F485485

General Info

Members Datasets Scaffolds Average Seq Length
911 379 1822 438

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0000164|Ga0500583_0000164_19545_20978
Length 477
Sequence VGIKKVPYLIVTSHLHSVARSVYFLLIASFLKNFFSMNQKLHFETLQLHAGQQIDPTTKARAVPIYQTTSYGFDSSAHAADLFGLRTFGNIYTRIMNPTTDVFEQRMAALEGGVAALATSSGQAAQFLALNNIMQAGDNFVSTSYLYGGTYNQFKISFKRLGIDARFVEGDDAENFVKHIDKNTKAIYLETIGNPRLNIPDFEKFAQLAKDYDLPLIVDNTFGAGGYLFRPLEHGAHVVVESATKWIGGHGTAIGGVIIDGGNYNWGNGKFPQFTEPSEGYHGLKFWDVFGEGNPLGLPNIAFAIRARVEGLRDFGPSLSPFNSFLLLQGLETLSLRVQRHVDNALTLATWLQEHPQVEFVEYPGLNTSPYNDLARKYLTNGFGGILNFGIKGEKEKASAFIDSLKLASHLANVGDAKTLVIHPASTTHEQLSAEEQLVAGVRPNQIRISVGIEHIEDIKADFEQAFEKVFANQLVA

Samples

Sample ID Description Type Environment
1 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
168 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
169 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
170 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
171 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
172 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
179 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
216 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
225 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
306 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
307 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
308 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
309 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
310 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
324 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
327 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
328 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
332 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
333 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
334 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
339 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
340 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
341 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
342 2643221670 Streptomyces sp. Root431 Isolate Unclassified
343 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
344 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
345 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
346 2738541278 Niastella sp. CF465 Isolate Unclassified
347 2738541283 Pedobacter sp. OK701 Isolate Unclassified
348 2738541284 Pedobacter sp. YR016 Isolate Unclassified
349 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
350 2738543023 Pedobacter sp. OK628 Isolate Unclassified
351 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
352 2818991444 Filimonas endophytica 3197 Isolate Unclassified
353 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
354 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
355 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
356 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
357 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
358 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
359 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
360 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
361 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
362 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
363 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
364 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
365 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
366 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
367 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
368 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
369 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
370 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
371 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
372 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
373 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
374 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
375 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
376 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
377 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
378 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
379 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.73
Metatranscriptomes 0.66
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.83
Nodule 0
Rhizoplane 0.55
Rhizosphere 88.47
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500583_0000164 3300053092 Bacteria 27548
2 SwRhRL2b_contig_308077 2162886007 Bacteria 7601
3 MBSR1b_contig_6741876 2162886012 Bacteria 1699
4 JGI24737J22298_10000733 3300001990 Bacteria 11561
5 JGI24735J21928_10000014 3300002067 Bacteria 186670
6 JGI25162J39368_1000020 3300002737 Bacteria 254723
7 JGI25162J39368_1001888 3300002737 Bacteria 9626
8 JGI25164J39214_1002648 3300002772 Bacteria 2607
9 JGI25165J46597_1000898 3300003214 Bacteria 20764
10 rootH1_10001098 3300003316 Bacteria 10436
11 rootH2_10002858 3300003320 Bacteria 54174
12 rootH2_10035181 3300003320 Bacteria 29518
13 rootL2_10163790 3300003322 Bacteria 2135
14 rootH1_10003699 3300003323 Bacteria 25103
15 rootH1_10017423 3300003323 Bacteria 3453
16 rootH1_10126862 3300003323 Bacteria 4549
17 JGI25160J50197_1003564 3300003354 Bacteria 6924
18 Ga0055536_1013049 3300003781 Bacteria 3029
19 Ga0065165_1000169 3300005262 Bacteria 115398
20 Ga0065165_1001340 3300005262 Bacteria 27256
21 Ga0065714_10002361 3300005288 Bacteria 37849
22 Ga0065714_10002919 3300005288 Bacteria 20677
23 Ga0065704_10000238 3300005289 Bacteria 87424
24 Ga0065704_10001141 3300005289 Bacteria 9730
25 Ga0065712_10001455 3300005290 Bacteria 6332
26 Ga0070658_10000011 3300005327 Bacteria 294396
27 Ga0070658_10037328 3300005327 Bacteria 3916
28 Ga0070658_10073847 3300005327 Bacteria 2797
29 Ga0070658_10088639 3300005327 Bacteria 2548
30 Ga0070676_10001211 3300005328 Bacteria 12929
31 Ga0070676_10002877 3300005328 Bacteria 8890
32 Ga0070683_100018837 3300005329 Bacteria 6123
33 Ga0070683_100159915 3300005329 Bacteria 2137
34 Ga0070670_100027222 3300005331 Bacteria 4918
35 Ga0070670_100038903 3300005331 Bacteria 4090
36 Ga0070670_100063646 3300005331 Bacteria 3166
37 Ga0070670_100078187 3300005331 Bacteria 2842
38 Ga0070670_100147645 3300005331 Bacteria 2035
39 Ga0068869_100016541 3300005334 Bacteria 4973
40 Ga0068869_100031202 3300005334 Bacteria 3748
41 Ga0068869_100038954 3300005334 Bacteria 3390
42 Ga0070666_10001123 3300005335 Bacteria 16300
43 Ga0070666_10006658 3300005335 Bacteria 7104
44 Ga0070680_100005777 3300005336 Bacteria 9391
45 Ga0070680_100041291 3300005336 Bacteria 3740
46 Ga0070680_100059914 3300005336 Bacteria 3115
47 Ga0070680_100068002 3300005336 Bacteria 2923
48 Ga0070680_100131695 3300005336 Bacteria 2093
49 Ga0070682_100003177 3300005337 Bacteria 9097
50 Ga0068868_100014216 3300005338 Bacteria 5862
51 Ga0068868_100136348 3300005338 Bacteria 2012
52 Ga0070660_100029365 3300005339 Bacteria 4120
53 Ga0070660_100052356 3300005339 Bacteria 3147
54 Ga0070660_100086977 3300005339 Bacteria 2460
55 Ga0070660_100123237 3300005339 Bacteria 2070
56 Ga0070691_10000930 3300005341 Bacteria 11888
57 Ga0070687_100030867 3300005343 Bacteria 2623
58 Ga0070687_100052188 3300005343 Bacteria 2121
59 Ga0070661_100018952 3300005344 Bacteria 4900
60 Ga0070692_10103083 3300005345 Bacteria 1567
61 Ga0070668_100004450 3300005347 Bacteria 10396
62 Ga0070669_100008200 3300005353 Bacteria 7461
63 Ga0070675_100007148 3300005354 Bacteria 8599
64 Ga0070675_100012647 3300005354 Bacteria 6621
65 Ga0070671_100094133 3300005355 Bacteria 2511
66 Ga0070671_100122779 3300005355 Bacteria 2186
67 Ga0070673_100001702 3300005364 Bacteria 13067
68 Ga0070673_100003548 3300005364 Bacteria 9732
69 Ga0070673_100029933 3300005364 Bacteria 4067
70 Ga0070673_100040799 3300005364 Bacteria 3563
71 Ga0070673_100117815 3300005364 Bacteria 2211
72 Ga0070688_100005858 3300005365 Bacteria 6504
73 Ga0070659_100021644 3300005366 Bacteria 4900
74 Ga0070659_100026196 3300005366 Bacteria 4485
75 Ga0070659_100042229 3300005366 Bacteria 3565
76 Ga0070659_100046953 3300005366 Bacteria 3385
77 Ga0070659_100247454 3300005366 Bacteria 1477
78 Ga0070667_100024412 3300005367 Bacteria 5021
79 Ga0070667_100077159 3300005367 Bacteria 2845
80 Ga0070667_100222451 3300005367 Bacteria 1680
81 Ga0070663_100028577 3300005455 Bacteria 3798
82 Ga0070663_100144121 3300005455 Bacteria 1821
83 Ga0070678_100007368 3300005456 Bacteria 6522
84 Ga0070662_100004667 3300005457 Bacteria 8690
85 Ga0070681_10142682 3300005458 Bacteria 2324
86 Ga0070681_10261627 3300005458 Bacteria 1642
87 Ga0068867_100006003 3300005459 Bacteria 8611
88 Ga0068867_100016922 3300005459 Bacteria 5181
89 Ga0068867_100028131 3300005459 Bacteria 4045
90 Ga0070679_100001254 3300005530 Bacteria 22385
91 Ga0070679_100010318 3300005530 Bacteria 8855
92 Ga0070679_100015447 3300005530 Bacteria 7337
93 Ga0070679_100199057 3300005530 Bacteria 1970
94 Ga0070684_100104674 3300005535 Bacteria 2532
95 Ga0070684_100119774 3300005535 Bacteria 2367
96 Ga0070684_100217623 3300005535 Bacteria 1742
97 Ga0068853_100016543 3300005539 Bacteria 6073
98 Ga0068853_100024401 3300005539 Bacteria 5069
99 Ga0068853_100068924 3300005539 Bacteria 3076
100 Ga0070672_100022405 3300005543 Bacteria 4640
101 Ga0070695_100112949 3300005545 Bacteria 1846
102 Ga0070665_100000003 3300005548 Bacteria 811857
103 Ga0070665_100000008 3300005548 Bacteria 606341
104 Ga0068855_100000727 3300005563 Bacteria 40453
105 Ga0068855_100000998 3300005563 Bacteria 35254
106 Ga0068855_100002579 3300005563 Bacteria 22327
107 Ga0068855_100010877 3300005563 Bacteria 10983
108 Ga0068855_100056698 3300005563 Bacteria 4595
109 Ga0068855_100094815 3300005563 Bacteria 3441
110 Ga0068855_100144948 3300005563 Bacteria 2704
111 Ga0068855_100180723 3300005563 Bacteria 2385
112 Ga0068855_100242163 3300005563 Bacteria 2015
113 Ga0068855_100378740 3300005563 Bacteria 1554
114 Ga0068857_100004830 3300005577 Bacteria 11421
115 Ga0068854_100031522 3300005578 Bacteria 3685
116 Ga0068856_100000259 3300005614 Bacteria 57810
117 Ga0068856_100003419 3300005614 Bacteria 16056
118 Ga0068856_100012928 3300005614 Bacteria 8080
119 Ga0068856_100110022 3300005614 Bacteria 2752
120 Ga0068852_100003639 3300005616 Bacteria 10799
121 Ga0068852_100005665 3300005616 Bacteria 8958
122 Ga0068852_100008807 3300005616 Bacteria 7466
123 Ga0068852_100024969 3300005616 Bacteria 4836
124 Ga0068852_100025420 3300005616 Bacteria 4798
125 Ga0068852_100068319 3300005616 Bacteria 3110
126 Ga0068852_100077757 3300005616 Bacteria 2934
127 Ga0068859_100000023 3300005617 Bacteria 221914
128 Ga0068859_100010680 3300005617 Bacteria 9241
129 Ga0068859_100020142 3300005617 Bacteria 6697
130 Ga0068859_100318554 3300005617 Bacteria 1649
131 Ga0068864_100000733 3300005618 Bacteria 27467
132 Ga0068864_100009349 3300005618 Bacteria 8085
133 Ga0068864_100043103 3300005618 Bacteria 3863
134 Ga0068866_10003738 3300005718 Bacteria 6241
135 Ga0068861_100040252 3300005719 Bacteria 3494
136 Ga0068861_100099963 3300005719 Bacteria 2305
137 Ga0068861_100189055 3300005719 Bacteria 1720
138 Ga0068851_10022987 3300005834 Bacteria 3044
139 Ga0068863_100027572 3300005841 Bacteria 5418
140 Ga0068863_100028175 3300005841 Bacteria 5362
141 Ga0068858_100003125 3300005842 Bacteria 16572
142 Ga0068858_100003981 3300005842 Bacteria 14582
143 Ga0068858_100098620 3300005842 Bacteria 2724
144 Ga0068858_100146325 3300005842 Bacteria 2219
145 Ga0068860_100000059 3300005843 Bacteria 196400
146 Ga0068860_100001384 3300005843 Bacteria 26311
147 Ga0068860_100024605 3300005843 Bacteria 5814
148 Ga0068860_100040343 3300005843 Bacteria 4462
149 Ga0068862_100004782 3300005844 Bacteria 11396
150 Ga0068862_100027564 3300005844 Bacteria 4782
151 Ga0068862_100213640 3300005844 Bacteria 1744
152 Ga0075366_10007290 3300006195 Bacteria 6099
153 Ga0075366_10032558 3300006195 Bacteria 3069
154 Ga0097621_100000020 3300006237 Bacteria 86226
155 Ga0097621_100000487 3300006237 Bacteria 27766
156 Ga0097621_100051390 3300006237 Bacteria 3355
157 Ga0097621_100064504 3300006237 Bacteria 3012
158 Ga0097621_100088581 3300006237 Bacteria 2586
159 Ga0097621_100115725 3300006237 Bacteria 2270
160 Ga0097621_100267105 3300006237 Unclassified 1502
161 Ga0068871_100000416 3300006358 Bacteria 29438
162 Ga0068871_100000598 3300006358 Bacteria 24790
163 Ga0068871_100013343 3300006358 Bacteria 6098
164 Ga0068871_100021887 3300006358 Bacteria 4922
165 Ga0068871_100027178 3300006358 Bacteria 4472
166 Ga0075431_100057971 3300006847 Bacteria 3994
167 Ga0075429_100049891 3300006880 Bacteria 3641
168 Ga0068865_100000208 3300006881 Bacteria 32611
169 Ga0068865_100004850 3300006881 Bacteria 8134
170 Ga0068865_100011685 3300006881 Bacteria 5501
171 Ga0097620_100000023 3300006931 Bacteria 221914
172 Ga0097620_100010683 3300006931 Bacteria 9241
173 Ga0097620_100020142 3300006931 Bacteria 6697
174 Ga0097620_100318566 3300006931 Bacteria 1649
175 Ga0105240_10000767 3300009093 Bacteria 58332
176 Ga0105240_10001584 3300009093 Bacteria 38608
177 Ga0105240_10007530 3300009093 Bacteria 15793
178 Ga0105240_10031042 3300009093 Bacteria 6934
179 Ga0105240_10049859 3300009093 Bacteria 5281
180 Ga0105240_10095335 3300009093 Bacteria 3628
181 Ga0105240_10102281 3300009093 Bacteria 3482
182 Ga0105240_10119990 3300009093 Bacteria 3167
183 Ga0105240_10171848 3300009093 Bacteria 2566
184 Ga0111539_10006433 3300009094 Bacteria 15147
185 Ga0111539_10011432 3300009094 Bacteria 11143
186 Ga0111539_10295731 3300009094 Bacteria 1884
187 Ga0105245_10050473 3300009098 Bacteria 3728
188 Ga0105247_10008227 3300009101 Bacteria 6363
189 Ga0105247_10009048 3300009101 Bacteria 6063
190 Ga0114129_10174564 3300009147 Bacteria 2928
191 Ga0105243_10000012 3300009148 Bacteria 300885
192 Ga0105243_10031803 3300009148 Bacteria 4071
193 Ga0105243_10074134 3300009148 Bacteria 2760
194 Ga0105243_10159239 3300009148 Bacteria 1945
195 Ga0105241_10000861 3300009174 Bacteria 23026
196 Ga0105241_10002514 3300009174 Bacteria 13768
197 Ga0105241_10018003 3300009174 Bacteria 5193
198 Ga0105241_10043565 3300009174 Bacteria 3399
199 Ga0105241_10096885 3300009174 Bacteria 2338
200 Ga0105241_10189405 3300009174 Bacteria 1712
201 Ga0105242_10059690 3300009176 Bacteria 3131
202 Ga0105242_10067351 3300009176 Bacteria 2960
203 Ga0105248_10013691 3300009177 Bacteria 8928
204 Ga0105248_10040274 3300009177 Bacteria 5237
205 Ga0105237_10000044 3300009545 Bacteria 177828
206 Ga0105237_10000356 3300009545 Bacteria 64629
207 Ga0105237_10000971 3300009545 Bacteria 38512
208 Ga0105237_10001449 3300009545 Bacteria 31348
209 Ga0105237_10001750 3300009545 Bacteria 28065
210 Ga0105237_10001907 3300009545 Bacteria 26596
211 Ga0105237_10004465 3300009545 Bacteria 16170
212 Ga0105237_10006762 3300009545 Bacteria 12655
213 Ga0105237_10006763 3300009545 Bacteria 12654
214 Ga0105237_10007600 3300009545 Bacteria 11844
215 Ga0105237_10007857 3300009545 Bacteria 11628
216 Ga0105237_10027387 3300009545 Bacteria 5819
217 Ga0105237_10079069 3300009545 Bacteria 3278
218 Ga0105237_10123090 3300009545 Bacteria 2588
219 Ga0105237_10135189 3300009545 Bacteria 2460
220 Ga0105238_10013311 3300009551 Bacteria 8299
221 Ga0105238_10053188 3300009551 Bacteria 4069
222 Ga0105238_10109459 3300009551 Bacteria 2744
223 Ga0105238_10169826 3300009551 Bacteria 2157
224 Ga0105249_10002037 3300009553 Bacteria 17526
225 Ga0105249_10006492 3300009553 Bacteria 10174
226 Ga0105249_10008554 3300009553 Bacteria 8924
227 Ga0105249_10010023 3300009553 Bacteria 8315
228 Ga0105249_10019997 3300009553 Bacteria 5978
229 Ga0105249_10056653 3300009553 Bacteria 3588
230 Ga0105249_10058903 3300009553 Bacteria 3522
231 Ga0105239_10000005 3300010375 Bacteria 496066
232 Ga0105239_10000013 3300010375 Bacteria 327371
233 Ga0105239_10000072 3300010375 Eukaryota 141600
234 Ga0105239_10000081 3300010375 Bacteria 133686
235 Ga0105239_10000259 3300010375 Bacteria 78760
236 Ga0105239_10001040 3300010375 Bacteria 38650
237 Ga0105239_10002120 3300010375 Bacteria 25598
238 Ga0105239_10002563 3300010375 Bacteria 23044
239 Ga0105239_10016008 3300010375 Bacteria 8300
240 Ga0105239_10031256 3300010375 Bacteria 5856
241 Ga0105239_10038296 3300010375 Bacteria 5254
242 Ga0105239_10038468 3300010375 Bacteria 5243
243 Ga0105239_10051224 3300010375 Bacteria 4526
244 Ga0105239_10060044 3300010375 Bacteria 4173
245 Ga0105239_10258127 3300010375 Bacteria 1958
246 Ga0157373_10000597 3300013100 Bacteria 28042
247 Ga0157373_10004754 3300013100 Bacteria 10220
248 Ga0157373_10019227 3300013100 Bacteria 4974
249 Ga0157373_10062478 3300013100 Bacteria 2638
250 Ga0157371_10000724 3300013102 Bacteria 38696
251 Ga0157371_10001349 3300013102 Bacteria 25843
252 Ga0157371_10001703 3300013102 Bacteria 22394
253 Ga0157371_10002487 3300013102 Bacteria 17524
254 Ga0157371_10003887 3300013102 Bacteria 13314
255 Ga0157371_10006631 3300013102 Bacteria 9493
256 Ga0157371_10008420 3300013102 Bacteria 8214
257 Ga0157371_10010626 3300013102 Bacteria 7151
258 Ga0157371_10022883 3300013102 Bacteria 4571
259 Ga0157371_10025530 3300013102 Bacteria 4304
260 Ga0157371_10041765 3300013102 Bacteria 3272
261 Ga0157371_10111945 3300013102 Bacteria 1937
262 Ga0157370_10001989 3300013104 Bacteria 25133
263 Ga0157370_10003763 3300013104 Bacteria 17707
264 Ga0157370_10005319 3300013104 Bacteria 14456
265 Ga0157370_10010139 3300013104 Bacteria 9950
266 Ga0157370_10012521 3300013104 Bacteria 8793
267 Ga0157370_10037184 3300013104 Bacteria 4719
268 Ga0157370_10040253 3300013104 Bacteria 4513
269 Ga0157369_10014216 3300013105 Bacteria 8992
270 Ga0157369_10024325 3300013105 Bacteria 6740
271 Ga0157369_10033374 3300013105 Bacteria 5657
272 Ga0157369_10039532 3300013105 Bacteria 5154
273 Ga0157369_10067870 3300013105 Bacteria 3832
274 Ga0157369_10113581 3300013105 Bacteria 2877
275 Ga0157369_10152866 3300013105 Unclassified 2439
276 Ga0157369_10188032 3300013105 Bacteria 2171
277 Ga0157374_10000723 3300013296 Bacteria 28842
278 Ga0157374_10125412 3300013296 Bacteria 2482
279 Ga0157374_10242437 3300013296 Bacteria 1773
280 Ga0157378_10004726 3300013297 Bacteria 11942
281 Ga0157378_10034883 3300013297 Bacteria 4448
282 Ga0157378_10073585 3300013297 Bacteria 3072
283 Ga0157378_10249580 3300013297 Bacteria 1698
284 Ga0157378_10307648 3300013297 Bacteria 1536
285 Ga0163162_10000066 3300013306 Bacteria 100009
286 Ga0163162_10000164 3300013306 Bacteria 60866
287 Ga0163162_10000373 3300013306 Bacteria 40682
288 Ga0163162_10000697 3300013306 Bacteria 31013
289 Ga0163162_10000856 3300013306 Bacteria 28341
290 Ga0163162_10001561 3300013306 Bacteria 21390
291 Ga0163162_10004336 3300013306 Bacteria 13656
292 Ga0163162_10007340 3300013306 Bacteria 10714
293 Ga0163162_10013198 3300013306 Bacteria 8069
294 Ga0163162_10180640 3300013306 Bacteria 2236
295 Ga0163162_10202005 3300013306 Unclassified 2116
296 Ga0163162_10346582 3300013306 Bacteria 1618
297 Ga0157372_10000676 3300013307 Bacteria 37536
298 Ga0157372_10001143 3300013307 Bacteria 28799
299 Ga0157372_10004620 3300013307 Bacteria 14640
300 Ga0157372_10005956 3300013307 Bacteria 12962
301 Ga0157372_10022840 3300013307 Bacteria 6773
302 Ga0157372_10022931 3300013307 Bacteria 6761
303 Ga0157372_10062402 3300013307 Bacteria 4175
304 Ga0157372_10094460 3300013307 Bacteria 3405
305 Ga0157372_10100848 3300013307 Bacteria 3295
306 Ga0157372_10202863 3300013307 Bacteria 2297
307 Ga0157372_10359662 3300013307 Bacteria 1696
308 Ga0157375_10000383 3300013308 Bacteria 40397
309 Ga0157375_10019253 3300013308 Bacteria 6205
310 Ga0157375_10041242 3300013308 Bacteria 4455
311 Ga0157375_10122099 3300013308 Unclassified 2716
312 Ga0157375_10127950 3300013308 Bacteria 2657
313 Ga0163163_10000560 3300014325 Bacteria 32679
314 Ga0163163_10002931 3300014325 Bacteria 14436
315 Ga0163163_10144484 3300014325 Unclassified 2422
316 Ga0157380_10001590 3300014326 Bacteria 14970
317 Ga0182008_10000010 3300014497 Bacteria 301527
318 Ga0182008_10003765 3300014497 Bacteria 9034
319 Ga0157377_10004008 3300014745 Bacteria 6716
320 Ga0157377_10057473 3300014745 Bacteria 2212
321 Ga0157379_10034273 3300014968 Bacteria 4525
322 Ga0157376_10002437 3300014969 Bacteria 12579
323 Ga0157376_10003607 3300014969 Bacteria 10680
324 Ga0157376_10029923 3300014969 Bacteria 4340
325 Ga0157376_10036441 3300014969 Bacteria 3985
326 Ga0182006_1026019 3300015261 Bacteria 2399
327 Ga0182007_10010906 3300015262 Bacteria 3563
328 Ga0183373_1010 3300015682 Bacteria 196982
329 Ga0163161_10001190 3300017792 Bacteria 19553
330 Ga0163161_10067587 3300017792 Bacteria 2610
331 Ga0206351_10002408 3300020077 Bacteria 2600
332 Ga0206350_10114900 3300020080 Bacteria 1917
333 Ga0154015_1295413 3300020610 Bacteria 2058
334 Ga0209563_103756 3300025230 Bacteria 3056
335 Ga0207427_100785 3300025231 Bacteria 14472
336 Ga0209437_100085 3300025233 Bacteria 254790
337 Ga0209437_100101 3300025233 Bacteria 226668
338 Ga0209646_1001361 3300025246 Bacteria 6739
339 Ga0209026_1000987 3300025250 Bacteria 14160
340 Ga0209026_1001037 3300025250 Bacteria 13605
341 Ga0209233_1000124 3300025261 Bacteria 226743
342 Ga0209455_1004434 3300025272 Bacteria 4600
343 Ga0209676_1000329 3300025292 Bacteria 91571
344 Ga0209050_1008696 3300025298 Bacteria 5357
345 Ga0209050_1024684 3300025298 Bacteria 2070
346 Ga0207426_1000040 3300025302 Bacteria 433920
347 Ga0209257_1000299 3300025304 Bacteria 108881
348 Ga0207656_10025276 3300025321 Bacteria 2409
349 Ga0207710_10002430 3300025900 Bacteria 8659
350 Ga0207680_10000568 3300025903 Bacteria 17460
351 Ga0207647_10030716 3300025904 Bacteria 3463
352 Ga0207645_10000542 3300025907 Bacteria 31431
353 Ga0207645_10000544 3300025907 Bacteria 31399
354 Ga0207645_10124726 3300025907 Bacteria 1673
355 Ga0207705_10000015 3300025909 Bacteria 382901
356 Ga0207705_10002903 3300025909 Bacteria 13109
357 Ga0207705_10007368 3300025909 Bacteria 8088
358 Ga0207705_10036116 3300025909 Bacteria 3536
359 Ga0207705_10151766 3300025909 Bacteria 1736
360 Ga0207654_10002706 3300025911 Bacteria 8996
361 Ga0207654_10038517 3300025911 Bacteria 2683
362 Ga0207654_10038897 3300025911 Bacteria 2672
363 Ga0207707_10002565 3300025912 Bacteria 16286
364 Ga0207707_10072069 3300025912 Bacteria 3011
365 Ga0207695_10000170 3300025913 Bacteria 192469
366 Ga0207695_10000425 3300025913 Bacteria 93523
367 Ga0207695_10000916 3300025913 Bacteria 52837
368 Ga0207695_10011968 3300025913 Bacteria 10442
369 Ga0207695_10016283 3300025913 Bacteria 8709
370 Ga0207695_10070758 3300025913 Bacteria 3564
371 Ga0207695_10086253 3300025913 Bacteria 3167
372 Ga0207695_10114967 3300025913 Bacteria 2666
373 Ga0207695_10238178 3300025913 Bacteria 1722
374 Ga0207671_10000004 3300025914 Bacteria 1022356
375 Ga0207671_10001803 3300025914 Bacteria 23938
376 Ga0207671_10001864 3300025914 Bacteria 23482
377 Ga0207671_10002376 3300025914 Bacteria 20227
378 Ga0207671_10006717 3300025914 Bacteria 10189
379 Ga0207671_10007521 3300025914 Bacteria 9442
380 Ga0207671_10007560 3300025914 Bacteria 9410
381 Ga0207671_10007647 3300025914 Bacteria 9335
382 Ga0207671_10010890 3300025914 Bacteria 7455
383 Ga0207671_10011739 3300025914 Bacteria 7098
384 Ga0207671_10019488 3300025914 Bacteria 5187
385 Ga0207671_10044618 3300025914 Bacteria 3279
386 Ga0207663_10002822 3300025916 Bacteria 8385
387 Ga0207660_10008582 3300025917 Bacteria 6611
388 Ga0207660_10042766 3300025917 Bacteria 3181
389 Ga0207660_10049766 3300025917 Bacteria 2973
390 Ga0207662_10022892 3300025918 Bacteria 3586
391 Ga0207657_10008447 3300025919 Bacteria 10445
392 Ga0207657_10016158 3300025919 Bacteria 7206
393 Ga0207657_10057719 3300025919 Bacteria 3344
394 Ga0207657_10172084 3300025919 Bacteria 1754
395 Ga0207649_10042136 3300025920 Bacteria 2783
396 Ga0207652_10000337 3300025921 Bacteria 48786
397 Ga0207652_10002860 3300025921 Bacteria 14452
398 Ga0207652_10020852 3300025921 Bacteria 5402
399 Ga0207652_10032090 3300025921 Bacteria 4412
400 Ga0207694_10038631 3300025924 Bacteria 3671
401 Ga0207694_10050652 3300025924 Bacteria 3217
402 Ga0207694_10092164 3300025924 Bacteria 2392
403 Ga0207650_10067551 3300025925 Bacteria 2683
404 Ga0207659_10023637 3300025926 Unclassified 4105
405 Ga0207644_10024181 3300025931 Unclassified 4168
406 Ga0207644_10068752 3300025931 Bacteria 2585
407 Ga0207690_10112169 3300025932 Bacteria 1966
408 Ga0207706_10002738 3300025933 Bacteria 17152
409 Ga0207706_10009939 3300025933 Bacteria 8721
410 Ga0207706_10036819 3300025933 Bacteria 4346
411 Ga0207709_10000006 3300025935 Bacteria 800946
412 Ga0207709_10080165 3300025935 Bacteria 2101
413 Ga0207709_10119077 3300025935 Bacteria 1779
414 Ga0207704_10000512 3300025938 Bacteria 17246
415 Ga0207704_10009752 3300025938 Bacteria 4650
416 Ga0207691_10000060 3300025940 Bacteria 86844
417 Ga0207691_10223802 3300025940 Bacteria 1631
418 Ga0207711_10044751 3300025941 Bacteria 3780
419 Ga0207711_10066146 3300025941 Bacteria 3126
420 Ga0207689_10005494 3300025942 Bacteria 11337
421 Ga0207689_10006819 3300025942 Bacteria 10044
422 Ga0207689_10018897 3300025942 Bacteria 5812
423 Ga0207667_10000020 3300025949 Bacteria 374770
424 Ga0207667_10001127 3300025949 Bacteria 33693
425 Ga0207667_10001491 3300025949 Bacteria 29391
426 Ga0207667_10002289 3300025949 Bacteria 24067
427 Ga0207667_10014074 3300025949 Bacteria 9132
428 Ga0207667_10020765 3300025949 Bacteria 7296
429 Ga0207667_10056182 3300025949 Bacteria 4136
430 Ga0207667_10060829 3300025949 Bacteria 3953
431 Ga0207667_10072509 3300025949 Bacteria 3579
432 Ga0207667_10085791 3300025949 Bacteria 3259
433 Ga0207667_10139059 3300025949 Bacteria 2500
434 Ga0207667_10277008 3300025949 Bacteria 1714
435 Ga0207651_10013175 3300025960 Bacteria 4719
436 Ga0207651_10017395 3300025960 Bacteria 4248
437 Ga0207651_10052572 3300025960 Bacteria 2778
438 Ga0207651_10199908 3300025960 Bacteria 1601
439 Ga0207712_10089110 3300025961 Bacteria 2267
440 Ga0207712_10150765 3300025961 Bacteria 1796
441 Ga0207712_10186025 3300025961 Bacteria 1636
442 Ga0207668_10030727 3300025972 Bacteria 3532
443 Ga0207658_10001199 3300025986 Bacteria 20672
444 Ga0207658_10022335 3300025986 Unclassified 4405
445 Ga0207677_10012534 3300026023 Bacteria 4878
446 Ga0207677_10038042 3300026023 Bacteria 3150
447 Ga0207677_10114976 3300026023 Bacteria 2012
448 Ga0207703_10008491 3300026035 Bacteria 8116
449 Ga0207703_10059028 3300026035 Bacteria 3134
450 Ga0207639_10019114 3300026041 Bacteria 4880
451 Ga0207639_10020628 3300026041 Bacteria 4720
452 Ga0207639_10021022 3300026041 Bacteria 4681
453 Ga0207639_10034523 3300026041 Bacteria 3738
454 Ga0207639_10220561 3300026041 Bacteria 1637
455 Ga0207678_10008280 3300026067 Bacteria 9160
456 Ga0207702_10000820 3300026078 Bacteria 32858
457 Ga0207702_10036846 3300026078 Bacteria 4092
458 Ga0207702_10078276 3300026078 Bacteria 2862
459 Ga0207702_10085244 3300026078 Bacteria 2752
460 Ga0207702_10122965 3300026078 Bacteria 2325
461 Ga0207641_10000250 3300026088 Bacteria 68774
462 Ga0207641_10003961 3300026088 Bacteria 12936
463 Ga0207641_10025863 3300026088 Bacteria 4841
464 Ga0207641_10031708 3300026088 Bacteria 4384
465 Ga0207648_10003642 3300026089 Bacteria 16123
466 Ga0207648_10004739 3300026089 Bacteria 13898
467 Ga0207648_10064738 3300026089 Bacteria 3186
468 Ga0207648_10073470 3300026089 Unclassified 2980
469 Ga0207676_10013473 3300026095 Bacteria 5874
470 Ga0207676_10109544 3300026095 Bacteria 2308
471 Ga0207674_10004594 3300026116 Bacteria 16575
472 Ga0207674_10191636 3300026116 Bacteria 1994
473 Ga0207674_10209049 3300026116 Bacteria 1901
474 Ga0207674_10224157 3300026116 Bacteria 1828
475 Ga0207675_100000599 3300026118 Bacteria 35195
476 Ga0207675_100022077 3300026118 Bacteria 5925
477 Ga0207675_100105979 3300026118 Bacteria 2650
478 Ga0207698_10002595 3300026142 Bacteria 10744
479 Ga0207698_10024598 3300026142 Bacteria 4230
480 Ga0207698_10067134 3300026142 Bacteria 2827
481 Ga0207698_10072052 3300026142 Bacteria 2745
482 Ga0207698_10294430 3300026142 Bacteria 1508
483 Ga0207428_10057977 3300027907 Bacteria 3074
484 Ga0268266_10000016 3300028379 Bacteria 629101
485 Ga0268266_10000052 3300028379 Bacteria 296230
486 Ga0268266_10039046 3300028379 Bacteria 4043
487 Ga0268266_10157587 3300028379 Unclassified 2052
488 Ga0268265_10022155 3300028380 Bacteria 4459
489 Ga0268265_10068788 3300028380 Bacteria 2747
490 Ga0268264_10000015 3300028381 Bacteria 508501
491 Ga0268264_10001580 3300028381 Bacteria 21079
492 Ga0268264_10003253 3300028381 Bacteria 14053
493 Ga0268264_10038610 3300028381 Bacteria 3941
494 Ga0265337_1000681 3300028556 Bacteria 17912
495 Ga0265326_10000758 3300028558 Bacteria 11952
496 Ga0265326_10003795 3300028558 Bacteria 4924
497 Ga0265319_1000297 3300028563 Bacteria 36855
498 Ga0265319_1002577 3300028563 Bacteria 9787
499 Ga0265334_10001759 3300028573 Bacteria 10350
500 Ga0265334_10004780 3300028573 Bacteria 5952
501 Ga0265318_10015518 3300028577 Bacteria 3167
502 Ga0265318_10032088 3300028577 Bacteria 2034
503 Ga0265323_10000395 3300028653 Bacteria 25117
504 Ga0265323_10001271 3300028653 Bacteria 12634
505 Ga0265323_10012792 3300028653 Bacteria 3358
506 Ga0265323_10017597 3300028653 Bacteria 2774
507 Ga0265322_10005276 3300028654 Bacteria 3825
508 Ga0265322_10005878 3300028654 Bacteria 3618
509 Ga0265336_10000194 3300028666 Bacteria 42728
510 Ga0265336_10026823 3300028666 Bacteria 1808
511 Ga0307517_10008552 3300028786 Bacteria 14661
512 Ga0307517_10015597 3300028786 Bacteria 10079
513 Ga0307515_10000057 3300028794 Bacteria 261695
514 Ga0307515_10000133 3300028794 Bacteria 176091
515 Ga0307515_10000432 3300028794 Bacteria 100348
516 Ga0307515_10001738 3300028794 Bacteria 48492
517 Ga0265338_10000273 3300028800 Bacteria 94209
518 Ga0265338_10000527 3300028800 Bacteria 67253
519 Ga0265338_10002518 3300028800 Bacteria 27237
520 Ga0265338_10006323 3300028800 Bacteria 15136
521 Ga0265338_10008747 3300028800 Bacteria 12237
522 Ga0265338_10016341 3300028800 Bacteria 8083
523 Ga0265338_10030132 3300028800 Bacteria 5356
524 Ga0265338_10063636 3300028800 Bacteria 3215
525 Ga0265324_10001372 3300029957 Bacteria 14108
526 Ga0265324_10007618 3300029957 Bacteria 4368
527 Ga0316183_1126735 3300030742 Bacteria 6783
528 Ga0316181_1118713 3300030744 Bacteria 3631
529 Ga0265330_10001086 3300031235 Bacteria 16394
530 Ga0265330_10025643 3300031235 Bacteria 2671
531 Ga0265332_10001653 3300031238 Bacteria 12173
532 Ga0265332_10007014 3300031238 Bacteria 5100
533 Ga0265320_10000494 3300031240 Bacteria 30746
534 Ga0265320_10005528 3300031240 Bacteria 8105
535 Ga0265325_10010739 3300031241 Bacteria 5285
536 Ga0265325_10012429 3300031241 Bacteria 4868
537 Ga0265340_10002804 3300031247 Bacteria 9917
538 Ga0265339_10007060 3300031249 Bacteria 7291
539 Ga0265331_10058487 3300031250 Bacteria 1825
540 Ga0265327_10000618 3300031251 Bacteria 58585
541 Ga0265327_10008002 3300031251 Bacteria 7987
542 Ga0265327_10072023 3300031251 Bacteria 1727
543 Ga0265316_10005060 3300031344 Bacteria 12935
544 Ga0265316_10077499 3300031344 Unclassified 2553
545 Ga0307513_10147438 3300031456 Bacteria 2269
546 Ga0307509_10010102 3300031507 Bacteria 11636
547 Ga0307509_10072885 3300031507 Bacteria 3577
548 Ga0307408_100001775 3300031548 Bacteria 15744
549 Ga0265313_10004678 3300031595 Bacteria 10336
550 Ga0265313_10005311 3300031595 Bacteria 9523
551 Ga0265313_10012195 3300031595 Bacteria 5275
552 Ga0310103_105240 3300031614 Eukaryota 1710
553 Ga0265314_10006023 3300031711 Bacteria 10804
554 Ga0265342_10001151 3300031712 Bacteria 25226
555 Ga0265342_10100515 3300031712 Bacteria 1648
556 Ga0316576_10002660 3300031727 Bacteria 10212
557 Ga0316576_10057544 3300031727 Bacteria 2841
558 Ga0316576_10065179 3300031727 Bacteria 2677
559 Ga0316576_10085185 3300031727 Bacteria 2349
560 Ga0316578_10000458 3300031728 Bacteria 13584
561 Ga0316578_10027250 3300031728 Bacteria 3229
562 Ga0316578_10081680 3300031728 Bacteria 1923
563 Ga0307516_10002738 3300031730 Bacteria 23246
564 Ga0307405_10163947 3300031731 Bacteria 1578
565 Ga0316577_10005407 3300031733 Bacteria 6699
566 Ga0316577_10005994 3300031733 Bacteria 6405
567 Ga0307412_10000018 3300031911 Bacteria 284374
568 Ga0307412_10091651 3300031911 Bacteria 2128
569 Ga0307409_100051015 3300031995 Bacteria 3164
570 Ga0307414_10000392 3300032004 Bacteria 23857
571 Ga0307414_10000393 3300032004 Bacteria 23776
572 Ga0307414_10022716 3300032004 Bacteria 3963
573 Ga0307414_10030980 3300032004 Bacteria 3501
574 Ga0307414_10051783 3300032004 Bacteria 2852
575 Ga0307414_10055507 3300032004 Bacteria 2774
576 Ga0307414_10221590 3300032004 Bacteria 1553
577 Ga0307507_10000064 3300033179 Bacteria 161226
578 Ga0307510_10005874 3300033180 Bacteria 14639
579 Ga0307510_10007411 3300033180 Bacteria 13083
580 Ga0373934_0001565 3300035086 Bacteria 8391
581 Ga0373923_0036491 3300035111 Bacteria 2006
582 Ga0373954_0046145 3300035118 Bacteria 2036
583 Ga0373956_0064778 3300035119 Bacteria 1659
584 Ga0373957_0041473 3300035120 Bacteria 1733
585 Ga0316574_0009680 3300035398 Bacteria 5409
586 Ga0316574_0178878 3300035398 Bacteria 1365
587 Ga0373927_0005089 3300035695 Bacteria 9100
588 Ga0373933_0007494 3300035724 Bacteria 5959
589 Ga0373937_0013067 3300036401 Bacteria 7313
590 Ga0310110_009579 3300036535 Eukaryota 1419
591 Ga0316582_0000862 3300036647 Bacteria 12362
592 Ga0316584_0000202 3300036712 Bacteria 29256
593 Ga0316584_0000530 3300036712 Bacteria 20366
594 Ga0316584_0043722 3300036712 Bacteria 3341
595 Ga0373925_0027719 3300037068 Bacteria 4147
596 Ga0395899_0002054 3300037312 Bacteria 16582
597 Ga0395899_0006794 3300037312 Bacteria 8865
598 Ga0395899_0017979 3300037312 Bacteria 5379
599 Ga0395899_0061038 3300037312 Bacteria 2776
600 Ga0395899_0088854 3300037312 Bacteria 2241
601 Ga0395900_0005501 3300037418 Bacteria 13258
602 Ga0395900_0005682 3300037418 Bacteria 13040
603 Ga0395900_0007296 3300037418 Bacteria 11434
604 Ga0395900_0029586 3300037418 Bacteria 5619
605 Ga0395900_0124774 3300037418 Bacteria 2640
606 Ga0395900_0153735 3300037418 Bacteria 2350
607 Ga0395900_0277274 3300037418 Bacteria 1670
608 Ga0395898_0009433 3300037466 Bacteria 10251
609 Ga0395898_0039456 3300037466 Bacteria 4674
610 Ga0395898_0130890 3300037466 Bacteria 2403
611 Ga0395905_0000516 3300037471 Bacteria 52868
612 Ga0395905_0001254 3300037471 Bacteria 31416
613 Ga0395905_0036571 3300037471 Bacteria 4611
614 Ga0395901_0000861 3300038443 Bacteria 33403
615 Ga0395901_0003324 3300038443 Bacteria 16201
616 Ga0395901_0136614 3300038443 Bacteria 2576
617 Ga0395901_0226951 3300038443 Bacteria 1951
618 Ga0400485_16601 3300038735 Bacteria 5179
619 Ga0400483_039122 3300039062 Bacteria 2017
620 Ga0436361_0539750 3300039447 Bacteria 15869
621 Ga0439439_0028272 3300041406 Bacteria 1419
622 Ga0451853_2051003 3300041512 Bacteria 2181
623 Ga0450898_003736 3300042134 Bacteria 2204
624 Ga0451577_0000072 3300042876 Bacteria 237934
625 Ga0451577_0000202 3300042876 Bacteria 124050
626 Ga0451577_0000217 3300042876 Bacteria 119582
627 Ga0451577_0000364 3300042876 Bacteria 84063
628 Ga0451577_0000509 3300042876 Bacteria 65250
629 Ga0451577_0000954 3300042876 Bacteria 42396
630 Ga0451577_0002430 3300042876 Bacteria 22208
631 Ga0451577_0012393 3300042876 Bacteria 8008
632 Ga0451577_0018198 3300042876 Bacteria 6474
633 Ga0451577_0060152 3300042876 Bacteria 3387
634 Ga0451577_0069804 3300042876 Bacteria 3134
635 Ga0451577_0076157 3300042876 Bacteria 2992
636 Ga0451577_0085788 3300042876 Bacteria 2809
637 Ga0451577_0097992 3300042876 Bacteria 2619
638 Ga0451577_0128676 3300042876 Unclassified 2271
639 Ga0451577_0137791 3300042876 Bacteria 2192
640 Ga0451577_0151581 3300042876 Unclassified 2086
641 Ga0451577_0345532 3300042876 Bacteria 1350
642 Ga0466972_0000205 3300044658 Bacteria 43008
643 Ga0466972_0000946 3300044658 Bacteria 13963
644 Ga0453683_0000139 3300044673 Bacteria 105329
645 Ga0453683_0000178 3300044673 Bacteria 88310
646 Ga0453683_0000476 3300044673 Bacteria 46055
647 Ga0453683_0000625 3300044673 Bacteria 38567
648 Ga0453683_0001467 3300044673 Bacteria 20284
649 Ga0453683_0003005 3300044673 Bacteria 12626
650 Ga0453683_0005318 3300044673 Bacteria 8996
651 Ga0453683_0010590 3300044673 Bacteria 6106
652 Ga0453683_0010664 3300044673 Bacteria 6085
653 Ga0453683_0017963 3300044673 Bacteria 4543
654 Ga0453683_0029661 3300044673 Bacteria 3458
655 Ga0453683_0040902 3300044673 Bacteria 2910
656 Ga0453683_0099936 3300044673 Bacteria 1821
657 Ga0453684_0000004 3300044712 Bacteria 1469893
658 Ga0453684_0000081 3300044712 Bacteria 402985
659 Ga0453684_0000086 3300044712 Bacteria 397278
660 Ga0453684_0000186 3300044712 Bacteria 273302
661 Ga0453684_0000337 3300044712 Bacteria 195296
662 Ga0453684_0000393 3300044712 Bacteria 179711
663 Ga0453684_0000608 3300044712 Bacteria 131904
664 Ga0453684_0000630 3300044712 Bacteria 128059
665 Ga0453684_0001006 3300044712 Bacteria 91343
666 Ga0453684_0001244 3300044712 Bacteria 77266
667 Ga0453684_0001377 3300044712 Bacteria 70373
668 Ga0453684_0002144 3300044712 Bacteria 49481
669 Ga0453684_0004157 3300044712 Bacteria 31323
670 Ga0453684_0004417 3300044712 Bacteria 29726
671 Ga0453684_0005203 3300044712 Bacteria 26128
672 Ga0453684_0005297 3300044712 Bacteria 25730
673 Ga0453684_0006234 3300044712 Bacteria 22857
674 Ga0453684_0007491 3300044712 Bacteria 20033
675 Ga0453684_0009673 3300044712 Bacteria 16788
676 Ga0453684_0013156 3300044712 Bacteria 13492
677 Ga0453684_0013250 3300044712 Bacteria 13430
678 Ga0453684_0017180 3300044712 Bacteria 11238
679 Ga0453684_0018143 3300044712 Bacteria 10831
680 Ga0453684_0019610 3300044712 Bacteria 10277
681 Ga0453684_0022403 3300044712 Bacteria 9373
682 Ga0453684_0026462 3300044712 Bacteria 8375
683 Ga0453684_0030202 3300044712 Bacteria 7663
684 Ga0453684_0030327 3300044712 Bacteria 7643
685 Ga0453684_0030674 3300044712 Bacteria 7586
686 Ga0453684_0041170 3300044712 Bacteria 6255
687 Ga0453684_0045474 3300044712 Bacteria 5856
688 Ga0453684_0058981 3300044712 Bacteria 4953
689 Ga0453684_0059245 3300044712 Bacteria 4939
690 Ga0453684_0067008 3300044712 Bacteria 4568
691 Ga0453684_0077277 3300044712 Unclassified 4175
692 Ga0453684_0096362 3300044712 Bacteria 3635
693 Ga0453684_0120378 3300044712 Bacteria 3171
694 Ga0453684_0139207 3300044712 Bacteria 2901
695 Ga0453684_0186360 3300044712 Bacteria 2431
696 Ga0453684_0255106 3300044712 Bacteria 2012
697 Ga0453684_0289366 3300044712 Bacteria 1866
698 Ga0453684_0301019 3300044712 Bacteria 1823
699 Ga0466968_0016433 3300044735 Bacteria 2947
700 Ga0466970_0000529 3300044765 Bacteria 18707
701 Ga0466957_0001121 3300044842 Bacteria 13866
702 Ga0451576_0000065 3300045051 Bacteria 274445
703 Ga0451576_0000083 3300045051 Bacteria 236908
704 Ga0451576_0000145 3300045051 Bacteria 179711
705 Ga0451576_0000294 3300045051 Bacteria 122276
706 Ga0451576_0000683 3300045051 Bacteria 69004
707 Ga0451576_0000729 3300045051 Bacteria 66020
708 Ga0451576_0001394 3300045051 Bacteria 41542
709 Ga0451576_0007238 3300045051 Bacteria 13361
710 Ga0451576_0009193 3300045051 Bacteria 11482
711 Ga0451576_0011975 3300045051 Bacteria 9798
712 Ga0451576_0051793 3300045051 Bacteria 4303
713 Ga0451576_0069951 3300045051 Bacteria 3653
714 Ga0451576_0080236 3300045051 Bacteria 3395
715 Ga0451576_0115641 3300045051 Bacteria 2792
716 Ga0451576_0322578 3300045051 Bacteria 1616
717 Ga0466967_0208069 3300045976 Bacteria 1855
718 Ga0495638_0000001 3300046460 Bacteria 1114121
719 Ga0495638_0028055 3300046460 Bacteria 3638
720 Ga0495651_0052900 3300046462 Bacteria 3127
721 Ga0495651_0098879 3300046462 Bacteria 2176
722 Ga0495653_0266227 3300046463 Bacteria 1131
723 Ga0495650_0000003 3300046471 Bacteria 900730
724 Ga0495580_0010183 3300046472 Bacteria 7339
725 Ga0495580_0016439 3300046472 Bacteria 5552
726 Ga0495585_0000085 3300046492 Bacteria 97836
727 Ga0495585_0001006 3300046492 Bacteria 23544
728 Ga0495606_0000002 3300046507 Bacteria 554637
729 Ga0495606_0005474 3300046507 Bacteria 12155
730 Ga0495606_0016294 3300046507 Bacteria 5675
731 Ga0495608_0050979 3300046511 Bacteria 2744
732 Ga0495610_0023746 3300046512 Bacteria 3324
733 Ga0495616_0005113 3300046513 Bacteria 8150
734 Ga0495616_0006849 3300046513 Bacteria 6865
735 Ga0495628_0004159 3300046516 Bacteria 12878
736 Ga0495631_0008059 3300046518 Bacteria 5324
737 Ga0495648_0002775 3300046524 Bacteria 15798
738 Ga0495652_0188421 3300046529 Bacteria 1577
739 Ga0495587_0052965 3300046536 Bacteria 2393
740 Ga0495609_0033790 3300046538 Bacteria 2320
741 Ga0495633_0000014 3300046558 Bacteria 261742
742 Ga0495633_0089582 3300046558 Bacteria 1430
743 Ga0495667_0077050 3300046559 Bacteria 2169
744 Ga0495668_0000003 3300046616 Bacteria 695023
745 Ga0495668_0001784 3300046616 Bacteria 19658
746 Ga0495611_0000179 3300046648 Bacteria 45869
747 Ga0495625_0000005 3300046660 Bacteria 596135
748 Ga0495625_0000471 3300046660 Bacteria 60628
749 Ga0495625_0001258 3300046660 Bacteria 31973
750 Ga0495625_0010947 3300046660 Bacteria 7446
751 Ga0495625_0017844 3300046660 Bacteria 5546
752 Ga0495661_0054825 3300046665 Bacteria 2392
753 Ga0495661_0088277 3300046665 Bacteria 1770
754 Ga0495657_0078202 3300046675 Bacteria 2144
755 Ga0495599_0077856 3300046678 Bacteria 2070
756 Ga0495647_0037234 3300046681 Bacteria 1835
757 Ga0495658_0141371 3300046683 Bacteria 1472
758 Ga0495613_0097663 3300046689 Bacteria 2123
759 Ga0495649_0000003 3300046694 Bacteria 880817
760 Ga0495660_0007560 3300046810 Bacteria 6380
761 Ga0495672_0033988 3300047320 Bacteria 3155
762 Ga0495683_0028303 3300047323 Bacteria 2865
763 Ga0495687_000004 3300047443 Bacteria 779298
764 Ga0495687_000544 3300047443 Bacteria 45065
765 Ga0495687_000762 3300047443 Bacteria 34827
766 Ga0495675_0010457 3300047444 Bacteria 5799
767 Ga0495686_0000004 3300047472 Bacteria 869019
768 Ga0495686_0003602 3300047472 Bacteria 13287
769 Ga0495686_0051650 3300047472 Bacteria 2579
770 Ga0495686_0132507 3300047472 Bacteria 1476
771 Ga0496101_0012235 3300048904 Bacteria 5721
772 Ga0496102_0176702 3300048905 Unclassified 2011
773 Ga0496104_0261118 3300048907 Bacteria 1645
774 Ga0496109_0083335 3300048912 Bacteria 2949
775 Ga0496116_0004290 3300048919 Bacteria 13667
776 Ga0496117_0008979 3300048920 Bacteria 9407
777 Ga0496122_0000789 3300048925 Bacteria 60958
778 Ga0496122_0006722 3300048925 Bacteria 13087
779 Ga0496123_0006610 3300048926 Bacteria 11199
780 Ga0496123_0013257 3300048926 Bacteria 6943
781 Ga0496124_0042623 3300048927 Bacteria 3907
782 Ga0501323_000726 3300049539 Bacteria 2601
783 Ga0501031_0017014 3300049568 Bacteria 4723
784 Ga0501032_0000789 3300049569 Bacteria 25632
785 Ga0501032_0103951 3300049569 Bacteria 1882
786 Ga0501033_0125458 3300049570 Bacteria 1862
787 Ga0501034_0006168 3300049571 Bacteria 12923
788 Ga0501034_0041867 3300049571 Bacteria 4634
789 Ga0501034_0109443 3300049571 Bacteria 2754
790 Ga0501036_0001149 3300049572 Bacteria 20161
791 Ga0501036_0004247 3300049572 Bacteria 11553
792 Ga0501037_0027852 3300049573 Bacteria 4175
793 Ga0501038_0101201 3300049574 Bacteria 2399
794 Ga0501039_0025685 3300049575 Bacteria 4527
795 Ga0501041_0014564 3300049577 Bacteria 4669
796 Ga0501042_0003714 3300049578 Bacteria 9642
797 Ga0501043_0013354 3300049579 Bacteria 6422
798 Ga0501043_0055797 3300049579 Bacteria 3104
799 Ga0501046_0002549 3300049580 Bacteria 17045
800 Ga0501046_0012945 3300049580 Bacteria 7088
801 Ga0501047_0003691 3300049581 Bacteria 14416
802 Ga0501048_0003076 3300049582 Bacteria 12717
803 Ga0501068_0013864 3300049584 Bacteria 4595
804 Ga0501068_0075269 3300049584 Bacteria 2065
805 Ga0501069_0011303 3300049585 Bacteria 4734
806 Ga0501070_0006716 3300049586 Bacteria 9798
807 Ga0501070_0119081 3300049586 Bacteria 2182
808 Ga0501070_0225193 3300049586 Bacteria 1537
809 Ga0501071_0022656 3300049587 Bacteria 4381
810 Ga0501072_0002595 3300049588 Bacteria 13546
811 Ga0501073_0002127 3300049589 Bacteria 14843
812 Ga0501073_0046449 3300049589 Bacteria 3054
813 Ga0501074_0000268 3300049590 Bacteria 29703
814 Ga0501074_0071210 3300049590 Bacteria 2499
815 Ga0501075_0052536 3300049591 Bacteria 3064
816 Ga0501217_005267 3300049661 Bacteria 2699
817 Ga0501223_000517 3300049663 Bacteria 9302
818 Ga0501236_000066 3300049670 Bacteria 9409
819 Ga0501238_006873 3300049671 Bacteria 1471
820 Ga0501243_008676 3300049675 Bacteria 1571
821 Ga0501225_0044910 3300049705 Bacteria 1223
822 Ga0501079_0005838 3300049741 Bacteria 9206
823 Ga0501080_0009651 3300049742 Bacteria 8812
824 Ga0501080_0082493 3300049742 Bacteria 2986
825 Ga0501080_0290176 3300049742 Bacteria 1485
826 Ga0501081_0001456 3300049743 Bacteria 14500
827 Ga0501081_0096995 3300049743 Bacteria 2080
828 Ga0501083_0002364 3300049744 Bacteria 12916
829 Ga0501083_0045344 3300049744 Bacteria 2975
830 Ga0501035_0006540 3300049822 Bacteria 10934
831 Ga0501035_0063517 3300049822 Bacteria 3284
832 Ga0501044_0008384 3300049823 Bacteria 11335
833 Ga0501044_0130700 3300049823 Bacteria 2505
834 Ga0501045_0033653 3300049824 Bacteria 3716
835 nmdc:mga0k408_33017_c1 3300050493 Bacteria 2958
836 nmdc:mga0k408_6399_c1 3300050493 Bacteria 6283
837 nmdc:mga05p37_20368_c1 3300050507 Bacteria 8025
838 nmdc:mga09592_92181_c1 3300050508 Bacteria 2590
839 nmdc:mga06r32_49377_c1 3300050510 Bacteria 4023
840 nmdc:mga08y16_141376_c1 3300050511 Bacteria 2502
841 nmdc:mga08y16_254478_c1 3300050511 Bacteria 1814
842 nmdc:mga08y16_3286_c1 3300050511 Bacteria 16755
843 nmdc:mga08y16_5732_c1 3300050511 Bacteria 13017
844 nmdc:mga08y16_60600_c1 3300050511 Bacteria 3952
845 Ga0500583_0000077 3300053092 Bacteria 58479
846 Ga0500583_0005181 3300053092 Bacteria 4340
847 Ga0500641_0059014 3300053096 Bacteria 1594
848 Ga0500562_002684 3300053108 Bacteria 4426
849 Ga0500608_001113 3300053122 Bacteria 9583
850 Ga0500614_012003 3300053123 Bacteria 1884
851 Ga0500618_000666 3300053125 Bacteria 20264
852 Ga0500618_008890 3300053125 Bacteria 2771
853 Ga0500559_0055216 3300053136 Bacteria 1761
854 Ga0500568_0000641 3300053139 Bacteria 25249
855 Ga0500616_0000009 3300053153 Bacteria 779095
856 Ga0500616_0007510 3300053153 Bacteria 6905
857 Ga0500622_0000009 3300053156 Bacteria 419980
858 Ga0500622_0000096 3300053156 Bacteria 90621
859 Ga0500622_0002927 3300053156 Bacteria 11867
860 Ga0500622_0003314 3300053156 Bacteria 10885
861 Ga0500622_0012934 3300053156 Bacteria 4508
862 Ga0500624_000970 3300053157 Bacteria 5869
863 Ga0500627_0036267 3300053158 Bacteria 2099
864 Ga0500611_000020 3300053727 Bacteria 105250
865 Ga0501084_0121959 3300054114 Bacteria 2192
866 Ga0501082_0002189 3300060353 Bacteria 17109
867 Ga0501082_0079639 3300060353 Bacteria 2826
868 Ga0530510_0003636 3300061734 Bacteria 10612
869 Ga0530510_0058992 3300061734 Bacteria 2775
870 2522551106 2522125168 Bacteria 7376607
871 2599477954 2599185184 Bacteria 6430550
872 2617917579 2617270889 Bacteria 9064343
873 2643948034 2643221587 Bacteria 7586415
874 2644390541 2643221670 Bacteria 6497041
875 2644433900 2643221677 Bacteria 7584031
876 2722729183 2721755487 Bacteria 6357185
877 2738698353 2738541273 Bacteria 4048577
878 2738731240 2738541278 Bacteria 9755573
879 2738756567 2738541283 Bacteria 7222293
880 2738760849 2738541284 Bacteria 5199923
881 2739252679 2738543014 Bacteria 4048139
882 2739304006 2738543023 Bacteria 6767879
883 2740031596 2739367866 Bacteria 4215900
884 2819587334 2818991444 Bacteria 6968812
885 2839992282 2839989709 Bacteria 3773432
886 2842906595 2842903701 Bacteria 6986368
887 2852623668 2852623160 Bacteria 4376875
888 2852627338 2852627209 Bacteria 5896285
889 2884937428 2884933994 Bacteria 4535041
890 2890738095 2890737413 Bacteria 4269751
891 2891633668 2891633521 Bacteria 4602265
892 2896318001 2896317667 Bacteria 4606601
893 2896345476 2896344016 Bacteria 3811746
894 2898715848 2898713307 Bacteria 4110805
895 2904780905 2904780799 Bacteria 5840761
896 2913846074 2913844669 Bacteria 8381711
897 2913941070 2913939268 Bacteria 8559644
898 2918504964 2918501144 Bacteria 8668083
899 2919180631 2919177583 Bacteria 5641607
900 2919187371 2919186247 Bacteria 6244071
901 2919441095 2919437846 Bacteria 6199444
902 2919693343 2919692658 Bacteria 5943958
903 2928079915 2928078545 Bacteria 6534839
904 2928147630 2928147474 Bacteria 6512076
905 2932088484 2932082852 Bacteria 6563563
906 2939665362 2939664404 Bacteria 6364494
907 2977236133 2977232053 Bacteria 5485925
908 3003235980 3003233435 Bacteria 4458031
909 642605327 642555144 Bacteria 9059191
910 8055589469 8055588893 Bacteria 3619545
911 8056440302 8056440228 Bacteria 4946504
912 Ga0500583_0000164
913 SwRhRL2b_contig_308077
914 MBSR1b_contig_6741876
915 JGI24737J22298_10000733
916 JGI24735J21928_10000014
917 JGI25162J39368_1000020
918 JGI25162J39368_1001888
919 JGI25164J39214_1002648
920 JGI25165J46597_1000898
921 rootH1_10001098
922 rootH2_10002858
923 rootH2_10035181
924 rootL2_10163790
925 rootH1_10003699
926 rootH1_10017423
927 rootH1_10126862
928 JGI25160J50197_1003564
929 Ga0055536_1013049
930 Ga0065165_1000169
931 Ga0065165_1001340
932 Ga0065714_10002361
933 Ga0065714_10002919
934 Ga0065704_10000238
935 Ga0065704_10001141
936 Ga0065712_10001455
937 Ga0070658_10000011
938 Ga0070658_10037328
939 Ga0070658_10073847
940 Ga0070658_10088639
941 Ga0070676_10001211
942 Ga0070676_10002877
943 Ga0070683_100018837
944 Ga0070683_100159915
945 Ga0070670_100027222
946 Ga0070670_100038903
947 Ga0070670_100063646
948 Ga0070670_100078187
949 Ga0070670_100147645
950 Ga0068869_100016541
951 Ga0068869_100031202
952 Ga0068869_100038954
953 Ga0070666_10001123
954 Ga0070666_10006658
955 Ga0070680_100005777
956 Ga0070680_100041291
957 Ga0070680_100059914
958 Ga0070680_100068002
959 Ga0070680_100131695
960 Ga0070682_100003177
961 Ga0068868_100014216
962 Ga0068868_100136348
963 Ga0070660_100029365
964 Ga0070660_100052356
965 Ga0070660_100086977
966 Ga0070660_100123237
967 Ga0070691_10000930
968 Ga0070687_100030867
969 Ga0070687_100052188
970 Ga0070661_100018952
971 Ga0070692_10103083
972 Ga0070668_100004450
973 Ga0070669_100008200
974 Ga0070675_100007148
975 Ga0070675_100012647
976 Ga0070671_100094133
977 Ga0070671_100122779
978 Ga0070673_100001702
979 Ga0070673_100003548
980 Ga0070673_100029933
981 Ga0070673_100040799
982 Ga0070673_100117815
983 Ga0070688_100005858
984 Ga0070659_100021644
985 Ga0070659_100026196
986 Ga0070659_100042229
987 Ga0070659_100046953
988 Ga0070659_100247454
989 Ga0070667_100024412
990 Ga0070667_100077159
991 Ga0070667_100222451
992 Ga0070663_100028577
993 Ga0070663_100144121
994 Ga0070678_100007368
995 Ga0070662_100004667
996 Ga0070681_10142682
997 Ga0070681_10261627
998 Ga0068867_100006003
999 Ga0068867_100016922
1000 Ga0068867_100028131
1001 Ga0070679_100001254
1002 Ga0070679_100010318
1003 Ga0070679_100015447
1004 Ga0070679_100199057
1005 Ga0070684_100104674
1006 Ga0070684_100119774
1007 Ga0070684_100217623
1008 Ga0068853_100016543
1009 Ga0068853_100024401
1010 Ga0068853_100068924
1011 Ga0070672_100022405
1012 Ga0070695_100112949
1013 Ga0070665_100000003
1014 Ga0070665_100000008
1015 Ga0068855_100000727
1016 Ga0068855_100000998
1017 Ga0068855_100002579
1018 Ga0068855_100010877
1019 Ga0068855_100056698
1020 Ga0068855_100094815
1021 Ga0068855_100144948
1022 Ga0068855_100180723
1023 Ga0068855_100242163
1024 Ga0068855_100378740
1025 Ga0068857_100004830
1026 Ga0068854_100031522
1027 Ga0068856_100000259
1028 Ga0068856_100003419
1029 Ga0068856_100012928
1030 Ga0068856_100110022
1031 Ga0068852_100003639
1032 Ga0068852_100005665
1033 Ga0068852_100008807
1034 Ga0068852_100024969
1035 Ga0068852_100025420
1036 Ga0068852_100068319
1037 Ga0068852_100077757
1038 Ga0068859_100000023
1039 Ga0068859_100010680
1040 Ga0068859_100020142
1041 Ga0068859_100318554
1042 Ga0068864_100000733
1043 Ga0068864_100009349
1044 Ga0068864_100043103
1045 Ga0068866_10003738
1046 Ga0068861_100040252
1047 Ga0068861_100099963
1048 Ga0068861_100189055
1049 Ga0068851_10022987
1050 Ga0068863_100027572
1051 Ga0068863_100028175
1052 Ga0068858_100003125
1053 Ga0068858_100003981
1054 Ga0068858_100098620
1055 Ga0068858_100146325
1056 Ga0068860_100000059
1057 Ga0068860_100001384
1058 Ga0068860_100024605
1059 Ga0068860_100040343
1060 Ga0068862_100004782
1061 Ga0068862_100027564
1062 Ga0068862_100213640
1063 Ga0075366_10007290
1064 Ga0075366_10032558
1065 Ga0097621_100000020
1066 Ga0097621_100000487
1067 Ga0097621_100051390
1068 Ga0097621_100064504
1069 Ga0097621_100088581
1070 Ga0097621_100115725
1071 Ga0097621_100267105
1072 Ga0068871_100000416
1073 Ga0068871_100000598
1074 Ga0068871_100013343
1075 Ga0068871_100021887
1076 Ga0068871_100027178
1077 Ga0075431_100057971
1078 Ga0075429_100049891
1079 Ga0068865_100000208
1080 Ga0068865_100004850
1081 Ga0068865_100011685
1082 Ga0097620_100000023
1083 Ga0097620_100010683
1084 Ga0097620_100020142
1085 Ga0097620_100318566
1086 Ga0105240_10000767
1087 Ga0105240_10001584
1088 Ga0105240_10007530
1089 Ga0105240_10031042
1090 Ga0105240_10049859
1091 Ga0105240_10095335
1092 Ga0105240_10102281
1093 Ga0105240_10119990
1094 Ga0105240_10171848
1095 Ga0111539_10006433
1096 Ga0111539_10011432
1097 Ga0111539_10295731
1098 Ga0105245_10050473
1099 Ga0105247_10008227
1100 Ga0105247_10009048
1101 Ga0114129_10174564
1102 Ga0105243_10000012
1103 Ga0105243_10031803
1104 Ga0105243_10074134
1105 Ga0105243_10159239
1106 Ga0105241_10000861
1107 Ga0105241_10002514
1108 Ga0105241_10018003
1109 Ga0105241_10043565
1110 Ga0105241_10096885
1111 Ga0105241_10189405
1112 Ga0105242_10059690
1113 Ga0105242_10067351
1114 Ga0105248_10013691
1115 Ga0105248_10040274
1116 Ga0105237_10000044
1117 Ga0105237_10000356
1118 Ga0105237_10000971
1119 Ga0105237_10001449
1120 Ga0105237_10001750
1121 Ga0105237_10001907
1122 Ga0105237_10004465
1123 Ga0105237_10006762
1124 Ga0105237_10006763
1125 Ga0105237_10007600
1126 Ga0105237_10007857
1127 Ga0105237_10027387
1128 Ga0105237_10079069
1129 Ga0105237_10123090
1130 Ga0105237_10135189
1131 Ga0105238_10013311
1132 Ga0105238_10053188
1133 Ga0105238_10109459
1134 Ga0105238_10169826
1135 Ga0105249_10002037
1136 Ga0105249_10006492
1137 Ga0105249_10008554
1138 Ga0105249_10010023
1139 Ga0105249_10019997
1140 Ga0105249_10056653
1141 Ga0105249_10058903
1142 Ga0105239_10000005
1143 Ga0105239_10000013
1144 Ga0105239_10000072
1145 Ga0105239_10000081
1146 Ga0105239_10000259
1147 Ga0105239_10001040
1148 Ga0105239_10002120
1149 Ga0105239_10002563
1150 Ga0105239_10016008
1151 Ga0105239_10031256
1152 Ga0105239_10038296
1153 Ga0105239_10038468
1154 Ga0105239_10051224
1155 Ga0105239_10060044
1156 Ga0105239_10258127
1157 Ga0157373_10000597
1158 Ga0157373_10004754
1159 Ga0157373_10019227
1160 Ga0157373_10062478
1161 Ga0157371_10000724
1162 Ga0157371_10001349
1163 Ga0157371_10001703
1164 Ga0157371_10002487
1165 Ga0157371_10003887
1166 Ga0157371_10006631
1167 Ga0157371_10008420
1168 Ga0157371_10010626
1169 Ga0157371_10022883
1170 Ga0157371_10025530
1171 Ga0157371_10041765
1172 Ga0157371_10111945
1173 Ga0157370_10001989
1174 Ga0157370_10003763
1175 Ga0157370_10005319
1176 Ga0157370_10010139
1177 Ga0157370_10012521
1178 Ga0157370_10037184
1179 Ga0157370_10040253
1180 Ga0157369_10014216
1181 Ga0157369_10024325
1182 Ga0157369_10033374
1183 Ga0157369_10039532
1184 Ga0157369_10067870
1185 Ga0157369_10113581
1186 Ga0157369_10152866
1187 Ga0157369_10188032
1188 Ga0157374_10000723
1189 Ga0157374_10125412
1190 Ga0157374_10242437
1191 Ga0157378_10004726
1192 Ga0157378_10034883
1193 Ga0157378_10073585
1194 Ga0157378_10249580
1195 Ga0157378_10307648
1196 Ga0163162_10000066
1197 Ga0163162_10000164
1198 Ga0163162_10000373
1199 Ga0163162_10000697
1200 Ga0163162_10000856
1201 Ga0163162_10001561
1202 Ga0163162_10004336
1203 Ga0163162_10007340
1204 Ga0163162_10013198
1205 Ga0163162_10180640
1206 Ga0163162_10202005
1207 Ga0163162_10346582
1208 Ga0157372_10000676
1209 Ga0157372_10001143
1210 Ga0157372_10004620
1211 Ga0157372_10005956
1212 Ga0157372_10022840
1213 Ga0157372_10022931
1214 Ga0157372_10062402
1215 Ga0157372_10094460
1216 Ga0157372_10100848
1217 Ga0157372_10202863
1218 Ga0157372_10359662
1219 Ga0157375_10000383
1220 Ga0157375_10019253
1221 Ga0157375_10041242
1222 Ga0157375_10122099
1223 Ga0157375_10127950
1224 Ga0163163_10000560
1225 Ga0163163_10002931
1226 Ga0163163_10144484
1227 Ga0157380_10001590
1228 Ga0182008_10000010
1229 Ga0182008_10003765
1230 Ga0157377_10004008
1231 Ga0157377_10057473
1232 Ga0157379_10034273
1233 Ga0157376_10002437
1234 Ga0157376_10003607
1235 Ga0157376_10029923
1236 Ga0157376_10036441
1237 Ga0182006_1026019
1238 Ga0182007_10010906
1239 Ga0183373_1010
1240 Ga0163161_10001190
1241 Ga0163161_10067587
1242 Ga0206351_10002408
1243 Ga0206350_10114900
1244 Ga0154015_1295413
1245 Ga0209563_103756
1246 Ga0207427_100785
1247 Ga0209437_100085
1248 Ga0209437_100101
1249 Ga0209646_1001361
1250 Ga0209026_1000987
1251 Ga0209026_1001037
1252 Ga0209233_1000124
1253 Ga0209455_1004434
1254 Ga0209676_1000329
1255 Ga0209050_1008696
1256 Ga0209050_1024684
1257 Ga0207426_1000040
1258 Ga0209257_1000299
1259 Ga0207656_10025276
1260 Ga0207710_10002430
1261 Ga0207680_10000568
1262 Ga0207647_10030716
1263 Ga0207645_10000542
1264 Ga0207645_10000544
1265 Ga0207645_10124726
1266 Ga0207705_10000015
1267 Ga0207705_10002903
1268 Ga0207705_10007368
1269 Ga0207705_10036116
1270 Ga0207705_10151766
1271 Ga0207654_10002706
1272 Ga0207654_10038517
1273 Ga0207654_10038897
1274 Ga0207707_10002565
1275 Ga0207707_10072069
1276 Ga0207695_10000170
1277 Ga0207695_10000425
1278 Ga0207695_10000916
1279 Ga0207695_10011968
1280 Ga0207695_10016283
1281 Ga0207695_10070758
1282 Ga0207695_10086253
1283 Ga0207695_10114967
1284 Ga0207695_10238178
1285 Ga0207671_10000004
1286 Ga0207671_10001803
1287 Ga0207671_10001864
1288 Ga0207671_10002376
1289 Ga0207671_10006717
1290 Ga0207671_10007521
1291 Ga0207671_10007560
1292 Ga0207671_10007647
1293 Ga0207671_10010890
1294 Ga0207671_10011739
1295 Ga0207671_10019488
1296 Ga0207671_10044618
1297 Ga0207663_10002822
1298 Ga0207660_10008582
1299 Ga0207660_10042766
1300 Ga0207660_10049766
1301 Ga0207662_10022892
1302 Ga0207657_10008447
1303 Ga0207657_10016158
1304 Ga0207657_10057719
1305 Ga0207657_10172084
1306 Ga0207649_10042136
1307 Ga0207652_10000337
1308 Ga0207652_10002860
1309 Ga0207652_10020852
1310 Ga0207652_10032090
1311 Ga0207694_10038631
1312 Ga0207694_10050652
1313 Ga0207694_10092164
1314 Ga0207650_10067551
1315 Ga0207659_10023637
1316 Ga0207644_10024181
1317 Ga0207644_10068752
1318 Ga0207690_10112169
1319 Ga0207706_10002738
1320 Ga0207706_10009939
1321 Ga0207706_10036819
1322 Ga0207709_10000006
1323 Ga0207709_10080165
1324 Ga0207709_10119077
1325 Ga0207704_10000512
1326 Ga0207704_10009752
1327 Ga0207691_10000060
1328 Ga0207691_10223802
1329 Ga0207711_10044751
1330 Ga0207711_10066146
1331 Ga0207689_10005494
1332 Ga0207689_10006819
1333 Ga0207689_10018897
1334 Ga0207667_10000020
1335 Ga0207667_10001127
1336 Ga0207667_10001491
1337 Ga0207667_10002289
1338 Ga0207667_10014074
1339 Ga0207667_10020765
1340 Ga0207667_10056182
1341 Ga0207667_10060829
1342 Ga0207667_10072509
1343 Ga0207667_10085791
1344 Ga0207667_10139059
1345 Ga0207667_10277008
1346 Ga0207651_10013175
1347 Ga0207651_10017395
1348 Ga0207651_10052572
1349 Ga0207651_10199908
1350 Ga0207712_10089110
1351 Ga0207712_10150765
1352 Ga0207712_10186025
1353 Ga0207668_10030727
1354 Ga0207658_10001199
1355 Ga0207658_10022335
1356 Ga0207677_10012534
1357 Ga0207677_10038042
1358 Ga0207677_10114976
1359 Ga0207703_10008491
1360 Ga0207703_10059028
1361 Ga0207639_10019114
1362 Ga0207639_10020628
1363 Ga0207639_10021022
1364 Ga0207639_10034523
1365 Ga0207639_10220561
1366 Ga0207678_10008280
1367 Ga0207702_10000820
1368 Ga0207702_10036846
1369 Ga0207702_10078276
1370 Ga0207702_10085244
1371 Ga0207702_10122965
1372 Ga0207641_10000250
1373 Ga0207641_10003961
1374 Ga0207641_10025863
1375 Ga0207641_10031708
1376 Ga0207648_10003642
1377 Ga0207648_10004739
1378 Ga0207648_10064738
1379 Ga0207648_10073470
1380 Ga0207676_10013473
1381 Ga0207676_10109544
1382 Ga0207674_10004594
1383 Ga0207674_10191636
1384 Ga0207674_10209049
1385 Ga0207674_10224157
1386 Ga0207675_100000599
1387 Ga0207675_100022077
1388 Ga0207675_100105979
1389 Ga0207698_10002595
1390 Ga0207698_10024598
1391 Ga0207698_10067134
1392 Ga0207698_10072052
1393 Ga0207698_10294430
1394 Ga0207428_10057977
1395 Ga0268266_10000016
1396 Ga0268266_10000052
1397 Ga0268266_10039046
1398 Ga0268266_10157587
1399 Ga0268265_10022155
1400 Ga0268265_10068788
1401 Ga0268264_10000015
1402 Ga0268264_10001580
1403 Ga0268264_10003253
1404 Ga0268264_10038610
1405 Ga0265337_1000681
1406 Ga0265326_10000758
1407 Ga0265326_10003795
1408 Ga0265319_1000297
1409 Ga0265319_1002577
1410 Ga0265334_10001759
1411 Ga0265334_10004780
1412 Ga0265318_10015518
1413 Ga0265318_10032088
1414 Ga0265323_10000395
1415 Ga0265323_10001271
1416 Ga0265323_10012792
1417 Ga0265323_10017597
1418 Ga0265322_10005276
1419 Ga0265322_10005878
1420 Ga0265336_10000194
1421 Ga0265336_10026823
1422 Ga0307517_10008552
1423 Ga0307517_10015597
1424 Ga0307515_10000057
1425 Ga0307515_10000133
1426 Ga0307515_10000432
1427 Ga0307515_10001738
1428 Ga0265338_10000273
1429 Ga0265338_10000527
1430 Ga0265338_10002518
1431 Ga0265338_10006323
1432 Ga0265338_10008747
1433 Ga0265338_10016341
1434 Ga0265338_10030132
1435 Ga0265338_10063636
1436 Ga0265324_10001372
1437 Ga0265324_10007618
1438 Ga0316183_1126735
1439 Ga0316181_1118713
1440 Ga0265330_10001086
1441 Ga0265330_10025643
1442 Ga0265332_10001653
1443 Ga0265332_10007014
1444 Ga0265320_10000494
1445 Ga0265320_10005528
1446 Ga0265325_10010739
1447 Ga0265325_10012429
1448 Ga0265340_10002804
1449 Ga0265339_10007060
1450 Ga0265331_10058487
1451 Ga0265327_10000618
1452 Ga0265327_10008002
1453 Ga0265327_10072023
1454 Ga0265316_10005060
1455 Ga0265316_10077499
1456 Ga0307513_10147438
1457 Ga0307509_10010102
1458 Ga0307509_10072885
1459 Ga0307408_100001775
1460 Ga0265313_10004678
1461 Ga0265313_10005311
1462 Ga0265313_10012195
1463 Ga0310103_105240
1464 Ga0265314_10006023
1465 Ga0265342_10001151
1466 Ga0265342_10100515
1467 Ga0316576_10002660
1468 Ga0316576_10057544
1469 Ga0316576_10065179
1470 Ga0316576_10085185
1471 Ga0316578_10000458
1472 Ga0316578_10027250
1473 Ga0316578_10081680
1474 Ga0307516_10002738
1475 Ga0307405_10163947
1476 Ga0316577_10005407
1477 Ga0316577_10005994
1478 Ga0307412_10000018
1479 Ga0307412_10091651
1480 Ga0307409_100051015
1481 Ga0307414_10000392
1482 Ga0307414_10000393
1483 Ga0307414_10022716
1484 Ga0307414_10030980
1485 Ga0307414_10051783
1486 Ga0307414_10055507
1487 Ga0307414_10221590
1488 Ga0307507_10000064
1489 Ga0307510_10005874
1490 Ga0307510_10007411
1491 Ga0373934_0001565
1492 Ga0373923_0036491
1493 Ga0373954_0046145
1494 Ga0373956_0064778
1495 Ga0373957_0041473
1496 Ga0316574_0009680
1497 Ga0316574_0178878
1498 Ga0373927_0005089
1499 Ga0373933_0007494
1500 Ga0373937_0013067
1501 Ga0310110_009579
1502 Ga0316582_0000862
1503 Ga0316584_0000202
1504 Ga0316584_0000530
1505 Ga0316584_0043722
1506 Ga0373925_0027719
1507 Ga0395899_0002054
1508 Ga0395899_0006794
1509 Ga0395899_0017979
1510 Ga0395899_0061038
1511 Ga0395899_0088854
1512 Ga0395900_0005501
1513 Ga0395900_0005682
1514 Ga0395900_0007296
1515 Ga0395900_0029586
1516 Ga0395900_0124774
1517 Ga0395900_0153735
1518 Ga0395900_0277274
1519 Ga0395898_0009433
1520 Ga0395898_0039456
1521 Ga0395898_0130890
1522 Ga0395905_0000516
1523 Ga0395905_0001254
1524 Ga0395905_0036571
1525 Ga0395901_0000861
1526 Ga0395901_0003324
1527 Ga0395901_0136614
1528 Ga0395901_0226951
1529 Ga0400485_16601
1530 Ga0400483_039122
1531 Ga0436361_0539750
1532 Ga0439439_0028272
1533 Ga0451853_2051003
1534 Ga0450898_003736
1535 Ga0451577_0000072
1536 Ga0451577_0000202
1537 Ga0451577_0000217
1538 Ga0451577_0000364
1539 Ga0451577_0000509
1540 Ga0451577_0000954
1541 Ga0451577_0002430
1542 Ga0451577_0012393
1543 Ga0451577_0018198
1544 Ga0451577_0060152
1545 Ga0451577_0069804
1546 Ga0451577_0076157
1547 Ga0451577_0085788
1548 Ga0451577_0097992
1549 Ga0451577_0128676
1550 Ga0451577_0137791
1551 Ga0451577_0151581
1552 Ga0451577_0345532
1553 Ga0466972_0000205
1554 Ga0466972_0000946
1555 Ga0453683_0000139
1556 Ga0453683_0000178
1557 Ga0453683_0000476
1558 Ga0453683_0000625
1559 Ga0453683_0001467
1560 Ga0453683_0003005
1561 Ga0453683_0005318
1562 Ga0453683_0010590
1563 Ga0453683_0010664
1564 Ga0453683_0017963
1565 Ga0453683_0029661
1566 Ga0453683_0040902
1567 Ga0453683_0099936
1568 Ga0453684_0000004
1569 Ga0453684_0000081
1570 Ga0453684_0000086
1571 Ga0453684_0000186
1572 Ga0453684_0000337
1573 Ga0453684_0000393
1574 Ga0453684_0000608
1575 Ga0453684_0000630
1576 Ga0453684_0001006
1577 Ga0453684_0001244
1578 Ga0453684_0001377
1579 Ga0453684_0002144
1580 Ga0453684_0004157
1581 Ga0453684_0004417
1582 Ga0453684_0005203
1583 Ga0453684_0005297
1584 Ga0453684_0006234
1585 Ga0453684_0007491
1586 Ga0453684_0009673
1587 Ga0453684_0013156
1588 Ga0453684_0013250
1589 Ga0453684_0017180
1590 Ga0453684_0018143
1591 Ga0453684_0019610
1592 Ga0453684_0022403
1593 Ga0453684_0026462
1594 Ga0453684_0030202
1595 Ga0453684_0030327
1596 Ga0453684_0030674
1597 Ga0453684_0041170
1598 Ga0453684_0045474
1599 Ga0453684_0058981
1600 Ga0453684_0059245
1601 Ga0453684_0067008
1602 Ga0453684_0077277
1603 Ga0453684_0096362
1604 Ga0453684_0120378
1605 Ga0453684_0139207
1606 Ga0453684_0186360
1607 Ga0453684_0255106
1608 Ga0453684_0289366
1609 Ga0453684_0301019
1610 Ga0466968_0016433
1611 Ga0466970_0000529
1612 Ga0466957_0001121
1613 Ga0451576_0000065
1614 Ga0451576_0000083
1615 Ga0451576_0000145
1616 Ga0451576_0000294
1617 Ga0451576_0000683
1618 Ga0451576_0000729
1619 Ga0451576_0001394
1620 Ga0451576_0007238
1621 Ga0451576_0009193
1622 Ga0451576_0011975
1623 Ga0451576_0051793
1624 Ga0451576_0069951
1625 Ga0451576_0080236
1626 Ga0451576_0115641
1627 Ga0451576_0322578
1628 Ga0466967_0208069
1629 Ga0495638_0000001
1630 Ga0495638_0028055
1631 Ga0495651_0052900
1632 Ga0495651_0098879
1633 Ga0495653_0266227
1634 Ga0495650_0000003
1635 Ga0495580_0010183
1636 Ga0495580_0016439
1637 Ga0495585_0000085
1638 Ga0495585_0001006
1639 Ga0495606_0000002
1640 Ga0495606_0005474
1641 Ga0495606_0016294
1642 Ga0495608_0050979
1643 Ga0495610_0023746
1644 Ga0495616_0005113
1645 Ga0495616_0006849
1646 Ga0495628_0004159
1647 Ga0495631_0008059
1648 Ga0495648_0002775
1649 Ga0495652_0188421
1650 Ga0495587_0052965
1651 Ga0495609_0033790
1652 Ga0495633_0000014
1653 Ga0495633_0089582
1654 Ga0495667_0077050
1655 Ga0495668_0000003
1656 Ga0495668_0001784
1657 Ga0495611_0000179
1658 Ga0495625_0000005
1659 Ga0495625_0000471
1660 Ga0495625_0001258
1661 Ga0495625_0010947
1662 Ga0495625_0017844
1663 Ga0495661_0054825
1664 Ga0495661_0088277
1665 Ga0495657_0078202
1666 Ga0495599_0077856
1667 Ga0495647_0037234
1668 Ga0495658_0141371
1669 Ga0495613_0097663
1670 Ga0495649_0000003
1671 Ga0495660_0007560
1672 Ga0495672_0033988
1673 Ga0495683_0028303
1674 Ga0495687_000004
1675 Ga0495687_000544
1676 Ga0495687_000762
1677 Ga0495675_0010457
1678 Ga0495686_0000004
1679 Ga0495686_0003602
1680 Ga0495686_0051650
1681 Ga0495686_0132507
1682 Ga0496101_0012235
1683 Ga0496102_0176702
1684 Ga0496104_0261118
1685 Ga0496109_0083335
1686 Ga0496116_0004290
1687 Ga0496117_0008979
1688 Ga0496122_0000789
1689 Ga0496122_0006722
1690 Ga0496123_0006610
1691 Ga0496123_0013257
1692 Ga0496124_0042623
1693 Ga0501323_000726
1694 Ga0501031_0017014
1695 Ga0501032_0000789
1696 Ga0501032_0103951
1697 Ga0501033_0125458
1698 Ga0501034_0006168
1699 Ga0501034_0041867
1700 Ga0501034_0109443
1701 Ga0501036_0001149
1702 Ga0501036_0004247
1703 Ga0501037_0027852
1704 Ga0501038_0101201
1705 Ga0501039_0025685
1706 Ga0501041_0014564
1707 Ga0501042_0003714
1708 Ga0501043_0013354
1709 Ga0501043_0055797
1710 Ga0501046_0002549
1711 Ga0501046_0012945
1712 Ga0501047_0003691
1713 Ga0501048_0003076
1714 Ga0501068_0013864
1715 Ga0501068_0075269
1716 Ga0501069_0011303
1717 Ga0501070_0006716
1718 Ga0501070_0119081
1719 Ga0501070_0225193
1720 Ga0501071_0022656
1721 Ga0501072_0002595
1722 Ga0501073_0002127
1723 Ga0501073_0046449
1724 Ga0501074_0000268
1725 Ga0501074_0071210
1726 Ga0501075_0052536
1727 Ga0501217_005267
1728 Ga0501223_000517
1729 Ga0501236_000066
1730 Ga0501238_006873
1731 Ga0501243_008676
1732 Ga0501225_0044910
1733 Ga0501079_0005838
1734 Ga0501080_0009651
1735 Ga0501080_0082493
1736 Ga0501080_0290176
1737 Ga0501081_0001456
1738 Ga0501081_0096995
1739 Ga0501083_0002364
1740 Ga0501083_0045344
1741 Ga0501035_0006540
1742 Ga0501035_0063517
1743 Ga0501044_0008384
1744 Ga0501044_0130700
1745 Ga0501045_0033653
1746 nmdc:mga0k408_33017_c1
1747 nmdc:mga0k408_6399_c1
1748 nmdc:mga05p37_20368_c1
1749 nmdc:mga09592_92181_c1
1750 nmdc:mga06r32_49377_c1
1751 nmdc:mga08y16_141376_c1
1752 nmdc:mga08y16_254478_c1
1753 nmdc:mga08y16_3286_c1
1754 nmdc:mga08y16_5732_c1
1755 nmdc:mga08y16_60600_c1
1756 Ga0500583_0000077
1757 Ga0500583_0005181
1758 Ga0500641_0059014
1759 Ga0500562_002684
1760 Ga0500608_001113
1761 Ga0500614_012003
1762 Ga0500618_000666
1763 Ga0500618_008890
1764 Ga0500559_0055216
1765 Ga0500568_0000641
1766 Ga0500616_0000009
1767 Ga0500616_0007510
1768 Ga0500622_0000009
1769 Ga0500622_0000096
1770 Ga0500622_0002927
1771 Ga0500622_0003314
1772 Ga0500622_0012934
1773 Ga0500624_000970
1774 Ga0500627_0036267
1775 Ga0500611_000020
1776 Ga0501084_0121959
1777 Ga0501082_0002189
1778 Ga0501082_0079639
1779 Ga0530510_0003636
1780 Ga0530510_0058992
1781 2522551106
1782 2599477954
1783 2617917579
1784 2643948034
1785 2644390541
1786 2644433900
1787 2722729183
1788 2738698353
1789 2738731240
1790 2738756567
1791 2738760849
1792 2739252679
1793 2739304006
1794 2740031596
1795 2819587334
1796 2839992282
1797 2842906595
1798 2852623668
1799 2852627338
1800 2884937428
1801 2890738095
1802 2891633668
1803 2896318001
1804 2896345476
1805 2898715848
1806 2904780905
1807 2913846074
1808 2913941070
1809 2918504964
1810 2919180631
1811 2919187371
1812 2919441095
1813 2919693343
1814 2928079915
1815 2928147630
1816 2932088484
1817 2939665362
1818 2977236133
1819 3003235980
1820 642605327
1821 8055589469
1822 8056440302

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

44

468

0.98

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

89

228

0.86

PF00155

Aminotran_1_2

Aminotransferase class I and II

86

261

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eqw-assembly1.cif.gz_G crystal structure of fub7 0.9819 6 434
8sf5-assembly1.cif.gz_A-2 promiscuous amino acid gamma synthase from caldicellulosiruptor hydrothermalis in open conformation 0.9816 5 428
8eqw-assembly4.cif.gz_D crystal structure of fub7 0.9813 6 434
8eqw-assembly3.cif.gz_C crystal structure of fub7 0.9804 5 434
8eqw-assembly1.cif.gz_A crystal structure of fub7 0.9803 5 434
ID Description Score Start End Superfamily
af_O13326_295_429_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9851 299 431 3.90.1150.10
af_Q59US5_3_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9813 5 293 3.40.640.10
af_P32929_263_402_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9771 298 432 3.90.1150.10
3ri6B02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9763 299 428 3.90.1150.10
af_Q59US5_3_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9745 5 293 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A434AUQ5-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase 0.9932 1 432 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A7G8JLQ7-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase 0.9919 47 430 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A1F2PGI7-F1-model_v4 Methionine gamma-lyase (EC 4.4.1.11) 0.9904 5 432 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0018826
GO:0019346
GO:0030170
GO:0071269
AF-A0A382DB25-F1-model_v4 Aminotransferase class V domain-containing protein 0.9903 5 228 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A430SEX8-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase (EC 2.5.1.49) 0.989 5 211 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269

Map