F485487

General Info

Members Datasets Scaffolds Average Seq Length
911 759 1820 304

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237084|2513569939
Length 344
Sequence KVLERPYRVLLDAGRSKSGAPALLPTRCESRTMANISVPSITTVARPAKRAANSKSSVAHDRLAVLLIFLPPALLLFTLFVIMPMGEAAWYSLYKWNGYGTPTEFIALRNFQVLFRNAAFTQALVNNGLIIVISICIQVPLAIWLATMLAHRIPGVVGYRLIFFLPYVLADVAAGLIWRFVYDGDYGLFAAVSNFFGFANPYVLADKDVAIYAVLGVIVWKYFGFHMMLFIAGLQSVDKSVLEAAEIDGATGWQKFRYVTLPLLGSTLRLSIFFAVVGSLQLFDMIMPLTGGGPSNSTQTMVTFLYTYGVMRMQVGLGSAVGVVLFIICVTLAFGYKRIFMRHD

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
71 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
240 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
246 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
247 2509276019 Ensifer aridi TW10 Isolate Nodule
248 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
249 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
250 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
251 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
252 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
253 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
254 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
255 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
256 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
257 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
258 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
259 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
260 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
261 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
262 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
263 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
264 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
265 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
266 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
267 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
268 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
269 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
270 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
271 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
272 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
273 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
274 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
275 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
276 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
277 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
278 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
279 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
280 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
281 2516143018 Ensifer sp. BR816 Isolate Nodule
282 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
283 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
284 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
285 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
286 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
287 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
288 2519899620 Rhizobium sp. Pop5 Isolate Nodule
289 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
290 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
291 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
292 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
293 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
294 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
295 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
296 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
297 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
298 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
299 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
300 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
301 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
302 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
303 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
304 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
305 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
306 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
307 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
308 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
309 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
310 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
311 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
312 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
313 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
314 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
315 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
316 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
317 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
318 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
319 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
320 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
321 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
322 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
323 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
324 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
325 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
326 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
327 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
328 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
329 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
330 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
331 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
332 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
333 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
334 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
335 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
336 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
337 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
338 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
339 2643221568 Rhizobium sp. Root564 Isolate Unclassified
340 2643221582 Rhizobium sp. Root651 Isolate Unclassified
341 2643221599 Rhizobium sp. Root708 Isolate Unclassified
342 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
343 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
344 2643221688 Rhizobium sp. Root482 Isolate Unclassified
345 2643221693 Rhizobium sp. Root491 Isolate Unclassified
346 2643221736 Bosea sp. Root483D1 Isolate Unclassified
347 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
348 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
349 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
350 2718217882 Rhizobium sp. N741 Isolate Nodule
351 2718217927 Rhizobium sp. N324 Isolate Nodule
352 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
353 2718218009 Rhizobium sp. N561 Isolate Nodule
354 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
355 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
356 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
357 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
358 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
359 2718218363 Rhizobium sp. N113 Isolate Nodule
360 2718218365 Rhizobium sp. N731 Isolate Nodule
361 2718218366 Rhizobium sp. N621 Isolate Nodule
362 2718218423 Rhizobium sp. N941 Isolate Nodule
363 2721755514 Rhizobium sp. N6212 Isolate Nodule
364 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
365 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
366 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
367 2721755809 Rhizobium sp. N541 Isolate Nodule
368 2721755810 Rhizobium sp. N871 Isolate Nodule
369 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
370 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
371 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
372 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
373 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
374 2728369365 Rhizobium sp. N1341 Isolate Nodule
375 2728369397 Rhizobium sp. N1314 Isolate Nodule
376 2738541293 Rhizobium sp. GV031 Isolate Unclassified
377 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
378 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
379 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
380 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
381 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
382 2791355256 Rhizobium sp. M10 Isolate Nodule
383 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
384 2791355260 Rhizobium sp. L9 Isolate Nodule
385 2791355261 Rhizobium sp. J15 Isolate Nodule
386 2791355262 Rhizobium sp. M1 Isolate Nodule
387 2791355263 Rhizobium chutanense C5 Isolate Nodule
388 2791355264 Rhizobium sp. S9 Isolate Nodule
389 2791355265 Rhizobium sp. H4 Isolate Nodule
390 2791355266 Rhizobium sp. L43 Isolate Nodule
391 2791355267 Rhizobium sp. L18 Isolate Nodule
392 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
393 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
394 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
395 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
396 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
397 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
398 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
399 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
400 2802429633 Rhizobium anhuiense J3 Isolate Nodule
401 2802429634 Rhizobium anhuiense S10 Isolate Nodule
402 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
403 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
404 2802429637 Rhizobium anhuiense C15 Isolate Nodule
405 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
406 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
407 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
408 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
409 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
410 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
411 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
412 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
413 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
414 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
415 2838048938 Rhizobium pisi 27/80 Isolate Nodule
416 2838061910 Rhizobium phaseoli L15 Isolate Nodule
417 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
418 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
419 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
420 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
421 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
422 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
423 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
424 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
425 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
426 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
427 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
428 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
429 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
430 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
431 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
432 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
433 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
434 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
435 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
436 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
437 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
438 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
439 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
440 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
441 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
442 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
443 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
444 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
445 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
446 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
447 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
448 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
449 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
450 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
451 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
452 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
453 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
454 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
455 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
456 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
457 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
458 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
459 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
460 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
461 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
462 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
463 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
464 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
465 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
466 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
467 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
468 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
469 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
470 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
471 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
472 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
473 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
474 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
475 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
476 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
477 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
478 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
479 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
480 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
481 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
482 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
483 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
484 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
485 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
486 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
487 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
488 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
489 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
490 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
491 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
492 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
493 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
494 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
495 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
496 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
497 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
498 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
499 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
500 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
501 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
502 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
503 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
504 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
505 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
506 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
507 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
508 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
509 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
510 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
511 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
512 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
513 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
514 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
515 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
516 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
517 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
518 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
519 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
520 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
521 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
522 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
523 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
524 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
525 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
526 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
527 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
528 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
529 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
530 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
531 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
532 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
533 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
534 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
535 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
536 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
537 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
538 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
539 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
540 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
541 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
542 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
543 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
544 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
545 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
546 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
547 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
548 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
549 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
550 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
551 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
552 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
553 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
554 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
555 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
556 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
557 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
558 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
559 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
560 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
561 2933599457 Rhizobium phaseoli M3 Isolate Nodule
562 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
563 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
564 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
565 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
566 2936381700 Rhizobium chutanense C16 Isolate Unclassified
567 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
568 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
569 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
570 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
571 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
572 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
573 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
574 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
575 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
576 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
577 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
578 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
579 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
580 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
581 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
582 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
583 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
584 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
585 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
586 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
587 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
588 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
589 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
590 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
591 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
592 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
593 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
594 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
595 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
596 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
597 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
598 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
599 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
600 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
601 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
602 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
603 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
604 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
605 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
606 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
607 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
608 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
609 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
610 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
611 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
612 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
613 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
614 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
615 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
616 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
617 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
618 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
619 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
620 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
621 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
622 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
623 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
624 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
625 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
626 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
627 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
628 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
629 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
630 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
631 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
632 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
633 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
634 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
635 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
636 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
637 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
638 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
639 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
640 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
641 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
642 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
643 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
644 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
645 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
646 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
647 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
648 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
649 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
650 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
651 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
652 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
653 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
654 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
655 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
656 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
657 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
658 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
659 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
660 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
661 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
662 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
663 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
664 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
665 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
666 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
667 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
668 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
669 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
670 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
671 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
672 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
673 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
674 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
675 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
676 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
677 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
678 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
679 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
680 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
681 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
682 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
683 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
684 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
685 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
686 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
687 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
688 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
689 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
690 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
691 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
692 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
693 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
694 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
695 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
696 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
697 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
698 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
699 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
700 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
701 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
702 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
703 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
704 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
705 2996887358 Rhizobium sp. R711 Isolate Nodule
706 2996893221 Rhizobium sp. R635 Isolate Nodule
707 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
708 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
709 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
710 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
711 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
712 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
713 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
714 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
715 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
716 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
717 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
718 8005258706 Rhizobium sp. R693 Isolate Nodule
719 8005275841 Rhizobium sp. N4311 Isolate Nodule
720 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
721 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
722 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
723 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
724 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
725 8005321885 Rhizobium sp. R72 Isolate Nodule
726 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
727 8005382845 Rhizobium sp. R634 Isolate Nodule
728 8005395548 Rhizobium sp. R339 Isolate Nodule
729 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
730 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
731 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
732 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
733 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
734 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
735 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
736 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
737 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
738 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
739 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
740 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
741 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
742 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
743 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
744 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
745 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
746 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
747 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
748 8018176218 Rhizobium sp. N122 Isolate Nodule
749 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
750 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
751 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
752 8024501048 Rhizobium sp. H4 Isolate Nodule
753 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
754 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
755 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
756 8056382006 Rhizobium croatiense 13T Isolate Nodule
757 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
758 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
759 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.14
Metatranscriptomes 0.22
Isolates 56.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 14.6
Nodule 44.9
Rhizoplane 1.76
Rhizosphere 25.58
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000274 3300001979 Bacteria 21830
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25156J39149_1000015 3300002705 Bacteria 181949
5 JGI25162J39368_1000930 3300002737 Bacteria 18809
6 JGI25154J39366_1000026 3300002738 Bacteria 200613
7 JGI25158J39367_1000140 3300002739 Bacteria 16957
8 JGI25157J39369_1000005 3300002741 Bacteria 269089
9 JGI25152J39213_1002440 3300002773 Bacteria 7071
10 JGI25152J39213_1002693 3300002773 Bacteria 6516
11 JGI25150J39212_1006970 3300002774 Bacteria 2298
12 JGI25159J45721_1000260 3300002987 Bacteria 24641
13 JGI25159J45721_1001000 3300002987 Bacteria 12200
14 JGI25151J46595_10000238 3300003187 Bacteria 64884
15 JGI25151J46595_10013544 3300003187 Bacteria 3665
16 JGI25151J46595_10028316 3300003187 Bacteria 2233
17 JGI25165J46597_1000715 3300003214 Bacteria 26079
18 JGI25153J46596_10005165 3300003215 Bacteria 6875
19 JGI25153J46596_10009689 3300003215 Bacteria 4437
20 rootH1_10050195 3300003316 Bacteria 2603
21 JGI25160J50197_1000022 3300003354 Bacteria 201071
22 JGI25160J50197_1006405 3300003354 Bacteria 4768
23 JGI25160J50197_1013391 3300003354 Bacteria 2797
24 JGI25161J50226_1000024 3300003374 Bacteria 152176
25 JGI25161J50226_1000050 3300003374 Bacteria 110628
26 JGI25161J50226_1004866 3300003374 Bacteria 2734
27 Ga0055526_1001371 3300003771 Bacteria 17456
28 Ga0055526_1002463 3300003771 Bacteria 12518
29 Ga0055526_1022297 3300003771 Bacteria 2159
30 Ga0055524_1000880 3300003775 Bacteria 19576
31 Ga0055524_1005903 3300003775 Bacteria 5394
32 Ga0055524_1014378 3300003775 Bacteria 2934
33 Ga0055528_1000106 3300003790 Bacteria 67208
34 Ga0055528_1001160 3300003790 Bacteria 17054
35 Ga0055528_1002460 3300003790 Bacteria 9911
36 Ga0055528_1020224 3300003790 Bacteria 2168
37 Ga0055540_1000103 3300003792 Bacteria 94710
38 Ga0055540_1001450 3300003792 Bacteria 14122
39 Ga0055540_1005697 3300003792 Bacteria 5148
40 Ga0055540_1015308 3300003792 Bacteria 2240
41 Ga0055531_10002344 3300003794 Bacteria 12752
42 Ga0055543_1000023 3300004625 Bacteria 140513
43 Ga0055543_1000025 3300004625 Bacteria 137886
44 Ga0055543_1001443 3300004625 Bacteria 9431
45 Ga0065165_1000200 3300005262 Bacteria 103564
46 Ga0065165_1010583 3300005262 Bacteria 3962
47 Ga0065165_1015319 3300005262 Bacteria 2928
48 Ga0065165_1016842 3300005262 Bacteria 2717
49 Ga0065704_10099334 3300005289 Bacteria 2316
50 Ga0065707_10086155 3300005295 Bacteria 5629
51 Ga0068869_100139575 3300005334 Bacteria 1870
52 Ga0070682_100278482 3300005337 Bacteria 1218
53 Ga0070660_100334670 3300005339 Bacteria 1245
54 Ga0070669_100085057 3300005353 Bacteria 2361
55 Ga0070674_100064095 3300005356 Bacteria 2574
56 Ga0070714_100375601 3300005435 Bacteria 1339
57 Ga0070700_100018816 3300005441 Bacteria 3977
58 Ga0070708_100010723 3300005445 Bacteria 7437
59 Ga0070678_100010927 3300005456 Bacteria 5572
60 Ga0070678_100515330 3300005456 Bacteria 1057
61 Ga0070678_100571440 3300005456 Bacteria 1006
62 Ga0068867_100005603 3300005459 Bacteria 8896
63 Ga0070706_100173652 3300005467 Bacteria 2012
64 Ga0070706_100385952 3300005467 Unclassified 1304
65 Ga0070707_100053165 3300005468 Unclassified 3883
66 Ga0070698_100000683 3300005471 Bacteria 36267
67 Ga0070699_100010118 3300005518 Bacteria 8166
68 Ga0070697_100023899 3300005536 Bacteria 4863
69 Ga0070697_100036048 3300005536 Bacteria 3994
70 Ga0068853_100002653 3300005539 Bacteria 13491
71 Ga0070672_100003609 3300005543 Bacteria 10033
72 Ga0070672_100205484 3300005543 Bacteria 1648
73 Ga0070665_100041738 3300005548 Bacteria 4612
74 Ga0070665_100106324 3300005548 Bacteria 2808
75 Ga0070665_100312963 3300005548 Bacteria 1574
76 Ga0070664_100323372 3300005564 Bacteria 1398
77 Ga0068859_100112421 3300005617 Bacteria 2787
78 Ga0068863_100068199 3300005841 Bacteria 3365
79 Ga0068858_100196888 3300005842 Bacteria 1904
80 Ga0068860_100007737 3300005843 Bacteria 10738
81 Ga0068860_100104396 3300005843 Bacteria 2705
82 Ga0068862_100015023 3300005844 Bacteria 6430
83 Ga0081455_10063610 3300005937 Bacteria 3095
84 Ga0081455_10358414 3300005937 Bacteria 1026
85 Ga0070717_10008768 3300006028 Bacteria 7570
86 Ga0070717_10100395 3300006028 Unclassified 2457
87 Ga0075365_10011384 3300006038 Bacteria 5229
88 Ga0075365_10084238 3300006038 Bacteria 2157
89 Ga0075368_10006397 3300006042 Bacteria 4111
90 Ga0075368_10041422 3300006042 Bacteria 1809
91 Ga0075368_10046801 3300006042 Bacteria 1712
92 Ga0075363_100058622 3300006048 Bacteria 2068
93 Ga0075363_100111375 3300006048 Bacteria 1522
94 Ga0075364_10006628 3300006051 Bacteria 6821
95 Ga0075364_10112000 3300006051 Bacteria 1822
96 Ga0070712_100167100 3300006175 Bacteria 1704
97 Ga0075362_10002240 3300006177 Bacteria 6436
98 Ga0075362_10008554 3300006177 Bacteria 3920
99 Ga0075367_10010707 3300006178 Bacteria 4828
100 Ga0075369_10013141 3300006186 Bacteria 3279
101 Ga0075366_10019997 3300006195 Bacteria 3881
102 Ga0075370_10004585 3300006353 Bacteria 6736
103 Ga0068865_100017435 3300006881 Bacteria 4617
104 Ga0097620_100112427 3300006931 Bacteria 2787
105 Ga0097620_100137443 3300006931 Bacteria 2517
106 Ga0099826_10001105 3300006948 Bacteria 15404
107 Ga0105240_10397442 3300009093 Bacteria 1553
108 Ga0105243_10003302 3300009148 Bacteria 13098
109 Ga0105243_10231545 3300009148 Bacteria 1639
110 Ga0105241_10152911 3300009174 Bacteria 1889
111 Ga0105237_10000188 3300009545 Bacteria 87497
112 Ga0105237_10699753 3300009545 Bacteria 1020
113 Ga0105249_10132075 3300009553 Bacteria 2385
114 Ga0105249_10435134 3300009553 Bacteria 1348
115 Ga0123341_1000095 3300009765 Bacteria 37499
116 Ga0123342_1014091 3300009766 Bacteria 7761
117 Ga0105239_10010200 3300010375 Bacteria 10524
118 Ga0157373_10001757 3300013100 Bacteria 16491
119 Ga0157373_10094929 3300013100 Bacteria 2099
120 Ga0157373_10247589 3300013100 Bacteria 1260
121 Ga0157371_10000002 3300013102 Bacteria 665040
122 Ga0157370_10000211 3300013104 Bacteria 74012
123 Ga0157369_10011908 3300013105 Bacteria 9878
124 Ga0157369_10079367 3300013105 Bacteria 3515
125 Ga0157378_10247293 3300013297 Bacteria 1706
126 Ga0157378_10380163 3300013297 Bacteria 1387
127 Ga0163162_10009513 3300013306 Bacteria 9453
128 Ga0163162_10190716 3300013306 Bacteria 2177
129 Ga0157375_10013667 3300013308 Bacteria 7237
130 Ga0157380_10017418 3300014326 Bacteria 5316
131 Ga0182008_10003079 3300014497 Bacteria 10241
132 Ga0157379_10024269 3300014968 Bacteria 5383
133 Ga0157376_10339119 3300014969 Bacteria 1435
134 Ga0182007_10001612 3300015262 Bacteria 11981
135 Ga0182005_1005419 3300015265 Bacteria 3988
136 Ga0183362_10002 3300015683 Bacteria 1432711
137 Ga0163161_10059617 3300017792 Bacteria 2776
138 Ga0209435_100009 3300025206 Bacteria 476614
139 Ga0209436_100053 3300025208 Bacteria 63474
140 Ga0209436_118015 3300025208 Bacteria 1016
141 Ga0209437_100057 3300025233 Bacteria 362922
142 Ga0207425_1001821 3300025245 Bacteria 8251
143 Ga0209646_1000018 3300025246 Bacteria 476716
144 Ga0209026_1000043 3300025250 Bacteria 269142
145 Ga0209759_1000007 3300025256 Bacteria 476614
146 Ga0209129_1000016 3300025258 Bacteria 485491
147 Ga0209129_1013604 3300025258 Bacteria 1781
148 Ga0209233_1000130 3300025261 Bacteria 205687
149 Ga0209455_1006859 3300025272 Bacteria 3309
150 Ga0209673_1000005 3300025273 Bacteria 692788
151 Ga0209673_1000139 3300025273 Bacteria 157765
152 Ga0209673_1002223 3300025273 Bacteria 14103
153 Ga0209673_1004169 3300025273 Bacteria 7904
154 Ga0209130_1000031 3300025284 Bacteria 322932
155 Ga0209130_1000251 3300025284 Bacteria 67741
156 Ga0209130_1004762 3300025284 Bacteria 5015
157 Ga0209676_1017732 3300025292 Bacteria 2508
158 Ga0209025_1000126 3300025294 Bacteria 200866
159 Ga0209025_1000237 3300025294 Bacteria 128553
160 Ga0209025_1002704 3300025294 Bacteria 18049
161 Ga0209025_1002712 3300025294 Bacteria 17992
162 Ga0209564_1000331 3300025295 Bacteria 91919
163 Ga0209564_1000577 3300025295 Bacteria 58129
164 Ga0209564_1002036 3300025295 Bacteria 17487
165 Ga0209564_1003502 3300025295 Bacteria 10647
166 Ga0209758_1000903 3300025297 Bacteria 40307
167 Ga0209758_1000931 3300025297 Bacteria 39600
168 Ga0209758_1001250 3300025297 Bacteria 31516
169 Ga0209758_1001440 3300025297 Bacteria 28025
170 Ga0209758_1003844 3300025297 Bacteria 13177
171 Ga0209050_1004134 3300025298 Bacteria 10072
172 Ga0209256_1000299 3300025299 Bacteria 86909
173 Ga0209256_1000961 3300025299 Bacteria 34812
174 Ga0209256_1011278 3300025299 Bacteria 3599
175 Ga0209256_1015383 3300025299 Bacteria 2681
176 Ga0207426_1000042 3300025302 Bacteria 433289
177 Ga0207426_1000082 3300025302 Bacteria 298939
178 Ga0207426_1000290 3300025302 Bacteria 99519
179 Ga0209051_1000095 3300025303 Bacteria 167840
180 Ga0209051_1000950 3300025303 Bacteria 28418
181 Ga0209051_1001462 3300025303 Bacteria 20029
182 Ga0209051_1030477 3300025303 Bacteria 2092
183 Ga0209051_1071002 3300025303 Bacteria 1048
184 Ga0209257_1001831 3300025304 Bacteria 23241
185 Ga0209257_1011109 3300025304 Bacteria 4401
186 Ga0209257_1016144 3300025304 Bacteria 3045
187 Ga0209257_1034763 3300025304 Bacteria 1567
188 Ga0207682_10104749 3300025893 Bacteria 1240
189 Ga0207642_10047277 3300025899 Bacteria 1923
190 Ga0207647_10044578 3300025904 Bacteria 2770
191 Ga0207684_10117644 3300025910 Bacteria 2277
192 Ga0207646_10033232 3300025922 Unclassified 4667
193 Ga0207694_10136647 3300025924 Bacteria 1969
194 Ga0207709_10035969 3300025935 Bacteria 2932
195 Ga0207704_10011032 3300025938 Bacteria 4433
196 Ga0207691_10021819 3300025940 Bacteria 6044
197 Ga0207691_10076699 3300025940 Bacteria 3012
198 Ga0207689_10080788 3300025942 Bacteria 2672
199 Ga0207679_10221969 3300025945 Bacteria 1590
200 Ga0207668_10516602 3300025972 Bacteria 1030
201 Ga0207639_10020434 3300026041 Bacteria 4740
202 Ga0207639_10065746 3300026041 Bacteria 2816
203 Ga0207678_10213137 3300026067 Bacteria 1652
204 Ga0207708_10031924 3300026075 Bacteria 4000
205 Ga0207648_10004328 3300026089 Bacteria 14625
206 Ga0207675_100001137 3300026118 Bacteria 26351
207 Ga0207675_100140317 3300026118 Bacteria 2295
208 Ga0207683_10010219 3300026121 Bacteria 8006
209 Ga0207683_10133634 3300026121 Bacteria 2232
210 Ga0207683_10207260 3300026121 Bacteria 1783
211 Ga0209371_1000012 3300027312 Bacteria 748304
212 Ga0209371_1001153 3300027312 Bacteria 19333
213 Ga0209371_1008000 3300027312 Bacteria 3580
214 Ga0209813_10002465 3300027866 Bacteria 4236
215 Ga0209813_10013890 3300027866 Bacteria 2158
216 Ga0209813_10020257 3300027866 Bacteria 1859
217 Ga0268266_10000728 3300028379 Bacteria 44205
218 Ga0268266_10069055 3300028379 Bacteria 3061
219 Ga0268265_10002980 3300028380 Bacteria 12384
220 Ga0268265_10016306 3300028380 Bacteria 5100
221 Ga0268264_10002471 3300028381 Bacteria 16246
222 Ga0268264_10385782 3300028381 Bacteria 1342
223 Ga0307515_10029370 3300028794 Bacteria 9295
224 Ga0268256_1000013 3300030500 Bacteria 752103
225 Ga0268256_1001230 3300030500 Bacteria 16198
226 Ga0307513_10021053 3300031456 Bacteria 7708
227 Ga0307516_10033201 3300031730 Bacteria 5193
228 Ga0307405_10086071 3300031731 Bacteria 2068
229 Ga0307412_10215704 3300031911 Bacteria 1468
230 Ga0307409_100225484 3300031995 Bacteria 1695
231 Ga0307415_100227527 3300032126 Bacteria 1499
232 Ga0373923_0014931 3300035111 Bacteria 2925
233 Ga0373946_0040860 3300035171 Bacteria 1900
234 Ga0373935_0083954 3300035692 Bacteria 2074
235 Ga0373927_0183007 3300035695 Bacteria 1375
236 Ga0373933_0143145 3300035724 Bacteria 1510
237 Ga0373937_0024706 3300036401 Bacteria 5422
238 Ga0395900_0592471 3300037418 Bacteria 1050
239 Ga0395898_0192241 3300037466 Bacteria 1950
240 Ga0395898_0232159 3300037466 Bacteria 1759
241 Ga0395905_0011131 3300037471 Bacteria 8701
242 Ga0237819_10937 3300038705 Bacteria 1168
243 Ga0436360_0181196 3300039438 Bacteria 3942
244 Ga0436360_0631865 3300039438 Bacteria 2828
245 Ga0436363_0080435 3300039450 Bacteria 16873
246 Ga0451791_0306668 3300041451 Bacteria 1236
247 Ga0451798_1010442 3300041458 Bacteria 1356
248 Ga0451804_1133873 3300041463 Bacteria 1626
249 Ga0451833_0067109 3300041491 Bacteria 2290
250 Ga0451839_0001838 3300041496 Bacteria 2040
251 Ga0451847_0304978 3300041503 Bacteria 2085
252 Ga0451843_0634892 3300041509 Bacteria 1941
253 Ga0451853_0324505 3300041512 Bacteria 1715
254 Ga0439449_0043230 3300042007 Bacteria 1673
255 Ga0466960_0039614 3300044901 Bacteria 2224
256 Ga0495592_0107470 3300046454 Bacteria 1979
257 Ga0495605_0075507 3300046474 Bacteria 1585
258 Ga0495664_0075500 3300046477 Bacteria 2017
259 Ga0495664_0105165 3300046477 Bacteria 1702
260 Ga0495664_0106357 3300046477 Bacteria 1692
261 Ga0495585_0012907 3300046492 Bacteria 4910
262 Ga0495583_0008439 3300046506 Bacteria 6294
263 Ga0495606_0008440 3300046507 Bacteria 8948
264 Ga0495610_0091406 3300046512 Bacteria 1379
265 Ga0495620_0038765 3300046515 Bacteria 2112
266 Ga0495643_0005020 3300046522 Bacteria 9066
267 Ga0495643_0014621 3300046522 Bacteria 4664
268 Ga0495648_0022370 3300046524 Bacteria 4354
269 Ga0495640_0062394 3300046533 Bacteria 2528
270 Ga0495587_0132874 3300046536 Bacteria 1422
271 Ga0495633_0022066 3300046558 Bacteria 3173
272 Ga0495633_0026340 3300046558 Bacteria 2854
273 Ga0495625_0130252 3300046660 Bacteria 1704
274 Ga0495588_0001204 3300046674 Bacteria 11140
275 Ga0495657_0138142 3300046675 Bacteria 1521
276 Ga0495599_0052832 3300046678 Bacteria 2546
277 Ga0495599_0311899 3300046678 Bacteria 948
278 Ga0495658_0132694 3300046683 Bacteria 1517
279 Ga0495670_0051364 3300046691 Bacteria 2063
280 Ga0495671_0139570 3300046692 Bacteria 1181
281 Ga0495649_0018570 3300046694 Bacteria 3911
282 Ga0495600_0121462 3300046809 Bacteria 1699
283 Ga0495660_0078075 3300046810 Bacteria 1741
284 Ga0495674_0272488 3300047319 Bacteria 1388
285 Ga0495683_0107685 3300047323 Bacteria 1334
286 Ga0495681_0001104 3300047470 Bacteria 20492
287 Ga0495686_0067976 3300047472 Bacteria 2199
288 Ga0495615_0008259 3300048090 Bacteria 2007
289 Ga0496102_0442358 3300048905 Bacteria 1220
290 Ga0496106_0000288 3300048909 Bacteria 35636
291 Ga0496106_0188584 3300048909 Bacteria 1639
292 Ga0496109_0161522 3300048912 Bacteria 2099
293 Ga0496110_0013366 3300048913 Bacteria 6783
294 Ga0496111_0107242 3300048914 Bacteria 2056
295 Ga0496113_0027381 3300048916 Bacteria 4087
296 Ga0496116_0000042 3300048919 Bacteria 330516
297 Ga0496116_0012229 3300048919 Bacteria 7021
298 Ga0496116_0024746 3300048919 Bacteria 4431
299 Ga0496117_0000016 3300048920 Bacteria 523642
300 Ga0496117_0139850 3300048920 Bacteria 1452
301 Ga0496118_0001168 3300048921 Bacteria 40490
302 Ga0496118_0011735 3300048921 Bacteria 8516
303 Ga0496118_0112514 3300048921 Bacteria 1802
304 Ga0496119_0130517 3300048922 Bacteria 1370
305 Ga0496119_0136800 3300048922 Bacteria 1328
306 Ga0496120_0000056 3300048923 Bacteria 180367
307 Ga0496121_0000240 3300048924 Bacteria 117890
308 Ga0496121_0000836 3300048924 Bacteria 55869
309 Ga0496121_0001142 3300048924 Bacteria 46580
310 Ga0496121_0008563 3300048924 Bacteria 11984
311 Ga0496121_0058530 3300048924 Bacteria 3185
312 Ga0496121_0069238 3300048924 Bacteria 2849
313 Ga0496121_0157630 3300048924 Bacteria 1664
314 Ga0496121_0195744 3300048924 Bacteria 1445
315 Ga0496121_0281548 3300048924 Bacteria 1137
316 Ga0496122_0000002 3300048925 Bacteria 905834
317 Ga0496122_0177009 3300048925 Bacteria 1277
318 Ga0496122_0254149 3300048925 Bacteria 980
319 Ga0496123_0000002 3300048926 Bacteria 1811682
320 Ga0496123_0106524 3300048926 Bacteria 1615
321 Ga0496123_0114618 3300048926 Bacteria 1532
322 Ga0496123_0125841 3300048926 Bacteria 1431
323 Ga0496124_0000080 3300048927 Bacteria 210439
324 Ga0496124_0045753 3300048927 Bacteria 3751
325 Ga0496124_0049873 3300048927 Bacteria 3568
326 Ga0496124_0068294 3300048927 Bacteria 2955
327 Ga0496124_0164243 3300048927 Bacteria 1727
328 Ga0496125_0000129 3300048928 Bacteria 163342
329 Ga0496125_0049912 3300048928 Bacteria 3470
330 Ga0496126_0000053 3300048929 Bacteria 311989
331 Ga0496126_0031713 3300048929 Bacteria 4987
332 Ga0496126_0031811 3300048929 Bacteria 4979
333 Ga0496126_0165266 3300048929 Bacteria 1889
334 Ga0501032_0014474 3300049569 Bacteria 5586
335 Ga0501032_0122718 3300049569 Bacteria 1717
336 Ga0501033_0032940 3300049570 Bacteria 3891
337 Ga0501034_0013702 3300049571 Bacteria 8338
338 Ga0501034_0027677 3300049571 Bacteria 5764
339 Ga0501034_0174705 3300049571 Bacteria 2115
340 Ga0501034_0187026 3300049571 Bacteria 2034
341 Ga0501034_0200903 3300049571 Bacteria 1951
342 Ga0501034_0323614 3300049571 Bacteria 1474
343 Ga0501036_0029613 3300049572 Bacteria 4624
344 Ga0501037_0016479 3300049573 Bacteria 5439
345 Ga0501037_0084737 3300049573 Bacteria 2295
346 Ga0501038_0021565 3300049574 Bacteria 5781
347 Ga0501038_0046382 3300049574 Bacteria 3768
348 Ga0501039_0033040 3300049575 Bacteria 3991
349 Ga0501043_0027262 3300049579 Bacteria 4486
350 Ga0501046_0181114 3300049580 Bacteria 1576
351 Ga0501046_0181680 3300049580 Bacteria 1572
352 Ga0501047_0083930 3300049581 Bacteria 3062
353 Ga0501047_0232184 3300049581 Bacteria 1698
354 Ga0501068_0249848 3300049584 Bacteria 1130
355 Ga0501070_0027205 3300049586 Bacteria 4797
356 Ga0501070_0032357 3300049586 Bacteria 4376
357 Ga0501073_0111760 3300049589 Bacteria 1895
358 Ga0501073_0134623 3300049589 Bacteria 1713
359 Ga0501238_003101 3300049671 Bacteria 2029
360 Ga0501035_0093121 3300049822 Bacteria 2651
361 Ga0501035_0234377 3300049822 Bacteria 1563
362 Ga0501044_0004981 3300049823 Bacteria 14857
363 Ga0501044_0250692 3300049823 Bacteria 1711
364 nmdc:mga03n38_30649_c1 3300050490 Bacteria 2263
365 nmdc:mga03n38_6063_c1 3300050490 Bacteria 4172
366 nmdc:mga00v17_252_c1 3300050491 Bacteria 31456
367 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
368 nmdc:mga0yw44_286_c1 3300050492 Bacteria 17382
369 nmdc:mga0k408_45190_c1 3300050493 Bacteria 2541
370 nmdc:mga0k408_54279_c1 3300050493 Bacteria 2323
371 nmdc:mga06z11_60085_c1 3300050494 Bacteria 1978
372 nmdc:mga04h51_21929_c1 3300050495 Bacteria 1926
373 nmdc:mga07m45_264008_c1 3300050496 Bacteria 1002
374 nmdc:mga0sz30_104_c1 3300050516 Bacteria 31594
375 nmdc:mga0sz30_27300_c1 3300050516 Bacteria 1749
376 Ga0500578_0084843 3300053086 Bacteria 2012
377 Ga0500572_002948 3300053111 Bacteria 3989
378 Ga0500618_000204 3300053125 Bacteria 47175
379 Ga0500618_006937 3300053125 Bacteria 3276
380 Ga0500658_0000086 3300053134 Bacteria 43329
381 Ga0500568_0007952 3300053139 Bacteria 5153
382 Ga0500604_0000460 3300053151 Bacteria 11248
383 Ga0500616_0000164 3300053153 Bacteria 110715
384 Ga0500622_0000559 3300053156 Bacteria 34086
385 Ga0500622_0016953 3300053156 Bacteria 3885
386 Ga0500624_000758 3300053157 Bacteria 7765
387 Ga0500634_0000366 3300053161 Bacteria 14376
388 Ga0500634_0002193 3300053161 Bacteria 8119
389 Ga0500634_0010912 3300053161 Bacteria 4659
390 Ga0500636_0000372 3300053177 Bacteria 24612
391 Ga0500636_0000392 3300053177 Bacteria 24127
392 Ga0587067_003653 3300059640 Bacteria 1941
393 Ga0587072_000950 3300059643 Bacteria 3342
394 Ga0501082_0018766 3300060353 Bacteria 5960
395 2513569939 2513237084 Bacteria 7231967
396 2509109477 2508501122 Bacteria 6292184
397 2509378213 2509276019 Bacteria 6802256
398 2509386983 2509276021 Bacteria 7634384
399 2509442511 2509276033 Bacteria 7180565
400 2510132964 2510065019 Bacteria 6903379
401 2510307612 2510065057 Bacteria 6649661
402 2510840357 2510461069 Bacteria 5505000
403 2510894345 2510461076 Bacteria 8618824
404 2510899370 2510461076 Bacteria 8618824
405 2511133074 2510917022 Bacteria 6504556
406 2511168701 2510917026 Bacteria 7046020
407 2511181453 2510917028 Bacteria 6185411
408 2511200216 2510917030 Bacteria 7460662
409 2511503213 2511231052 Bacteria 6974333
410 2512534485 2512047086 Bacteria 6850303
411 2512973706 2512875026 Bacteria 6861065
412 2513575211 2513237085 Bacteria 7695351
413 2513585178 2513237086 Bacteria 7265287
414 2513595280 2513237088 Bacteria 6927906
415 2513601776 2513237089 Bacteria 6553624
416 2513616963 2513237091 Bacteria 6900273
417 2513633107 2513237093 Bacteria 7545552
418 2513710155 2513237103 Bacteria 7647401
419 2513866727 2513237138 Bacteria 7368160
420 2513884179 2513237140 Bacteria 7076289
421 2513903508 2513237143 Bacteria 6664116
422 2513911441 2513237144 Bacteria 7530820
423 2513928829 2513237146 Bacteria 7166346
424 2514003640 2513237160 Bacteria 6650282
425 2514021789 2513237162 Bacteria 7468464
426 2515111916 2515075009 Bacteria 7288508
427 2515610950 2515154107 Bacteria 6795637
428 2515633718 2515154113 Bacteria 7807172
429 2515645108 2515154114 Bacteria 7848616
430 2515660249 2515154116 Bacteria 7552979
431 2515738907 2515154134 Bacteria 7220242
432 2516206344 2516143018 Bacteria 6951533
433 2516894645 2516653046 Bacteria 6989037
434 2517035655 2516653077 Bacteria 7555578
435 2517076084 2516653085 Bacteria 7346596
436 2517094836 2517093000 Bacteria 7412387
437 2517406465 2517287029 Bacteria 6905599
438 2517571291 2517487022 Bacteria 7227575
439 2520379453 2519899620 Bacteria 6499161
440 2524450563 2524023207 Bacteria 6813453
441 2524458596 2524023209 Bacteria 6679728
442 2530645223 2529292951 Bacteria 6916614
443 2535520187 2534681796 Bacteria 7146037
444 2537876817 2537561587 Bacteria 5425293
445 2551679629 2551306084 Bacteria 8942552
446 2551687372 2551306085 Bacteria 7347181
447 2551691563 2551306086 Bacteria 6843938
448 2551700716 2551306087 Bacteria 7351905
449 2551715511 2551306089 Bacteria 7162724
450 2551723034 2551306090 Bacteria 7953713
451 2551726795 2551306091 Bacteria 7086830
452 2551736014 2551306092 Bacteria 6992595
453 2551744717 2551306093 Bacteria 7064773
454 2554245666 2554235003 Bacteria 5877155
455 2558867301 2558860100 Bacteria 8458965
456 2559296505 2558860242 Bacteria 5568029
457 2585204273 2582581294 Bacteria 6626667
458 2585222371 2582581298 Bacteria 7315509
459 2585231972 2582581299 Bacteria 6518058
460 2585258731 2582581304 Bacteria 5831370
461 2585271812 2582581307 Bacteria 6597605
462 2585279822 2582581308 Bacteria 7413247
463 2585326636 2582581315 Bacteria 7318924
464 2585333813 2582581316 Bacteria 7774528
465 2585401466 2582581867 Bacteria 7184437
466 2585528241 2585427526 Bacteria 7258840
467 2585531774 2585427527 Bacteria 7273426
468 2585540439 2585427528 Bacteria 6842387
469 2585544677 2585427529 Bacteria 7395659
470 2585551278 2585427530 Bacteria 7383882
471 2585563823 2585427531 Bacteria 6992870
472 2585821159 2585427590 Bacteria 6824633
473 2585838650 2585427593 Bacteria 7141551
474 2585842901 2585427594 Bacteria 6180594
475 2585896980 2585427608 Bacteria 6544331
476 2585907162 2585427609 Bacteria 6667127
477 2585997420 2585427633 Bacteria 6413184
478 2586002026 2585427634 Bacteria 6455027
479 2587982844 2585428125 Bacteria 6662905
480 2599414846 2599185170 Bacteria 7295545
481 2599603000 2599185210 Bacteria 5624189
482 2599724259 2599185236 Bacteria 6875203
483 2600376169 2600254933 Bacteria 4750527
484 2601610621 2600255279 Bacteria 5605316
485 2601747049 2600255308 Bacteria 5611129
486 2616292746 2615840624 Bacteria 6557588
487 2616306613 2615840626 Bacteria 7921970
488 2616551248 2615840698 Bacteria 7319877
489 2617382992 2617270742 Bacteria 6808054
490 2643857047 2643221568 Bacteria 5187270
491 2643917549 2643221582 Bacteria 5804683
492 2644003483 2643221599 Bacteria 6292121
493 2644195571 2643221634 Bacteria 6705461
494 2644242314 2643221643 Bacteria 5749658
495 2644492602 2643221688 Bacteria 5260751
496 2644520632 2643221693 Bacteria 5513853
497 2644742730 2643221736 Bacteria 6608466
498 2671113373 2667528174 Bacteria 6435400
499 2671695279 2671180139 Bacteria 4196045
500 2692314746 2690316117 Bacteria 6800650
501 2719180888 2718217882 Bacteria 6556348
502 2719385492 2718217927 Bacteria 6972593
503 2719665317 2718217997 Bacteria 6740740
504 2719731637 2718218009 Bacteria 6478651
505 2720491737 2718218199 Bacteria 6740745
506 2720613006 2718218232 Bacteria 6720332
507 2720619856 2718218233 Bacteria 6662049
508 2720631284 2718218235 Bacteria 6630699
509 2720775011 2718218269 Bacteria 6906114
510 2721146982 2718218363 Bacteria 6524337
511 2721158512 2718218365 Bacteria 6274507
512 2721163900 2718218366 Bacteria 6425255
513 2721399240 2718218423 Bacteria 6438183
514 2722840070 2721755514 Bacteria 6424414
515 2723026650 2721755556 Bacteria 6745503
516 2723560264 2721755684 Bacteria 6859907
517 2723566831 2721755685 Bacteria 6704835
518 2724038053 2721755809 Bacteria 6438790
519 2724044393 2721755810 Bacteria 6479005
520 2724089618 2721755819 Bacteria 6906405
521 2724104096 2721755822 Bacteria 6726041
522 2724109905 2721755823 Bacteria 6752556
523 2725949846 2724679232 Bacteria 7646494
524 2730107586 2728369352 Bacteria 6745171
525 2730164125 2728369365 Bacteria 6555560
526 2730298144 2728369397 Bacteria 6274511
527 2738801519 2738541293 Bacteria 7065685
528 2739037931 2738541333 Bacteria 7106503
529 2753463911 2751185821 Bacteria 6189929
530 2757569225 2757320392 Bacteria 3737298
531 2766062343 2765235942 Bacteria 7445910
532 2778179028 2775507266 Bacteria 7392367
533 2793299155 2791355256 Bacteria 6798008
534 2793313806 2791355259 Bacteria 7254731
535 2793321172 2791355260 Bacteria 6598818
536 2793326398 2791355261 Bacteria 6661293
537 2793337020 2791355262 Bacteria 6774204
538 2793341239 2791355263 Bacteria 6872478
539 2793347588 2791355264 Bacteria 6429314
540 2793352341 2791355265 Bacteria 6539969
541 2793361482 2791355266 Bacteria 7116587
542 2793366493 2791355267 Bacteria 7222458
543 2802717342 2802428858 Bacteria 6636079
544 2802724669 2802428859 Bacteria 6667919
545 2802729421 2802428860 Bacteria 6525526
546 2802736766 2802428861 Bacteria 6534206
547 2802743172 2802428862 Bacteria 6633353
548 2802749702 2802428863 Bacteria 6410669
549 2805927677 2802429605 Bacteria 6875453
550 2805936154 2802429606 Bacteria 6346811
551 2806045460 2802429633 Bacteria 7341974
552 2806051737 2802429634 Bacteria 7083200
553 2806061781 2802429635 Bacteria 7650140
554 2806067962 2802429636 Bacteria 7597525
555 2806072689 2802429637 Bacteria 7067217
556 2808986956 2808606387 Bacteria 5697198
557 2819560741 2818991439 Bacteria 6907412
558 2819611615 2818991448 Bacteria 6772224
559 2819638709 2818991453 Bacteria 7181617
560 2835317168 2835312727 Bacteria 7413381
561 2838018852 2838016132 Bacteria 6577831
562 2838025445 2838022645 Bacteria 6494267
563 2838031040 2838029111 Bacteria 6603031
564 2838039435 2838035591 Bacteria 7166484
565 2838043140 2838042994 Bacteria 6046894
566 2838052082 2838048938 Bacteria 6044578
567 2838067301 2838061910 Bacteria 6794874
568 2838071416 2838068647 Bacteria 6208656
569 2838667609 2838661181 Bacteria 7385261
570 2838670123 2838668709 Bacteria 6671819
571 2838677768 2838675328 Bacteria 4909118
572 2838682542 2838680041 Bacteria 6545511
573 2838689155 2838686498 Bacteria 7807632
574 2838697113 2838694306 Bacteria 6853137
575 2838702494 2838701080 Bacteria 6669771
576 2838709646 2838707686 Bacteria 6619912
577 2838717327 2838714209 Bacteria 5525906
578 2838722063 2838719591 Bacteria 5523910
579 2838728076 2838724970 Bacteria 4908691
580 2838730503 2838729681 Bacteria 7400765
581 2838743444 2838742623 Bacteria 7396178
582 2841849737 2841846520 Bacteria 5345850
583 2841854880 2841851746 Bacteria 7532261
584 2841864250 2841859092 Bacteria 5436171
585 2841864860 2841864319 Bacteria 6742987
586 2842077820 2842077413 Bacteria 6508645
587 2842110853 2842110456 Bacteria 7656360
588 2842119672 2842118031 Bacteria 7033875
589 2842127515 2842124991 Bacteria 5346824
590 2842132661 2842130223 Bacteria 4909145
591 2842146961 2842146304 Bacteria 5957337
592 2842154655 2842152218 Bacteria 4908957
593 2842157743 2842156927 Bacteria 6894975
594 2842164953 2842163707 Bacteria 6916235
595 2842173152 2842170452 Bacteria 5525737
596 2842178275 2842175837 Bacteria 4908771
597 2842180672 2842180545 Bacteria 6888678
598 2842190434 2842187318 Bacteria 5524014
599 2842196943 2842192696 Bacteria 6147454
600 2842201013 2842198810 Bacteria 6608673
601 2842206341 2842205361 Bacteria 6340321
602 2842214748 2842211629 Bacteria 5523832
603 2842220682 2842217011 Bacteria 7497767
604 2842227469 2842224351 Bacteria 5524473
605 2842231276 2842229732 Bacteria 7475766
606 2842239059 2842237096 Bacteria 6620661
607 2842244623 2842243621 Bacteria 7421798
608 2842252026 2842250916 Bacteria 6579627
609 2842258436 2842257432 Bacteria 7401195
610 2842267472 2842264693 Bacteria 6472963
611 2842273175 2842271015 Bacteria 7807131
612 2842279798 2842278818 Bacteria 6340002
613 2842287445 2842285085 Bacteria 6011953
614 2842291482 2842291075 Bacteria 7076806
615 2842300143 2842298080 Bacteria 6123127
616 2842309342 2842304105 Bacteria 7023636
617 2842315462 2842311132 Bacteria 6616990
618 2842318211 2842317721 Bacteria 6793725
619 2842347212 2842341865 Bacteria 7003929
620 2842359054 2842357229 Bacteria 6485165
621 2842366603 2842363717 Bacteria 6844742
622 2842373109 2842370503 Bacteria 7038661
623 2842377878 2842377471 Bacteria 7140707
624 2842386181 2842384541 Bacteria 7057858
625 2842397357 2842395702 Bacteria 6780583
626 2842405026 2842402390 Bacteria 6681310
627 2842411608 2842409023 Bacteria 6687331
628 2842417941 2842415677 Bacteria 6596907
629 2842424926 2842422224 Bacteria 6239196
630 2842431950 2842428310 Bacteria 6767288
631 2842438063 2842434925 Bacteria 6502746
632 2842444876 2842441272 Bacteria 6769273
633 2842451791 2842447887 Bacteria 6754142
634 2842465746 2842462802 Bacteria 6588055
635 2842472680 2842469257 Bacteria 6752936
636 2842477772 2842475841 Bacteria 6603183
637 2842485078 2842482326 Bacteria 7212537
638 2842492827 2842489311 Bacteria 6620893
639 2842496478 2842495871 Bacteria 6820686
640 2842504356 2842502639 Bacteria 6604161
641 2842511578 2842509118 Bacteria 6850950
642 2842521003 2842515876 Bacteria 5436280
643 2844459490 2844454524 Bacteria 7952546
644 2847420198 2847417321 Bacteria 6913799
645 2848995096 2848992105 Bacteria 6810864
646 2850082537 2850079185 Bacteria 6848280
647 2852391877 2852387548 Bacteria 8025568
648 2854902099 2854896431 Bacteria 5869725
649 2854921325 2854916844 Bacteria 5725939
650 2855827271 2855825444 Bacteria 6785811
651 2855842653 2855839649 Bacteria 7135830
652 2855874617 2855872281 Bacteria 6964271
653 2857523750 2857516855 Bacteria 7787325
654 2858803464 2858800743 Bacteria 6603254
655 2882462471 2882456835 Bacteria 6863978
656 2891051284 2891048133 Bacteria 4447501
657 2894233508 2894232714 Bacteria 8834183
658 2896387545 2896384573 Bacteria 7700774
659 2899793509 2899792073 Bacteria 4926588
660 2899847704 2899845264 Bacteria 5672268
661 2915982557 2915980308 Bacteria 6624279
662 2915991167 2915986958 Bacteria 6739310
663 2916000268 2915993759 Bacteria 7016183
664 2916007194 2916000859 Bacteria 6865702
665 2916008428 2916007675 Bacteria 6898660
666 2916019690 2916014648 Bacteria 6946486
667 2916026734 2916021584 Bacteria 6854472
668 2916033535 2916028427 Bacteria 6748433
669 2916039641 2916035215 Bacteria 6755766
670 2916047019 2916041962 Bacteria 6820487
671 2916052836 2916048683 Bacteria 6543552
672 2916059548 2916055098 Bacteria 6758838
673 2916065155 2916061851 Bacteria 6737736
674 2916071223 2916068649 Bacteria 6943657
675 2916078054 2916076590 Bacteria 6596108
676 2919102931 2919100787 Bacteria 7710546
677 2919117593 2919114240 Bacteria 5700270
678 2919170193 2919166419 Bacteria 4952238
679 2919173716 2919171160 Bacteria 6499771
680 2919411171 2919408235 Bacteria 6149349
681 2921211456 2921208531 Bacteria 6745326
682 2921244031 2921237296 Bacteria 6876710
683 2921248742 2921244191 Bacteria 6568419
684 2921254682 2921250672 Bacteria 6677771
685 2921262131 2921257292 Bacteria 6808382
686 2921270677 2921263974 Bacteria 6864552
687 2921288814 2921282425 Bacteria 6826397
688 2921296337 2921289301 Bacteria 7316391
689 2921298086 2921296804 Bacteria 7176999
690 2923556953 2923556063 Bacteria 6793593
691 2924147723 2924144063 Bacteria 6883928
692 2924156448 2924150972 Bacteria 7169444
693 2924160182 2924158325 Bacteria 7188855
694 2924170218 2924165586 Bacteria 7260590
695 2924177618 2924172951 Bacteria 6749356
696 2924186297 2924179722 Bacteria 6843264
697 2924191583 2924186466 Bacteria 6876637
698 2924195237 2924193448 Bacteria 6955718
699 2924204794 2924200457 Bacteria 6757188
700 2924209354 2924207177 Bacteria 6917007
701 2924214361 2924214083 Bacteria 7080103
702 2924228794 2924221636 Bacteria 7113495
703 2924234396 2924228884 Bacteria 6633132
704 2926759030 2926754445 Bacteria 5964435
705 2926763453 2926760298 Bacteria 5505990
706 2933009962 2933006813 Bacteria 4912075
707 2933011585 2933011516 Bacteria 5439334
708 2933023384 2933016740 Bacteria 6355406
709 2933575885 2933570622 Bacteria 7023390
710 2933586878 2933586486 Bacteria 7667493
711 2933595931 2933594066 Bacteria 5594265
712 2933602215 2933599457 Bacteria 5858799
713 2935899021 2935894831 Bacteria 6620579
714 2935904400 2935901341 Bacteria 7341747
715 2936373076 2936367885 Bacteria 7324495
716 2936381220 2936375103 Bacteria 6652732
717 2936385985 2936381700 Bacteria 7006523
718 2936997572 2936996657 Bacteria 6298727
719 2937007598 2937002841 Bacteria 6934057
720 2937013956 2937009748 Bacteria 6746052
721 2937020894 2937016420 Bacteria 6782579
722 2937024771 2937023124 Bacteria 6815156
723 2937033304 2937029754 Bacteria 6424026
724 2937036084 2937036028 Bacteria 6846469
725 2937049239 2937042894 Bacteria 6741576
726 2937056141 2937049772 Bacteria 6757901
727 2937061425 2937056579 Bacteria 7107896
728 2937069220 2937063883 Bacteria 7199456
729 2937076306 2937071275 Bacteria 6984483
730 2937082356 2937078374 Bacteria 6610289
731 2937086372 2937084907 Bacteria 6618516
732 2937097284 2937091812 Bacteria 6979387
733 2937106254 2937098957 Bacteria 7249374
734 2937106986 2937106411 Bacteria 6947143
735 2937118164 2937113482 Bacteria 6505872
736 2937121741 2937119839 Bacteria 6597547
737 2937127836 2937126314 Bacteria 6771275
738 2939673011 2939669807 Bacteria 5028511
739 2954011753 2954011201 Bacteria 4762601
740 2957378890 2957375807 Bacteria 6425588
741 2957383854 2957382221 Bacteria 6737050
742 2957391478 2957388812 Bacteria 6778072
743 2957400528 2957395598 Bacteria 6822399
744 2957403943 2957402308 Bacteria 6741770
745 2957409852 2957408893 Bacteria 6558585
746 2957420548 2957415311 Bacteria 6991633
747 2957424467 2957422303 Bacteria 7172205
748 2957439745 2957437181 Bacteria 6568994
749 2957449060 2957443900 Bacteria 6869977
750 2957456777 2957450854 Bacteria 6765715
751 2957462781 2957457609 Bacteria 6967680
752 2957467499 2957464669 Bacteria 6568877
753 2957477460 2957471148 Bacteria 6797643
754 2957482479 2957478035 Bacteria 6756658
755 2957485146 2957484790 Bacteria 6703082
756 2957497285 2957491536 Bacteria 6695180
757 2957504678 2957498199 Bacteria 7126688
758 2957510698 2957505466 Bacteria 7253085
759 2960584334 2960584000 Bacteria 6864594
760 2960594968 2960591022 Bacteria 6622873
761 2960599390 2960597568 Bacteria 6550735
762 2960609060 2960603979 Bacteria 6898737
763 2960612173 2960610863 Bacteria 6691244
764 2960618174 2960617483 Bacteria 6727748
765 2960625907 2960624210 Bacteria 6875384
766 2960634754 2960631154 Bacteria 6732508
767 2960638291 2960637947 Bacteria 7296468
768 2960650760 2960645483 Bacteria 7211087
769 2960655400 2960652885 Bacteria 7083688
770 2960665721 2960660292 Bacteria 7041660
771 2960672033 2960667422 Bacteria 6763020
772 2960678020 2960674078 Bacteria 6609048
773 2960684287 2960680706 Bacteria 6624464
774 2960693680 2960687367 Bacteria 6535474
775 2960696680 2960693952 Bacteria 6749742
776 2964609637 2964607997 Bacteria 7101408
777 2964619689 2964615318 Bacteria 6809089
778 2964626219 2964621998 Bacteria 6834995
779 2964630458 2964628898 Bacteria 7083044
780 2964636461 2964636051 Bacteria 7091832
781 2964645252 2964643177 Bacteria 6820887
782 2964652693 2964649959 Bacteria 6675118
783 2964662333 2964656573 Bacteria 7100150
784 2964666246 2964663802 Bacteria 7019362
785 2964672782 2964670856 Bacteria 6851364
786 2964678261 2964678106 Bacteria 6792020
787 2964691415 2964685014 Bacteria 6839111
788 2964696560 2964691889 Bacteria 6802758
789 2964702203 2964698721 Bacteria 6765331
790 2964712483 2964705432 Bacteria 7114648
791 2964712898 2964712639 Bacteria 6695970
792 2964720229 2964719344 Bacteria 7286602
793 2967670988 2967664464 Bacteria 6948836
794 2967672034 2967671571 Bacteria 7021409
795 2967680556 2967678726 Bacteria 7264382
796 2967689162 2967686174 Bacteria 6678622
797 2967695487 2967693043 Bacteria 6804451
798 2967705879 2967699805 Bacteria 6854538
799 2967713904 2967706974 Bacteria 7186053
800 2967719096 2967714385 Bacteria 7000047
801 2967727141 2967721400 Bacteria 7073753
802 2967731939 2967728569 Bacteria 6641507
803 2967736798 2967735183 Bacteria 6827012
804 2967744095 2967742019 Bacteria 6794534
805 2967749885 2967748971 Bacteria 6733771
806 2967756234 2967755722 Bacteria 6814706
807 2967768611 2967762386 Bacteria 6923502
808 2967773789 2967769361 Bacteria 6587838
809 2967778532 2967775926 Bacteria 6738189
810 2970026271 2970019648 Bacteria 7072033
811 2970029935 2970026789 Bacteria 6785236
812 2970038835 2970033650 Bacteria 7118744
813 2970045680 2970040964 Bacteria 6731123
814 2970052365 2970047711 Bacteria 7088379
815 2970059732 2970054988 Bacteria 6611507
816 2970062315 2970061556 Bacteria 7099761
817 2970075610 2970068827 Bacteria 7123112
818 2970081663 2970076120 Bacteria 6697332
819 2970086382 2970082768 Bacteria 6183754
820 2970093948 2970088815 Bacteria 6933825
821 2970101817 2970095765 Bacteria 6936963
822 2970106878 2970102677 Bacteria 6812532
823 2970111442 2970109326 Bacteria 6863976
824 2970121495 2970116247 Bacteria 6501857
825 2970125865 2970122695 Bacteria 6625855
826 2970131896 2970129317 Bacteria 6806560
827 2970138148 2970136068 Bacteria 7207982
828 2970143730 2970143518 Bacteria 6446480
829 2970154403 2970149975 Bacteria 6779706
830 2970157585 2970156795 Bacteria 7168044
831 2970168920 2970164137 Bacteria 6861252
832 2970176842 2970170962 Bacteria 6876229
833 2970180221 2970177841 Bacteria 6768001
834 2970189601 2970184632 Bacteria 7054431
835 2970196880 2970191845 Bacteria 7032787
836 2977518426 2977516862 Bacteria 6940108
837 2977524513 2977523885 Bacteria 6960446
838 2977534668 2977530762 Bacteria 6951399
839 2977542351 2977537788 Bacteria 6929320
840 2977551425 2977544691 Bacteria 6875412
841 2977553309 2977551784 Bacteria 7125765
842 2977565493 2977558990 Bacteria 6863948
843 2977569296 2977565890 Bacteria 6901543
844 2977579189 2977572785 Bacteria 6763888
845 2977585480 2977579622 Bacteria 6772100
846 2978970179 2978969890 Bacteria 5400756
847 2979091512 2979089926 Bacteria 5670289
848 2979097032 2979095461 Bacteria 5669583
849 2979101292 2979100975 Bacteria 5423623
850 2984510753 2984509177 Bacteria 5274802
851 2984518546 2984518228 Bacteria 5277463
852 2984539103 2984537506 Bacteria 5277481
853 2984587206 2984587000 Bacteria 5263363
854 2984605797 2984601300 Bacteria 5455244
855 2995395568 2995392953 Bacteria 4539380
856 2996887398 2996887358 Bacteria 5795980
857 2996898424 2996893221 Bacteria 5823108
858 3002145843 3002141150 Bacteria 5254435
859 3005409806 3005409236 Bacteria 7188837
860 3005421512 3005416602 Bacteria 7064308
861 3005450864 3005445848 Bacteria 6906074
862 3005456883 3005452660 Bacteria 5889319
863 639648208 639633055 Bacteria 7751309
864 648737093 648276728 Bacteria 6968865
865 650842922 650716007 Bacteria 5573770
866 8003573257 8003570095 Bacteria 5747666
867 8003995235 8003992118 Bacteria 7266902
868 8004002951 8003999396 Bacteria 7063185
869 8005261961 8005258706 Bacteria 6184835
870 8005280263 8005275841 Bacteria 6929066
871 8005288335 8005282627 Bacteria 6675747
872 8005294847 8005289223 Bacteria 6634003
873 8005306992 8005301065 Bacteria 6614431
874 8005314188 8005307578 Bacteria 7395396
875 8005319785 8005314921 Bacteria 7072929
876 8005321925 8005321885 Bacteria 5795980
877 8005378856 8005376324 Bacteria 6590079
878 8005388053 8005382845 Bacteria 6732062
879 8005396991 8005395548 Bacteria 6806915
880 8005433178 8005430974 Bacteria 6689030
881 8005462576 8005460587 Bacteria 7157962
882 8005490410 8005484373 Bacteria 6297373
883 8005499958 8005497431 Bacteria 6477605
884 8005547919 8005542996 Bacteria 7077758
885 8005558054 8005556819 Bacteria 6908598
886 8005569229 8005563573 Bacteria 7153261
887 8005575486 8005570704 Bacteria 6957481
888 8005621325 8005619151 Bacteria 7030230
889 8005631386 8005626139 Bacteria 6534237
890 8005647054 8005645114 Bacteria 6950293
891 8005661272 8005658619 Bacteria 4500593
892 8005671374 8005668836 Bacteria 6953162
893 8005686984 8005682033 Bacteria 6726518
894 8005694907 8005688590 Bacteria 6610080
895 8005696082 8005695170 Bacteria 6912330
896 8018129615 8018127388 Bacteria 7351159
897 8018154834 8018150411 Bacteria 5549903
898 8018168162 8018163183 Bacteria 7277977
899 8018177947 8018176218 Bacteria 6896178
900 8023681021 8023680758 Bacteria 7729763
901 8024485817 8024479707 Bacteria 6954785
902 8024487224 8024486573 Bacteria 6540512
903 8024505288 8024501048 Bacteria 6427847
904 8046767383 8046767195 Bacteria 7547379
905 8054464317 8054460903 Bacteria 4872905
906 8056380205 8056375014 Bacteria 7006639
907 8056387501 8056382006 Bacteria 6408074
908 8057532068 8057529695 Bacteria 6306553
909 8057578491 8057575449 Bacteria 7367519
910 8057875424 8057874678 Bacteria 7494653
911 JGI24740J21852_10000274
912 JGI25155J39150_1000004
913 JGI25156J39149_1000014
914 JGI25156J39149_1000015
915 JGI25162J39368_1000930
916 JGI25154J39366_1000026
917 JGI25158J39367_1000140
918 JGI25157J39369_1000005
919 JGI25152J39213_1002440
920 JGI25152J39213_1002693
921 JGI25150J39212_1006970
922 JGI25159J45721_1000260
923 JGI25159J45721_1001000
924 JGI25151J46595_10000238
925 JGI25151J46595_10013544
926 JGI25151J46595_10028316
927 JGI25165J46597_1000715
928 JGI25153J46596_10005165
929 JGI25153J46596_10009689
930 rootH1_10050195
931 JGI25160J50197_1000022
932 JGI25160J50197_1006405
933 JGI25160J50197_1013391
934 JGI25161J50226_1000024
935 JGI25161J50226_1000050
936 JGI25161J50226_1004866
937 Ga0055526_1001371
938 Ga0055526_1002463
939 Ga0055526_1022297
940 Ga0055524_1000880
941 Ga0055524_1005903
942 Ga0055524_1014378
943 Ga0055528_1000106
944 Ga0055528_1001160
945 Ga0055528_1002460
946 Ga0055528_1020224
947 Ga0055540_1000103
948 Ga0055540_1001450
949 Ga0055540_1005697
950 Ga0055540_1015308
951 Ga0055531_10002344
952 Ga0055543_1000023
953 Ga0055543_1000025
954 Ga0055543_1001443
955 Ga0065165_1000200
956 Ga0065165_1010583
957 Ga0065165_1015319
958 Ga0065165_1016842
959 Ga0065704_10099334
960 Ga0065707_10086155
961 Ga0068869_100139575
962 Ga0070682_100278482
963 Ga0070660_100334670
964 Ga0070669_100085057
965 Ga0070674_100064095
966 Ga0070714_100375601
967 Ga0070700_100018816
968 Ga0070708_100010723
969 Ga0070678_100010927
970 Ga0070678_100515330
971 Ga0070678_100571440
972 Ga0068867_100005603
973 Ga0070706_100173652
974 Ga0070706_100385952
975 Ga0070707_100053165
976 Ga0070698_100000683
977 Ga0070699_100010118
978 Ga0070697_100023899
979 Ga0070697_100036048
980 Ga0068853_100002653
981 Ga0070672_100003609
982 Ga0070672_100205484
983 Ga0070665_100041738
984 Ga0070665_100106324
985 Ga0070665_100312963
986 Ga0070664_100323372
987 Ga0068859_100112421
988 Ga0068863_100068199
989 Ga0068858_100196888
990 Ga0068860_100007737
991 Ga0068860_100104396
992 Ga0068862_100015023
993 Ga0081455_10063610
994 Ga0081455_10358414
995 Ga0070717_10008768
996 Ga0070717_10100395
997 Ga0075365_10011384
998 Ga0075365_10084238
999 Ga0075368_10006397
1000 Ga0075368_10041422
1001 Ga0075368_10046801
1002 Ga0075363_100058622
1003 Ga0075363_100111375
1004 Ga0075364_10006628
1005 Ga0075364_10112000
1006 Ga0070712_100167100
1007 Ga0075362_10002240
1008 Ga0075362_10008554
1009 Ga0075367_10010707
1010 Ga0075369_10013141
1011 Ga0075366_10019997
1012 Ga0075370_10004585
1013 Ga0068865_100017435
1014 Ga0097620_100112427
1015 Ga0097620_100137443
1016 Ga0099826_10001105
1017 Ga0105240_10397442
1018 Ga0105243_10003302
1019 Ga0105243_10231545
1020 Ga0105241_10152911
1021 Ga0105237_10000188
1022 Ga0105237_10699753
1023 Ga0105249_10132075
1024 Ga0105249_10435134
1025 Ga0123341_1000095
1026 Ga0123342_1014091
1027 Ga0105239_10010200
1028 Ga0157373_10001757
1029 Ga0157373_10094929
1030 Ga0157373_10247589
1031 Ga0157371_10000002
1032 Ga0157370_10000211
1033 Ga0157369_10011908
1034 Ga0157369_10079367
1035 Ga0157378_10247293
1036 Ga0157378_10380163
1037 Ga0163162_10009513
1038 Ga0163162_10190716
1039 Ga0157375_10013667
1040 Ga0157380_10017418
1041 Ga0182008_10003079
1042 Ga0157379_10024269
1043 Ga0157376_10339119
1044 Ga0182007_10001612
1045 Ga0182005_1005419
1046 Ga0183362_10002
1047 Ga0163161_10059617
1048 Ga0209435_100009
1049 Ga0209436_100053
1050 Ga0209436_118015
1051 Ga0209437_100057
1052 Ga0207425_1001821
1053 Ga0209646_1000018
1054 Ga0209026_1000043
1055 Ga0209759_1000007
1056 Ga0209129_1000016
1057 Ga0209129_1013604
1058 Ga0209233_1000130
1059 Ga0209455_1006859
1060 Ga0209673_1000005
1061 Ga0209673_1000139
1062 Ga0209673_1002223
1063 Ga0209673_1004169
1064 Ga0209130_1000031
1065 Ga0209130_1000251
1066 Ga0209130_1004762
1067 Ga0209676_1017732
1068 Ga0209025_1000126
1069 Ga0209025_1000237
1070 Ga0209025_1002704
1071 Ga0209025_1002712
1072 Ga0209564_1000331
1073 Ga0209564_1000577
1074 Ga0209564_1002036
1075 Ga0209564_1003502
1076 Ga0209758_1000903
1077 Ga0209758_1000931
1078 Ga0209758_1001250
1079 Ga0209758_1001440
1080 Ga0209758_1003844
1081 Ga0209050_1004134
1082 Ga0209256_1000299
1083 Ga0209256_1000961
1084 Ga0209256_1011278
1085 Ga0209256_1015383
1086 Ga0207426_1000042
1087 Ga0207426_1000082
1088 Ga0207426_1000290
1089 Ga0209051_1000095
1090 Ga0209051_1000950
1091 Ga0209051_1001462
1092 Ga0209051_1030477
1093 Ga0209051_1071002
1094 Ga0209257_1001831
1095 Ga0209257_1011109
1096 Ga0209257_1016144
1097 Ga0209257_1034763
1098 Ga0207682_10104749
1099 Ga0207642_10047277
1100 Ga0207647_10044578
1101 Ga0207684_10117644
1102 Ga0207646_10033232
1103 Ga0207694_10136647
1104 Ga0207709_10035969
1105 Ga0207704_10011032
1106 Ga0207691_10021819
1107 Ga0207691_10076699
1108 Ga0207689_10080788
1109 Ga0207679_10221969
1110 Ga0207668_10516602
1111 Ga0207639_10020434
1112 Ga0207639_10065746
1113 Ga0207678_10213137
1114 Ga0207708_10031924
1115 Ga0207648_10004328
1116 Ga0207675_100001137
1117 Ga0207675_100140317
1118 Ga0207683_10010219
1119 Ga0207683_10133634
1120 Ga0207683_10207260
1121 Ga0209371_1000012
1122 Ga0209371_1001153
1123 Ga0209371_1008000
1124 Ga0209813_10002465
1125 Ga0209813_10013890
1126 Ga0209813_10020257
1127 Ga0268266_10000728
1128 Ga0268266_10069055
1129 Ga0268265_10002980
1130 Ga0268265_10016306
1131 Ga0268264_10002471
1132 Ga0268264_10385782
1133 Ga0307515_10029370
1134 Ga0268256_1000013
1135 Ga0268256_1001230
1136 Ga0307513_10021053
1137 Ga0307516_10033201
1138 Ga0307405_10086071
1139 Ga0307412_10215704
1140 Ga0307409_100225484
1141 Ga0307415_100227527
1142 Ga0373923_0014931
1143 Ga0373946_0040860
1144 Ga0373935_0083954
1145 Ga0373927_0183007
1146 Ga0373933_0143145
1147 Ga0373937_0024706
1148 Ga0395900_0592471
1149 Ga0395898_0192241
1150 Ga0395898_0232159
1151 Ga0395905_0011131
1152 Ga0237819_10937
1153 Ga0436360_0181196
1154 Ga0436360_0631865
1155 Ga0436363_0080435
1156 Ga0451791_0306668
1157 Ga0451798_1010442
1158 Ga0451804_1133873
1159 Ga0451833_0067109
1160 Ga0451839_0001838
1161 Ga0451847_0304978
1162 Ga0451843_0634892
1163 Ga0451853_0324505
1164 Ga0439449_0043230
1165 Ga0466960_0039614
1166 Ga0495592_0107470
1167 Ga0495605_0075507
1168 Ga0495664_0075500
1169 Ga0495664_0105165
1170 Ga0495664_0106357
1171 Ga0495585_0012907
1172 Ga0495583_0008439
1173 Ga0495606_0008440
1174 Ga0495610_0091406
1175 Ga0495620_0038765
1176 Ga0495643_0005020
1177 Ga0495643_0014621
1178 Ga0495648_0022370
1179 Ga0495640_0062394
1180 Ga0495587_0132874
1181 Ga0495633_0022066
1182 Ga0495633_0026340
1183 Ga0495625_0130252
1184 Ga0495588_0001204
1185 Ga0495657_0138142
1186 Ga0495599_0052832
1187 Ga0495599_0311899
1188 Ga0495658_0132694
1189 Ga0495670_0051364
1190 Ga0495671_0139570
1191 Ga0495649_0018570
1192 Ga0495600_0121462
1193 Ga0495660_0078075
1194 Ga0495674_0272488
1195 Ga0495683_0107685
1196 Ga0495681_0001104
1197 Ga0495686_0067976
1198 Ga0495615_0008259
1199 Ga0496102_0442358
1200 Ga0496106_0000288
1201 Ga0496106_0188584
1202 Ga0496109_0161522
1203 Ga0496110_0013366
1204 Ga0496111_0107242
1205 Ga0496113_0027381
1206 Ga0496116_0000042
1207 Ga0496116_0012229
1208 Ga0496116_0024746
1209 Ga0496117_0000016
1210 Ga0496117_0139850
1211 Ga0496118_0001168
1212 Ga0496118_0011735
1213 Ga0496118_0112514
1214 Ga0496119_0130517
1215 Ga0496119_0136800
1216 Ga0496120_0000056
1217 Ga0496121_0000240
1218 Ga0496121_0000836
1219 Ga0496121_0001142
1220 Ga0496121_0008563
1221 Ga0496121_0058530
1222 Ga0496121_0069238
1223 Ga0496121_0157630
1224 Ga0496121_0195744
1225 Ga0496121_0281548
1226 Ga0496122_0000002
1227 Ga0496122_0177009
1228 Ga0496122_0254149
1229 Ga0496123_0000002
1230 Ga0496123_0106524
1231 Ga0496123_0114618
1232 Ga0496123_0125841
1233 Ga0496124_0000080
1234 Ga0496124_0045753
1235 Ga0496124_0049873
1236 Ga0496124_0068294
1237 Ga0496124_0164243
1238 Ga0496125_0000129
1239 Ga0496125_0049912
1240 Ga0496126_0000053
1241 Ga0496126_0031713
1242 Ga0496126_0031811
1243 Ga0496126_0165266
1244 Ga0501032_0014474
1245 Ga0501032_0122718
1246 Ga0501033_0032940
1247 Ga0501034_0013702
1248 Ga0501034_0027677
1249 Ga0501034_0174705
1250 Ga0501034_0187026
1251 Ga0501034_0200903
1252 Ga0501034_0323614
1253 Ga0501036_0029613
1254 Ga0501037_0016479
1255 Ga0501037_0084737
1256 Ga0501038_0021565
1257 Ga0501038_0046382
1258 Ga0501039_0033040
1259 Ga0501043_0027262
1260 Ga0501046_0181114
1261 Ga0501046_0181680
1262 Ga0501047_0083930
1263 Ga0501047_0232184
1264 Ga0501068_0249848
1265 Ga0501070_0027205
1266 Ga0501070_0032357
1267 Ga0501073_0111760
1268 Ga0501073_0134623
1269 Ga0501238_003101
1270 Ga0501035_0093121
1271 Ga0501035_0234377
1272 Ga0501044_0004981
1273 Ga0501044_0250692
1274 nmdc:mga03n38_30649_c1
1275 nmdc:mga03n38_6063_c1
1276 nmdc:mga00v17_252_c1
1277 nmdc:mga00v17_3_c1
1278 nmdc:mga0yw44_286_c1
1279 nmdc:mga0k408_45190_c1
1280 nmdc:mga0k408_54279_c1
1281 nmdc:mga06z11_60085_c1
1282 nmdc:mga04h51_21929_c1
1283 nmdc:mga07m45_264008_c1
1284 nmdc:mga0sz30_104_c1
1285 nmdc:mga0sz30_27300_c1
1286 Ga0500578_0084843
1287 Ga0500572_002948
1288 Ga0500618_000204
1289 Ga0500618_006937
1290 Ga0500658_0000086
1291 Ga0500568_0007952
1292 Ga0500604_0000460
1293 Ga0500616_0000164
1294 Ga0500622_0000559
1295 Ga0500622_0016953
1296 Ga0500624_000758
1297 Ga0500634_0000366
1298 Ga0500634_0002193
1299 Ga0500634_0010912
1300 Ga0500636_0000372
1301 Ga0500636_0000392
1302 Ga0587067_003653
1303 Ga0587072_000950
1304 Ga0501082_0018766
1305 2513569939
1306 2509109477
1307 2509378213
1308 2509386983
1309 2509442511
1310 2510132964
1311 2510307612
1312 2510840357
1313 2510894345
1314 2510899370
1315 2511133074
1316 2511168701
1317 2511181453
1318 2511200216
1319 2511503213
1320 2512534485
1321 2512973706
1322 2513575211
1323 2513585178
1324 2513595280
1325 2513601776
1326 2513616963
1327 2513633107
1328 2513710155
1329 2513866727
1330 2513884179
1331 2513903508
1332 2513911441
1333 2513928829
1334 2514003640
1335 2514021789
1336 2515111916
1337 2515610950
1338 2515633718
1339 2515645108
1340 2515660249
1341 2515738907
1342 2516206344
1343 2516894645
1344 2517035655
1345 2517076084
1346 2517094836
1347 2517406465
1348 2517571291
1349 2520379453
1350 2524450563
1351 2524458596
1352 2530645223
1353 2535520187
1354 2537876817
1355 2551679629
1356 2551687372
1357 2551691563
1358 2551700716
1359 2551715511
1360 2551723034
1361 2551726795
1362 2551736014
1363 2551744717
1364 2554245666
1365 2558867301
1366 2559296505
1367 2585204273
1368 2585222371
1369 2585231972
1370 2585258731
1371 2585271812
1372 2585279822
1373 2585326636
1374 2585333813
1375 2585401466
1376 2585528241
1377 2585531774
1378 2585540439
1379 2585544677
1380 2585551278
1381 2585563823
1382 2585821159
1383 2585838650
1384 2585842901
1385 2585896980
1386 2585907162
1387 2585997420
1388 2586002026
1389 2587982844
1390 2599414846
1391 2599603000
1392 2599724259
1393 2600376169
1394 2601610621
1395 2601747049
1396 2616292746
1397 2616306613
1398 2616551248
1399 2617382992
1400 2643857047
1401 2643917549
1402 2644003483
1403 2644195571
1404 2644242314
1405 2644492602
1406 2644520632
1407 2644742730
1408 2671113373
1409 2671695279
1410 2692314746
1411 2719180888
1412 2719385492
1413 2719665317
1414 2719731637
1415 2720491737
1416 2720613006
1417 2720619856
1418 2720631284
1419 2720775011
1420 2721146982
1421 2721158512
1422 2721163900
1423 2721399240
1424 2722840070
1425 2723026650
1426 2723560264
1427 2723566831
1428 2724038053
1429 2724044393
1430 2724089618
1431 2724104096
1432 2724109905
1433 2725949846
1434 2730107586
1435 2730164125
1436 2730298144
1437 2738801519
1438 2739037931
1439 2753463911
1440 2757569225
1441 2766062343
1442 2778179028
1443 2793299155
1444 2793313806
1445 2793321172
1446 2793326398
1447 2793337020
1448 2793341239
1449 2793347588
1450 2793352341
1451 2793361482
1452 2793366493
1453 2802717342
1454 2802724669
1455 2802729421
1456 2802736766
1457 2802743172
1458 2802749702
1459 2805927677
1460 2805936154
1461 2806045460
1462 2806051737
1463 2806061781
1464 2806067962
1465 2806072689
1466 2808986956
1467 2819560741
1468 2819611615
1469 2819638709
1470 2835317168
1471 2838018852
1472 2838025445
1473 2838031040
1474 2838039435
1475 2838043140
1476 2838052082
1477 2838067301
1478 2838071416
1479 2838667609
1480 2838670123
1481 2838677768
1482 2838682542
1483 2838689155
1484 2838697113
1485 2838702494
1486 2838709646
1487 2838717327
1488 2838722063
1489 2838728076
1490 2838730503
1491 2838743444
1492 2841849737
1493 2841854880
1494 2841864250
1495 2841864860
1496 2842077820
1497 2842110853
1498 2842119672
1499 2842127515
1500 2842132661
1501 2842146961
1502 2842154655
1503 2842157743
1504 2842164953
1505 2842173152
1506 2842178275
1507 2842180672
1508 2842190434
1509 2842196943
1510 2842201013
1511 2842206341
1512 2842214748
1513 2842220682
1514 2842227469
1515 2842231276
1516 2842239059
1517 2842244623
1518 2842252026
1519 2842258436
1520 2842267472
1521 2842273175
1522 2842279798
1523 2842287445
1524 2842291482
1525 2842300143
1526 2842309342
1527 2842315462
1528 2842318211
1529 2842347212
1530 2842359054
1531 2842366603
1532 2842373109
1533 2842377878
1534 2842386181
1535 2842397357
1536 2842405026
1537 2842411608
1538 2842417941
1539 2842424926
1540 2842431950
1541 2842438063
1542 2842444876
1543 2842451791
1544 2842465746
1545 2842472680
1546 2842477772
1547 2842485078
1548 2842492827
1549 2842496478
1550 2842504356
1551 2842511578
1552 2842521003
1553 2844459490
1554 2847420198
1555 2848995096
1556 2850082537
1557 2852391877
1558 2854902099
1559 2854921325
1560 2855827271
1561 2855842653
1562 2855874617
1563 2857523750
1564 2858803464
1565 2882462471
1566 2891051284
1567 2894233508
1568 2896387545
1569 2899793509
1570 2899847704
1571 2915982557
1572 2915991167
1573 2916000268
1574 2916007194
1575 2916008428
1576 2916019690
1577 2916026734
1578 2916033535
1579 2916039641
1580 2916047019
1581 2916052836
1582 2916059548
1583 2916065155
1584 2916071223
1585 2916078054
1586 2919102931
1587 2919117593
1588 2919170193
1589 2919173716
1590 2919411171
1591 2921211456
1592 2921244031
1593 2921248742
1594 2921254682
1595 2921262131
1596 2921270677
1597 2921288814
1598 2921296337
1599 2921298086
1600 2923556953
1601 2924147723
1602 2924156448
1603 2924160182
1604 2924170218
1605 2924177618
1606 2924186297
1607 2924191583
1608 2924195237
1609 2924204794
1610 2924209354
1611 2924214361
1612 2924228794
1613 2924234396
1614 2926759030
1615 2926763453
1616 2933009962
1617 2933011585
1618 2933023384
1619 2933575885
1620 2933586878
1621 2933595931
1622 2933602215
1623 2935899021
1624 2935904400
1625 2936373076
1626 2936381220
1627 2936385985
1628 2936997572
1629 2937007598
1630 2937013956
1631 2937020894
1632 2937024771
1633 2937033304
1634 2937036084
1635 2937049239
1636 2937056141
1637 2937061425
1638 2937069220
1639 2937076306
1640 2937082356
1641 2937086372
1642 2937097284
1643 2937106254
1644 2937106986
1645 2937118164
1646 2937121741
1647 2937127836
1648 2939673011
1649 2954011753
1650 2957378890
1651 2957383854
1652 2957391478
1653 2957400528
1654 2957403943
1655 2957409852
1656 2957420548
1657 2957424467
1658 2957439745
1659 2957449060
1660 2957456777
1661 2957462781
1662 2957467499
1663 2957477460
1664 2957482479
1665 2957485146
1666 2957497285
1667 2957504678
1668 2957510698
1669 2960584334
1670 2960594968
1671 2960599390
1672 2960609060
1673 2960612173
1674 2960618174
1675 2960625907
1676 2960634754
1677 2960638291
1678 2960650760
1679 2960655400
1680 2960665721
1681 2960672033
1682 2960678020
1683 2960684287
1684 2960693680
1685 2960696680
1686 2964609637
1687 2964619689
1688 2964626219
1689 2964630458
1690 2964636461
1691 2964645252
1692 2964652693
1693 2964662333
1694 2964666246
1695 2964672782
1696 2964678261
1697 2964691415
1698 2964696560
1699 2964702203
1700 2964712483
1701 2964712898
1702 2964720229
1703 2967670988
1704 2967672034
1705 2967680556
1706 2967689162
1707 2967695487
1708 2967705879
1709 2967713904
1710 2967719096
1711 2967727141
1712 2967731939
1713 2967736798
1714 2967744095
1715 2967749885
1716 2967756234
1717 2967768611
1718 2967773789
1719 2967778532
1720 2970026271
1721 2970029935
1722 2970038835
1723 2970045680
1724 2970052365
1725 2970059732
1726 2970062315
1727 2970075610
1728 2970081663
1729 2970086382
1730 2970093948
1731 2970101817
1732 2970106878
1733 2970111442
1734 2970121495
1735 2970125865
1736 2970131896
1737 2970138148
1738 2970143730
1739 2970154403
1740 2970157585
1741 2970168920
1742 2970176842
1743 2970180221
1744 2970189601
1745 2970196880
1746 2977518426
1747 2977524513
1748 2977534668
1749 2977542351
1750 2977551425
1751 2977553309
1752 2977565493
1753 2977569296
1754 2977579189
1755 2977585480
1756 2978970179
1757 2979091512
1758 2979097032
1759 2979101292
1760 2984510753
1761 2984518546
1762 2984539103
1763 2984587206
1764 2984605797
1765 2995395568
1766 2996887398
1767 2996898424
1768 3002145843
1769 3005409806
1770 3005421512
1771 3005450864
1772 3005456883
1773 639648208
1774 648737093
1775 650842922
1776 8003573257
1777 8003995235
1778 8004002951
1779 8005261961
1780 8005280263
1781 8005288335
1782 8005294847
1783 8005306992
1784 8005314188
1785 8005319785
1786 8005321925
1787 8005378856
1788 8005388053
1789 8005396991
1790 8005433178
1791 8005462576
1792 8005490410
1793 8005499958
1794 8005547919
1795 8005558054
1796 8005569229
1797 8005575486
1798 8005621325
1799 8005631386
1800 8005647054
1801 8005661272
1802 8005671374
1803 8005686984
1804 8005694907
1805 8005696082
1806 8018129615
1807 8018154834
1808 8018168162
1809 8018177947
1810 8023681021
1811 8024485817
1812 8024487224
1813 8024505288
1814 8046767383
1815 8054464317
1816 8056380205
1817 8056387501
1818 8057532068
1819 8057578491
1820 8057875424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

138

343

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8968 13 276
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.89 13 276
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8825 13 276
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8734 13 276
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.8546 13 278
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9136 40 279 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9047 13 272 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9028 40 279 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8936 41 279 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8915 41 274 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0S6UP24-F1-model_v4 Hypothetical ABC transporter permease protein yurN 0.9612 19 280 GO:0005886
GO:0055085
AF-A0A0S6UP24-F1-model_v4 Hypothetical ABC transporter permease protein yurN 0.9542 19 280 GO:0005886
GO:0055085
AF-A0A074TH60-F1-model_v4 Sugar ABC transporter permease 0.9528 13 279 GO:0005886
GO:0055085
AF-A0A8A6KC01-F1-model_v4 deleted 0.9519 13 280
AF-A0A7T8XUY2-F1-model_v4 deleted 0.9466 13 278

Map