F485489

General Info

Members Datasets Scaffolds Average Seq Length
911 778 1822 460

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221609|2644061966
Length 460
Sequence DYDLFVIGGGSGGVRAGRVAASLGKRVAVAEEYRFGGTCVIRGCVPKKLFVYASQFHEHFEDAAGYGWQVGTPTFDWKALIAAKDKEIARLEGLYRRGLDTNGAEIIDSRAELVDAHTVRLVASGKTVTAERIVIATGGAPNPHAALPGHELCISSNEAFDLAKLPRSILIAGGGYIAVEFANIFHGLGVQVTLIYRGKEILSRFDHDMRQGLHKAMVDKGIRILLADVIENVAKVEGAGGGLIATTKNGETIAVDTVMLALGRDPNTRGLGLEAAGVAMDERGAIIVDPYSRTNVPSIWALGDVTNRVQLTPVAIHEAMCFIETEYRGKPTVPDHDLIATAVFSQPEIGTVGLSEEDAAQRYAEIEVYRAEFRPMKATLSGRAEKMIMKLVVDAASRKVLGAHILGHDAGEMVQLLGISLKAGVTKDDFDRTMAVHPTASEELVTMYQPSYRIKNGQRA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
42 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
43 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
44 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
45 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
46 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
47 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
75 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
80 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
87 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
143 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
152 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
153 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
154 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
155 2643221609 Acidovorax sp. Root217 Isolate Unclassified
156 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
157 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
158 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
159 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
160 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
161 2509276019 Ensifer aridi TW10 Isolate Nodule
162 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
163 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
164 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
165 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
166 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
167 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
168 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
169 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
170 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
171 2512875024
172 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
173 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
174 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
175 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
176 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
177 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
178 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
179 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
180 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
181 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
182 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
183 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
184 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
185 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
186 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
187 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
188 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
189 2534681786 Brucella suis 92/29 Isolate Unclassified
190 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
191 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
192 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
193 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
194 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
195 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
196 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
197 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
198 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
199 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
200 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
201 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
202 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
203 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
204 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
205 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
206 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
207 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
208 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
209 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
210 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
211 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
212 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
213 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
214 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
215 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
216 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
217 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
218 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
219 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
220 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
221 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
222 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
223 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
224 2643221557 Ensifer sp. Root558 Isolate Unclassified
225 2643221558 Rhizobium sp. Root149 Isolate Unclassified
226 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
227 2643221568 Rhizobium sp. Root564 Isolate Unclassified
228 2643221582 Rhizobium sp. Root651 Isolate Unclassified
229 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
230 2643221607 Rhizobium sp. Root73 Isolate Unclassified
231 2643221610 Ensifer sp. Root74 Isolate Unclassified
232 2643221611 Acidovorax sp. Root219 Isolate Unclassified
233 2643221618 Ensifer sp. Root231 Isolate Unclassified
234 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
235 2643221626 Ensifer sp. Root31 Isolate Unclassified
236 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
237 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
238 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
239 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
240 2643221655 Ensifer sp. Root1252 Isolate Unclassified
241 2643221659 Ensifer sp. Root127 Isolate Unclassified
242 2643221668 Ensifer sp. Root423 Isolate Unclassified
243 2643221675 Ensifer sp. Root1298 Isolate Unclassified
244 2643221680 Ensifer sp. Root1312 Isolate Unclassified
245 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
246 2643221688 Rhizobium sp. Root482 Isolate Unclassified
247 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
248 2643221693 Rhizobium sp. Root491 Isolate Unclassified
249 2643221698 Ensifer sp. Root142 Isolate Unclassified
250 2643221712 Ensifer sp. Root258 Isolate Unclassified
251 2643221718 Rhizobium sp. Root268 Isolate Unclassified
252 2643221719 Rhizobium sp. Root274 Isolate Unclassified
253 2643221723 Ensifer sp. Root278 Isolate Unclassified
254 2643221726 Ensifer sp. Root954 Isolate Unclassified
255 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
256 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
257 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
258 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
259 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
260 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
261 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
262 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
263 2738543012 Acidovorax sp. CF301 Isolate Unclassified
264 2738543024 Aminobacter sp. AP02 Isolate Unclassified
265 2751185800 Brucella pituitosa AA2 Isolate Unclassified
266 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
267 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
268 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
269 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
270 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
271 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
272 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
273 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
274 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
275 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
276 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
277 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
278 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
279 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
280 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
281 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
282 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
283 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
284 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
285 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
286 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
287 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
288 2802429633 Rhizobium anhuiense J3 Isolate Nodule
289 2802429634 Rhizobium anhuiense S10 Isolate Nodule
290 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
291 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
292 2802429637 Rhizobium anhuiense C15 Isolate Nodule
293 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
294 2816332133 Acidovorax radicis 2721A Isolate Unclassified
295 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
296 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
297 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
298 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
299 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
300 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
301 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
302 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
303 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
304 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
305 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
306 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
307 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
308 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
309 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
310 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
311 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
312 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
313 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
314 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
315 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
316 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
317 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
318 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
319 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
320 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
321 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
322 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
323 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
324 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
325 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
326 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
327 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
328 2844163670 Ensifer sp. 1H6 Isolate Unclassified
329 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
330 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
331 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
332 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
333 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
334 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
335 2854911287 Brucella lupini LUP21 Isolate Unclassified
336 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
337 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
338 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
339 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
340 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
341 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
342 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
343 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
344 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
345 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
346 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
347 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
348 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
349 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
350 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
351 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
352 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
353 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
354 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
355 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
356 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
357 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
358 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
359 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
360 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
361 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
362 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
363 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
364 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
365 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
366 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
367 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
368 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
369 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
370 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
371 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
372 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
373 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
374 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
375 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
376 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
377 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
378 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
379 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
380 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
381 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
382 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
383 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
384 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
385 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
386 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
387 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
388 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
389 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
390 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
391 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
392 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
393 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
394 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
395 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
396 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
397 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
398 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
399 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
400 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
401 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
402 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
403 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
404 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
405 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
406 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
407 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
408 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
409 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
410 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
411 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
412 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
413 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
414 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
415 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
416 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
417 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
418 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
419 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
420 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
421 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
422 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
423 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
424 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
425 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
426 2904456579 Variovorax sp. 2002 Isolate Unclassified
427 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
428 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
429 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
430 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
431 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
432 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
433 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
434 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
435 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
436 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
437 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
438 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
439 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
440 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
441 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
442 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
443 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
444 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
445 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
446 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
447 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
448 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
449 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
450 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
451 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
452 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
453 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
454 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
455 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
456 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
457 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
458 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
459 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
460 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
461 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
462 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
463 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
464 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
465 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
466 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
467 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
468 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
469 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
470 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
471 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
472 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
473 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
474 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
475 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
476 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
477 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
478 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
479 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
480 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
481 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
482 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
483 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
484 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
485 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
486 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
487 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
488 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
489 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
490 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
491 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
492 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
493 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
494 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
495 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
496 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
497 2929520902 Variovorax beijingensis 502 Isolate Unclassified
498 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
499 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
500 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
501 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
502 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
503 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
504 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
505 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
506 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
507 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
508 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
509 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
510 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
511 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
512 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
513 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
514 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
515 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
516 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
517 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
518 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
519 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
520 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
521 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
522 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
523 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
524 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
525 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
526 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
527 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
528 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
529 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
530 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
531 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
532 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
533 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
534 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
535 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
536 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
537 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
538 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
539 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
540 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
541 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
542 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
543 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
544 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
545 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
546 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
547 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
548 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
549 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
550 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
551 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
552 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
553 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
554 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
555 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
556 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
557 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
558 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
559 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
560 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
561 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
562 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
563 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
564 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
565 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
566 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
567 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
568 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
569 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
570 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
571 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
572 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
573 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
574 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
575 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
576 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
577 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
578 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
579 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
580 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
581 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
582 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
583 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
584 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
585 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
586 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
587 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
588 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
589 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
590 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
591 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
592 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
593 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
594 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
595 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
596 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
597 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
598 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
599 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
600 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
601 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
602 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
603 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
604 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
605 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
606 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
607 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
608 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
609 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
610 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
611 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
612 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
613 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
614 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
615 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
616 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
617 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
618 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
619 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
620 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
621 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
622 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
623 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
624 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
625 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
626 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
627 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
628 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
629 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
630 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
631 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
632 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
633 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
634 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
635 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
636 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
637 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
638 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
639 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
640 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
641 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
642 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
643 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
644 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
645 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
646 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
647 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
648 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
649 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
650 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
651 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
652 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
653 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
654 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
655 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
656 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
657 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
658 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
659 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
660 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
661 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
662 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
663 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
664 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
665 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
666 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
667 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
668 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
669 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
670 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
671 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
672 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
673 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
674 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
675 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
676 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
677 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
678 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
679 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
680 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
681 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
682 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
683 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
684 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
685 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
686 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
687 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
688 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
689 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
690 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
691 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
692 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
693 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
694 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
695 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
696 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
697 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
698 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
699 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
700 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
701 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
702 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
703 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
704 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
705 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
706 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
707 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
708 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
709 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
710 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
711 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
712 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
713 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
714 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
715 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
716 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
717 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
718 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
719 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
720 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
721 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
722 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
723 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
724 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
725 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
726 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
727 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
728 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
729 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
730 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
731 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
732 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
733 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
734 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
735 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
736 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
737 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
738 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
739 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
740 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
741 3004167301 Mesorhizobium loti 582 Isolate Unclassified
742 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
743 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
744 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
745 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
746 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
747 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
748 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
749 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
750 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
751 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
752 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
753 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
754 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
755 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
756 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
757 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
758 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
759 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
760 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
761 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
762 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
763 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
764 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
765 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
766 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
767 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
768 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
769 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
770 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
771 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
772 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
773 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
774 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
775 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
776 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
777 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
778 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 31.17
Metatranscriptomes 0.11
Isolates 68.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 9.66
Nodule 52.36
Rhizoplane 1.43
Rhizosphere 18.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10006473 3300001989 Bacteria 4419
2 JGI25157J39369_1000750 3300002741 Bacteria 17062
3 JGI25152J39213_1010229 3300002773 Bacteria 2164
4 JGI25151J46595_10000134 3300003187 Bacteria 98987
5 JGI25151J46595_10028641 3300003187 Bacteria 2216
6 JGI25165J46597_1000033 3300003214 Bacteria 293030
7 JGI25153J46596_10001403 3300003215 Bacteria 14441
8 JGI25153J46596_10011152 3300003215 Bacteria 3996
9 JGI25160J50197_1000011 3300003354 Bacteria 275577
10 JGI25160J50197_1000572 3300003354 Bacteria 20786
11 JGI25161J50226_1000232 3300003374 Bacteria 34042
12 JGI25161J50226_1001043 3300003374 Bacteria 9517
13 Ga0006562J51391_1008942 3300003578 Bacteria 4280
14 Ga0055542_1000654 3300003762 Bacteria 28482
15 Ga0055529_1002419 3300003763 Bacteria 3634
16 Ga0055526_1002003 3300003771 Bacteria 14035
17 Ga0055526_1003319 3300003771 Bacteria 10294
18 Ga0055524_1001915 3300003775 Bacteria 11254
19 Ga0055536_1002697 3300003781 Bacteria 9850
20 Ga0055528_1001460 3300003790 Bacteria 14399
21 Ga0055531_10000733 3300003794 Bacteria 27746
22 Ga0055531_10013794 3300003794 Bacteria 3698
23 Ga0058692_1001202 3300003856 Bacteria 9918
24 Ga0058692_1004873 3300003856 Bacteria 3902
25 Ga0055543_1000354 3300004625 Bacteria 31120
26 Ga0055543_1002191 3300004625 Bacteria 6697
27 Ga0065165_1000018 3300005262 Bacteria 275082
28 Ga0065165_1001860 3300005262 Bacteria 20499
29 Ga0065165_1009367 3300005262 Bacteria 4403
30 Ga0065704_10072842 3300005289 Bacteria 7936
31 Ga0070665_100060247 3300005548 Bacteria 3805
32 Ga0068856_100280332 3300005614 Bacteria 1683
33 Ga0081539_10001646 3300005985 Bacteria 36279
34 Ga0075365_10002027 3300006038 Bacteria 9621
35 Ga0075365_10047938 3300006038 Bacteria 2810
36 Ga0075365_10114197 3300006038 Bacteria 1858
37 Ga0075368_10013307 3300006042 Bacteria 3020
38 Ga0075363_100066825 3300006048 Bacteria 1947
39 Ga0075364_10003103 3300006051 Bacteria 9397
40 Ga0075362_10002505 3300006177 Bacteria 6180
41 Ga0075362_10028613 3300006177 Bacteria 2394
42 Ga0075367_10027101 3300006178 Bacteria 3256
43 Ga0075367_10058803 3300006178 Bacteria 2287
44 Ga0075367_10117277 3300006178 Bacteria 1638
45 Ga0075369_10012429 3300006186 Bacteria 3364
46 Ga0079104_1000022 3300006946 Bacteria 223522
47 Ga0079104_1004678 3300006946 Bacteria 5739
48 Ga0079104_1007604 3300006946 Bacteria 3895
49 Ga0099826_10000184 3300006948 Bacteria 26251
50 Ga0099826_10009956 3300006948 Bacteria 7107
51 Ga0105237_10180725 3300009545 Bacteria 2110
52 Ga0105238_10028151 3300009551 Bacteria 5725
53 Ga0123342_1000455 3300009766 Bacteria 64500
54 Ga0157371_10000015 3300013102 Bacteria 339838
55 Ga0157371_10004053 3300013102 Bacteria 12959
56 Ga0157370_10001244 3300013104 Bacteria 31808
57 Ga0157370_10001762 3300013104 Bacteria 26694
58 Ga0171463_1008 3300013249 Bacteria 299022
59 Ga0182008_10020318 3300014497 Bacteria 3421
60 Ga0182006_1006962 3300015261 Bacteria 5205
61 Ga0183363_1212 3300015690 Bacteria 11717
62 Ga0214544_1000691 3300021320 Bacteria 64943
63 Ga0214542_1000019 3300021321 Bacteria 199445
64 Ga0214542_1022261 3300021321 Bacteria 4105
65 Ga0214543_1000010 3300021327 Bacteria 364844
66 Ga0214543_1000011 3300021327 Bacteria 344093
67 Ga0228711_1000007 3300022739 Bacteria 202413
68 Ga0228710_1000007 3300022740 Bacteria 189104
69 Ga0209436_100281 3300025208 Bacteria 23411
70 Ga0207425_1004590 3300025245 Bacteria 4100
71 Ga0207425_1010512 3300025245 Bacteria 2250
72 Ga0209026_1000002 3300025250 Bacteria 1136158
73 Ga0209148_1000072 3300025254 Bacteria 325292
74 Ga0209759_1000146 3300025256 Bacteria 121497
75 Ga0209129_1000659 3300025258 Bacteria 23019
76 Ga0209233_1000027 3300025261 Bacteria 652089
77 Ga0209455_1000153 3300025272 Bacteria 124411
78 Ga0209673_1000552 3300025273 Bacteria 60264
79 Ga0209130_1000029 3300025284 Bacteria 323399
80 Ga0209676_1001236 3300025292 Bacteria 26898
81 Ga0209676_1001652 3300025292 Bacteria 19497
82 Ga0209025_1000094 3300025294 Bacteria 241080
83 Ga0209025_1000119 3300025294 Bacteria 210606
84 Ga0209025_1000166 3300025294 Bacteria 164692
85 Ga0209025_1000843 3300025294 Bacteria 48547
86 Ga0209025_1032078 3300025294 Bacteria 2466
87 Ga0209564_1000469 3300025295 Bacteria 67659
88 Ga0209564_1000501 3300025295 Bacteria 64474
89 Ga0209758_1000155 3300025297 Bacteria 160455
90 Ga0209758_1000218 3300025297 Bacteria 124300
91 Ga0209758_1047111 3300025297 Bacteria 1547
92 Ga0209050_1003018 3300025298 Bacteria 13041
93 Ga0209256_1000194 3300025299 Bacteria 116709
94 Ga0209256_1000946 3300025299 Bacteria 35213
95 Ga0209256_1001513 3300025299 Bacteria 23507
96 Ga0207426_1000039 3300025302 Bacteria 439937
97 Ga0207426_1000074 3300025302 Bacteria 323399
98 Ga0209051_1000998 3300025303 Bacteria 27177
99 Ga0209051_1002938 3300025303 Bacteria 11659
100 Ga0207647_10006306 3300025904 Bacteria 8636
101 Ga0207694_10033071 3300025924 Bacteria 3961
102 Ga0207640_10032392 3300025981 Bacteria 3240
103 Ga0207702_10139406 3300026078 Bacteria 2192
104 Ga0209281_1000036 3300027111 Bacteria 369415
105 Ga0209281_1000047 3300027111 Bacteria 326514
106 Ga0209281_1000128 3300027111 Bacteria 199265
107 Ga0209281_1000483 3300027111 Bacteria 55407
108 Ga0209371_1000021 3300027312 Bacteria 555864
109 Ga0209371_1001463 3300027312 Bacteria 15921
110 Ga0209282_1000034 3300027666 Bacteria 140100
111 Ga0209282_1003372 3300027666 Bacteria 9484
112 Ga0209282_1004065 3300027666 Bacteria 8797
113 Ga0268266_10021580 3300028379 Bacteria 5485
114 Ga0268266_10042265 3300028379 Bacteria 3893
115 Ga0307515_10000023 3300028794 Bacteria 400846
116 Ga0307515_10000945 3300028794 Bacteria 66458
117 Ga0307515_10009074 3300028794 Bacteria 19290
118 Ga0268256_1000020 3300030500 Bacteria 557873
119 Ga0268256_1005833 3300030500 Bacteria 4732
120 Ga0316181_1152995 3300030744 Bacteria 3207
121 Ga0307513_10002881 3300031456 Bacteria 23553
122 Ga0315914_1000010 3300031967 Bacteria 171642
123 Ga0307414_10143029 3300032004 Bacteria 1875
124 Ga0315913_1000005 3300033430 Bacteria 171651
125 Ga0315915_1000012 3300033464 Bacteria 199284
126 Ga0395899_0000073 3300037312 Bacteria 181387
127 Ga0395900_0000027 3300037418 Bacteria 285957
128 Ga0395900_0143628 3300037418 Bacteria 2442
129 Ga0395900_0240765 3300037418 Bacteria 1815
130 Ga0395898_0000043 3300037466 Bacteria 301783
131 Ga0395905_0000032 3300037471 Bacteria 285932
132 Ga0395905_0064647 3300037471 Bacteria 3424
133 Ga0395905_0125508 3300037471 Bacteria 2413
134 Ga0395905_0189378 3300037471 Bacteria 1930
135 Ga0395905_0268954 3300037471 Bacteria 1590
136 Ga0395901_0000056 3300038443 Bacteria 154356
137 Ga0395901_0105657 3300038443 Bacteria 2955
138 Ga0395901_0219947 3300038443 Bacteria 1985
139 Ga0439436_0013760 3300041404 Bacteria 2446
140 Ga0450920_004347 3300042122 Bacteria 2486
141 Ga0439434_0018339 3300042435 Bacteria 2095
142 Ga0450918_000667 3300042531 Bacteria 7314
143 Ga0466972_0023536 3300044658 Bacteria 3062
144 Ga0466965_0042987 3300044683 Bacteria 2230
145 Ga0466968_0018122 3300044735 Bacteria 2822
146 Ga0466968_0019776 3300044735 Bacteria 2714
147 Ga0466970_0006625 3300044765 Bacteria 5793
148 Ga0466960_0057972 3300044901 Bacteria 1890
149 Ga0495607_0000021 3300046501 Bacteria 164571
150 Ga0495633_0045000 3300046558 Bacteria 2091
151 Ga0495625_0043204 3300046660 Bacteria 3270
152 Ga0495588_0029082 3300046674 Bacteria 2770
153 Ga0495681_0007458 3300047470 Bacteria 6985
154 Ga0496111_0003923 3300048914 Bacteria 9324
155 Ga0496112_0018186 3300048915 Bacteria 6615
156 Ga0496115_0074577 3300048918 Bacteria 2755
157 Ga0496116_0000043 3300048919 Bacteria 328085
158 Ga0496117_0000002 3300048920 Bacteria 2483758
159 Ga0496118_0001571 3300048921 Bacteria 33887
160 Ga0496119_0015286 3300048922 Bacteria 5928
161 Ga0496120_0001517 3300048923 Bacteria 27372
162 Ga0496120_0002771 3300048923 Bacteria 17044
163 Ga0496120_0008186 3300048923 Bacteria 7661
164 Ga0496120_0014559 3300048923 Bacteria 5236
165 Ga0496121_0000001 3300048924 Bacteria 1830318
166 Ga0496121_0000959 3300048924 Bacteria 52098
167 Ga0496121_0071523 3300048924 Bacteria 2789
168 Ga0496122_0000001 3300048925 Bacteria 1827766
169 Ga0496122_0000025 3300048925 Bacteria 362915
170 Ga0496122_0005442 3300048925 Bacteria 15164
171 Ga0496122_0008197 3300048925 Bacteria 11352
172 Ga0496122_0047797 3300048925 Bacteria 3298
173 Ga0496122_0059066 3300048925 Bacteria 2833
174 Ga0496123_0000001 3300048926 Bacteria 1831497
175 Ga0496123_0000032 3300048926 Bacteria 285282
176 Ga0496123_0000552 3300048926 Bacteria 64124
177 Ga0496123_0024982 3300048926 Bacteria 4520
178 Ga0496124_0002011 3300048927 Bacteria 27685
179 Ga0496124_0024412 3300048927 Bacteria 5497
180 Ga0496124_0035414 3300048927 Bacteria 4368
181 Ga0496124_0036108 3300048927 Bacteria 4315
182 Ga0496125_0000001 3300048928 Bacteria 1766138
183 Ga0496125_0000394 3300048928 Bacteria 81230
184 Ga0496125_0049047 3300048928 Bacteria 3512
185 Ga0496125_0151403 3300048928 Bacteria 1592
186 Ga0496126_0001040 3300048929 Bacteria 46920
187 Ga0496126_0002456 3300048929 Bacteria 25007
188 Ga0501031_0000087 3300049568 Bacteria 49387
189 Ga0501031_0070635 3300049568 Bacteria 2274
190 Ga0501032_0000059 3300049569 Bacteria 96399
191 Ga0501032_0000111 3300049569 Bacteria 69802
192 Ga0501032_0008780 3300049569 Bacteria 7361
193 Ga0501032_0033625 3300049569 Bacteria 3512
194 Ga0501032_0073947 3300049569 Bacteria 2270
195 Ga0501033_0000048 3300049570 Bacteria 120958
196 Ga0501033_0000213 3300049570 Bacteria 55690
197 Ga0501033_0003451 3300049570 Bacteria 12993
198 Ga0501033_0003709 3300049570 Bacteria 12426
199 Ga0501033_0012509 3300049570 Bacteria 6476
200 Ga0501033_0013177 3300049570 Bacteria 6299
201 Ga0501034_0000452 3300049571 Bacteria 67967
202 Ga0501034_0000960 3300049571 Bacteria 41575
203 Ga0501034_0010338 3300049571 Bacteria 9726
204 Ga0501034_0034410 3300049571 Bacteria 5135
205 Ga0501034_0045555 3300049571 Bacteria 4432
206 Ga0501034_0072537 3300049571 Bacteria 3451
207 Ga0501034_0143246 3300049571 Bacteria 2369
208 Ga0501036_0000092 3300049572 Bacteria 56405
209 Ga0501036_0000093 3300049572 Bacteria 55690
210 Ga0501037_0000061 3300049573 Bacteria 98711
211 Ga0501037_0000131 3300049573 Bacteria 69802
212 Ga0501037_0001008 3300049573 Bacteria 20840
213 Ga0501038_0000109 3300049574 Bacteria 69802
214 Ga0501038_0000123 3300049574 Bacteria 65136
215 Ga0501038_0039203 3300049574 Bacteria 4145
216 Ga0501038_0120640 3300049574 Bacteria 2163
217 Ga0501039_0000108 3300049575 Bacteria 55675
218 Ga0501040_0003364 3300049576 Bacteria 10323
219 Ga0501043_0000063 3300049579 Bacteria 95102
220 Ga0501043_0000303 3300049579 Bacteria 44666
221 Ga0501043_0003292 3300049579 Bacteria 13310
222 Ga0501043_0033651 3300049579 Bacteria 4033
223 Ga0501043_0051239 3300049579 Bacteria 3243
224 Ga0501046_0101215 3300049580 Bacteria 2210
225 Ga0501047_0002263 3300049581 Bacteria 18414
226 Ga0501047_0006155 3300049581 Bacteria 11283
227 Ga0501047_0013540 3300049581 Bacteria 7735
228 Ga0501047_0014712 3300049581 Bacteria 7445
229 Ga0501047_0019990 3300049581 Bacteria 6429
230 Ga0501047_0065758 3300049581 Bacteria 3495
231 Ga0501048_0150604 3300049582 Bacteria 1645
232 Ga0501069_0000060 3300049585 Bacteria 62672
233 Ga0501069_0027706 3300049585 Bacteria 3106
234 Ga0501070_0002994 3300049586 Bacteria 14700
235 Ga0501070_0014307 3300049586 Bacteria 6677
236 Ga0501070_0018055 3300049586 Bacteria 5919
237 Ga0501070_0026613 3300049586 Bacteria 4853
238 Ga0501071_0003798 3300049587 Bacteria 9494
239 Ga0501071_0058670 3300049587 Bacteria 2783
240 Ga0501073_0010648 3300049589 Bacteria 6731
241 Ga0501074_0000070 3300049590 Bacteria 48920
242 Ga0501079_0196407 3300049741 Bacteria 1575
243 Ga0501080_0000761 3300049742 Bacteria 26140
244 Ga0501080_0026967 3300049742 Bacteria 5342
245 Ga0501083_0000098 3300049744 Bacteria 59246
246 Ga0501083_0025339 3300049744 Bacteria 4106
247 Ga0501280_004522 3300049776 Bacteria 2040
248 Ga0501035_0000055 3300049822 Bacteria 139471
249 Ga0501035_0000076 3300049822 Bacteria 121548
250 Ga0501035_0000219 3300049822 Bacteria 68343
251 Ga0501035_0001473 3300049822 Bacteria 24103
252 Ga0501035_0002916 3300049822 Bacteria 16465
253 Ga0501035_0005019 3300049822 Bacteria 12534
254 Ga0501035_0006674 3300049822 Bacteria 10786
255 Ga0501035_0035138 3300049822 Bacteria 4549
256 Ga0501035_0058637 3300049822 Bacteria 3430
257 Ga0501035_0159254 3300049822 Bacteria 1955
258 Ga0501044_0000075 3300049823 Bacteria 120819
259 Ga0501044_0000234 3300049823 Bacteria 69802
260 Ga0501044_0001711 3300049823 Bacteria 25728
261 Ga0501044_0004401 3300049823 Bacteria 15758
262 Ga0501044_0007161 3300049823 Bacteria 12270
263 nmdc:mga03683_2603_c1 3300050489 Bacteria 5634
264 nmdc:mga03n38_29434_c1 3300050490 Bacteria 2298
265 nmdc:mga00v17_667_c1 3300050491 Bacteria 18911
266 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
267 nmdc:mga0yw44_109121_c1 3300050492 Bacteria 1771
268 nmdc:mga0yw44_25580_c1 3300050492 Bacteria 3359
269 nmdc:mga0yw44_34054_c1 3300050492 Bacteria 2982
270 nmdc:mga0sz30_94_c1 3300050516 Bacteria 34557
271 Ga0500556_0011736 3300053104 Bacteria 2601
272 Ga0500618_000084 3300053125 Bacteria 76331
273 Ga0500618_000777 3300053125 Bacteria 17927
274 Ga0500559_0009220 3300053136 Bacteria 4282
275 Ga0500561_0000351 3300053137 Bacteria 7696
276 Ga0500568_0000144 3300053139 Bacteria 62519
277 Ga0500573_0000256 3300053140 Bacteria 22413
278 Ga0500616_0000551 3300053153 Bacteria 46529
279 Ga0500616_0042806 3300053153 Bacteria 2424
280 Ga0500616_0059768 3300053153 Bacteria 1978
281 Ga0500620_000380 3300053155 Bacteria 8222
282 Ga0500622_0000116 3300053156 Bacteria 82811
283 Ga0500634_0005798 3300053161 Bacteria 5911
284 Ga0500636_0000015 3300053177 Bacteria 123980
285 Ga0500611_004864 3300053727 Bacteria 1846
286 2644061966 2643221609 Bacteria 6756331
287 2503202525 2503198000 Bacteria 6884444
288 2509107494 2508501122 Bacteria 6292184
289 2509114320 2508501123 Bacteria 6283661
290 2509140377 2508501127 Bacteria 7037543
291 2509370372 2509276018 Bacteria 6910194
292 2509375829 2509276019 Bacteria 6802256
293 2509397044 2509276022 Bacteria 6200534
294 2510303358 2510065057 Bacteria 6649661
295 2510317343 2510065059 Bacteria 6847884
296 2510842930 2510461069 Bacteria 5505000
297 2511172850 2510917026 Bacteria 7046020
298 2511389612 2511231027 Bacteria 5013807
299 2511501825 2511231052 Bacteria 6974333
300 2512533262 2512047086 Bacteria 6850303
301 2512930696 2512875016 Bacteria 6529530
302 2512958441 2512875024 Bacteria 7195110
303 2512971242 2512875026 Bacteria 6861065
304 2513584684 2513237086 Bacteria 7265287
305 2513603952 2513237089 Bacteria 6553624
306 2513613607 2513237090 Bacteria 7096802
307 2513615394 2513237091 Bacteria 6900273
308 2513881182 2513237140 Bacteria 7076289
309 2513905677 2513237143 Bacteria 6664116
310 2513984390 2513237156 Bacteria 6402557
311 2513997164 2513237159 Bacteria 6810126
312 2514006177 2513237160 Bacteria 6650282
313 2514038408 2513237164 Bacteria 7563725
314 2514416808 2513237305 Bacteria 7293571
315 2514590129 2513237351 Bacteria 6968952
316 2515608688 2515154107 Bacteria 6795637
317 2516893120 2516653046 Bacteria 6989037
318 2517569876 2517487022 Bacteria 7227575
319 2524448909 2524023207 Bacteria 6813453
320 2535484737 2534681786 Bacteria 3308809
321 2537877601 2537561587 Bacteria 5425293
322 2551677986 2551306084 Bacteria 8942552
323 2551686741 2551306085 Bacteria 7347181
324 2551690966 2551306086 Bacteria 6843938
325 2551703004 2551306087 Bacteria 7351905
326 2551713842 2551306089 Bacteria 7162724
327 2551717843 2551306090 Bacteria 7953713
328 2551719323 2551306090 Bacteria 7953713
329 2551727843 2551306091 Bacteria 7086830
330 2551732549 2551306092 Bacteria 6992595
331 2551743905 2551306093 Bacteria 7064773
332 2554247686 2554235003 Bacteria 5877155
333 2558868100 2558860100 Bacteria 8458965
334 2559294819 2558860242 Bacteria 5568029
335 2585166038 2582581283 Bacteria 6030556
336 2585268059 2582581306 Bacteria 6450535
337 2585386838 2582581865 Bacteria 6644329
338 2585396723 2582581866 Bacteria 6859583
339 2585537574 2585427528 Bacteria 6842387
340 2585835524 2585427593 Bacteria 7141551
341 2585995750 2585427633 Bacteria 6413184
342 2586000315 2585427634 Bacteria 6455027
343 2588516359 2588253730 Bacteria 6881675
344 2597813847 2597489875 Bacteria 7010078
345 2599331497 2599185156 Bacteria 5403036
346 2599604086 2599185210 Bacteria 5624189
347 2599721099 2599185236 Bacteria 6875203
348 2599939660 2599185301 Bacteria 6161860
349 2600193181 2599185352 Bacteria 7228948
350 2600374514 2600254933 Bacteria 4750527
351 2601608124 2600255279 Bacteria 5605316
352 2601744899 2600255308 Bacteria 5611129
353 2643774263 2643221550 Bacteria 4619371
354 2643775345 2643221551 Bacteria 3750538
355 2643793791 2643221555 Bacteria 3749717
356 2643803676 2643221557 Bacteria 7184309
357 2643811711 2643221558 Bacteria 5460675
358 2643837603 2643221564 Bacteria 4193379
359 2643855619 2643221568 Bacteria 5187270
360 2643919307 2643221582 Bacteria 5804683
361 2643986741 2643221595 Bacteria 6565519
362 2644049130 2643221607 Bacteria 6314006
363 2644067645 2643221610 Bacteria 7480339
364 2644071526 2643221611 Bacteria 6820941
365 2644107796 2643221618 Bacteria 7717186
366 2644132248 2643221623 Bacteria 5239945
367 2644148531 2643221626 Bacteria 8069654
368 2644155331 2643221627 Bacteria 6761570
369 2644204526 2643221636 Bacteria 6583769
370 2644210291 2643221637 Bacteria 5345260
371 2644298527 2643221653 Bacteria 4569637
372 2644309190 2643221655 Bacteria 7722067
373 2644333017 2643221659 Bacteria 7890716
374 2644375323 2643221668 Bacteria 7306521
375 2644418699 2643221675 Bacteria 7473456
376 2644452065 2643221680 Bacteria 7473610
377 2644482164 2643221686 Bacteria 6310811
378 2644491726 2643221688 Bacteria 5260751
379 2644501809 2643221689 Bacteria 6042950
380 2644522212 2643221693 Bacteria 5513853
381 2644545811 2643221698 Bacteria 7756764
382 2644615132 2643221712 Bacteria 7729434
383 2644653843 2643221718 Bacteria 5345506
384 2644656756 2643221719 Bacteria 4568197
385 2644672557 2643221723 Bacteria 7095460
386 2644690828 2643221726 Bacteria 7455827
387 2657685422 2657244999 Bacteria 5946535
388 2688599256 2687453392 Bacteria 6880454
389 2692315923 2690316117 Bacteria 6800650
390 2694632049 2693429783 Bacteria 7019804
391 2694634544 2693429784 Bacteria 7241525
392 2723576203 2721755686 Bacteria 7343952
393 2738946246 2738541317 Bacteria 5340176
394 2739036537 2738541333 Bacteria 7106503
395 2739245039 2738543012 Bacteria 7115078
396 2739308064 2738543024 Bacteria 5603683
397 2753359303 2751185800 Bacteria 5467370
398 2753458809 2751185821 Bacteria 6189929
399 2756676907 2756170246 Bacteria 7451806
400 2757569548 2757320392 Bacteria 3737298
401 2758641608 2758568016 Bacteria 5645291
402 2765464872 2765235802 Bacteria 5618596
403 2770195202 2767802442 Bacteria 5747986
404 2776270897 2775506902 Bacteria 6208009
405 2776282787 2775506904 Bacteria 5954060
406 2776913723 2775507049 Bacteria 6284736
407 2792581881 2791355082 Bacteria 5973319
408 2792620081 2791355091 Bacteria 6135441
409 2792626500 2791355092 Bacteria 6248105
410 2792639430 2791355094 Bacteria 7011481
411 2792752857 2791355123 Bacteria 8049106
412 2793279878 2791355253 Bacteria 5171699
413 2802719150 2802428858 Bacteria 6636079
414 2802727381 2802428859 Bacteria 6667919
415 2802732163 2802428860 Bacteria 6525526
416 2802739093 2802428861 Bacteria 6534206
417 2802744993 2802428862 Bacteria 6633353
418 2802752268 2802428863 Bacteria 6410669
419 2804752280 2802429268 Bacteria 6094027
420 2806046087 2802429633 Bacteria 7341974
421 2806054466 2802429634 Bacteria 7083200
422 2806060471 2802429635 Bacteria 7650140
423 2806065071 2802429636 Bacteria 7597525
424 2806072336 2802429637 Bacteria 7067217
425 2808985410 2808606387 Bacteria 5697198
426 2816474602 2816332133 Bacteria 7249298
427 2819241607 2818991272 Bacteria 4622173
428 2819559842 2818991439 Bacteria 6907412
429 2819687317 2818991461 Bacteria 7026071
430 2821127991 2821123053 Bacteria 7836056
431 2837653578 2837651117 Bacteria 3772164
432 2837683271 2837678835 Bacteria 5252418
433 2838078925 2838074704 Bacteria 6785777
434 2838676255 2838675328 Bacteria 4909118
435 2838715138 2838714209 Bacteria 5525906
436 2838721062 2838719591 Bacteria 5523910
437 2838725896 2838724970 Bacteria 4908691
438 2838738403 2838736955 Bacteria 5760694
439 2839994795 2839993093 Bacteria 5512535
440 2840767660 2840764183 Bacteria 6358399
441 2841740255 2841734538 Bacteria 6784580
442 2841841228 2841840854 Bacteria 5761912
443 2841848021 2841846520 Bacteria 5345850
444 2841859430 2841859092 Bacteria 5436171
445 2842125949 2842124991 Bacteria 5346824
446 2842131149 2842130223 Bacteria 4909145
447 2842141006 2842140634 Bacteria 5759631
448 2842153681 2842152218 Bacteria 4908957
449 2842171381 2842170452 Bacteria 5525737
450 2842177301 2842175837 Bacteria 4908771
451 2842188246 2842187318 Bacteria 5524014
452 2842212557 2842211629 Bacteria 5523832
453 2842225824 2842224351 Bacteria 5524473
454 2842516214 2842515876 Bacteria 5436280
455 2842522594 2842521101 Bacteria 6569494
456 2842871708 2842871566 Bacteria 4827117
457 2842923894 2842922631 Bacteria 5824079
458 2844006653 2844002411 Bacteria 7168230
459 2844014432 2844009547 Bacteria 6728125
460 2844167484 2844163670 Bacteria 7266046
461 2847419012 2847417321 Bacteria 6913799
462 2847670924 2847670302 Bacteria 6165597
463 2847693108 2847686936 Bacteria 6278406
464 2848994044 2848992105 Bacteria 6810864
465 2850082058 2850079185 Bacteria 6848280
466 2854899165 2854896431 Bacteria 5869725
467 2854912027 2854911287 Bacteria 5582813
468 2854918813 2854916844 Bacteria 5725939
469 2855825921 2855825444 Bacteria 6785811
470 2855841270 2855839649 Bacteria 7135830
471 2855876687 2855872281 Bacteria 6964271
472 2856316381 2856314179 Bacteria 6477897
473 2856326116 2856320880 Bacteria 7263508
474 2856329204 2856328259 Bacteria 6528202
475 2856341883 2856334872 Bacteria 7037011
476 2856346200 2856342000 Bacteria 7176905
477 2856354642 2856349417 Bacteria 6230045
478 2856357675 2856356410 Bacteria 6297484
479 2856369024 2856364286 Bacteria 6939991
480 2857355728 2857349434 Bacteria 7926032
481 2857535034 2857531043 Bacteria 6754041
482 2857576759 2857576091 Bacteria 5465855
483 2858802249 2858800743 Bacteria 6603254
484 2869165423 2869162929 Bacteria 6399702
485 2869240438 2869234852 Bacteria 6654993
486 2869245554 2869242130 Bacteria 6609239
487 2869253688 2869249662 Bacteria 6868783
488 2869262633 2869256925 Bacteria 6981691
489 2869264532 2869264136 Bacteria 6880765
490 2869278799 2869278585 Bacteria 7077053
491 2869291542 2869285874 Bacteria 6901219
492 2871433822 2871429161 Bacteria 6547891
493 2871451764 2871444079 Bacteria 6423508
494 2871452191 2871451962 Bacteria 7336357
495 2871467776 2871466892 Bacteria 6923287
496 2871475597 2871474448 Bacteria 6806570
497 2871486532 2871481445 Bacteria 6700002
498 2871495149 2871488783 Bacteria 6929816
499 2871500588 2871495908 Bacteria 6935695
500 2874106916 2874102143 Bacteria 6342645
501 2874112334 2874109183 Bacteria 6517025
502 2874121504 2874116593 Bacteria 6674494
503 2874125829 2874123672 Bacteria 7238285
504 2874136682 2874131515 Bacteria 6820270
505 2874145383 2874139085 Bacteria 7021506
506 2874153401 2874146452 Bacteria 7533118
507 2874160665 2874155637 Bacteria 6724144
508 2874165832 2874162495 Bacteria 6174670
509 2874172692 2874168670 Bacteria 8062617
510 2876367957 2876363079 Bacteria 6544991
511 2876395132 2876392853 Bacteria 6660880
512 2876403309 2876399893 Bacteria 6927900
513 2876408471 2876406927 Bacteria 6191900
514 2876419691 2876413966 Bacteria 6831344
515 2876424418 2876420981 Bacteria 6687741
516 2878041705 2878035449 Bacteria 6555736
517 2878743709 2878738818 Bacteria 7136951
518 2878751434 2878745973 Bacteria 6867388
519 2878758185 2878753008 Bacteria 6922523
520 2878764677 2878760144 Bacteria 6823465
521 2878771778 2878767105 Bacteria 6898628
522 2878779973 2878774303 Bacteria 6108671
523 2878782052 2878781027 Bacteria 6834456
524 2881152686 2881147464 Bacteria 7779814
525 2881156083 2881155292 Bacteria 6461656
526 2881168499 2881161766 Bacteria 7127907
527 2881851530 2881845957 Bacteria 6611900
528 2881856385 2881853255 Bacteria 6698367
529 2881865239 2881861095 Bacteria 7128710
530 2882638534 2882632389 Bacteria 8154593
531 2882915215 2882912400 Bacteria 6801539
532 2885310477 2885305155 Bacteria 7348390
533 2885317303 2885312484 Bacteria 6415165
534 2885322326 2885318864 Bacteria 6729568
535 2885330356 2885326080 Bacteria 7134805
536 2885341063 2885334103 Bacteria 7216818
537 2885356032 2885350715 Bacteria 6787678
538 2888340483 2888337043 Bacteria 6629336
539 2888347711 2888343758 Bacteria 6611049
540 2888356763 2888350351 Bacteria 7372807
541 2889011818 2889010040 Bacteria 6749192
542 2889023254 2889016732 Bacteria 6700763
543 2889791861 2889790730 Bacteria 5689708
544 2889918866 2889914905 Bacteria 5702301
545 2891051792 2891048133 Bacteria 4447501
546 2891373089 2891373044 Bacteria 5202277
547 2894656230 2894652903 Bacteria 4587256
548 2894820220 2894817345 Bacteria 4892941
549 2899796227 2899792073 Bacteria 4926588
550 2899807695 2899803654 Bacteria 5577784
551 2899847416 2899845264 Bacteria 5672268
552 2903449719 2903448605 Bacteria 7357801
553 2903496083 2903492973 Bacteria 13473544
554 2903505539 2903492973 Bacteria 13473544
555 2903526953 2903521522 Bacteria 6525694
556 2903533180 2903528002 Bacteria 6586099
557 2903545401 2903540706 Bacteria 7062119
558 2904455974 2904449895 Bacteria 6927402
559 2904461364 2904456579 Bacteria 6819253
560 2904580863 2904578770 Bacteria 5302906
561 2904661763 2904659560 Bacteria 6685615
562 2906313351 2906308376 Bacteria 6841989
563 2906326062 2906321335 Bacteria 6579571
564 2906328511 2906328253 Bacteria 6585166
565 2906356648 2906354277 Bacteria 6991324
566 2906399139 2906393657 Bacteria 6790866
567 2906403362 2906401398 Bacteria 6693206
568 2906414254 2906408224 Bacteria 6162342
569 2906416518 2906414383 Bacteria 6580790
570 2913300658 2913295892 Bacteria 6333755
571 2913311167 2913308742 Bacteria 5350706
572 2915653950 2915650412 Bacteria 4288180
573 2915981635 2915980308 Bacteria 6624279
574 2915990333 2915986958 Bacteria 6739310
575 2915994868 2915993759 Bacteria 7016183
576 2916005316 2916000859 Bacteria 6865702
577 2916014466 2916007675 Bacteria 6898660
578 2916017376 2916014648 Bacteria 6946486
579 2916024005 2916021584 Bacteria 6854472
580 2916033234 2916028427 Bacteria 6748433
581 2916036707 2916035215 Bacteria 6755766
582 2916044275 2916041962 Bacteria 6820487
583 2916052213 2916048683 Bacteria 6543552
584 2916055531 2916055098 Bacteria 6758838
585 2916065272 2916061851 Bacteria 6737736
586 2916082011 2916076590 Bacteria 6596108
587 2919115228 2919114240 Bacteria 5700270
588 2919121422 2919119836 Bacteria 5208557
589 2919167617 2919166419 Bacteria 4952238
590 2919175246 2919171160 Bacteria 6499771
591 2920766164 2920760137 Bacteria 7427611
592 2920824630 2920822456 Bacteria 6897201
593 2921205251 2921201388 Bacteria 6926299
594 2921212615 2921208531 Bacteria 6745326
595 2921241836 2921237296 Bacteria 6876710
596 2921246584 2921244191 Bacteria 6568419
597 2921255162 2921250672 Bacteria 6677771
598 2921259590 2921257292 Bacteria 6808382
599 2921266980 2921263974 Bacteria 6864552
600 2921284127 2921282425 Bacteria 6826397
601 2921294151 2921289301 Bacteria 7316391
602 2922134849 2922130491 Bacteria 7173936
603 2922165133 2922158528 Bacteria 6573167
604 2922172997 2922172374 Bacteria 6167644
605 2922190741 2922185730 Bacteria 7113964
606 2924145984 2924144063 Bacteria 6883928
607 2924154558 2924150972 Bacteria 7169444
608 2924163049 2924158325 Bacteria 7188855
609 2924170321 2924165586 Bacteria 7260590
610 2924176330 2924172951 Bacteria 6749356
611 2924184384 2924179722 Bacteria 6843264
612 2924189833 2924186466 Bacteria 6876637
613 2924196531 2924193448 Bacteria 6955718
614 2924205815 2924200457 Bacteria 6757188
615 2924211234 2924207177 Bacteria 6917007
616 2924216536 2924214083 Bacteria 7080103
617 2924225014 2924221636 Bacteria 7113495
618 2924231454 2924228884 Bacteria 6633132
619 2924727866 2924726620 Bacteria 6271473
620 2924739203 2924733363 Bacteria 7574837
621 2924744883 2924741084 Bacteria 6661321
622 2924758321 2924754689 Bacteria 6774424
623 2924768804 2924762789 Bacteria 6561353
624 2924781522 2924776078 Bacteria 7492003
625 2924785925 2924784321 Bacteria 7416538
626 2926756276 2926754445 Bacteria 5964435
627 2926760501 2926760298 Bacteria 5505990
628 2928523645 2928521798 Bacteria 4960112
629 2929139830 2929138655 Bacteria 5810547
630 2929523024 2929520902 Bacteria 6765052
631 2933008328 2933006813 Bacteria 4912075
632 2933013143 2933011516 Bacteria 5439334
633 2933597835 2933594066 Bacteria 5594265
634 2936999598 2936996657 Bacteria 6298727
635 2937005998 2937002841 Bacteria 6934057
636 2937013288 2937009748 Bacteria 6746052
637 2937019327 2937016420 Bacteria 6782579
638 2937028902 2937023124 Bacteria 6815156
639 2937033638 2937029754 Bacteria 6424026
640 2937041860 2937036028 Bacteria 6846469
641 2937047526 2937042894 Bacteria 6741576
642 2937050707 2937049772 Bacteria 6757901
643 2937063629 2937056579 Bacteria 7107896
644 2937068079 2937063883 Bacteria 7199456
645 2937071965 2937071275 Bacteria 6984483
646 2937079304 2937078374 Bacteria 6610289
647 2937085213 2937084907 Bacteria 6618516
648 2937093761 2937091812 Bacteria 6979387
649 2937106224 2937098957 Bacteria 7249374
650 2937108016 2937106411 Bacteria 6947143
651 2937115209 2937113482 Bacteria 6505872
652 2937123364 2937119839 Bacteria 6597547
653 2937129099 2937126314 Bacteria 6771275
654 2937820499 2937813078 Bacteria 7783518
655 2937827097 2937822353 Bacteria 7290551
656 2937837621 2937836603 Bacteria 6811263
657 2937847421 2937843397 Bacteria 5256375
658 2937853756 2937848649 Bacteria 6983481
659 2937875751 2937868953 Bacteria 6639878
660 2937879160 2937877337 Bacteria 7246526
661 2937893547 2937891427 Bacteria 6357007
662 2937975093 2937972304 Bacteria 7532020
663 2937987555 2937980651 Bacteria 6517427
664 2937999251 2937994558 Bacteria 7036190
665 2938020877 2938014810 Bacteria 6700592
666 2941503640 2941499720 Bacteria 7599444
667 2954015928 2954011201 Bacteria 4762601
668 2957381489 2957375807 Bacteria 6425588
669 2957387498 2957382221 Bacteria 6737050
670 2957391781 2957388812 Bacteria 6778072
671 2957397331 2957395598 Bacteria 6822399
672 2957404870 2957402308 Bacteria 6741770
673 2957410907 2957408893 Bacteria 6558585
674 2957420129 2957415311 Bacteria 6991633
675 2957425987 2957422303 Bacteria 7172205
676 2957433939 2957430029 Bacteria 7022557
677 2957441119 2957437181 Bacteria 6568994
678 2957445692 2957443900 Bacteria 6869977
679 2957454625 2957450854 Bacteria 6765715
680 2957464019 2957457609 Bacteria 6967680
681 2957467815 2957464669 Bacteria 6568877
682 2957472460 2957471148 Bacteria 6797643
683 2957480729 2957478035 Bacteria 6756658
684 2957488526 2957484790 Bacteria 6703082
685 2957494359 2957491536 Bacteria 6695180
686 2957502672 2957498199 Bacteria 7126688
687 2957506814 2957505466 Bacteria 7253085
688 2958034915 2958034702 Bacteria 6989922
689 2958042956 2958041894 Bacteria 13082850
690 2958067146 2958064165 Bacteria 7158582
691 2958074165 2958071322 Bacteria 6815895
692 2958086334 2958084443 Bacteria 7312792
693 2958106368 2958100919 Bacteria 6800575
694 2958110242 2958108152 Bacteria 6681128
695 2958122616 2958115193 Bacteria 6923548
696 2958129402 2958122699 Bacteria 7280457
697 2958135942 2958130278 Bacteria 6897202
698 2958139116 2958137437 Bacteria 6050276
699 2958160113 2958158011 Bacteria 6058449
700 2958169725 2958165035 Bacteria 6906348
701 2958175143 2958172287 Bacteria 6716688
702 2958185409 2958179912 Bacteria 6874908
703 2960587021 2960584000 Bacteria 6864594
704 2960597303 2960591022 Bacteria 6622873
705 2960598250 2960597568 Bacteria 6550735
706 2960609075 2960603979 Bacteria 6898737
707 2960615187 2960610863 Bacteria 6691244
708 2960620896 2960617483 Bacteria 6727748
709 2960627600 2960624210 Bacteria 6875384
710 2960635907 2960631154 Bacteria 6732508
711 2960644695 2960637947 Bacteria 7296468
712 2960649042 2960645483 Bacteria 7211087
713 2960659254 2960652885 Bacteria 7083688
714 2960662191 2960660292 Bacteria 7041660
715 2960672730 2960667422 Bacteria 6763020
716 2960677149 2960674078 Bacteria 6609048
717 2960687255 2960680706 Bacteria 6624464
718 2960689905 2960687367 Bacteria 6535474
719 2960698420 2960693952 Bacteria 6749742
720 2961083676 2961077736 Bacteria 7079850
721 2961116916 2961114664 Bacteria 6680456
722 2961135814 2961127735 Bacteria 7196641
723 2961168185 2961163497 Bacteria 6901077
724 2961174816 2961170736 Bacteria 7072258
725 2961184461 2961183825 Bacteria 6688536
726 2963648530 2963644680 Bacteria 6530403
727 2964611725 2964607997 Bacteria 7101408
728 2964616915 2964615318 Bacteria 6809089
729 2964624629 2964621998 Bacteria 6834995
730 2964631119 2964628898 Bacteria 7083044
731 2964637543 2964636051 Bacteria 7091832
732 2964646436 2964643177 Bacteria 6820887
733 2964651657 2964649959 Bacteria 6675118
734 2964661635 2964656573 Bacteria 7100150
735 2964669878 2964663802 Bacteria 7019362
736 2964675048 2964670856 Bacteria 6851364
737 2964678489 2964678106 Bacteria 6792020
738 2964686865 2964685014 Bacteria 6839111
739 2964694409 2964691889 Bacteria 6802758
740 2964701566 2964698721 Bacteria 6765331
741 2964710723 2964705432 Bacteria 7114648
742 2964715649 2964712639 Bacteria 6695970
743 2964723467 2964719344 Bacteria 7286602
744 2965023004 2965018300 Bacteria 6883036
745 2965029357 2965025482 Bacteria 6532201
746 2965047201 2965040258 Bacteria 6855979
747 2965055080 2965047637 Bacteria 6623551
748 2965066835 2965062239 Bacteria 7412989
749 2965094510 2965089291 Bacteria 6866420
750 2965118930 2965110997 Bacteria 6693150
751 2965126093 2965119406 Bacteria 6956431
752 2967665141 2967664464 Bacteria 6948836
753 2967675543 2967671571 Bacteria 7021409
754 2967686154 2967678726 Bacteria 7264382
755 2967690088 2967686174 Bacteria 6678622
756 2967697477 2967693043 Bacteria 6804451
757 2967702539 2967699805 Bacteria 6854538
758 2967709038 2967706974 Bacteria 7186053
759 2967716809 2967714385 Bacteria 7000047
760 2967726358 2967721400 Bacteria 7073753
761 2967732747 2967728569 Bacteria 6641507
762 2967740070 2967735183 Bacteria 6827012
763 2967744868 2967742019 Bacteria 6794534
764 2967753760 2967748971 Bacteria 6733771
765 2967758679 2967755722 Bacteria 6814706
766 2967769289 2967762386 Bacteria 6923502
767 2967770904 2967769361 Bacteria 6587838
768 2967776903 2967775926 Bacteria 6738189
769 2968000751 2967996073 Bacteria 6787468
770 2968009877 2968003550 Bacteria 6929263
771 2968017660 2968016561 Bacteria 7022047
772 2968083759 2968083720 Bacteria 7351627
773 2968091954 2968091066 Bacteria 6052692
774 2968099354 2968097103 Bacteria 6107094
775 2968112823 2968110612 Bacteria 6814636
776 2968122945 2968117919 Bacteria 6536078
777 2968128886 2968128360 Bacteria 6270294
778 2968176585 2968171901 Bacteria 6894245
779 2970024646 2970019648 Bacteria 7072033
780 2970030855 2970026789 Bacteria 6785236
781 2970036936 2970033650 Bacteria 7118744
782 2970042091 2970040964 Bacteria 6731123
783 2970048917 2970047711 Bacteria 7088379
784 2970057111 2970054988 Bacteria 6611507
785 2970066197 2970061556 Bacteria 7099761
786 2970070872 2970068827 Bacteria 7123112
787 2970079287 2970076120 Bacteria 6697332
788 2970083675 2970082768 Bacteria 6183754
789 2970090467 2970088815 Bacteria 6933825
790 2970099177 2970095765 Bacteria 6936963
791 2970107429 2970102677 Bacteria 6812532
792 2970111629 2970109326 Bacteria 6863976
793 2970121951 2970116247 Bacteria 6501857
794 2970126706 2970122695 Bacteria 6625855
795 2970133439 2970129317 Bacteria 6806560
796 2970143248 2970136068 Bacteria 7207982
797 2970148103 2970143518 Bacteria 6446480
798 2970156392 2970149975 Bacteria 6779706
799 2970157210 2970156795 Bacteria 7168044
800 2970168189 2970164137 Bacteria 6861252
801 2970174699 2970170962 Bacteria 6876229
802 2970180525 2970177841 Bacteria 6768001
803 2970189318 2970184632 Bacteria 7054431
804 2970195793 2970191845 Bacteria 7032787
805 2970472165 2970469710 Bacteria 6969209
806 2970489895 2970489779 Bacteria 6517260
807 2970507402 2970503327 Bacteria 7099517
808 2970517833 2970510686 Bacteria 7006402
809 2970530157 2970524798 Bacteria 6840927
810 2970539457 2970532167 Bacteria 6553173
811 2970546148 2970540015 Bacteria 6977556
812 2970548157 2970547951 Bacteria 6931819
813 2970559524 2970554993 Bacteria 6814252
814 2970593395 2970593180 Bacteria 7073582
815 2970623398 2970619444 Bacteria 6986144
816 2970628400 2970627176 Bacteria 6680862
817 2977521402 2977516862 Bacteria 6940108
818 2977530270 2977523885 Bacteria 6960446
819 2977534788 2977530762 Bacteria 6951399
820 2977542585 2977537788 Bacteria 6929320
821 2977547776 2977544691 Bacteria 6875412
822 2977556368 2977551784 Bacteria 7125765
823 2977560954 2977558990 Bacteria 6863948
824 2977567897 2977565890 Bacteria 6901543
825 2977575166 2977572785 Bacteria 6763888
826 2977584259 2977579622 Bacteria 6772100
827 2977828741 2977821940 Bacteria 6906439
828 2977830423 2977828996 Bacteria 7007971
829 2977848797 2977843712 Bacteria 6753583
830 2977853573 2977851361 Bacteria 6694324
831 2977864883 2977858184 Bacteria 6215359
832 2977872096 2977864932 Bacteria 7534097
833 2977873132 2977872689 Bacteria 7270173
834 2977911130 2977907340 Bacteria 6577984
835 2977919689 2977915119 Bacteria 6829656
836 2977929086 2977922695 Bacteria 6956781
837 2977939939 2977935797 Bacteria 6252826
838 2977944385 2977942078 Bacteria 7570577
839 2977950710 2977950692 Bacteria 6893264
840 2977961395 2977957713 Bacteria 6877875
841 2977971962 2977971508 Bacteria 7472917
842 2977989876 2977986579 Bacteria 6581278
843 2978974067 2978969890 Bacteria 5400756
844 2979098399 2979095461 Bacteria 5669583
845 2979106225 2979100975 Bacteria 5423623
846 2979713940 2979710463 Bacteria 6785254
847 2979743536 2979742915 Bacteria 7301278
848 2979777610 2979772303 Bacteria 6618277
849 2979784442 2979779861 Bacteria 6219781
850 2979795121 2979793036 Bacteria 6808957
851 2979812598 2979808191 Bacteria 7179355
852 2984511978 2984509177 Bacteria 5274802
853 2984521661 2984518228 Bacteria 5277463
854 2984540956 2984537506 Bacteria 5277481
855 2984589395 2984587000 Bacteria 5263363
856 2984603217 2984601300 Bacteria 5455244
857 2987640862 2987636660 Bacteria 8088555
858 2987647666 2987645492 Bacteria 6117018
859 2987657104 2987652177 Bacteria 6969023
860 2987664199 2987659509 Bacteria 6966464
861 2987670482 2987666974 Bacteria 6509233
862 2987676717 2987673487 Bacteria 6884027
863 2989349357 2989349275 Bacteria 6349068
864 2989775863 2989771324 Bacteria 5605128
865 2989779057 2989776772 Bacteria 4843317
866 2996310693 2996310559 Bacteria 6357320
867 2996337935 2996336353 Bacteria 5511628
868 2996344773 2996341866 Bacteria 6643098
869 2996351081 2996348954 Bacteria 7239054
870 2996388205 2996386984 Bacteria 6978667
871 3000138314 3000135777 Bacteria 6891109
872 3002144447 3002141150 Bacteria 5254435
873 3003933697 3003930520 Bacteria 5667563
874 3004170047 3004167301 Bacteria 8330599
875 3004193254 3004188549 Bacteria 6952365
876 3004209059 3004203850 Bacteria 7307914
877 3004212623 3004211236 Bacteria 7417683
878 3004221687 3004218560 Bacteria 7421728
879 3004238162 3004232784 Bacteria 6662140
880 3004273767 3004268573 Bacteria 7043476
881 3004277779 3004275668 Bacteria 7114440
882 3004340419 3004334049 Bacteria 8449246
883 637073741 637000159 Bacteria 7596297
884 643825900 643692032 Bacteria 6891900
885 648737489 648276728 Bacteria 6968865
886 649873743 649633066 Bacteria 6690028
887 650740077 650716007 Bacteria 5573770
888 8002286275 8002285264 Bacteria 6717907
889 8003571074 8003570095 Bacteria 5747666
890 8003993776 8003992118 Bacteria 7266902
891 8004001242 8003999396 Bacteria 7063185
892 8004304341 8004300914 Bacteria 6132239
893 8004318654 8004312739 Bacteria 7444653
894 8004368514 8004361976 Bacteria 6858373
895 8004379697 8004374579 Bacteria 6898112
896 8004393902 8004387939 Bacteria 7049250
897 8004446310 8004445564 Bacteria 6322258
898 8004636237 8004633249 Bacteria 6723080
899 8004643258 8004640170 Bacteria 6723001
900 8004714576 8004703790 Bacteria 8006957
901 8004719606 8004714634 Bacteria 6776161
902 8004729137 8004727605 Bacteria 6643904
903 8005248614 8005246636 Bacteria 4933972
904 8005574269 8005570704 Bacteria 6957481
905 8005659309 8005658619 Bacteria 4500593
906 8045865052 8045864390 Bacteria 5043873
907 8049294845 8049293176 Bacteria 6128433
908 8054462611 8054460903 Bacteria 4872905
909 8054558681 8054558443 Bacteria 5204801
910 8055621789 8055617313 Bacteria 7548464
911 8056877511 8056875544 Bacteria 4355797
912 JGI24739J22299_10006473
913 JGI25157J39369_1000750
914 JGI25152J39213_1010229
915 JGI25151J46595_10000134
916 JGI25151J46595_10028641
917 JGI25165J46597_1000033
918 JGI25153J46596_10001403
919 JGI25153J46596_10011152
920 JGI25160J50197_1000011
921 JGI25160J50197_1000572
922 JGI25161J50226_1000232
923 JGI25161J50226_1001043
924 Ga0006562J51391_1008942
925 Ga0055542_1000654
926 Ga0055529_1002419
927 Ga0055526_1002003
928 Ga0055526_1003319
929 Ga0055524_1001915
930 Ga0055536_1002697
931 Ga0055528_1001460
932 Ga0055531_10000733
933 Ga0055531_10013794
934 Ga0058692_1001202
935 Ga0058692_1004873
936 Ga0055543_1000354
937 Ga0055543_1002191
938 Ga0065165_1000018
939 Ga0065165_1001860
940 Ga0065165_1009367
941 Ga0065704_10072842
942 Ga0070665_100060247
943 Ga0068856_100280332
944 Ga0081539_10001646
945 Ga0075365_10002027
946 Ga0075365_10047938
947 Ga0075365_10114197
948 Ga0075368_10013307
949 Ga0075363_100066825
950 Ga0075364_10003103
951 Ga0075362_10002505
952 Ga0075362_10028613
953 Ga0075367_10027101
954 Ga0075367_10058803
955 Ga0075367_10117277
956 Ga0075369_10012429
957 Ga0079104_1000022
958 Ga0079104_1004678
959 Ga0079104_1007604
960 Ga0099826_10000184
961 Ga0099826_10009956
962 Ga0105237_10180725
963 Ga0105238_10028151
964 Ga0123342_1000455
965 Ga0157371_10000015
966 Ga0157371_10004053
967 Ga0157370_10001244
968 Ga0157370_10001762
969 Ga0171463_1008
970 Ga0182008_10020318
971 Ga0182006_1006962
972 Ga0183363_1212
973 Ga0214544_1000691
974 Ga0214542_1000019
975 Ga0214542_1022261
976 Ga0214543_1000010
977 Ga0214543_1000011
978 Ga0228711_1000007
979 Ga0228710_1000007
980 Ga0209436_100281
981 Ga0207425_1004590
982 Ga0207425_1010512
983 Ga0209026_1000002
984 Ga0209148_1000072
985 Ga0209759_1000146
986 Ga0209129_1000659
987 Ga0209233_1000027
988 Ga0209455_1000153
989 Ga0209673_1000552
990 Ga0209130_1000029
991 Ga0209676_1001236
992 Ga0209676_1001652
993 Ga0209025_1000094
994 Ga0209025_1000119
995 Ga0209025_1000166
996 Ga0209025_1000843
997 Ga0209025_1032078
998 Ga0209564_1000469
999 Ga0209564_1000501
1000 Ga0209758_1000155
1001 Ga0209758_1000218
1002 Ga0209758_1047111
1003 Ga0209050_1003018
1004 Ga0209256_1000194
1005 Ga0209256_1000946
1006 Ga0209256_1001513
1007 Ga0207426_1000039
1008 Ga0207426_1000074
1009 Ga0209051_1000998
1010 Ga0209051_1002938
1011 Ga0207647_10006306
1012 Ga0207694_10033071
1013 Ga0207640_10032392
1014 Ga0207702_10139406
1015 Ga0209281_1000036
1016 Ga0209281_1000047
1017 Ga0209281_1000128
1018 Ga0209281_1000483
1019 Ga0209371_1000021
1020 Ga0209371_1001463
1021 Ga0209282_1000034
1022 Ga0209282_1003372
1023 Ga0209282_1004065
1024 Ga0268266_10021580
1025 Ga0268266_10042265
1026 Ga0307515_10000023
1027 Ga0307515_10000945
1028 Ga0307515_10009074
1029 Ga0268256_1000020
1030 Ga0268256_1005833
1031 Ga0316181_1152995
1032 Ga0307513_10002881
1033 Ga0315914_1000010
1034 Ga0307414_10143029
1035 Ga0315913_1000005
1036 Ga0315915_1000012
1037 Ga0395899_0000073
1038 Ga0395900_0000027
1039 Ga0395900_0143628
1040 Ga0395900_0240765
1041 Ga0395898_0000043
1042 Ga0395905_0000032
1043 Ga0395905_0064647
1044 Ga0395905_0125508
1045 Ga0395905_0189378
1046 Ga0395905_0268954
1047 Ga0395901_0000056
1048 Ga0395901_0105657
1049 Ga0395901_0219947
1050 Ga0439436_0013760
1051 Ga0450920_004347
1052 Ga0439434_0018339
1053 Ga0450918_000667
1054 Ga0466972_0023536
1055 Ga0466965_0042987
1056 Ga0466968_0018122
1057 Ga0466968_0019776
1058 Ga0466970_0006625
1059 Ga0466960_0057972
1060 Ga0495607_0000021
1061 Ga0495633_0045000
1062 Ga0495625_0043204
1063 Ga0495588_0029082
1064 Ga0495681_0007458
1065 Ga0496111_0003923
1066 Ga0496112_0018186
1067 Ga0496115_0074577
1068 Ga0496116_0000043
1069 Ga0496117_0000002
1070 Ga0496118_0001571
1071 Ga0496119_0015286
1072 Ga0496120_0001517
1073 Ga0496120_0002771
1074 Ga0496120_0008186
1075 Ga0496120_0014559
1076 Ga0496121_0000001
1077 Ga0496121_0000959
1078 Ga0496121_0071523
1079 Ga0496122_0000001
1080 Ga0496122_0000025
1081 Ga0496122_0005442
1082 Ga0496122_0008197
1083 Ga0496122_0047797
1084 Ga0496122_0059066
1085 Ga0496123_0000001
1086 Ga0496123_0000032
1087 Ga0496123_0000552
1088 Ga0496123_0024982
1089 Ga0496124_0002011
1090 Ga0496124_0024412
1091 Ga0496124_0035414
1092 Ga0496124_0036108
1093 Ga0496125_0000001
1094 Ga0496125_0000394
1095 Ga0496125_0049047
1096 Ga0496125_0151403
1097 Ga0496126_0001040
1098 Ga0496126_0002456
1099 Ga0501031_0000087
1100 Ga0501031_0070635
1101 Ga0501032_0000059
1102 Ga0501032_0000111
1103 Ga0501032_0008780
1104 Ga0501032_0033625
1105 Ga0501032_0073947
1106 Ga0501033_0000048
1107 Ga0501033_0000213
1108 Ga0501033_0003451
1109 Ga0501033_0003709
1110 Ga0501033_0012509
1111 Ga0501033_0013177
1112 Ga0501034_0000452
1113 Ga0501034_0000960
1114 Ga0501034_0010338
1115 Ga0501034_0034410
1116 Ga0501034_0045555
1117 Ga0501034_0072537
1118 Ga0501034_0143246
1119 Ga0501036_0000092
1120 Ga0501036_0000093
1121 Ga0501037_0000061
1122 Ga0501037_0000131
1123 Ga0501037_0001008
1124 Ga0501038_0000109
1125 Ga0501038_0000123
1126 Ga0501038_0039203
1127 Ga0501038_0120640
1128 Ga0501039_0000108
1129 Ga0501040_0003364
1130 Ga0501043_0000063
1131 Ga0501043_0000303
1132 Ga0501043_0003292
1133 Ga0501043_0033651
1134 Ga0501043_0051239
1135 Ga0501046_0101215
1136 Ga0501047_0002263
1137 Ga0501047_0006155
1138 Ga0501047_0013540
1139 Ga0501047_0014712
1140 Ga0501047_0019990
1141 Ga0501047_0065758
1142 Ga0501048_0150604
1143 Ga0501069_0000060
1144 Ga0501069_0027706
1145 Ga0501070_0002994
1146 Ga0501070_0014307
1147 Ga0501070_0018055
1148 Ga0501070_0026613
1149 Ga0501071_0003798
1150 Ga0501071_0058670
1151 Ga0501073_0010648
1152 Ga0501074_0000070
1153 Ga0501079_0196407
1154 Ga0501080_0000761
1155 Ga0501080_0026967
1156 Ga0501083_0000098
1157 Ga0501083_0025339
1158 Ga0501280_004522
1159 Ga0501035_0000055
1160 Ga0501035_0000076
1161 Ga0501035_0000219
1162 Ga0501035_0001473
1163 Ga0501035_0002916
1164 Ga0501035_0005019
1165 Ga0501035_0006674
1166 Ga0501035_0035138
1167 Ga0501035_0058637
1168 Ga0501035_0159254
1169 Ga0501044_0000075
1170 Ga0501044_0000234
1171 Ga0501044_0001711
1172 Ga0501044_0004401
1173 Ga0501044_0007161
1174 nmdc:mga03683_2603_c1
1175 nmdc:mga03n38_29434_c1
1176 nmdc:mga00v17_667_c1
1177 nmdc:mga00v17_6_c1
1178 nmdc:mga0yw44_109121_c1
1179 nmdc:mga0yw44_25580_c1
1180 nmdc:mga0yw44_34054_c1
1181 nmdc:mga0sz30_94_c1
1182 Ga0500556_0011736
1183 Ga0500618_000084
1184 Ga0500618_000777
1185 Ga0500559_0009220
1186 Ga0500561_0000351
1187 Ga0500568_0000144
1188 Ga0500573_0000256
1189 Ga0500616_0000551
1190 Ga0500616_0042806
1191 Ga0500616_0059768
1192 Ga0500620_000380
1193 Ga0500622_0000116
1194 Ga0500634_0005798
1195 Ga0500636_0000015
1196 Ga0500611_004864
1197 2644061966
1198 2503202525
1199 2509107494
1200 2509114320
1201 2509140377
1202 2509370372
1203 2509375829
1204 2509397044
1205 2510303358
1206 2510317343
1207 2510842930
1208 2511172850
1209 2511389612
1210 2511501825
1211 2512533262
1212 2512930696
1213 2512958441
1214 2512971242
1215 2513584684
1216 2513603952
1217 2513613607
1218 2513615394
1219 2513881182
1220 2513905677
1221 2513984390
1222 2513997164
1223 2514006177
1224 2514038408
1225 2514416808
1226 2514590129
1227 2515608688
1228 2516893120
1229 2517569876
1230 2524448909
1231 2535484737
1232 2537877601
1233 2551677986
1234 2551686741
1235 2551690966
1236 2551703004
1237 2551713842
1238 2551717843
1239 2551719323
1240 2551727843
1241 2551732549
1242 2551743905
1243 2554247686
1244 2558868100
1245 2559294819
1246 2585166038
1247 2585268059
1248 2585386838
1249 2585396723
1250 2585537574
1251 2585835524
1252 2585995750
1253 2586000315
1254 2588516359
1255 2597813847
1256 2599331497
1257 2599604086
1258 2599721099
1259 2599939660
1260 2600193181
1261 2600374514
1262 2601608124
1263 2601744899
1264 2643774263
1265 2643775345
1266 2643793791
1267 2643803676
1268 2643811711
1269 2643837603
1270 2643855619
1271 2643919307
1272 2643986741
1273 2644049130
1274 2644067645
1275 2644071526
1276 2644107796
1277 2644132248
1278 2644148531
1279 2644155331
1280 2644204526
1281 2644210291
1282 2644298527
1283 2644309190
1284 2644333017
1285 2644375323
1286 2644418699
1287 2644452065
1288 2644482164
1289 2644491726
1290 2644501809
1291 2644522212
1292 2644545811
1293 2644615132
1294 2644653843
1295 2644656756
1296 2644672557
1297 2644690828
1298 2657685422
1299 2688599256
1300 2692315923
1301 2694632049
1302 2694634544
1303 2723576203
1304 2738946246
1305 2739036537
1306 2739245039
1307 2739308064
1308 2753359303
1309 2753458809
1310 2756676907
1311 2757569548
1312 2758641608
1313 2765464872
1314 2770195202
1315 2776270897
1316 2776282787
1317 2776913723
1318 2792581881
1319 2792620081
1320 2792626500
1321 2792639430
1322 2792752857
1323 2793279878
1324 2802719150
1325 2802727381
1326 2802732163
1327 2802739093
1328 2802744993
1329 2802752268
1330 2804752280
1331 2806046087
1332 2806054466
1333 2806060471
1334 2806065071
1335 2806072336
1336 2808985410
1337 2816474602
1338 2819241607
1339 2819559842
1340 2819687317
1341 2821127991
1342 2837653578
1343 2837683271
1344 2838078925
1345 2838676255
1346 2838715138
1347 2838721062
1348 2838725896
1349 2838738403
1350 2839994795
1351 2840767660
1352 2841740255
1353 2841841228
1354 2841848021
1355 2841859430
1356 2842125949
1357 2842131149
1358 2842141006
1359 2842153681
1360 2842171381
1361 2842177301
1362 2842188246
1363 2842212557
1364 2842225824
1365 2842516214
1366 2842522594
1367 2842871708
1368 2842923894
1369 2844006653
1370 2844014432
1371 2844167484
1372 2847419012
1373 2847670924
1374 2847693108
1375 2848994044
1376 2850082058
1377 2854899165
1378 2854912027
1379 2854918813
1380 2855825921
1381 2855841270
1382 2855876687
1383 2856316381
1384 2856326116
1385 2856329204
1386 2856341883
1387 2856346200
1388 2856354642
1389 2856357675
1390 2856369024
1391 2857355728
1392 2857535034
1393 2857576759
1394 2858802249
1395 2869165423
1396 2869240438
1397 2869245554
1398 2869253688
1399 2869262633
1400 2869264532
1401 2869278799
1402 2869291542
1403 2871433822
1404 2871451764
1405 2871452191
1406 2871467776
1407 2871475597
1408 2871486532
1409 2871495149
1410 2871500588
1411 2874106916
1412 2874112334
1413 2874121504
1414 2874125829
1415 2874136682
1416 2874145383
1417 2874153401
1418 2874160665
1419 2874165832
1420 2874172692
1421 2876367957
1422 2876395132
1423 2876403309
1424 2876408471
1425 2876419691
1426 2876424418
1427 2878041705
1428 2878743709
1429 2878751434
1430 2878758185
1431 2878764677
1432 2878771778
1433 2878779973
1434 2878782052
1435 2881152686
1436 2881156083
1437 2881168499
1438 2881851530
1439 2881856385
1440 2881865239
1441 2882638534
1442 2882915215
1443 2885310477
1444 2885317303
1445 2885322326
1446 2885330356
1447 2885341063
1448 2885356032
1449 2888340483
1450 2888347711
1451 2888356763
1452 2889011818
1453 2889023254
1454 2889791861
1455 2889918866
1456 2891051792
1457 2891373089
1458 2894656230
1459 2894820220
1460 2899796227
1461 2899807695
1462 2899847416
1463 2903449719
1464 2903496083
1465 2903505539
1466 2903526953
1467 2903533180
1468 2903545401
1469 2904455974
1470 2904461364
1471 2904580863
1472 2904661763
1473 2906313351
1474 2906326062
1475 2906328511
1476 2906356648
1477 2906399139
1478 2906403362
1479 2906414254
1480 2906416518
1481 2913300658
1482 2913311167
1483 2915653950
1484 2915981635
1485 2915990333
1486 2915994868
1487 2916005316
1488 2916014466
1489 2916017376
1490 2916024005
1491 2916033234
1492 2916036707
1493 2916044275
1494 2916052213
1495 2916055531
1496 2916065272
1497 2916082011
1498 2919115228
1499 2919121422
1500 2919167617
1501 2919175246
1502 2920766164
1503 2920824630
1504 2921205251
1505 2921212615
1506 2921241836
1507 2921246584
1508 2921255162
1509 2921259590
1510 2921266980
1511 2921284127
1512 2921294151
1513 2922134849
1514 2922165133
1515 2922172997
1516 2922190741
1517 2924145984
1518 2924154558
1519 2924163049
1520 2924170321
1521 2924176330
1522 2924184384
1523 2924189833
1524 2924196531
1525 2924205815
1526 2924211234
1527 2924216536
1528 2924225014
1529 2924231454
1530 2924727866
1531 2924739203
1532 2924744883
1533 2924758321
1534 2924768804
1535 2924781522
1536 2924785925
1537 2926756276
1538 2926760501
1539 2928523645
1540 2929139830
1541 2929523024
1542 2933008328
1543 2933013143
1544 2933597835
1545 2936999598
1546 2937005998
1547 2937013288
1548 2937019327
1549 2937028902
1550 2937033638
1551 2937041860
1552 2937047526
1553 2937050707
1554 2937063629
1555 2937068079
1556 2937071965
1557 2937079304
1558 2937085213
1559 2937093761
1560 2937106224
1561 2937108016
1562 2937115209
1563 2937123364
1564 2937129099
1565 2937820499
1566 2937827097
1567 2937837621
1568 2937847421
1569 2937853756
1570 2937875751
1571 2937879160
1572 2937893547
1573 2937975093
1574 2937987555
1575 2937999251
1576 2938020877
1577 2941503640
1578 2954015928
1579 2957381489
1580 2957387498
1581 2957391781
1582 2957397331
1583 2957404870
1584 2957410907
1585 2957420129
1586 2957425987
1587 2957433939
1588 2957441119
1589 2957445692
1590 2957454625
1591 2957464019
1592 2957467815
1593 2957472460
1594 2957480729
1595 2957488526
1596 2957494359
1597 2957502672
1598 2957506814
1599 2958034915
1600 2958042956
1601 2958067146
1602 2958074165
1603 2958086334
1604 2958106368
1605 2958110242
1606 2958122616
1607 2958129402
1608 2958135942
1609 2958139116
1610 2958160113
1611 2958169725
1612 2958175143
1613 2958185409
1614 2960587021
1615 2960597303
1616 2960598250
1617 2960609075
1618 2960615187
1619 2960620896
1620 2960627600
1621 2960635907
1622 2960644695
1623 2960649042
1624 2960659254
1625 2960662191
1626 2960672730
1627 2960677149
1628 2960687255
1629 2960689905
1630 2960698420
1631 2961083676
1632 2961116916
1633 2961135814
1634 2961168185
1635 2961174816
1636 2961184461
1637 2963648530
1638 2964611725
1639 2964616915
1640 2964624629
1641 2964631119
1642 2964637543
1643 2964646436
1644 2964651657
1645 2964661635
1646 2964669878
1647 2964675048
1648 2964678489
1649 2964686865
1650 2964694409
1651 2964701566
1652 2964710723
1653 2964715649
1654 2964723467
1655 2965023004
1656 2965029357
1657 2965047201
1658 2965055080
1659 2965066835
1660 2965094510
1661 2965118930
1662 2965126093
1663 2967665141
1664 2967675543
1665 2967686154
1666 2967690088
1667 2967697477
1668 2967702539
1669 2967709038
1670 2967716809
1671 2967726358
1672 2967732747
1673 2967740070
1674 2967744868
1675 2967753760
1676 2967758679
1677 2967769289
1678 2967770904
1679 2967776903
1680 2968000751
1681 2968009877
1682 2968017660
1683 2968083759
1684 2968091954
1685 2968099354
1686 2968112823
1687 2968122945
1688 2968128886
1689 2968176585
1690 2970024646
1691 2970030855
1692 2970036936
1693 2970042091
1694 2970048917
1695 2970057111
1696 2970066197
1697 2970070872
1698 2970079287
1699 2970083675
1700 2970090467
1701 2970099177
1702 2970107429
1703 2970111629
1704 2970121951
1705 2970126706
1706 2970133439
1707 2970143248
1708 2970148103
1709 2970156392
1710 2970157210
1711 2970168189
1712 2970174699
1713 2970180525
1714 2970189318
1715 2970195793
1716 2970472165
1717 2970489895
1718 2970507402
1719 2970517833
1720 2970530157
1721 2970539457
1722 2970546148
1723 2970548157
1724 2970559524
1725 2970593395
1726 2970623398
1727 2970628400
1728 2977521402
1729 2977530270
1730 2977534788
1731 2977542585
1732 2977547776
1733 2977556368
1734 2977560954
1735 2977567897
1736 2977575166
1737 2977584259
1738 2977828741
1739 2977830423
1740 2977848797
1741 2977853573
1742 2977864883
1743 2977872096
1744 2977873132
1745 2977911130
1746 2977919689
1747 2977929086
1748 2977939939
1749 2977944385
1750 2977950710
1751 2977961395
1752 2977971962
1753 2977989876
1754 2978974067
1755 2979098399
1756 2979106225
1757 2979713940
1758 2979743536
1759 2979777610
1760 2979784442
1761 2979795121
1762 2979812598
1763 2984511978
1764 2984521661
1765 2984540956
1766 2984589395
1767 2984603217
1768 2987640862
1769 2987647666
1770 2987657104
1771 2987664199
1772 2987670482
1773 2987676717
1774 2989349357
1775 2989775863
1776 2989779057
1777 2996310693
1778 2996337935
1779 2996344773
1780 2996351081
1781 2996388205
1782 3000138314
1783 3002144447
1784 3003933697
1785 3004170047
1786 3004193254
1787 3004209059
1788 3004212623
1789 3004221687
1790 3004238162
1791 3004273767
1792 3004277779
1793 3004340419
1794 637073741
1795 643825900
1796 648737489
1797 649873743
1798 650740077
1799 8002286275
1800 8003571074
1801 8003993776
1802 8004001242
1803 8004304341
1804 8004318654
1805 8004368514
1806 8004379697
1807 8004393902
1808 8004446310
1809 8004636237
1810 8004643258
1811 8004714576
1812 8004719606
1813 8004729137
1814 8005248614
1815 8005574269
1816 8005659309
1817 8045865052
1818 8049294845
1819 8054462611
1820 8054558681
1821 8055621789
1822 8056877511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02852

Pyr_redox_dim

Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

339

448

0.98

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

2

319

0.97

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

168

247

0.93

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

96

303

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kdg-assembly1.cif.gz_B crystal structure of the flavin domain of cellobiose dehydrogenase 0.9893 6 36
4dna-assembly1.cif.gz_B crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021 0.9782 4 462
3o0h-assembly1.cif.gz_A crystal structure of glutathione reductase from bartonella henselae 0.9755 4 462
3o0h-assembly1.cif.gz_B crystal structure of glutathione reductase from bartonella henselae 0.9731 4 462
4dna-assembly1.cif.gz_B crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021 0.9719 4 462
ID Description Score Start End Superfamily
af_A0A1D6HP35_184_301_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9805 156 271 3.50.50.60
af_P9WFZ3_1_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9798 172 202 3.40.50.720
4dnaB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9794 146 261 3.50.50.60
2hqmB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9783 146 264 3.50.50.60
6b4oA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9774 151 263 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A530GGC5-F1-model_v4 Glutathione-disulfide reductase 0.991 137 256 GO:0004362
GO:0005829
GO:0006749
GO:0034599
GO:0045454
GO:0050660
AF-A0A7S2ZAC2-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9839 2 283 GO:0004362
GO:0005739
GO:0005829
GO:0006749
GO:0034599
GO:0045454
GO:0050660
AF-A0A530GGC5-F1-model_v4 Glutathione-disulfide reductase 0.9829 137 256 GO:0004362
GO:0005829
GO:0006749
GO:0034599
GO:0045454
GO:0050660
AF-A0A135HUU0-F1-model_v4 Glutathione reductase (GRase) (EC 1.8.1.7) 0.9821 1 462 GO:0004362
GO:0005829
GO:0006749
GO:0034599
GO:0045454
GO:0050660
GO:0050661
AF-A0A7C7WI17-F1-model_v4 deleted 0.9816 1 252

Map