
| 174 | Ga0097620_100318566 | 3300006931 | Bacteria | 1649 |
| 175 | Ga0105240_10000767 | 3300009093 | Bacteria | 58332 |
| 176 | Ga0105240_10001584 | 3300009093 | Bacteria | 38608 |
| 177 | Ga0105240_10007530 | 3300009093 | Bacteria | 15793 |
| 178 | Ga0105240_10031042 | 3300009093 | Bacteria | 6934 |
| 179 | Ga0105240_10049859 | 3300009093 | Bacteria | 5281 |
| 180 | Ga0105240_10095335 | 3300009093 | Bacteria | 3628 |
| 181 | Ga0105240_10102281 | 3300009093 | Bacteria | 3482 |
| 182 | Ga0105240_10119990 | 3300009093 | Bacteria | 3167 |
| 183 | Ga0105240_10171848 | 3300009093 | Bacteria | 2566 |
| 184 | Ga0111539_10006433 | 3300009094 | Bacteria | 15147 |
| 185 | Ga0111539_10011432 | 3300009094 | Bacteria | 11143 |
| 186 | Ga0111539_10295731 | 3300009094 | Bacteria | 1884 |
| 187 | Ga0105245_10050473 | 3300009098 | Bacteria | 3728 |
| 188 | Ga0105247_10008227 | 3300009101 | Bacteria | 6363 |
| 189 | Ga0105247_10009048 | 3300009101 | Bacteria | 6063 |
| 190 | Ga0114129_10174564 | 3300009147 | Bacteria | 2928 |
| 191 | Ga0105243_10000012 | 3300009148 | Bacteria | 300885 |
| 192 | Ga0105243_10031803 | 3300009148 | Bacteria | 4071 |
| 193 | Ga0105243_10074134 | 3300009148 | Bacteria | 2760 |
| 194 | Ga0105243_10159239 | 3300009148 | Bacteria | 1945 |
| 195 | Ga0105241_10000861 | 3300009174 | Bacteria | 23026 |
| 196 | Ga0105241_10002514 | 3300009174 | Bacteria | 13768 |
| 197 | Ga0105241_10018003 | 3300009174 | Bacteria | 5193 |
| 198 | Ga0105241_10043565 | 3300009174 | Bacteria | 3399 |
| 199 | Ga0105241_10096885 | 3300009174 | Bacteria | 2338 |
| 200 | Ga0105241_10189405 | 3300009174 | Bacteria | 1712 |
| 201 | Ga0105242_10059690 | 3300009176 | Bacteria | 3131 |
| 202 | Ga0105242_10067351 | 3300009176 | Bacteria | 2960 |
| 203 | Ga0105248_10013691 | 3300009177 | Bacteria | 8928 |
| 204 | Ga0105248_10040274 | 3300009177 | Bacteria | 5237 |
| 205 | Ga0105237_10000044 | 3300009545 | Bacteria | 177828 |
| 206 | Ga0105237_10000356 | 3300009545 | Bacteria | 64629 |
| 207 | Ga0105237_10000971 | 3300009545 | Bacteria | 38512 |
| 208 | Ga0105237_10001449 | 3300009545 | Bacteria | 31348 |
| 209 | Ga0105237_10001750 | 3300009545 | Bacteria | 28065 |
| 210 | Ga0105237_10001907 | 3300009545 | Bacteria | 26596 |
| 211 | Ga0105237_10004465 | 3300009545 | Bacteria | 16170 |
| 212 | Ga0105237_10006762 | 3300009545 | Bacteria | 12655 |
| 213 | Ga0105237_10006763 | 3300009545 | Bacteria | 12654 |
| 214 | Ga0105237_10007600 | 3300009545 | Bacteria | 11844 |
| 215 | Ga0105237_10007857 | 3300009545 | Bacteria | 11628 |
| 216 | Ga0105237_10027387 | 3300009545 | Bacteria | 5819 |
| 217 | Ga0105237_10079069 | 3300009545 | Bacteria | 3278 |
| 218 | Ga0105237_10123090 | 3300009545 | Bacteria | 2588 |
| 219 | Ga0105237_10135189 | 3300009545 | Bacteria | 2460 |
| 220 | Ga0105238_10013311 | 3300009551 | Bacteria | 8299 |
| 221 | Ga0105238_10053188 | 3300009551 | Bacteria | 4069 |
| 222 | Ga0105238_10109459 | 3300009551 | Bacteria | 2744 |
| 223 | Ga0105238_10169826 | 3300009551 | Bacteria | 2157 |
| 224 | Ga0105249_10002037 | 3300009553 | Bacteria | 17526 |
| 225 | Ga0105249_10006492 | 3300009553 | Bacteria | 10174 |
| 226 | Ga0105249_10008554 | 3300009553 | Bacteria | 8924 |
| 227 | Ga0105249_10010023 | 3300009553 | Bacteria | 8315 |
| 228 | Ga0105249_10019997 | 3300009553 | Bacteria | 5978 |
| 229 | Ga0105249_10056653 | 3300009553 | Bacteria | 3588 |
| 230 | Ga0105249_10058903 | 3300009553 | Bacteria | 3522 |
| 231 | Ga0105239_10000005 | 3300010375 | Bacteria | 496066 |
| 232 | Ga0105239_10000013 | 3300010375 | Bacteria | 327371 |
| 233 | Ga0105239_10000072 | 3300010375 | Eukaryota | 141600 |
| 234 | Ga0105239_10000081 | 3300010375 | Bacteria | 133686 |
| 235 | Ga0105239_10000259 | 3300010375 | Bacteria | 78760 |
| 236 | Ga0105239_10001040 | 3300010375 | Bacteria | 38650 |
| 237 | Ga0105239_10002120 | 3300010375 | Bacteria | 25598 |
| 238 | Ga0105239_10002563 | 3300010375 | Bacteria | 23044 |
| 239 | Ga0105239_10016008 | 3300010375 | Bacteria | 8300 |
| 240 | Ga0105239_10031256 | 3300010375 | Bacteria | 5856 |
| 241 | Ga0105239_10038296 | 3300010375 | Bacteria | 5254 |
| 242 | Ga0105239_10038468 | 3300010375 | Bacteria | 5243 |
| 243 | Ga0105239_10051224 | 3300010375 | Bacteria | 4526 |
| 244 | Ga0105239_10060044 | 3300010375 | Bacteria | 4173 |
| 245 | Ga0105239_10258127 | 3300010375 | Bacteria | 1958 |
| 246 | Ga0157373_10000597 | 3300013100 | Bacteria | 28042 |
| 247 | Ga0157373_10004754 | 3300013100 | Bacteria | 10220 |
| 248 | Ga0157373_10019227 | 3300013100 | Bacteria | 4974 |
| 249 | Ga0157373_10062478 | 3300013100 | Bacteria | 2638 |
| 250 | Ga0157371_10000724 | 3300013102 | Bacteria | 38696 |
| 251 | Ga0157371_10001349 | 3300013102 | Bacteria | 25843 |
| 252 | Ga0157371_10001703 | 3300013102 | Bacteria | 22394 |
| 253 | Ga0157371_10002487 | 3300013102 | Bacteria | 17524 |
| 254 | Ga0157371_10003887 | 3300013102 | Bacteria | 13314 |
| 255 | Ga0157371_10006631 | 3300013102 | Bacteria | 9493 |
| 256 | Ga0157371_10008420 | 3300013102 | Bacteria | 8214 |
| 257 | Ga0157371_10010626 | 3300013102 | Bacteria | 7151 |
| 258 | Ga0157371_10022883 | 3300013102 | Bacteria | 4571 |
| 259 | Ga0157371_10025530 | 3300013102 | Bacteria | 4304 |
| 260 | Ga0157371_10041765 | 3300013102 | Bacteria | 3272 |
| 261 | Ga0157371_10111945 | 3300013102 | Bacteria | 1937 |
| 262 | Ga0157370_10001989 | 3300013104 | Bacteria | 25133 |
| 263 | Ga0157370_10003763 | 3300013104 | Bacteria | 17707 |
| 264 | Ga0157370_10005319 | 3300013104 | Bacteria | 14456 |
| 265 | Ga0157370_10010139 | 3300013104 | Bacteria | 9950 |
| 266 | Ga0157370_10012521 | 3300013104 | Bacteria | 8793 |
| 267 | Ga0157370_10037184 | 3300013104 | Bacteria | 4719 |
| 268 | Ga0157370_10040253 | 3300013104 | Bacteria | 4513 |
| 269 | Ga0157369_10014216 | 3300013105 | Bacteria | 8992 |
| 270 | Ga0157369_10024325 | 3300013105 | Bacteria | 6740 |
| 271 | Ga0157369_10033374 | 3300013105 | Bacteria | 5657 |
| 272 | Ga0157369_10039532 | 3300013105 | Bacteria | 5154 |
| 273 | Ga0157369_10067870 | 3300013105 | Bacteria | 3832 |
| 274 | Ga0157369_10113581 | 3300013105 | Bacteria | 2877 |
| 275 | Ga0157369_10152866 | 3300013105 | Unclassified | 2439 |
| 276 | Ga0157369_10188032 | 3300013105 | Bacteria | 2171 |
| 277 | Ga0157374_10000723 | 3300013296 | Bacteria | 28842 |
| 278 | Ga0157374_10125412 | 3300013296 | Bacteria | 2482 |
| 279 | Ga0157374_10242437 | 3300013296 | Bacteria | 1773 |
| 280 | Ga0157378_10004726 | 3300013297 | Bacteria | 11942 |
| 281 | Ga0157378_10034883 | 3300013297 | Bacteria | 4448 |
| 282 | Ga0157378_10073585 | 3300013297 | Bacteria | 3072 |
| 283 | Ga0157378_10249580 | 3300013297 | Bacteria | 1698 |
| 284 | Ga0157378_10307648 | 3300013297 | Bacteria | 1536 |
| 285 | Ga0163162_10000066 | 3300013306 | Bacteria | 100009 |
| 286 | Ga0163162_10000164 | 3300013306 | Bacteria | 60866 |
| 287 | Ga0163162_10000373 | 3300013306 | Bacteria | 40682 |
| 288 | Ga0163162_10000697 | 3300013306 | Bacteria | 31013 |
| 289 | Ga0163162_10000856 | 3300013306 | Bacteria | 28341 |
| 290 | Ga0163162_10001561 | 3300013306 | Bacteria | 21390 |
| 291 | Ga0163162_10004336 | 3300013306 | Bacteria | 13656 |
| 292 | Ga0163162_10007340 | 3300013306 | Bacteria | 10714 |
| 293 | Ga0163162_10013198 | 3300013306 | Bacteria | 8069 |
| 294 | Ga0163162_10180640 | 3300013306 | Bacteria | 2236 |
| 295 | Ga0163162_10202005 | 3300013306 | Unclassified | 2116 |
| 296 | Ga0163162_10346582 | 3300013306 | Bacteria | 1618 |
| 297 | Ga0157372_10000676 | 3300013307 | Bacteria | 37536 |
| 298 | Ga0157372_10001143 | 3300013307 | Bacteria | 28799 |
| 299 | Ga0157372_10004620 | 3300013307 | Bacteria | 14640 |
| 300 | Ga0157372_10005956 | 3300013307 | Bacteria | 12962 |
| 301 | Ga0157372_10022840 | 3300013307 | Bacteria | 6773 |
| 302 | Ga0157372_10022931 | 3300013307 | Bacteria | 6761 |
| 303 | Ga0157372_10062402 | 3300013307 | Bacteria | 4175 |
| 304 | Ga0157372_10094460 | 3300013307 | Bacteria | 3405 |
| 305 | Ga0157372_10100848 | 3300013307 | Bacteria | 3295 |
| 306 | Ga0157372_10202863 | 3300013307 | Bacteria | 2297 |
| 307 | Ga0157372_10359662 | 3300013307 | Bacteria | 1696 |
| 308 | Ga0157375_10000383 | 3300013308 | Bacteria | 40397 |
| 309 | Ga0157375_10019253 | 3300013308 | Bacteria | 6205 |
| 310 | Ga0157375_10041242 | 3300013308 | Bacteria | 4455 |
| 311 | Ga0157375_10122099 | 3300013308 | Unclassified | 2716 |
| 312 | Ga0157375_10127950 | 3300013308 | Bacteria | 2657 |
| 313 | Ga0163163_10000560 | 3300014325 | Bacteria | 32679 |
| 314 | Ga0163163_10002931 | 3300014325 | Bacteria | 14436 |
| 315 | Ga0163163_10144484 | 3300014325 | Unclassified | 2422 |
| 316 | Ga0157380_10001590 | 3300014326 | Bacteria | 14970 |
| 317 | Ga0182008_10000010 | 3300014497 | Bacteria | 301527 |
| 318 | Ga0182008_10003765 | 3300014497 | Bacteria | 9034 |
| 319 | Ga0157377_10004008 | 3300014745 | Bacteria | 6716 |
| 320 | Ga0157377_10057473 | 3300014745 | Bacteria | 2212 |
| 321 | Ga0157379_10034273 | 3300014968 | Bacteria | 4525 |
| 322 | Ga0157376_10002437 | 3300014969 | Bacteria | 12579 |
| 323 | Ga0157376_10003607 | 3300014969 | Bacteria | 10680 |
| 324 | Ga0157376_10029923 | 3300014969 | Bacteria | 4340 |
| 325 | Ga0157376_10036441 | 3300014969 | Bacteria | 3985 |
| 326 | Ga0182006_1026019 | 3300015261 | Bacteria | 2399 |
| 327 | Ga0182007_10010906 | 3300015262 | Bacteria | 3563 |
| 328 | Ga0183373_1010 | 3300015682 | Bacteria | 196982 |
| 329 | Ga0163161_10001190 | 3300017792 | Bacteria | 19553 |
| 330 | Ga0163161_10067587 | 3300017792 | Bacteria | 2610 |
| 331 | Ga0206351_10002408 | 3300020077 | Bacteria | 2600 |
| 332 | Ga0206350_10114900 | 3300020080 | Bacteria | 1917 |
| 333 | Ga0154015_1295413 | 3300020610 | Bacteria | 2058 |
| 334 | Ga0209563_103756 | 3300025230 | Bacteria | 3056 |
| 335 | Ga0207427_100785 | 3300025231 | Bacteria | 14472 |
| 336 | Ga0209437_100085 | 3300025233 | Bacteria | 254790 |
| 337 | Ga0209437_100101 | 3300025233 | Bacteria | 226668 |
| 338 | Ga0209646_1001361 | 3300025246 | Bacteria | 6739 |
| 339 | Ga0209026_1000987 | 3300025250 | Bacteria | 14160 |
| 340 | Ga0209026_1001037 | 3300025250 | Bacteria | 13605 |
| 341 | Ga0209233_1000124 | 3300025261 | Bacteria | 226743 |
| 342 | Ga0209455_1004434 | 3300025272 | Bacteria | 4600 |
| 343 | Ga0209676_1000329 | 3300025292 | Bacteria | 91571 |
| 344 | Ga0209050_1008696 | 3300025298 | Bacteria | 5357 |
| 345 | Ga0209050_1024684 | 3300025298 | Bacteria | 2070 |
| 346 | Ga0207426_1000040 | 3300025302 | Bacteria | 433920 |
| 347 | Ga0209257_1000299 | 3300025304 | Bacteria | 108881 |
| 348 | Ga0207656_10025276 | 3300025321 | Bacteria | 2409 |
| 349 | Ga0207710_10002430 | 3300025900 | Bacteria | 8659 |
| 350 | Ga0207680_10000568 | 3300025903 | Bacteria | 17460 |
| 351 | Ga0207647_10030716 | 3300025904 | Bacteria | 3463 |
| 352 | Ga0207645_10000542 | 3300025907 | Bacteria | 31431 |
| 353 | Ga0207645_10000544 | 3300025907 | Bacteria | 31399 |
| 354 | Ga0207645_10124726 | 3300025907 | Bacteria | 1673 |
| 355 | Ga0207705_10000015 | 3300025909 | Bacteria | 382901 |
| 356 | Ga0207705_10002903 | 3300025909 | Bacteria | 13109 |
| 357 | Ga0207705_10007368 | 3300025909 | Bacteria | 8088 |
| 358 | Ga0207705_10036116 | 3300025909 | Bacteria | 3536 |
| 359 | Ga0207705_10151766 | 3300025909 | Bacteria | 1736 |
| 360 | Ga0207654_10002706 | 3300025911 | Bacteria | 8996 |
| 361 | Ga0207654_10038517 | 3300025911 | Bacteria | 2683 |
| 362 | Ga0207654_10038897 | 3300025911 | Bacteria | 2672 |
| 363 | Ga0207707_10002565 | 3300025912 | Bacteria | 16286 |
| 364 | Ga0207707_10072069 | 3300025912 | Bacteria | 3011 |
| 365 | Ga0207695_10000170 | 3300025913 | Bacteria | 192469 |
| 366 | Ga0207695_10000425 | 3300025913 | Bacteria | 93523 |
| 367 | Ga0207695_10000916 | 3300025913 | Bacteria | 52837 |
| 368 | Ga0207695_10011968 | 3300025913 | Bacteria | 10442 |
| 369 | Ga0207695_10016283 | 3300025913 | Bacteria | 8709 |
| 370 | Ga0207695_10070758 | 3300025913 | Bacteria | 3564 |
| 371 | Ga0207695_10086253 | 3300025913 | Bacteria | 3167 |
| 372 | Ga0207695_10114967 | 3300025913 | Bacteria | 2666 |
| 373 | Ga0207695_10238178 | 3300025913 | Bacteria | 1722 |
| 374 | Ga0207671_10000004 | 3300025914 | Bacteria | 1022356 |
| 375 | Ga0207671_10001803 | 3300025914 | Bacteria | 23938 |
| 376 | Ga0207671_10001864 | 3300025914 | Bacteria | 23482 |
| 377 | Ga0207671_10002376 | 3300025914 | Bacteria | 20227 |
| 378 | Ga0207671_10006717 | 3300025914 | Bacteria | 10189 |
| 379 | Ga0207671_10007521 | 3300025914 | Bacteria | 9442 |
| 380 | Ga0207671_10007560 | 3300025914 | Bacteria | 9410 |
| 381 | Ga0207671_10007647 | 3300025914 | Bacteria | 9335 |
| 382 | Ga0207671_10010890 | 3300025914 | Bacteria | 7455 |
| 383 | Ga0207671_10011739 | 3300025914 | Bacteria | 7098 |
| 384 | Ga0207671_10019488 | 3300025914 | Bacteria | 5187 |
| 385 | Ga0207671_10044618 | 3300025914 | Bacteria | 3279 |
| 386 | Ga0207663_10002822 | 3300025916 | Bacteria | 8385 |
| 387 | Ga0207660_10008582 | 3300025917 | Bacteria | 6611 |
| 388 | Ga0207660_10042766 | 3300025917 | Bacteria | 3181 |
| 389 | Ga0207660_10049766 | 3300025917 | Bacteria | 2973 |
| 390 | Ga0207662_10022892 | 3300025918 | Bacteria | 3586 |
| 391 | Ga0207657_10008447 | 3300025919 | Bacteria | 10445 |
| 392 | Ga0207657_10016158 | 3300025919 | Bacteria | 7206 |
| 393 | Ga0207657_10057719 | 3300025919 | Bacteria | 3344 |
| 394 | Ga0207657_10172084 | 3300025919 | Bacteria | 1754 |
| 395 | Ga0207649_10042136 | 3300025920 | Bacteria | 2783 |
| 396 | Ga0207652_10000337 | 3300025921 | Bacteria | 48786 |
| 397 | Ga0207652_10002860 | 3300025921 | Bacteria | 14452 |
| 398 | Ga0207652_10020852 | 3300025921 | Bacteria | 5402 |
| 399 | Ga0207652_10032090 | 3300025921 | Bacteria | 4412 |
| 400 | Ga0207694_10038631 | 3300025924 | Bacteria | 3671 |
| 401 | Ga0207694_10050652 | 3300025924 | Bacteria | 3217 |
| 402 | Ga0207694_10092164 | 3300025924 | Bacteria | 2392 |
| 403 | Ga0207650_10067551 | 3300025925 | Bacteria | 2683 |
| 404 | Ga0207659_10023637 | 3300025926 | Unclassified | 4105 |
| 405 | Ga0207644_10024181 | 3300025931 | Unclassified | 4168 |
| 406 | Ga0207644_10068752 | 3300025931 | Bacteria | 2585 |
| 407 | Ga0207690_10112169 | 3300025932 | Bacteria | 1966 |
| 408 | Ga0207706_10002738 | 3300025933 | Bacteria | 17152 |
| 409 | Ga0207706_10009939 | 3300025933 | Bacteria | 8721 |
| 410 | Ga0207706_10036819 | 3300025933 | Bacteria | 4346 |
| 411 | Ga0207709_10000006 | 3300025935 | Bacteria | 800946 |
| 412 | Ga0207709_10080165 | 3300025935 | Bacteria | 2101 |
| 413 | Ga0207709_10119077 | 3300025935 | Bacteria | 1779 |
| 414 | Ga0207704_10000512 | 3300025938 | Bacteria | 17246 |
| 415 | Ga0207704_10009752 | 3300025938 | Bacteria | 4650 |
| 416 | Ga0207691_10000060 | 3300025940 | Bacteria | 86844 |
| 417 | Ga0207691_10223802 | 3300025940 | Bacteria | 1631 |
| 418 | Ga0207711_10044751 | 3300025941 | Bacteria | 3780 |
| 419 | Ga0207711_10066146 | 3300025941 | Bacteria | 3126 |
| 420 | Ga0207689_10005494 | 3300025942 | Bacteria | 11337 |
| 421 | Ga0207689_10006819 | 3300025942 | Bacteria | 10044 |
| 422 | Ga0207689_10018897 | 3300025942 | Bacteria | 5812 |
| 423 | Ga0207667_10000020 | 3300025949 | Bacteria | 374770 |
| 424 | Ga0207667_10001127 | 3300025949 | Bacteria | 33693 |
| 425 | Ga0207667_10001491 | 3300025949 | Bacteria | 29391 |
| 426 | Ga0207667_10002289 | 3300025949 | Bacteria | 24067 |
| 427 | Ga0207667_10014074 | 3300025949 | Bacteria | 9132 |
| 428 | Ga0207667_10020765 | 3300025949 | Bacteria | 7296 |
| 429 | Ga0207667_10056182 | 3300025949 | Bacteria | 4136 |
| 430 | Ga0207667_10060829 | 3300025949 | Bacteria | 3953 |
| 431 | Ga0207667_10072509 | 3300025949 | Bacteria | 3579 |
| 432 | Ga0207667_10085791 | 3300025949 | Bacteria | 3259 |
| 433 | Ga0207667_10139059 | 3300025949 | Bacteria | 2500 |
| 434 | Ga0207667_10277008 | 3300025949 | Bacteria | 1714 |
| 435 | Ga0207651_10013175 | 3300025960 | Bacteria | 4719 |
| 436 | Ga0207651_10017395 | 3300025960 | Bacteria | 4248 |
| 437 | Ga0207651_10052572 | 3300025960 | Bacteria | 2778 |
| 438 | Ga0207651_10199908 | 3300025960 | Bacteria | 1601 |
| 439 | Ga0207712_10089110 | 3300025961 | Bacteria | 2267 |
| 440 | Ga0207712_10150765 | 3300025961 | Bacteria | 1796 |
| 441 | Ga0207712_10186025 | 3300025961 | Bacteria | 1636 |
| 442 | Ga0207668_10030727 | 3300025972 | Bacteria | 3532 |
| 443 | Ga0207658_10001199 | 3300025986 | Bacteria | 20672 |
| 444 | Ga0207658_10022335 | 3300025986 | Unclassified | 4405 |
| 445 | Ga0207677_10012534 | 3300026023 | Bacteria | 4878 |
| 446 | Ga0207677_10038042 | 3300026023 | Bacteria | 3150 |
| 447 | Ga0207677_10114976 | 3300026023 | Bacteria | 2012 |
| 448 | Ga0207703_10008491 | 3300026035 | Bacteria | 8116 |
| 449 | Ga0207703_10059028 | 3300026035 | Bacteria | 3134 |
| 450 | Ga0207639_10019114 | 3300026041 | Bacteria | 4880 |
| 451 | Ga0207639_10020628 | 3300026041 | Bacteria | 4720 |
| 452 | Ga0207639_10021022 | 3300026041 | Bacteria | 4681 |
| 453 | Ga0207639_10034523 | 3300026041 | Bacteria | 3738 |
| 454 | Ga0207639_10220561 | 3300026041 | Bacteria | 1637 |
| 455 | Ga0207678_10008280 | 3300026067 | Bacteria | 9160 |
| 456 | Ga0207702_10000820 | 3300026078 | Bacteria | 32858 |
| 457 | Ga0207702_10036846 | 3300026078 | Bacteria | 4092 |
| 458 | Ga0207702_10078276 | 3300026078 | Bacteria | 2862 |
| 459 | Ga0207702_10085244 | 3300026078 | Bacteria | 2752 |
| 460 | Ga0207702_10122965 | 3300026078 | Bacteria | 2325 |
| 461 | Ga0207641_10000250 | 3300026088 | Bacteria | 68774 |
| 462 | Ga0207641_10003961 | 3300026088 | Bacteria | 12936 |
| 463 | Ga0207641_10025863 | 3300026088 | Bacteria | 4841 |
| 464 | Ga0207641_10031708 | 3300026088 | Bacteria | 4384 |
| 465 | Ga0207648_10003642 | 3300026089 | Bacteria | 16123 |
| 466 | Ga0207648_10004739 | 3300026089 | Bacteria | 13898 |
| 467 | Ga0207648_10064738 | 3300026089 | Bacteria | 3186 |
| 468 | Ga0207648_10073470 | 3300026089 | Unclassified | 2980 |
| 469 | Ga0207676_10013473 | 3300026095 | Bacteria | 5874 |
| 470 | Ga0207676_10109544 | 3300026095 | Bacteria | 2308 |
| 471 | Ga0207674_10004594 | 3300026116 | Bacteria | 16575 |
| 472 | Ga0207674_10191636 | 3300026116 | Bacteria | 1994 |
| 473 | Ga0207674_10209049 | 3300026116 | Bacteria | 1901 |
| 474 | Ga0207674_10224157 | 3300026116 | Bacteria | 1828 |
| 475 | Ga0207675_100000599 | 3300026118 | Bacteria | 35195 |
| 476 | Ga0207675_100022077 | 3300026118 | Bacteria | 5925 |
| 477 | Ga0207675_100105979 | 3300026118 | Bacteria | 2650 |
| 478 | Ga0207698_10002595 | 3300026142 | Bacteria | 10744 |
| 479 | Ga0207698_10024598 | 3300026142 | Bacteria | 4230 |
| 480 | Ga0207698_10067134 | 3300026142 | Bacteria | 2827 |
| 481 | Ga0207698_10072052 | 3300026142 | Bacteria | 2745 |
| 482 | Ga0207698_10294430 | 3300026142 | Bacteria | 1508 |
| 483 | Ga0207428_10057977 | 3300027907 | Bacteria | 3074 |
| 484 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 485 | Ga0268266_10000052 | 3300028379 | Bacteria | 296230 |
| 486 | Ga0268266_10039046 | 3300028379 | Bacteria | 4043 |
| 487 | Ga0268266_10157587 | 3300028379 | Unclassified | 2052 |
| 488 | Ga0268265_10022155 | 3300028380 | Bacteria | 4459 |
| 489 | Ga0268265_10068788 | 3300028380 | Bacteria | 2747 |
| 490 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 491 | Ga0268264_10001580 | 3300028381 | Bacteria | 21079 |
| 492 | Ga0268264_10003253 | 3300028381 | Bacteria | 14053 |
| 493 | Ga0268264_10038610 | 3300028381 | Bacteria | 3941 |
| 494 | Ga0265337_1000681 | 3300028556 | Bacteria | 17912 |
| 495 | Ga0265326_10000758 | 3300028558 | Bacteria | 11952 |
| 496 | Ga0265326_10003795 | 3300028558 | Bacteria | 4924 |
| 497 | Ga0265319_1000297 | 3300028563 | Bacteria | 36855 |
| 498 | Ga0265319_1002577 | 3300028563 | Bacteria | 9787 |
| 499 | Ga0265334_10001759 | 3300028573 | Bacteria | 10350 |
| 500 | Ga0265334_10004780 | 3300028573 | Bacteria | 5952 |
| 501 | Ga0265318_10015518 | 3300028577 | Bacteria | 3167 |
| 502 | Ga0265318_10032088 | 3300028577 | Bacteria | 2034 |
| 503 | Ga0265323_10000395 | 3300028653 | Bacteria | 25117 |
| 504 | Ga0265323_10001271 | 3300028653 | Bacteria | 12634 |
| 505 | Ga0265323_10012792 | 3300028653 | Bacteria | 3358 |
| 506 | Ga0265323_10017597 | 3300028653 | Bacteria | 2774 |
| 507 | Ga0265322_10005276 | 3300028654 | Bacteria | 3825 |
| 508 | Ga0265322_10005878 | 3300028654 | Bacteria | 3618 |
| 509 | Ga0265336_10000194 | 3300028666 | Bacteria | 42728 |
| 510 | Ga0265336_10026823 | 3300028666 | Bacteria | 1808 |
| 511 | Ga0307517_10008552 | 3300028786 | Bacteria | 14661 |
| 512 | Ga0307517_10015597 | 3300028786 | Bacteria | 10079 |
| 513 | Ga0307515_10000057 | 3300028794 | Bacteria | 261695 |
| 514 | Ga0307515_10000133 | 3300028794 | Bacteria | 176091 |
| 515 | Ga0307515_10000432 | 3300028794 | Bacteria | 100348 |
| 516 | Ga0307515_10001738 | 3300028794 | Bacteria | 48492 |
| 517 | Ga0265338_10000273 | 3300028800 | Bacteria | 94209 |
| 518 | Ga0265338_10000527 | 3300028800 | Bacteria | 67253 |
| 519 | Ga0265338_10002518 | 3300028800 | Bacteria | 27237 |
| 520 | Ga0265338_10006323 | 3300028800 | Bacteria | 15136 |
| 521 | Ga0265338_10008747 | 3300028800 | Bacteria | 12237 |
| 522 | Ga0265338_10016341 | 3300028800 | Bacteria | 8083 |
| 523 | Ga0265338_10030132 | 3300028800 | Bacteria | 5356 |
| 524 | Ga0265338_10063636 | 3300028800 | Bacteria | 3215 |
| 525 | Ga0265324_10001372 | 3300029957 | Bacteria | 14108 |
| 526 | Ga0265324_10007618 | 3300029957 | Bacteria | 4368 |
| 527 | Ga0316183_1126735 | 3300030742 | Bacteria | 6783 |
| 528 | Ga0316181_1118713 | 3300030744 | Bacteria | 3631 |
| 529 | Ga0265330_10001086 | 3300031235 | Bacteria | 16394 |
| 530 | Ga0265330_10025643 | 3300031235 | Bacteria | 2671 |
| 531 | Ga0265332_10001653 | 3300031238 | Bacteria | 12173 |
| 532 | Ga0265332_10007014 | 3300031238 | Bacteria | 5100 |
| 533 | Ga0265320_10000494 | 3300031240 | Bacteria | 30746 |
| 534 | Ga0265320_10005528 | 3300031240 | Bacteria | 8105 |
| 535 | Ga0265325_10010739 | 3300031241 | Bacteria | 5285 |
| 536 | Ga0265325_10012429 | 3300031241 | Bacteria | 4868 |
| 537 | Ga0265340_10002804 | 3300031247 | Bacteria | 9917 |
| 538 | Ga0265339_10007060 | 3300031249 | Bacteria | 7291 |
| 539 | Ga0265331_10058487 | 3300031250 | Bacteria | 1825 |
| 540 | Ga0265327_10000618 | 3300031251 | Bacteria | 58585 |
| 541 | Ga0265327_10008002 | 3300031251 | Bacteria | 7987 |
| 542 | Ga0265327_10072023 | 3300031251 | Bacteria | 1727 |
| 543 | Ga0265316_10005060 | 3300031344 | Bacteria | 12935 |
| 544 | Ga0265316_10077499 | 3300031344 | Unclassified | 2553 |
| 545 | Ga0307513_10147438 | 3300031456 | Bacteria | 2269 |
| 546 | Ga0307509_10010102 | 3300031507 | Bacteria | 11636 |
| 547 | Ga0307509_10072885 | 3300031507 | Bacteria | 3577 |
| 548 | Ga0307408_100001775 | 3300031548 | Bacteria | 15744 |
| 549 | Ga0265313_10004678 | 3300031595 | Bacteria | 10336 |
| 550 | Ga0265313_10005311 | 3300031595 | Bacteria | 9523 |
| 551 | Ga0265313_10012195 | 3300031595 | Bacteria | 5275 |
| 552 | Ga0310103_105240 | 3300031614 | Eukaryota | 1710 |
| 553 | Ga0265314_10006023 | 3300031711 | Bacteria | 10804 |
| 554 | Ga0265342_10001151 | 3300031712 | Bacteria | 25226 |
| 555 | Ga0265342_10100515 | 3300031712 | Bacteria | 1648 |
| 556 | Ga0316576_10002660 | 3300031727 | Bacteria | 10212 |
| 557 | Ga0316576_10057544 | 3300031727 | Bacteria | 2841 |
| 558 | Ga0316576_10065179 | 3300031727 | Bacteria | 2677 |
| 559 | Ga0316576_10085185 | 3300031727 | Bacteria | 2349 |
| 560 | Ga0316578_10000458 | 3300031728 | Bacteria | 13584 |
| 561 | Ga0316578_10027250 | 3300031728 | Bacteria | 3229 |
| 562 | Ga0316578_10081680 | 3300031728 | Bacteria | 1923 |
| 563 | Ga0307516_10002738 | 3300031730 | Bacteria | 23246 |
| 564 | Ga0307405_10163947 | 3300031731 | Bacteria | 1578 |
| 565 | Ga0316577_10005407 | 3300031733 | Bacteria | 6699 |
| 566 | Ga0316577_10005994 | 3300031733 | Bacteria | 6405 |
| 567 | Ga0307412_10000018 | 3300031911 | Bacteria | 284374 |
| 568 | Ga0307412_10091651 | 3300031911 | Bacteria | 2128 |
| 569 | Ga0307409_100051015 | 3300031995 | Bacteria | 3164 |
| 570 | Ga0307414_10000392 | 3300032004 | Bacteria | 23857 |
| 571 | Ga0307414_10000393 | 3300032004 | Bacteria | 23776 |
| 572 | Ga0307414_10022716 | 3300032004 | Bacteria | 3963 |
| 573 | Ga0307414_10030980 | 3300032004 | Bacteria | 3501 |
| 574 | Ga0307414_10051783 | 3300032004 | Bacteria | 2852 |
| 575 | Ga0307414_10055507 | 3300032004 | Bacteria | 2774 |
| 576 | Ga0307414_10221590 | 3300032004 | Bacteria | 1553 |
| 577 | Ga0307507_10000064 | 3300033179 | Bacteria | 161226 |
| 578 | Ga0307510_10005874 | 3300033180 | Bacteria | 14639 |
| 579 | Ga0307510_10007411 | 3300033180 | Bacteria | 13083 |
| 580 | Ga0373934_0001565 | 3300035086 | Bacteria | 8391 |
| 581 | Ga0373923_0036491 | 3300035111 | Bacteria | 2006 |
| 582 | Ga0373954_0046145 | 3300035118 | Bacteria | 2036 |
| 583 | Ga0373956_0064778 | 3300035119 | Bacteria | 1659 |
| 584 | Ga0373957_0041473 | 3300035120 | Bacteria | 1733 |
| 585 | Ga0316574_0009680 | 3300035398 | Bacteria | 5409 |
| 586 | Ga0316574_0178878 | 3300035398 | Bacteria | 1365 |
| 587 | Ga0373927_0005089 | 3300035695 | Bacteria | 9100 |
| 588 | Ga0373933_0007494 | 3300035724 | Bacteria | 5959 |
| 589 | Ga0373937_0013067 | 3300036401 | Bacteria | 7313 |
| 590 | Ga0310110_009579 | 3300036535 | Eukaryota | 1419 |
| 591 | Ga0316582_0000862 | 3300036647 | Bacteria | 12362 |
| 592 | Ga0316584_0000202 | 3300036712 | Bacteria | 29256 |
| 593 | Ga0316584_0000530 | 3300036712 | Bacteria | 20366 |
| 594 | Ga0316584_0043722 | 3300036712 | Bacteria | 3341 |
| 595 | Ga0373925_0027719 | 3300037068 | Bacteria | 4147 |
| 596 | Ga0395899_0002054 | 3300037312 | Bacteria | 16582 |
| 597 | Ga0395899_0006794 | 3300037312 | Bacteria | 8865 |
| 598 | Ga0395899_0017979 | 3300037312 | Bacteria | 5379 |
| 599 | Ga0395899_0061038 | 3300037312 | Bacteria | 2776 |
| 600 | Ga0395899_0088854 | 3300037312 | Bacteria | 2241 |
| 601 | Ga0395900_0005501 | 3300037418 | Bacteria | 13258 |
| 602 | Ga0395900_0005682 | 3300037418 | Bacteria | 13040 |
| 603 | Ga0395900_0007296 | 3300037418 | Bacteria | 11434 |
| 604 | Ga0395900_0029586 | 3300037418 | Bacteria | 5619 |
| 605 | Ga0395900_0124774 | 3300037418 | Bacteria | 2640 |
| 606 | Ga0395900_0153735 | 3300037418 | Bacteria | 2350 |
| 607 | Ga0395900_0277274 | 3300037418 | Bacteria | 1670 |
| 608 | Ga0395898_0009433 | 3300037466 | Bacteria | 10251 |
| 609 | Ga0395898_0039456 | 3300037466 | Bacteria | 4674 |
| 610 | Ga0395898_0130890 | 3300037466 | Bacteria | 2403 |
| 611 | Ga0395905_0000516 | 3300037471 | Bacteria | 52868 |
| 612 | Ga0395905_0001254 | 3300037471 | Bacteria | 31416 |
| 613 | Ga0395905_0036571 | 3300037471 | Bacteria | 4611 |
| 614 | Ga0395901_0000861 | 3300038443 | Bacteria | 33403 |
| 615 | Ga0395901_0003324 | 3300038443 | Bacteria | 16201 |
| 616 | Ga0395901_0136614 | 3300038443 | Bacteria | 2576 |
| 617 | Ga0395901_0226951 | 3300038443 | Bacteria | 1951 |
| 618 | Ga0400485_16601 | 3300038735 | Bacteria | 5179 |
| 619 | Ga0400483_039122 | 3300039062 | Bacteria | 2017 |
| 620 | Ga0436361_0539750 | 3300039447 | Bacteria | 15869 |
| 621 | Ga0439439_0028272 | 3300041406 | Bacteria | 1419 |
| 622 | Ga0451853_2051003 | 3300041512 | Bacteria | 2181 |
| 623 | Ga0450898_003736 | 3300042134 | Bacteria | 2204 |
| 624 | Ga0451577_0000072 | 3300042876 | Bacteria | 237934 |
| 625 | Ga0451577_0000202 | 3300042876 | Bacteria | 124050 |
| 626 | Ga0451577_0000217 | 3300042876 | Bacteria | 119582 |
| 627 | Ga0451577_0000364 | 3300042876 | Bacteria | 84063 |
| 628 | Ga0451577_0000509 | 3300042876 | Bacteria | 65250 |
| 629 | Ga0451577_0000954 | 3300042876 | Bacteria | 42396 |
| 630 | Ga0451577_0002430 | 3300042876 | Bacteria | 22208 |
| 631 | Ga0451577_0012393 | 3300042876 | Bacteria | 8008 |
| 632 | Ga0451577_0018198 | 3300042876 | Bacteria | 6474 |
| 633 | Ga0451577_0060152 | 3300042876 | Bacteria | 3387 |
| 634 | Ga0451577_0069804 | 3300042876 | Bacteria | 3134 |
| 635 | Ga0451577_0076157 | 3300042876 | Bacteria | 2992 |
| 636 | Ga0451577_0085788 | 3300042876 | Bacteria | 2809 |
| 637 | Ga0451577_0097992 | 3300042876 | Bacteria | 2619 |
| 638 | Ga0451577_0128676 | 3300042876 | Unclassified | 2271 |
| 639 | Ga0451577_0137791 | 3300042876 | Bacteria | 2192 |
| 640 | Ga0451577_0151581 | 3300042876 | Unclassified | 2086 |
| 641 | Ga0451577_0345532 | 3300042876 | Bacteria | 1350 |
| 642 | Ga0466972_0000205 | 3300044658 | Bacteria | 43008 |
| 643 | Ga0466972_0000946 | 3300044658 | Bacteria | 13963 |
| 644 | Ga0453683_0000139 | 3300044673 | Bacteria | 105329 |
| 645 | Ga0453683_0000178 | 3300044673 | Bacteria | 88310 |
| 646 | Ga0453683_0000476 | 3300044673 | Bacteria | 46055 |
| 647 | Ga0453683_0000625 | 3300044673 | Bacteria | 38567 |
| 648 | Ga0453683_0001467 | 3300044673 | Bacteria | 20284 |
| 649 | Ga0453683_0003005 | 3300044673 | Bacteria | 12626 |
| 650 | Ga0453683_0005318 | 3300044673 | Bacteria | 8996 |
| 651 | Ga0453683_0010590 | 3300044673 | Bacteria | 6106 |
| 652 | Ga0453683_0010664 | 3300044673 | Bacteria | 6085 |
| 653 | Ga0453683_0017963 | 3300044673 | Bacteria | 4543 |
| 654 | Ga0453683_0029661 | 3300044673 | Bacteria | 3458 |
| 655 | Ga0453683_0040902 | 3300044673 | Bacteria | 2910 |
| 656 | Ga0453683_0099936 | 3300044673 | Bacteria | 1821 |
| 657 | Ga0453684_0000004 | 3300044712 | Bacteria | 1469893 |
| 658 | Ga0453684_0000081 | 3300044712 | Bacteria | 402985 |
| 659 | Ga0453684_0000086 | 3300044712 | Bacteria | 397278 |
| 660 | Ga0453684_0000186 | 3300044712 | Bacteria | 273302 |
| 661 | Ga0453684_0000337 | 3300044712 | Bacteria | 195296 |
| 662 | Ga0453684_0000393 | 3300044712 | Bacteria | 179711 |
| 663 | Ga0453684_0000608 | 3300044712 | Bacteria | 131904 |
| 664 | Ga0453684_0000630 | 3300044712 | Bacteria | 128059 |
| 665 | Ga0453684_0001006 | 3300044712 | Bacteria | 91343 |
| 666 | Ga0453684_0001244 | 3300044712 | Bacteria | 77266 |
| 667 | Ga0453684_0001377 | 3300044712 | Bacteria | 70373 |
| 668 | Ga0453684_0002144 | 3300044712 | Bacteria | 49481 |
| 669 | Ga0453684_0004157 | 3300044712 | Bacteria | 31323 |
| 670 | Ga0453684_0004417 | 3300044712 | Bacteria | 29726 |
| 671 | Ga0453684_0005203 | 3300044712 | Bacteria | 26128 |
| 672 | Ga0453684_0005297 | 3300044712 | Bacteria | 25730 |
| 673 | Ga0453684_0006234 | 3300044712 | Bacteria | 22857 |
| 674 | Ga0453684_0007491 | 3300044712 | Bacteria | 20033 |
| 675 | Ga0453684_0009673 | 3300044712 | Bacteria | 16788 |
| 676 | Ga0453684_0013156 | 3300044712 | Bacteria | 13492 |
| 677 | Ga0453684_0013250 | 3300044712 | Bacteria | 13430 |
| 678 | Ga0453684_0017180 | 3300044712 | Bacteria | 11238 |
| 679 | Ga0453684_0018143 | 3300044712 | Bacteria | 10831 |
| 680 | Ga0453684_0019610 | 3300044712 | Bacteria | 10277 |
| 681 | Ga0453684_0022403 | 3300044712 | Bacteria | 9373 |
| 682 | Ga0453684_0026462 | 3300044712 | Bacteria | 8375 |
| 683 | Ga0453684_0030202 | 3300044712 | Bacteria | 7663 |
| 684 | Ga0453684_0030327 | 3300044712 | Bacteria | 7643 |
| 685 | Ga0453684_0030674 | 3300044712 | Bacteria | 7586 |
| 686 | Ga0453684_0041170 | 3300044712 | Bacteria | 6255 |
| 687 | Ga0453684_0045474 | 3300044712 | Bacteria | 5856 |
| 688 | Ga0453684_0058981 | 3300044712 | Bacteria | 4953 |
| 689 | Ga0453684_0059245 | 3300044712 | Bacteria | 4939 |
| 690 | Ga0453684_0067008 | 3300044712 | Bacteria | 4568 |
| 691 | Ga0453684_0077277 | 3300044712 | Unclassified | 4175 |
| 692 | Ga0453684_0096362 | 3300044712 | Bacteria | 3635 |
| 693 | Ga0453684_0120378 | 3300044712 | Bacteria | 3171 |
| 694 | Ga0453684_0139207 | 3300044712 | Bacteria | 2901 |
| 695 | Ga0453684_0186360 | 3300044712 | Bacteria | 2431 |
| 696 | Ga0453684_0255106 | 3300044712 | Bacteria | 2012 |
| 697 | Ga0453684_0289366 | 3300044712 | Bacteria | 1866 |
| 698 | Ga0453684_0301019 | 3300044712 | Bacteria | 1823 |
| 699 | Ga0466968_0016433 | 3300044735 | Bacteria | 2947 |
| 700 | Ga0466970_0000529 | 3300044765 | Bacteria | 18707 |
| 701 | Ga0466957_0001121 | 3300044842 | Bacteria | 13866 |
| 702 | Ga0451576_0000065 | 3300045051 | Bacteria | 274445 |
| 703 | Ga0451576_0000083 | 3300045051 | Bacteria | 236908 |
| 704 | Ga0451576_0000145 | 3300045051 | Bacteria | 179711 |
| 705 | Ga0451576_0000294 | 3300045051 | Bacteria | 122276 |
| 706 | Ga0451576_0000683 | 3300045051 | Bacteria | 69004 |
| 707 | Ga0451576_0000729 | 3300045051 | Bacteria | 66020 |
| 708 | Ga0451576_0001394 | 3300045051 | Bacteria | 41542 |
| 709 | Ga0451576_0007238 | 3300045051 | Bacteria | 13361 |
| 710 | Ga0451576_0009193 | 3300045051 | Bacteria | 11482 |
| 711 | Ga0451576_0011975 | 3300045051 | Bacteria | 9798 |
| 712 | Ga0451576_0051793 | 3300045051 | Bacteria | 4303 |
| 713 | Ga0451576_0069951 | 3300045051 | Bacteria | 3653 |
| 714 | Ga0451576_0080236 | 3300045051 | Bacteria | 3395 |
| 715 | Ga0451576_0115641 | 3300045051 | Bacteria | 2792 |
| 716 | Ga0451576_0322578 | 3300045051 | Bacteria | 1616 |
| 717 | Ga0466967_0208069 | 3300045976 | Bacteria | 1855 |
| 718 | Ga0495638_0000001 | 3300046460 | Bacteria | 1114121 |
| 719 | Ga0495638_0028055 | 3300046460 | Bacteria | 3638 |
| 720 | Ga0495651_0052900 | 3300046462 | Bacteria | 3127 |
| 721 | Ga0495651_0098879 | 3300046462 | Bacteria | 2176 |
| 722 | Ga0495653_0266227 | 3300046463 | Bacteria | 1131 |
| 723 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 724 | Ga0495580_0010183 | 3300046472 | Bacteria | 7339 |
| 725 | Ga0495580_0016439 | 3300046472 | Bacteria | 5552 |
| 726 | Ga0495585_0000085 | 3300046492 | Bacteria | 97836 |
| 727 | Ga0495585_0001006 | 3300046492 | Bacteria | 23544 |
| 728 | Ga0495606_0000002 | 3300046507 | Bacteria | 554637 |
| 729 | Ga0495606_0005474 | 3300046507 | Bacteria | 12155 |
| 730 | Ga0495606_0016294 | 3300046507 | Bacteria | 5675 |
| 731 | Ga0495608_0050979 | 3300046511 | Bacteria | 2744 |
| 732 | Ga0495610_0023746 | 3300046512 | Bacteria | 3324 |
| 733 | Ga0495616_0005113 | 3300046513 | Bacteria | 8150 |
| 734 | Ga0495616_0006849 | 3300046513 | Bacteria | 6865 |
| 735 | Ga0495628_0004159 | 3300046516 | Bacteria | 12878 |
| 736 | Ga0495631_0008059 | 3300046518 | Bacteria | 5324 |
| 737 | Ga0495648_0002775 | 3300046524 | Bacteria | 15798 |
| 738 | Ga0495652_0188421 | 3300046529 | Bacteria | 1577 |
| 739 | Ga0495587_0052965 | 3300046536 | Bacteria | 2393 |
| 740 | Ga0495609_0033790 | 3300046538 | Bacteria | 2320 |
| 741 | Ga0495633_0000014 | 3300046558 | Bacteria | 261742 |
| 742 | Ga0495633_0089582 | 3300046558 | Bacteria | 1430 |
| 743 | Ga0495667_0077050 | 3300046559 | Bacteria | 2169 |
| 744 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 745 | Ga0495668_0001784 | 3300046616 | Bacteria | 19658 |
| 746 | Ga0495611_0000179 | 3300046648 | Bacteria | 45869 |
| 747 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 748 | Ga0495625_0000471 | 3300046660 | Bacteria | 60628 |
| 749 | Ga0495625_0001258 | 3300046660 | Bacteria | 31973 |
| 750 | Ga0495625_0010947 | 3300046660 | Bacteria | 7446 |
| 751 | Ga0495625_0017844 | 3300046660 | Bacteria | 5546 |
| 752 | Ga0495661_0054825 | 3300046665 | Bacteria | 2392 |
| 753 | Ga0495661_0088277 | 3300046665 | Bacteria | 1770 |
| 754 | Ga0495657_0078202 | 3300046675 | Bacteria | 2144 |
| 755 | Ga0495599_0077856 | 3300046678 | Bacteria | 2070 |
| 756 | Ga0495647_0037234 | 3300046681 | Bacteria | 1835 |
| 757 | Ga0495658_0141371 | 3300046683 | Bacteria | 1472 |
| 758 | Ga0495613_0097663 | 3300046689 | Bacteria | 2123 |
| 759 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 760 | Ga0495660_0007560 | 3300046810 | Bacteria | 6380 |
| 761 | Ga0495672_0033988 | 3300047320 | Bacteria | 3155 |
| 762 | Ga0495683_0028303 | 3300047323 | Bacteria | 2865 |
| 763 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 764 | Ga0495687_000544 | 3300047443 | Bacteria | 45065 |
| 765 | Ga0495687_000762 | 3300047443 | Bacteria | 34827 |
| 766 | Ga0495675_0010457 | 3300047444 | Bacteria | 5799 |
| 767 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 768 | Ga0495686_0003602 | 3300047472 | Bacteria | 13287 |
| 769 | Ga0495686_0051650 | 3300047472 | Bacteria | 2579 |
| 770 | Ga0495686_0132507 | 3300047472 | Bacteria | 1476 |
| 771 | Ga0496101_0012235 | 3300048904 | Bacteria | 5721 |
| 772 | Ga0496102_0176702 | 3300048905 | Unclassified | 2011 |
| 773 | Ga0496104_0261118 | 3300048907 | Bacteria | 1645 |
| 774 | Ga0496109_0083335 | 3300048912 | Bacteria | 2949 |
| 775 | Ga0496116_0004290 | 3300048919 | Bacteria | 13667 |
| 776 | Ga0496117_0008979 | 3300048920 | Bacteria | 9407 |
| 777 | Ga0496122_0000789 | 3300048925 | Bacteria | 60958 |
| 778 | Ga0496122_0006722 | 3300048925 | Bacteria | 13087 |
| 779 | Ga0496123_0006610 | 3300048926 | Bacteria | 11199 |
| 780 | Ga0496123_0013257 | 3300048926 | Bacteria | 6943 |
| 781 | Ga0496124_0042623 | 3300048927 | Bacteria | 3907 |
| 782 | Ga0501323_000726 | 3300049539 | Bacteria | 2601 |
| 783 | Ga0501031_0017014 | 3300049568 | Bacteria | 4723 |
| 784 | Ga0501032_0000789 | 3300049569 | Bacteria | 25632 |
| 785 | Ga0501032_0103951 | 3300049569 | Bacteria | 1882 |
| 786 | Ga0501033_0125458 | 3300049570 | Bacteria | 1862 |
| 787 | Ga0501034_0006168 | 3300049571 | Bacteria | 12923 |
| 788 | Ga0501034_0041867 | 3300049571 | Bacteria | 4634 |
| 789 | Ga0501034_0109443 | 3300049571 | Bacteria | 2754 |
| 790 | Ga0501036_0001149 | 3300049572 | Bacteria | 20161 |
| 791 | Ga0501036_0004247 | 3300049572 | Bacteria | 11553 |
| 792 | Ga0501037_0027852 | 3300049573 | Bacteria | 4175 |
| 793 | Ga0501038_0101201 | 3300049574 | Bacteria | 2399 |
| 794 | Ga0501039_0025685 | 3300049575 | Bacteria | 4527 |
| 795 | Ga0501041_0014564 | 3300049577 | Bacteria | 4669 |
| 796 | Ga0501042_0003714 | 3300049578 | Bacteria | 9642 |
| 797 | Ga0501043_0013354 | 3300049579 | Bacteria | 6422 |
| 798 | Ga0501043_0055797 | 3300049579 | Bacteria | 3104 |
| 799 | Ga0501046_0002549 | 3300049580 | Bacteria | 17045 |
| 800 | Ga0501046_0012945 | 3300049580 | Bacteria | 7088 |
| 801 | Ga0501047_0003691 | 3300049581 | Bacteria | 14416 |
| 802 | Ga0501048_0003076 | 3300049582 | Bacteria | 12717 |
| 803 | Ga0501068_0013864 | 3300049584 | Bacteria | 4595 |
| 804 | Ga0501068_0075269 | 3300049584 | Bacteria | 2065 |
| 805 | Ga0501069_0011303 | 3300049585 | Bacteria | 4734 |
| 806 | Ga0501070_0006716 | 3300049586 | Bacteria | 9798 |
| 807 | Ga0501070_0119081 | 3300049586 | Bacteria | 2182 |
| 808 | Ga0501070_0225193 | 3300049586 | Bacteria | 1537 |
| 809 | Ga0501071_0022656 | 3300049587 | Bacteria | 4381 |
| 810 | Ga0501072_0002595 | 3300049588 | Bacteria | 13546 |
| 811 | Ga0501073_0002127 | 3300049589 | Bacteria | 14843 |
| 812 | Ga0501073_0046449 | 3300049589 | Bacteria | 3054 |
| 813 | Ga0501074_0000268 | 3300049590 | Bacteria | 29703 |
| 814 | Ga0501074_0071210 | 3300049590 | Bacteria | 2499 |
| 815 | Ga0501075_0052536 | 3300049591 | Bacteria | 3064 |
| 816 | Ga0501217_005267 | 3300049661 | Bacteria | 2699 |
| 817 | Ga0501223_000517 | 3300049663 | Bacteria | 9302 |
| 818 | Ga0501236_000066 | 3300049670 | Bacteria | 9409 |
| 819 | Ga0501238_006873 | 3300049671 | Bacteria | 1471 |
| 820 | Ga0501243_008676 | 3300049675 | Bacteria | 1571 |
| 821 | Ga0501225_0044910 | 3300049705 | Bacteria | 1223 |
| 822 | Ga0501079_0005838 | 3300049741 | Bacteria | 9206 |
| 823 | Ga0501080_0009651 | 3300049742 | Bacteria | 8812 |
| 824 | Ga0501080_0082493 | 3300049742 | Bacteria | 2986 |
| 825 | Ga0501080_0290176 | 3300049742 | Bacteria | 1485 |
| 826 | Ga0501081_0001456 | 3300049743 | Bacteria | 14500 |
| 827 | Ga0501081_0096995 | 3300049743 | Bacteria | 2080 |
| 828 | Ga0501083_0002364 | 3300049744 | Bacteria | 12916 |
| 829 | Ga0501083_0045344 | 3300049744 | Bacteria | 2975 |
| 830 | Ga0501035_0006540 | 3300049822 | Bacteria | 10934 |
| 831 | Ga0501035_0063517 | 3300049822 | Bacteria | 3284 |
| 832 | Ga0501044_0008384 | 3300049823 | Bacteria | 11335 |
| 833 | Ga0501044_0130700 | 3300049823 | Bacteria | 2505 |
| 834 | Ga0501045_0033653 | 3300049824 | Bacteria | 3716 |
| 835 | nmdc:mga0k408_33017_c1 | 3300050493 | Bacteria | 2958 |
| 836 | nmdc:mga0k408_6399_c1 | 3300050493 | Bacteria | 6283 |
| 837 | nmdc:mga05p37_20368_c1 | 3300050507 | Bacteria | 8025 |
| 838 | nmdc:mga09592_92181_c1 | 3300050508 | Bacteria | 2590 |
| 839 | nmdc:mga06r32_49377_c1 | 3300050510 | Bacteria | 4023 |
| 840 | nmdc:mga08y16_141376_c1 | 3300050511 | Bacteria | 2502 |
| 841 | nmdc:mga08y16_254478_c1 | 3300050511 | Bacteria | 1814 |
| 842 | nmdc:mga08y16_3286_c1 | 3300050511 | Bacteria | 16755 |
| 843 | nmdc:mga08y16_5732_c1 | 3300050511 | Bacteria | 13017 |
| 844 | nmdc:mga08y16_60600_c1 | 3300050511 | Bacteria | 3952 |
| 845 | Ga0500583_0000077 | 3300053092 | Bacteria | 58479 |
| 846 | Ga0500583_0005181 | 3300053092 | Bacteria | 4340 |
| 847 | Ga0500641_0059014 | 3300053096 | Bacteria | 1594 |
| 848 | Ga0500562_002684 | 3300053108 | Bacteria | 4426 |
| 849 | Ga0500608_001113 | 3300053122 | Bacteria | 9583 |
| 850 | Ga0500614_012003 | 3300053123 | Bacteria | 1884 |
| 851 | Ga0500618_000666 | 3300053125 | Bacteria | 20264 |
| 852 | Ga0500618_008890 | 3300053125 | Bacteria | 2771 |
| 853 | Ga0500559_0055216 | 3300053136 | Bacteria | 1761 |
| 854 | Ga0500568_0000641 | 3300053139 | Bacteria | 25249 |
| 855 | Ga0500616_0000009 | 3300053153 | Bacteria | 779095 |
| 856 | Ga0500616_0007510 | 3300053153 | Bacteria | 6905 |
| 857 | Ga0500622_0000009 | 3300053156 | Bacteria | 419980 |
| 858 | Ga0500622_0000096 | 3300053156 | Bacteria | 90621 |
| 859 | Ga0500622_0002927 | 3300053156 | Bacteria | 11867 |
| 860 | Ga0500622_0003314 | 3300053156 | Bacteria | 10885 |
| 861 | Ga0500622_0012934 | 3300053156 | Bacteria | 4508 |
| 862 | Ga0500624_000970 | 3300053157 | Bacteria | 5869 |
| 863 | Ga0500627_0036267 | 3300053158 | Bacteria | 2099 |
| 864 | Ga0500611_000020 | 3300053727 | Bacteria | 105250 |
| 865 | Ga0501084_0121959 | 3300054114 | Bacteria | 2192 |
| 866 | Ga0501082_0002189 | 3300060353 | Bacteria | 17109 |
| 867 | Ga0501082_0079639 | 3300060353 | Bacteria | 2826 |
| 868 | Ga0530510_0003636 | 3300061734 | Bacteria | 10612 |
| 869 | Ga0530510_0058992 | 3300061734 | Bacteria | 2775 |
| 870 | 2522551106 | 2522125168 | Bacteria | 7376607 |
| 871 | 2599477954 | 2599185184 | Bacteria | 6430550 |
| 872 | 2617917579 | 2617270889 | Bacteria | 9064343 |
| 873 | 2643948034 | 2643221587 | Bacteria | 7586415 |
| 874 | 2644390541 | 2643221670 | Bacteria | 6497041 |
| 875 | 2644433900 | 2643221677 | Bacteria | 7584031 |
| 876 | 2722729183 | 2721755487 | Bacteria | 6357185 |
| 877 | 2738698353 | 2738541273 | Bacteria | 4048577 |
| 878 | 2738731240 | 2738541278 | Bacteria | 9755573 |
| 879 | 2738756567 | 2738541283 | Bacteria | 7222293 |
| 880 | 2738760849 | 2738541284 | Bacteria | 5199923 |
| 881 | 2739252679 | 2738543014 | Bacteria | 4048139 |
| 882 | 2739304006 | 2738543023 | Bacteria | 6767879 |
| 883 | 2740031596 | 2739367866 | Bacteria | 4215900 |
| 884 | 2819587334 | 2818991444 | Bacteria | 6968812 |
| 885 | 2839992282 | 2839989709 | Bacteria | 3773432 |
| 886 | 2842906595 | 2842903701 | Bacteria | 6986368 |
| 887 | 2852623668 | 2852623160 | Bacteria | 4376875 |
| 888 | 2852627338 | 2852627209 | Bacteria | 5896285 |
| 889 | 2884937428 | 2884933994 | Bacteria | 4535041 |
| 890 | 2890738095 | 2890737413 | Bacteria | 4269751 |
| 891 | 2891633668 | 2891633521 | Bacteria | 4602265 |
| 892 | 2896318001 | 2896317667 | Bacteria | 4606601 |
| 893 | 2896345476 | 2896344016 | Bacteria | 3811746 |
| 894 | 2898715848 | 2898713307 | Bacteria | 4110805 |
| 895 | 2904780905 | 2904780799 | Bacteria | 5840761 |
| 896 | 2913846074 | 2913844669 | Bacteria | 8381711 |
| 897 | 2913941070 | 2913939268 | Bacteria | 8559644 |
| 898 | 2918504964 | 2918501144 | Bacteria | 8668083 |
| 899 | 2919180631 | 2919177583 | Bacteria | 5641607 |
| 900 | 2919187371 | 2919186247 | Bacteria | 6244071 |
| 901 | 2919441095 | 2919437846 | Bacteria | 6199444 |
| 902 | 2919693343 | 2919692658 | Bacteria | 5943958 |
| 903 | 2928079915 | 2928078545 | Bacteria | 6534839 |
| 904 | 2928147630 | 2928147474 | Bacteria | 6512076 |
| 905 | 2932088484 | 2932082852 | Bacteria | 6563563 |
| 906 | 2939665362 | 2939664404 | Bacteria | 6364494 |
| 907 | 2977236133 | 2977232053 | Bacteria | 5485925 |
| 908 | 3003235980 | 3003233435 | Bacteria | 4458031 |
| 909 | 642605327 | 642555144 | Bacteria | 9059191 |
| 910 | 8055589469 | 8055588893 | Bacteria | 3619545 |
| 911 | 8056440302 | 8056440228 | Bacteria | 4946504 |
| 912 | Ga0500583_0000164 | |||
| 913 | SwRhRL2b_contig_308077 | |||
| 914 | MBSR1b_contig_6741876 | |||
| 915 | JGI24737J22298_10000733 | |||
| 916 | JGI24735J21928_10000014 | |||
| 917 | JGI25162J39368_1000020 | |||
| 918 | JGI25162J39368_1001888 | |||
| 919 | JGI25164J39214_1002648 | |||
| 920 | JGI25165J46597_1000898 | |||
| 921 | rootH1_10001098 | |||
| 922 | rootH2_10002858 | |||
| 923 | rootH2_10035181 | |||
| 924 | rootL2_10163790 | |||
| 925 | rootH1_10003699 | |||
| 926 | rootH1_10017423 | |||
| 927 | rootH1_10126862 | |||
| 928 | JGI25160J50197_1003564 | |||
| 929 | Ga0055536_1013049 | |||
| 930 | Ga0065165_1000169 | |||
| 931 | Ga0065165_1001340 | |||
| 932 | Ga0065714_10002361 | |||
| 933 | Ga0065714_10002919 | |||
| 934 | Ga0065704_10000238 | |||
| 935 | Ga0065704_10001141 | |||
| 936 | Ga0065712_10001455 | |||
| 937 | Ga0070658_10000011 | |||
| 938 | Ga0070658_10037328 | |||
| 939 | Ga0070658_10073847 | |||
| 940 | Ga0070658_10088639 | |||
| 941 | Ga0070676_10001211 | |||
| 942 | Ga0070676_10002877 | |||
| 943 | Ga0070683_100018837 | |||
| 944 | Ga0070683_100159915 | |||
| 945 | Ga0070670_100027222 | |||
| 946 | Ga0070670_100038903 | |||
| 947 | Ga0070670_100063646 | |||
| 948 | Ga0070670_100078187 | |||
| 949 | Ga0070670_100147645 | |||
| 950 | Ga0068869_100016541 | |||
| 951 | Ga0068869_100031202 | |||
| 952 | Ga0068869_100038954 | |||
| 953 | Ga0070666_10001123 | |||
| 954 | Ga0070666_10006658 | |||
| 955 | Ga0070680_100005777 | |||
| 956 | Ga0070680_100041291 | |||
| 957 | Ga0070680_100059914 | |||
| 958 | Ga0070680_100068002 | |||
| 959 | Ga0070680_100131695 | |||
| 960 | Ga0070682_100003177 | |||
| 961 | Ga0068868_100014216 | |||
| 962 | Ga0068868_100136348 | |||
| 963 | Ga0070660_100029365 | |||
| 964 | Ga0070660_100052356 | |||
| 965 | Ga0070660_100086977 | |||
| 966 | Ga0070660_100123237 | |||
| 967 | Ga0070691_10000930 | |||
| 968 | Ga0070687_100030867 | |||
| 969 | Ga0070687_100052188 | |||
| 970 | Ga0070661_100018952 | |||
| 971 | Ga0070692_10103083 | |||
| 972 | Ga0070668_100004450 | |||
| 973 | Ga0070669_100008200 | |||
| 974 | Ga0070675_100007148 | |||
| 975 | Ga0070675_100012647 | |||
| 976 | Ga0070671_100094133 | |||
| 977 | Ga0070671_100122779 | |||
| 978 | Ga0070673_100001702 | |||
| 979 | Ga0070673_100003548 | |||
| 980 | Ga0070673_100029933 | |||
| 981 | Ga0070673_100040799 | |||
| 982 | Ga0070673_100117815 | |||
| 983 | Ga0070688_100005858 | |||
| 984 | Ga0070659_100021644 | |||
| 985 | Ga0070659_100026196 | |||
| 986 | Ga0070659_100042229 | |||
| 987 | Ga0070659_100046953 | |||
| 988 | Ga0070659_100247454 | |||
| 989 | Ga0070667_100024412 | |||
| 990 | Ga0070667_100077159 | |||
| 991 | Ga0070667_100222451 | |||
| 992 | Ga0070663_100028577 | |||
| 993 | Ga0070663_100144121 | |||
| 994 | Ga0070678_100007368 | |||
| 995 | Ga0070662_100004667 | |||
| 996 | Ga0070681_10142682 | |||
| 997 | Ga0070681_10261627 | |||
| 998 | Ga0068867_100006003 | |||
| 999 | Ga0068867_100016922 | |||
| 1000 | Ga0068867_100028131 | |||
| 1001 | Ga0070679_100001254 | |||
| 1002 | Ga0070679_100010318 | |||
| 1003 | Ga0070679_100015447 | |||
| 1004 | Ga0070679_100199057 | |||
| 1005 | Ga0070684_100104674 | |||
| 1006 | Ga0070684_100119774 | |||
| 1007 | Ga0070684_100217623 | |||
| 1008 | Ga0068853_100016543 | |||
| 1009 | Ga0068853_100024401 | |||
| 1010 | Ga0068853_100068924 | |||
| 1011 | Ga0070672_100022405 | |||
| 1012 | Ga0070695_100112949 | |||
| 1013 | Ga0070665_100000003 | |||
| 1014 | Ga0070665_100000008 | |||
| 1015 | Ga0068855_100000727 | |||
| 1016 | Ga0068855_100000998 | |||
| 1017 | Ga0068855_100002579 | |||
| 1018 | Ga0068855_100010877 | |||
| 1019 | Ga0068855_100056698 | |||
| 1020 | Ga0068855_100094815 | |||
| 1021 | Ga0068855_100144948 | |||
| 1022 | Ga0068855_100180723 | |||
| 1023 | Ga0068855_100242163 | |||
| 1024 | Ga0068855_100378740 | |||
| 1025 | Ga0068857_100004830 | |||
| 1026 | Ga0068854_100031522 | |||
| 1027 | Ga0068856_100000259 | |||
| 1028 | Ga0068856_100003419 | |||
| 1029 | Ga0068856_100012928 | |||
| 1030 | Ga0068856_100110022 | |||
| 1031 | Ga0068852_100003639 | |||
| 1032 | Ga0068852_100005665 | |||
| 1033 | Ga0068852_100008807 | |||
| 1034 | Ga0068852_100024969 | |||
| 1035 | Ga0068852_100025420 | |||
| 1036 | Ga0068852_100068319 | |||
| 1037 | Ga0068852_100077757 | |||
| 1038 | Ga0068859_100000023 | |||
| 1039 | Ga0068859_100010680 | |||
| 1040 | Ga0068859_100020142 | |||
| 1041 | Ga0068859_100318554 | |||
| 1042 | Ga0068864_100000733 | |||
| 1043 | Ga0068864_100009349 | |||
| 1044 | Ga0068864_100043103 | |||
| 1045 | Ga0068866_10003738 | |||
| 1046 | Ga0068861_100040252 | |||
| 1047 | Ga0068861_100099963 | |||
| 1048 | Ga0068861_100189055 | |||
| 1049 | Ga0068851_10022987 | |||
| 1050 | Ga0068863_100027572 | |||
| 1051 | Ga0068863_100028175 | |||
| 1052 | Ga0068858_100003125 | |||
| 1053 | Ga0068858_100003981 | |||
| 1054 | Ga0068858_100098620 | |||
| 1055 | Ga0068858_100146325 | |||
| 1056 | Ga0068860_100000059 | |||
| 1057 | Ga0068860_100001384 | |||
| 1058 | Ga0068860_100024605 | |||
| 1059 | Ga0068860_100040343 | |||
| 1060 | Ga0068862_100004782 | |||
| 1061 | Ga0068862_100027564 | |||
| 1062 | Ga0068862_100213640 | |||
| 1063 | Ga0075366_10007290 | |||
| 1064 | Ga0075366_10032558 | |||
| 1065 | Ga0097621_100000020 | |||
| 1066 | Ga0097621_100000487 | |||
| 1067 | Ga0097621_100051390 | |||
| 1068 | Ga0097621_100064504 | |||
| 1069 | Ga0097621_100088581 | |||
| 1070 | Ga0097621_100115725 | |||
| 1071 | Ga0097621_100267105 | |||
| 1072 | Ga0068871_100000416 | |||
| 1073 | Ga0068871_100000598 | |||
| 1074 | Ga0068871_100013343 | |||
| 1075 | Ga0068871_100021887 | |||
| 1076 | Ga0068871_100027178 | |||
| 1077 | Ga0075431_100057971 | |||
| 1078 | Ga0075429_100049891 | |||
| 1079 | Ga0068865_100000208 | |||
| 1080 | Ga0068865_100004850 | |||
| 1081 | Ga0068865_100011685 | |||
| 1082 | Ga0097620_100000023 | |||
| 1083 | Ga0097620_100010683 | |||
| 1084 | Ga0097620_100020142 | |||
| 1085 | Ga0097620_100318566 | |||
| 1086 | Ga0105240_10000767 | |||
| 1087 | Ga0105240_10001584 | |||
| 1088 | Ga0105240_10007530 | |||
| 1089 | Ga0105240_10031042 | |||
| 1090 | Ga0105240_10049859 | |||
| 1091 | Ga0105240_10095335 | |||
| 1092 | Ga0105240_10102281 | |||
| 1093 | Ga0105240_10119990 | |||
| 1094 | Ga0105240_10171848 | |||
| 1095 | Ga0111539_10006433 | |||
| 1096 | Ga0111539_10011432 | |||
| 1097 | Ga0111539_10295731 | |||
| 1098 | Ga0105245_10050473 | |||
| 1099 | Ga0105247_10008227 | |||
| 1100 | Ga0105247_10009048 | |||
| 1101 | Ga0114129_10174564 | |||
| 1102 | Ga0105243_10000012 | |||
| 1103 | Ga0105243_10031803 | |||
| 1104 | Ga0105243_10074134 | |||
| 1105 | Ga0105243_10159239 | |||
| 1106 | Ga0105241_10000861 | |||
| 1107 | Ga0105241_10002514 | |||
| 1108 | Ga0105241_10018003 | |||
| 1109 | Ga0105241_10043565 | |||
| 1110 | Ga0105241_10096885 | |||
| 1111 | Ga0105241_10189405 | |||
| 1112 | Ga0105242_10059690 | |||
| 1113 | Ga0105242_10067351 | |||
| 1114 | Ga0105248_10013691 | |||
| 1115 | Ga0105248_10040274 | |||
| 1116 | Ga0105237_10000044 | |||
| 1117 | Ga0105237_10000356 | |||
| 1118 | Ga0105237_10000971 | |||
| 1119 | Ga0105237_10001449 | |||
| 1120 | Ga0105237_10001750 | |||
| 1121 | Ga0105237_10001907 | |||
| 1122 | Ga0105237_10004465 | |||
| 1123 | Ga0105237_10006762 | |||
| 1124 | Ga0105237_10006763 | |||
| 1125 | Ga0105237_10007600 | |||
| 1126 | Ga0105237_10007857 | |||
| 1127 | Ga0105237_10027387 | |||
| 1128 | Ga0105237_10079069 | |||
| 1129 | Ga0105237_10123090 | |||
| 1130 | Ga0105237_10135189 | |||
| 1131 | Ga0105238_10013311 | |||
| 1132 | Ga0105238_10053188 | |||
| 1133 | Ga0105238_10109459 | |||
| 1134 | Ga0105238_10169826 | |||
| 1135 | Ga0105249_10002037 | |||
| 1136 | Ga0105249_10006492 | |||
| 1137 | Ga0105249_10008554 | |||
| 1138 | Ga0105249_10010023 | |||
| 1139 | Ga0105249_10019997 | |||
| 1140 | Ga0105249_10056653 | |||
| 1141 | Ga0105249_10058903 | |||
| 1142 | Ga0105239_10000005 | |||
| 1143 | Ga0105239_10000013 | |||
| 1144 | Ga0105239_10000072 | |||
| 1145 | Ga0105239_10000081 | |||
| 1146 | Ga0105239_10000259 | |||
| 1147 | Ga0105239_10001040 | |||
| 1148 | Ga0105239_10002120 | |||
| 1149 | Ga0105239_10002563 | |||
| 1150 | Ga0105239_10016008 | |||
| 1151 | Ga0105239_10031256 | |||
| 1152 | Ga0105239_10038296 | |||
| 1153 | Ga0105239_10038468 | |||
| 1154 | Ga0105239_10051224 | |||
| 1155 | Ga0105239_10060044 | |||
| 1156 | Ga0105239_10258127 | |||
| 1157 | Ga0157373_10000597 | |||
| 1158 | Ga0157373_10004754 | |||
| 1159 | Ga0157373_10019227 | |||
| 1160 | Ga0157373_10062478 | |||
| 1161 | Ga0157371_10000724 | |||
| 1162 | Ga0157371_10001349 | |||
| 1163 | Ga0157371_10001703 | |||
| 1164 | Ga0157371_10002487 | |||
| 1165 | Ga0157371_10003887 | |||
| 1166 | Ga0157371_10006631 | |||
| 1167 | Ga0157371_10008420 | |||
| 1168 | Ga0157371_10010626 | |||
| 1169 | Ga0157371_10022883 | |||
| 1170 | Ga0157371_10025530 | |||
| 1171 | Ga0157371_10041765 | |||
| 1172 | Ga0157371_10111945 | |||
| 1173 | Ga0157370_10001989 | |||
| 1174 | Ga0157370_10003763 | |||
| 1175 | Ga0157370_10005319 | |||
| 1176 | Ga0157370_10010139 | |||
| 1177 | Ga0157370_10012521 | |||
| 1178 | Ga0157370_10037184 | |||
| 1179 | Ga0157370_10040253 | |||
| 1180 | Ga0157369_10014216 | |||
| 1181 | Ga0157369_10024325 | |||
| 1182 | Ga0157369_10033374 | |||
| 1183 | Ga0157369_10039532 | |||
| 1184 | Ga0157369_10067870 | |||
| 1185 | Ga0157369_10113581 | |||
| 1186 | Ga0157369_10152866 | |||
| 1187 | Ga0157369_10188032 | |||
| 1188 | Ga0157374_10000723 | |||
| 1189 | Ga0157374_10125412 | |||
| 1190 | Ga0157374_10242437 | |||
| 1191 | Ga0157378_10004726 | |||
| 1192 | Ga0157378_10034883 | |||
| 1193 | Ga0157378_10073585 | |||
| 1194 | Ga0157378_10249580 | |||
| 1195 | Ga0157378_10307648 | |||
| 1196 | Ga0163162_10000066 | |||
| 1197 | Ga0163162_10000164 | |||
| 1198 | Ga0163162_10000373 | |||
| 1199 | Ga0163162_10000697 | |||
| 1200 | Ga0163162_10000856 | |||
| 1201 | Ga0163162_10001561 | |||
| 1202 | Ga0163162_10004336 | |||
| 1203 | Ga0163162_10007340 | |||
| 1204 | Ga0163162_10013198 | |||
| 1205 | Ga0163162_10180640 | |||
| 1206 | Ga0163162_10202005 | |||
| 1207 | Ga0163162_10346582 | |||
| 1208 | Ga0157372_10000676 | |||
| 1209 | Ga0157372_10001143 | |||
| 1210 | Ga0157372_10004620 | |||
| 1211 | Ga0157372_10005956 | |||
| 1212 | Ga0157372_10022840 | |||
| 1213 | Ga0157372_10022931 | |||
| 1214 | Ga0157372_10062402 | |||
| 1215 | Ga0157372_10094460 | |||
| 1216 | Ga0157372_10100848 | |||
| 1217 | Ga0157372_10202863 | |||
| 1218 | Ga0157372_10359662 | |||
| 1219 | Ga0157375_10000383 | |||
| 1220 | Ga0157375_10019253 | |||
| 1221 | Ga0157375_10041242 | |||
| 1222 | Ga0157375_10122099 | |||
| 1223 | Ga0157375_10127950 | |||
| 1224 | Ga0163163_10000560 | |||
| 1225 | Ga0163163_10002931 | |||
| 1226 | Ga0163163_10144484 | |||
| 1227 | Ga0157380_10001590 | |||
| 1228 | Ga0182008_10000010 | |||
| 1229 | Ga0182008_10003765 | |||
| 1230 | Ga0157377_10004008 | |||
| 1231 | Ga0157377_10057473 | |||
| 1232 | Ga0157379_10034273 | |||
| 1233 | Ga0157376_10002437 | |||
| 1234 | Ga0157376_10003607 | |||
| 1235 | Ga0157376_10029923 | |||
| 1236 | Ga0157376_10036441 | |||
| 1237 | Ga0182006_1026019 | |||
| 1238 | Ga0182007_10010906 | |||
| 1239 | Ga0183373_1010 | |||
| 1240 | Ga0163161_10001190 | |||
| 1241 | Ga0163161_10067587 | |||
| 1242 | Ga0206351_10002408 | |||
| 1243 | Ga0206350_10114900 | |||
| 1244 | Ga0154015_1295413 | |||
| 1245 | Ga0209563_103756 | |||
| 1246 | Ga0207427_100785 | |||
| 1247 | Ga0209437_100085 | |||
| 1248 | Ga0209437_100101 | |||
| 1249 | Ga0209646_1001361 | |||
| 1250 | Ga0209026_1000987 | |||
| 1251 | Ga0209026_1001037 | |||
| 1252 | Ga0209233_1000124 | |||
| 1253 | Ga0209455_1004434 | |||
| 1254 | Ga0209676_1000329 | |||
| 1255 | Ga0209050_1008696 | |||
| 1256 | Ga0209050_1024684 | |||
| 1257 | Ga0207426_1000040 | |||
| 1258 | Ga0209257_1000299 | |||
| 1259 | Ga0207656_10025276 | |||
| 1260 | Ga0207710_10002430 | |||
| 1261 | Ga0207680_10000568 | |||
| 1262 | Ga0207647_10030716 | |||
| 1263 | Ga0207645_10000542 | |||
| 1264 | Ga0207645_10000544 | |||
| 1265 | Ga0207645_10124726 | |||
| 1266 | Ga0207705_10000015 | |||
| 1267 | Ga0207705_10002903 | |||
| 1268 | Ga0207705_10007368 | |||
| 1269 | Ga0207705_10036116 | |||
| 1270 | Ga0207705_10151766 | |||
| 1271 | Ga0207654_10002706 | |||
| 1272 | Ga0207654_10038517 | |||
| 1273 | Ga0207654_10038897 | |||
| 1274 | Ga0207707_10002565 | |||
| 1275 | Ga0207707_10072069 | |||
| 1276 | Ga0207695_10000170 | |||
| 1277 | Ga0207695_10000425 | |||
| 1278 | Ga0207695_10000916 | |||
| 1279 | Ga0207695_10011968 | |||
| 1280 | Ga0207695_10016283 | |||
| 1281 | Ga0207695_10070758 | |||
| 1282 | Ga0207695_10086253 | |||
| 1283 | Ga0207695_10114967 | |||
| 1284 | Ga0207695_10238178 | |||
| 1285 | Ga0207671_10000004 | |||
| 1286 | Ga0207671_10001803 | |||
| 1287 | Ga0207671_10001864 | |||
| 1288 | Ga0207671_10002376 | |||
| 1289 | Ga0207671_10006717 | |||
| 1290 | Ga0207671_10007521 | |||
| 1291 | Ga0207671_10007560 | |||
| 1292 | Ga0207671_10007647 | |||
| 1293 | Ga0207671_10010890 | |||
| 1294 | Ga0207671_10011739 | |||
| 1295 | Ga0207671_10019488 | |||
| 1296 | Ga0207671_10044618 | |||
| 1297 | Ga0207663_10002822 | |||
| 1298 | Ga0207660_10008582 | |||
| 1299 | Ga0207660_10042766 | |||
| 1300 | Ga0207660_10049766 | |||
| 1301 | Ga0207662_10022892 | |||
| 1302 | Ga0207657_10008447 | |||
| 1303 | Ga0207657_10016158 | |||
| 1304 | Ga0207657_10057719 | |||
| 1305 | Ga0207657_10172084 | |||
| 1306 | Ga0207649_10042136 | |||
| 1307 | Ga0207652_10000337 | |||
| 1308 | Ga0207652_10002860 | |||
| 1309 | Ga0207652_10020852 | |||
| 1310 | Ga0207652_10032090 | |||
| 1311 | Ga0207694_10038631 | |||
| 1312 | Ga0207694_10050652 | |||
| 1313 | Ga0207694_10092164 | |||
| 1314 | Ga0207650_10067551 | |||
| 1315 | Ga0207659_10023637 | |||
| 1316 | Ga0207644_10024181 | |||
| 1317 | Ga0207644_10068752 | |||
| 1318 | Ga0207690_10112169 | |||
| 1319 | Ga0207706_10002738 | |||
| 1320 | Ga0207706_10009939 | |||
| 1321 | Ga0207706_10036819 | |||
| 1322 | Ga0207709_10000006 | |||
| 1323 | Ga0207709_10080165 | |||
| 1324 | Ga0207709_10119077 | |||
| 1325 | Ga0207704_10000512 | |||
| 1326 | Ga0207704_10009752 | |||
| 1327 | Ga0207691_10000060 | |||
| 1328 | Ga0207691_10223802 | |||
| 1329 | Ga0207711_10044751 | |||
| 1330 | Ga0207711_10066146 | |||
| 1331 | Ga0207689_10005494 | |||
| 1332 | Ga0207689_10006819 | |||
| 1333 | Ga0207689_10018897 | |||
| 1334 | Ga0207667_10000020 | |||
| 1335 | Ga0207667_10001127 | |||
| 1336 | Ga0207667_10001491 | |||
| 1337 | Ga0207667_10002289 | |||
| 1338 | Ga0207667_10014074 | |||
| 1339 | Ga0207667_10020765 | |||
| 1340 | Ga0207667_10056182 | |||
| 1341 | Ga0207667_10060829 | |||
| 1342 | Ga0207667_10072509 | |||
| 1343 | Ga0207667_10085791 | |||
| 1344 | Ga0207667_10139059 | |||
| 1345 | Ga0207667_10277008 | |||
| 1346 | Ga0207651_10013175 | |||
| 1347 | Ga0207651_10017395 | |||
| 1348 | Ga0207651_10052572 | |||
| 1349 | Ga0207651_10199908 | |||
| 1350 | Ga0207712_10089110 | |||
| 1351 | Ga0207712_10150765 | |||
| 1352 | Ga0207712_10186025 | |||
| 1353 | Ga0207668_10030727 | |||
| 1354 | Ga0207658_10001199 | |||
| 1355 | Ga0207658_10022335 | |||
| 1356 | Ga0207677_10012534 | |||
| 1357 | Ga0207677_10038042 | |||
| 1358 | Ga0207677_10114976 | |||
| 1359 | Ga0207703_10008491 | |||
| 1360 | Ga0207703_10059028 | |||
| 1361 | Ga0207639_10019114 | |||
| 1362 | Ga0207639_10020628 | |||
| 1363 | Ga0207639_10021022 | |||
| 1364 | Ga0207639_10034523 | |||
| 1365 | Ga0207639_10220561 | |||
| 1366 | Ga0207678_10008280 | |||
| 1367 | Ga0207702_10000820 | |||
| 1368 | Ga0207702_10036846 | |||
| 1369 | Ga0207702_10078276 | |||
| 1370 | Ga0207702_10085244 | |||
| 1371 | Ga0207702_10122965 | |||
| 1372 | Ga0207641_10000250 | |||
| 1373 | Ga0207641_10003961 | |||
| 1374 | Ga0207641_10025863 | |||
| 1375 | Ga0207641_10031708 | |||
| 1376 | Ga0207648_10003642 | |||
| 1377 | Ga0207648_10004739 | |||
| 1378 | Ga0207648_10064738 | |||
| 1379 | Ga0207648_10073470 | |||
| 1380 | Ga0207676_10013473 | |||
| 1381 | Ga0207676_10109544 | |||
| 1382 | Ga0207674_10004594 | |||
| 1383 | Ga0207674_10191636 | |||
| 1384 | Ga0207674_10209049 | |||
| 1385 | Ga0207674_10224157 | |||
| 1386 | Ga0207675_100000599 | |||
| 1387 | Ga0207675_100022077 | |||
| 1388 | Ga0207675_100105979 | |||
| 1389 | Ga0207698_10002595 | |||
| 1390 | Ga0207698_10024598 | |||
| 1391 | Ga0207698_10067134 | |||
| 1392 | Ga0207698_10072052 | |||
| 1393 | Ga0207698_10294430 | |||
| 1394 | Ga0207428_10057977 | |||
| 1395 | Ga0268266_10000016 | |||
| 1396 | Ga0268266_10000052 | |||
| 1397 | Ga0268266_10039046 | |||
| 1398 | Ga0268266_10157587 | |||
| 1399 | Ga0268265_10022155 | |||
| 1400 | Ga0268265_10068788 | |||
| 1401 | Ga0268264_10000015 | |||
| 1402 | Ga0268264_10001580 | |||
| 1403 | Ga0268264_10003253 | |||
| 1404 | Ga0268264_10038610 | |||
| 1405 | Ga0265337_1000681 | |||
| 1406 | Ga0265326_10000758 | |||
| 1407 | Ga0265326_10003795 | |||
| 1408 | Ga0265319_1000297 | |||
| 1409 | Ga0265319_1002577 | |||
| 1410 | Ga0265334_10001759 | |||
| 1411 | Ga0265334_10004780 | |||
| 1412 | Ga0265318_10015518 | |||
| 1413 | Ga0265318_10032088 | |||
| 1414 | Ga0265323_10000395 | |||
| 1415 | Ga0265323_10001271 | |||
| 1416 | Ga0265323_10012792 | |||
| 1417 | Ga0265323_10017597 | |||
| 1418 | Ga0265322_10005276 | |||
| 1419 | Ga0265322_10005878 | |||
| 1420 | Ga0265336_10000194 | |||
| 1421 | Ga0265336_10026823 | |||
| 1422 | Ga0307517_10008552 | |||
| 1423 | Ga0307517_10015597 | |||
| 1424 | Ga0307515_10000057 | |||
| 1425 | Ga0307515_10000133 | |||
| 1426 | Ga0307515_10000432 | |||
| 1427 | Ga0307515_10001738 | |||
| 1428 | Ga0265338_10000273 | |||
| 1429 | Ga0265338_10000527 | |||
| 1430 | Ga0265338_10002518 | |||
| 1431 | Ga0265338_10006323 | |||
| 1432 | Ga0265338_10008747 | |||
| 1433 | Ga0265338_10016341 | |||
| 1434 | Ga0265338_10030132 | |||
| 1435 | Ga0265338_10063636 | |||
| 1436 | Ga0265324_10001372 | |||
| 1437 | Ga0265324_10007618 | |||
| 1438 | Ga0316183_1126735 | |||
| 1439 | Ga0316181_1118713 | |||
| 1440 | Ga0265330_10001086 | |||
| 1441 | Ga0265330_10025643 | |||
| 1442 | Ga0265332_10001653 | |||
| 1443 | Ga0265332_10007014 | |||
| 1444 | Ga0265320_10000494 | |||
| 1445 | Ga0265320_10005528 | |||
| 1446 | Ga0265325_10010739 | |||
| 1447 | Ga0265325_10012429 | |||
| 1448 | Ga0265340_10002804 | |||
| 1449 | Ga0265339_10007060 | |||
| 1450 | Ga0265331_10058487 | |||
| 1451 | Ga0265327_10000618 | |||
| 1452 | Ga0265327_10008002 | |||
| 1453 | Ga0265327_10072023 | |||
| 1454 | Ga0265316_10005060 | |||
| 1455 | Ga0265316_10077499 | |||
| 1456 | Ga0307513_10147438 | |||
| 1457 | Ga0307509_10010102 | |||
| 1458 | Ga0307509_10072885 | |||
| 1459 | Ga0307408_100001775 | |||
| 1460 | Ga0265313_10004678 | |||
| 1461 | Ga0265313_10005311 | |||
| 1462 | Ga0265313_10012195 | |||
| 1463 | Ga0310103_105240 | |||
| 1464 | Ga0265314_10006023 | |||
| 1465 | Ga0265342_10001151 | |||
| 1466 | Ga0265342_10100515 | |||
| 1467 | Ga0316576_10002660 | |||
| 1468 | Ga0316576_10057544 | |||
| 1469 | Ga0316576_10065179 | |||
| 1470 | Ga0316576_10085185 | |||
| 1471 | Ga0316578_10000458 | |||
| 1472 | Ga0316578_10027250 | |||
| 1473 | Ga0316578_10081680 | |||
| 1474 | Ga0307516_10002738 | |||
| 1475 | Ga0307405_10163947 | |||
| 1476 | Ga0316577_10005407 | |||
| 1477 | Ga0316577_10005994 | |||
| 1478 | Ga0307412_10000018 | |||
| 1479 | Ga0307412_10091651 | |||
| 1480 | Ga0307409_100051015 | |||
| 1481 | Ga0307414_10000392 | |||
| 1482 | Ga0307414_10000393 | |||
| 1483 | Ga0307414_10022716 | |||
| 1484 | Ga0307414_10030980 | |||
| 1485 | Ga0307414_10051783 | |||
| 1486 | Ga0307414_10055507 | |||
| 1487 | Ga0307414_10221590 | |||
| 1488 | Ga0307507_10000064 | |||
| 1489 | Ga0307510_10005874 | |||
| 1490 | Ga0307510_10007411 | |||
| 1491 | Ga0373934_0001565 | |||
| 1492 | Ga0373923_0036491 | |||
| 1493 | Ga0373954_0046145 | |||
| 1494 | Ga0373956_0064778 | |||
| 1495 | Ga0373957_0041473 | |||
| 1496 | Ga0316574_0009680 | |||
| 1497 | Ga0316574_0178878 | |||
| 1498 | Ga0373927_0005089 | |||
| 1499 | Ga0373933_0007494 | |||
| 1500 | Ga0373937_0013067 | |||
| 1501 | Ga0310110_009579 | |||
| 1502 | Ga0316582_0000862 | |||
| 1503 | Ga0316584_0000202 | |||
| 1504 | Ga0316584_0000530 | |||
| 1505 | Ga0316584_0043722 | |||
| 1506 | Ga0373925_0027719 | |||
| 1507 | Ga0395899_0002054 | |||
| 1508 | Ga0395899_0006794 | |||
| 1509 | Ga0395899_0017979 | |||
| 1510 | Ga0395899_0061038 | |||
| 1511 | Ga0395899_0088854 | |||
| 1512 | Ga0395900_0005501 | |||
| 1513 | Ga0395900_0005682 | |||
| 1514 | Ga0395900_0007296 | |||
| 1515 | Ga0395900_0029586 | |||
| 1516 | Ga0395900_0124774 | |||
| 1517 | Ga0395900_0153735 | |||
| 1518 | Ga0395900_0277274 | |||
| 1519 | Ga0395898_0009433 | |||
| 1520 | Ga0395898_0039456 | |||
| 1521 | Ga0395898_0130890 | |||
| 1522 | Ga0395905_0000516 | |||
| 1523 | Ga0395905_0001254 | |||
| 1524 | Ga0395905_0036571 | |||
| 1525 | Ga0395901_0000861 | |||
| 1526 | Ga0395901_0003324 | |||
| 1527 | Ga0395901_0136614 | |||
| 1528 | Ga0395901_0226951 | |||
| 1529 | Ga0400485_16601 | |||
| 1530 | Ga0400483_039122 | |||
| 1531 | Ga0436361_0539750 | |||
| 1532 | Ga0439439_0028272 | |||
| 1533 | Ga0451853_2051003 | |||
| 1534 | Ga0450898_003736 | |||
| 1535 | Ga0451577_0000072 | |||
| 1536 | Ga0451577_0000202 | |||
| 1537 | Ga0451577_0000217 | |||
| 1538 | Ga0451577_0000364 | |||
| 1539 | Ga0451577_0000509 | |||
| 1540 | Ga0451577_0000954 | |||
| 1541 | Ga0451577_0002430 | |||
| 1542 | Ga0451577_0012393 | |||
| 1543 | Ga0451577_0018198 | |||
| 1544 | Ga0451577_0060152 | |||
| 1545 | Ga0451577_0069804 | |||
| 1546 | Ga0451577_0076157 | |||
| 1547 | Ga0451577_0085788 | |||
| 1548 | Ga0451577_0097992 | |||
| 1549 | Ga0451577_0128676 | |||
| 1550 | Ga0451577_0137791 | |||
| 1551 | Ga0451577_0151581 | |||
| 1552 | Ga0451577_0345532 | |||
| 1553 | Ga0466972_0000205 | |||
| 1554 | Ga0466972_0000946 | |||
| 1555 | Ga0453683_0000139 | |||
| 1556 | Ga0453683_0000178 | |||
| 1557 | Ga0453683_0000476 | |||
| 1558 | Ga0453683_0000625 | |||
| 1559 | Ga0453683_0001467 | |||
| 1560 | Ga0453683_0003005 | |||
| 1561 | Ga0453683_0005318 | |||
| 1562 | Ga0453683_0010590 | |||
| 1563 | Ga0453683_0010664 | |||
| 1564 | Ga0453683_0017963 | |||
| 1565 | Ga0453683_0029661 | |||
| 1566 | Ga0453683_0040902 | |||
| 1567 | Ga0453683_0099936 | |||
| 1568 | Ga0453684_0000004 | |||
| 1569 | Ga0453684_0000081 | |||
| 1570 | Ga0453684_0000086 | |||
| 1571 | Ga0453684_0000186 | |||
| 1572 | Ga0453684_0000337 | |||
| 1573 | Ga0453684_0000393 | |||
| 1574 | Ga0453684_0000608 | |||
| 1575 | Ga0453684_0000630 | |||
| 1576 | Ga0453684_0001006 | |||
| 1577 | Ga0453684_0001244 | |||
| 1578 | Ga0453684_0001377 | |||
| 1579 | Ga0453684_0002144 | |||
| 1580 | Ga0453684_0004157 | |||
| 1581 | Ga0453684_0004417 | |||
| 1582 | Ga0453684_0005203 | |||
| 1583 | Ga0453684_0005297 | |||
| 1584 | Ga0453684_0006234 | |||
| 1585 | Ga0453684_0007491 | |||
| 1586 | Ga0453684_0009673 | |||
| 1587 | Ga0453684_0013156 | |||
| 1588 | Ga0453684_0013250 | |||
| 1589 | Ga0453684_0017180 | |||
| 1590 | Ga0453684_0018143 | |||
| 1591 | Ga0453684_0019610 | |||
| 1592 | Ga0453684_0022403 | |||
| 1593 | Ga0453684_0026462 | |||
| 1594 | Ga0453684_0030202 | |||
| 1595 | Ga0453684_0030327 | |||
| 1596 | Ga0453684_0030674 | |||
| 1597 | Ga0453684_0041170 | |||
| 1598 | Ga0453684_0045474 | |||
| 1599 | Ga0453684_0058981 | |||
| 1600 | Ga0453684_0059245 | |||
| 1601 | Ga0453684_0067008 | |||
| 1602 | Ga0453684_0077277 | |||
| 1603 | Ga0453684_0096362 | |||
| 1604 | Ga0453684_0120378 | |||
| 1605 | Ga0453684_0139207 | |||
| 1606 | Ga0453684_0186360 | |||
| 1607 | Ga0453684_0255106 | |||
| 1608 | Ga0453684_0289366 | |||
| 1609 | Ga0453684_0301019 | |||
| 1610 | Ga0466968_0016433 | |||
| 1611 | Ga0466970_0000529 | |||
| 1612 | Ga0466957_0001121 | |||
| 1613 | Ga0451576_0000065 | |||
| 1614 | Ga0451576_0000083 | |||
| 1615 | Ga0451576_0000145 | |||
| 1616 | Ga0451576_0000294 | |||
| 1617 | Ga0451576_0000683 | |||
| 1618 | Ga0451576_0000729 | |||
| 1619 | Ga0451576_0001394 | |||
| 1620 | Ga0451576_0007238 | |||
| 1621 | Ga0451576_0009193 | |||
| 1622 | Ga0451576_0011975 | |||
| 1623 | Ga0451576_0051793 | |||
| 1624 | Ga0451576_0069951 | |||
| 1625 | Ga0451576_0080236 | |||
| 1626 | Ga0451576_0115641 | |||
| 1627 | Ga0451576_0322578 | |||
| 1628 | Ga0466967_0208069 | |||
| 1629 | Ga0495638_0000001 | |||
| 1630 | Ga0495638_0028055 | |||
| 1631 | Ga0495651_0052900 | |||
| 1632 | Ga0495651_0098879 | |||
| 1633 | Ga0495653_0266227 | |||
| 1634 | Ga0495650_0000003 | |||
| 1635 | Ga0495580_0010183 | |||
| 1636 | Ga0495580_0016439 | |||
| 1637 | Ga0495585_0000085 | |||
| 1638 | Ga0495585_0001006 | |||
| 1639 | Ga0495606_0000002 | |||
| 1640 | Ga0495606_0005474 | |||
| 1641 | Ga0495606_0016294 | |||
| 1642 | Ga0495608_0050979 | |||
| 1643 | Ga0495610_0023746 | |||
| 1644 | Ga0495616_0005113 | |||
| 1645 | Ga0495616_0006849 | |||
| 1646 | Ga0495628_0004159 | |||
| 1647 | Ga0495631_0008059 | |||
| 1648 | Ga0495648_0002775 | |||
| 1649 | Ga0495652_0188421 | |||
| 1650 | Ga0495587_0052965 | |||
| 1651 | Ga0495609_0033790 | |||
| 1652 | Ga0495633_0000014 | |||
| 1653 | Ga0495633_0089582 | |||
| 1654 | Ga0495667_0077050 | |||
| 1655 | Ga0495668_0000003 | |||
| 1656 | Ga0495668_0001784 | |||
| 1657 | Ga0495611_0000179 | |||
| 1658 | Ga0495625_0000005 | |||
| 1659 | Ga0495625_0000471 | |||
| 1660 | Ga0495625_0001258 | |||
| 1661 | Ga0495625_0010947 | |||
| 1662 | Ga0495625_0017844 | |||
| 1663 | Ga0495661_0054825 | |||
| 1664 | Ga0495661_0088277 | |||
| 1665 | Ga0495657_0078202 | |||
| 1666 | Ga0495599_0077856 | |||
| 1667 | Ga0495647_0037234 | |||
| 1668 | Ga0495658_0141371 | |||
| 1669 | Ga0495613_0097663 | |||
| 1670 | Ga0495649_0000003 | |||
| 1671 | Ga0495660_0007560 | |||
| 1672 | Ga0495672_0033988 | |||
| 1673 | Ga0495683_0028303 | |||
| 1674 | Ga0495687_000004 | |||
| 1675 | Ga0495687_000544 | |||
| 1676 | Ga0495687_000762 | |||
| 1677 | Ga0495675_0010457 | |||
| 1678 | Ga0495686_0000004 | |||
| 1679 | Ga0495686_0003602 | |||
| 1680 | Ga0495686_0051650 | |||
| 1681 | Ga0495686_0132507 | |||
| 1682 | Ga0496101_0012235 | |||
| 1683 | Ga0496102_0176702 | |||
| 1684 | Ga0496104_0261118 | |||
| 1685 | Ga0496109_0083335 | |||
| 1686 | Ga0496116_0004290 | |||
| 1687 | Ga0496117_0008979 | |||
| 1688 | Ga0496122_0000789 | |||
| 1689 | Ga0496122_0006722 | |||
| 1690 | Ga0496123_0006610 | |||
| 1691 | Ga0496123_0013257 | |||
| 1692 | Ga0496124_0042623 | |||
| 1693 | Ga0501323_000726 | |||
| 1694 | Ga0501031_0017014 | |||
| 1695 | Ga0501032_0000789 | |||
| 1696 | Ga0501032_0103951 | |||
| 1697 | Ga0501033_0125458 | |||
| 1698 | Ga0501034_0006168 | |||
| 1699 | Ga0501034_0041867 | |||
| 1700 | Ga0501034_0109443 | |||
| 1701 | Ga0501036_0001149 | |||
| 1702 | Ga0501036_0004247 | |||
| 1703 | Ga0501037_0027852 | |||
| 1704 | Ga0501038_0101201 | |||
| 1705 | Ga0501039_0025685 | |||
| 1706 | Ga0501041_0014564 | |||
| 1707 | Ga0501042_0003714 | |||
| 1708 | Ga0501043_0013354 | |||
| 1709 | Ga0501043_0055797 | |||
| 1710 | Ga0501046_0002549 | |||
| 1711 | Ga0501046_0012945 | |||
| 1712 | Ga0501047_0003691 | |||
| 1713 | Ga0501048_0003076 | |||
| 1714 | Ga0501068_0013864 | |||
| 1715 | Ga0501068_0075269 | |||
| 1716 | Ga0501069_0011303 | |||
| 1717 | Ga0501070_0006716 | |||
| 1718 | Ga0501070_0119081 | |||
| 1719 | Ga0501070_0225193 | |||
| 1720 | Ga0501071_0022656 | |||
| 1721 | Ga0501072_0002595 | |||
| 1722 | Ga0501073_0002127 | |||
| 1723 | Ga0501073_0046449 | |||
| 1724 | Ga0501074_0000268 | |||
| 1725 | Ga0501074_0071210 | |||
| 1726 | Ga0501075_0052536 | |||
| 1727 | Ga0501217_005267 | |||
| 1728 | Ga0501223_000517 | |||
| 1729 | Ga0501236_000066 | |||
| 1730 | Ga0501238_006873 | |||
| 1731 | Ga0501243_008676 | |||
| 1732 | Ga0501225_0044910 | |||
| 1733 | Ga0501079_0005838 | |||
| 1734 | Ga0501080_0009651 | |||
| 1735 | Ga0501080_0082493 | |||
| 1736 | Ga0501080_0290176 | |||
| 1737 | Ga0501081_0001456 | |||
| 1738 | Ga0501081_0096995 | |||
| 1739 | Ga0501083_0002364 | |||
| 1740 | Ga0501083_0045344 | |||
| 1741 | Ga0501035_0006540 | |||
| 1742 | Ga0501035_0063517 | |||
| 1743 | Ga0501044_0008384 | |||
| 1744 | Ga0501044_0130700 | |||
| 1745 | Ga0501045_0033653 | |||
| 1746 | nmdc:mga0k408_33017_c1 | |||
| 1747 | nmdc:mga0k408_6399_c1 | |||
| 1748 | nmdc:mga05p37_20368_c1 | |||
| 1749 | nmdc:mga09592_92181_c1 | |||
| 1750 | nmdc:mga06r32_49377_c1 | |||
| 1751 | nmdc:mga08y16_141376_c1 | |||
| 1752 | nmdc:mga08y16_254478_c1 | |||
| 1753 | nmdc:mga08y16_3286_c1 | |||
| 1754 | nmdc:mga08y16_5732_c1 | |||
| 1755 | nmdc:mga08y16_60600_c1 | |||
| 1756 | Ga0500583_0000077 | |||
| 1757 | Ga0500583_0005181 | |||
| 1758 | Ga0500641_0059014 | |||
| 1759 | Ga0500562_002684 | |||
| 1760 | Ga0500608_001113 | |||
| 1761 | Ga0500614_012003 | |||
| 1762 | Ga0500618_000666 | |||
| 1763 | Ga0500618_008890 | |||
| 1764 | Ga0500559_0055216 | |||
| 1765 | Ga0500568_0000641 | |||
| 1766 | Ga0500616_0000009 | |||
| 1767 | Ga0500616_0007510 | |||
| 1768 | Ga0500622_0000009 | |||
| 1769 | Ga0500622_0000096 | |||
| 1770 | Ga0500622_0002927 | |||
| 1771 | Ga0500622_0003314 | |||
| 1772 | Ga0500622_0012934 | |||
| 1773 | Ga0500624_000970 | |||
| 1774 | Ga0500627_0036267 | |||
| 1775 | Ga0500611_000020 | |||
| 1776 | Ga0501084_0121959 | |||
| 1777 | Ga0501082_0002189 | |||
| 1778 | Ga0501082_0079639 | |||
| 1779 | Ga0530510_0003636 | |||
| 1780 | Ga0530510_0058992 | |||
| 1781 | 2522551106 | |||
| 1782 | 2599477954 | |||
| 1783 | 2617917579 | |||
| 1784 | 2643948034 | |||
| 1785 | 2644390541 | |||
| 1786 | 2644433900 | |||
| 1787 | 2722729183 | |||
| 1788 | 2738698353 | |||
| 1789 | 2738731240 | |||
| 1790 | 2738756567 | |||
| 1791 | 2738760849 | |||
| 1792 | 2739252679 | |||
| 1793 | 2739304006 | |||
| 1794 | 2740031596 | |||
| 1795 | 2819587334 | |||
| 1796 | 2839992282 | |||
| 1797 | 2842906595 | |||
| 1798 | 2852623668 | |||
| 1799 | 2852627338 | |||
| 1800 | 2884937428 | |||
| 1801 | 2890738095 | |||
| 1802 | 2891633668 | |||
| 1803 | 2896318001 | |||
| 1804 | 2896345476 | |||
| 1805 | 2898715848 | |||
| 1806 | 2904780905 | |||
| 1807 | 2913846074 | |||
| 1808 | 2913941070 | |||
| 1809 | 2918504964 | |||
| 1810 | 2919180631 | |||
| 1811 | 2919187371 | |||
| 1812 | 2919441095 | |||
| 1813 | 2919693343 | |||
| 1814 | 2928079915 | |||
| 1815 | 2928147630 | |||
| 1816 | 2932088484 | |||
| 1817 | 2939665362 | |||
| 1818 | 2977236133 | |||
| 1819 | 3003235980 | |||
| 1820 | 642605327 | |||
| 1821 | 8055589469 | |||
| 1822 | 8056440302 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8eqw-assembly1.cif.gz_G | crystal structure of fub7 | 0.9819 | 6 | 434 |
| 8sf5-assembly1.cif.gz_A-2 | promiscuous amino acid gamma synthase from caldicellulosiruptor hydrothermalis in open conformation | 0.9816 | 5 | 428 |
| 8eqw-assembly4.cif.gz_D | crystal structure of fub7 | 0.9813 | 6 | 434 |
| 8eqw-assembly3.cif.gz_C | crystal structure of fub7 | 0.9804 | 5 | 434 |
| 8eqw-assembly1.cif.gz_A | crystal structure of fub7 | 0.9803 | 5 | 434 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O13326_295_429_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9851 | 299 | 431 | 3.90.1150.10 |
| af_Q59US5_3_288_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9813 | 5 | 293 | 3.40.640.10 |
| af_P32929_263_402_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9771 | 298 | 432 | 3.90.1150.10 |
| 3ri6B02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9763 | 299 | 428 | 3.90.1150.10 |
| af_Q59US5_3_288_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9745 | 5 | 293 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434AUQ5-F1-model_v4 | O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase | 0.9932 | 1 | 432 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A7G8JLQ7-F1-model_v4 | O-acetylhomoserine aminocarboxypropyltransferase | 0.9919 | 47 | 430 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A1F2PGI7-F1-model_v4 | Methionine gamma-lyase (EC 4.4.1.11) | 0.9904 | 5 | 432 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0018826 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A382DB25-F1-model_v4 | Aminotransferase class V domain-containing protein | 0.9903 | 5 | 228 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A430SEX8-F1-model_v4 | O-acetylhomoserine aminocarboxypropyltransferase (EC 2.5.1.49) | 0.989 | 5 | 211 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |