F485491

General Info

Members Datasets Scaffolds Average Seq Length
911 557 704 396

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2844315083|2844317674
Length 438
Sequence NPRGAMFRVIVPNQPSRVTNAELFFDLVFVFAVTQVSHTLLNHFTPSGALEVTLLFLAVWWVWVYTAWVTNWLNPDLTPVRILIFLMMLGGLVLSTTIPTAFDGRGLWFAIAYAAMQVGRTAFWLFATPRHRTAVRHNAIRILVWLCGSAVFWILGGLAHGEARLWFWSAALGIEYVSPAVRFWVPKLGFSSVEAWAVEGGHMAERCAGFIIIALGEAVVVNGATFAELTWSADNILAFVACLVGSIAMWWVYFHKGAEAGSEVISKAAESGRVARLAYTYLHMPIVAGIILTAVSDELVLKHPTGHSDLRTIVSTIGGSPGVSGRHHPVQALDPRLPPALPRHRHHPVAGAVVVRRRSLAALADGRDERDHDRRRGVGVGVARIEAGRGQGALRRRSFYSAASSACTENIFAESVQLSRTRQPAPCASAAKRSRLYL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
27 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
28 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
29 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
33 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
34 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
35 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
36 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
37 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
38 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
39 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
40 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
41 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
42 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
43 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
44 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
45 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
46 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
47 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
48 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
53 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
54 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
55 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
56 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
57 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
58 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
59 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
60 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
61 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
62 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
63 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
64 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
65 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
66 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
67 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
68 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
69 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
70 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
71 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
72 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
73 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
74 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
75 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
76 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
77 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
78 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
79 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
80 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
81 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
82 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
83 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
84 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
85 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
86 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
87 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
88 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
89 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
90 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
91 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
92 2904699407
93 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
94 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
95 2906610324
96 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
97 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
98 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
99 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
100 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
101 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
102 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
103 2922368715
104 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
105 2922425934
106 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
107 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
108 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
109 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
110 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
111 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
112 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
113 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
114 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
115 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
116 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
117 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
118 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
119 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
120 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
121 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
122 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
123 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
124 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
125 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
126 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
127 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
128 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
129 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
130 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
131 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
132 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
133 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
134 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
135 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
136 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
137 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
138 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
139 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
140 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
141 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
142 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
143 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
144 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
145 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
146 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
147 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
148 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
149 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
150 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
151 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
152 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
153 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
154 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
155 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
156 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
157 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
158 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
159 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
160 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
161 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
162 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
163 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
164 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
165 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
166 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
167 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
168 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
169 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
170 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
171 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
172 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
173 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
174 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
175 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
176 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
177 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
178 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
179 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
180 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
181 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
182 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
183 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
184 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
185 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
186 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
187 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
188 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
189 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
190 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
191 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
192 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
193 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
194 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
195 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
196 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
197 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
198 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
199 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
200 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
201 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
202 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
203 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
204 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
205 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
206 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
207 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
208 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
209 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
210 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
211 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
212 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
213 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
214 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
215 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
216 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
217 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
218 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
219 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
220 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
221 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
222 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
223 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
224 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
225 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
226 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
227 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
228 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
229 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
230 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
231 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
232 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
233 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
234 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
235 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
236 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
237 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
238 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
239 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
240 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
241 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
242 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
243 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
244 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
245 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
246 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
247 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
248 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
249 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
250 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
251 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
252 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
253 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
254 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
255 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
256 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
257 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
258 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
259 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
260 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
261 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
262 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
263 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
264 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
265 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
266 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
267 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
268 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
269 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
270 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
271 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
272 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
273 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
274 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
275 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
276 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
277 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
278 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
279 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
280 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
281 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
282 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
283 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
284 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
288 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
289 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
290 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
292 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
339 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
340 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
341 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
342 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
346 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
347 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
348 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
349 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
350 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
351 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
352 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
353 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
354 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
355 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
356 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
357 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
358 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
359 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
360 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
361 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
362 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
363 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
364 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
365 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
366 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
367 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
368 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
369 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
370 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
371 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
372 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
373 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
374 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
375 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
376 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
377 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
378 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
379 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
380 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
381 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
382 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
383 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
384 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
385 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
386 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
387 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
388 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
389 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
390 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
391 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
392 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
393 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
394 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
395 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
396 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
397 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
398 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
399 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
400 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
401 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
402 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
403 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
404 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
405 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
406 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
407 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
408 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
409 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
410 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
411 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
412 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
413 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
414 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
415 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
416 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
417 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
418 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
419 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
420 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
421 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
422 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
423 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
424 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
425 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
426 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
427 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
428 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
429 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
430 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
431 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
432 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
433 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
436 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
437 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
438 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
439 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
440 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
441 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
442 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
443 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
444 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
445 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
446 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
447 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
448 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
449 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
450 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
451 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
452 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
453 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
454 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
455 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
456 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
457 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
458 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
459 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
460 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
461 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
462 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
463 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
464 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
465 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
466 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
467 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
468 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
469 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
470 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
471 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
472 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
473 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
474 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
476 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
477 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
478 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
479 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
480 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
481 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
482 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
483 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
484 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
485 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
486 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
487 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
488 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
489 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
490 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
491 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
492 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
493 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
494 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
495 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
496 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
497 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
498 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
499 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
500 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
501 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
502 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
503 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
504 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
505 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
506 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
507 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
508 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
509 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
510 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
511 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
512 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
513 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
514 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
515 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
516 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
517 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
518 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
519 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
520 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
521 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
522 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
523 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
524 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
525 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
526 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
527 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
528 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
529 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
530 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
531 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
532 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
533 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
534 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
535 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
536 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
537 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
538 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
539 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
540 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
541 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
542 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
543 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
544 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
545 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
546 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
547 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
548 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
549 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
550 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
551 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
552 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
553 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
554 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
555 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
556 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
557 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.62
Metatranscriptomes 0
Isolates 22.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.09
Nodule 18.22
Rhizoplane 5.16
Rhizosphere 53.79
Stem 0
Stem Tuber 0
Unclassified 11.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004609 3300001979 Bacteria 5922
2 JGI24737J22298_10004171 3300001990 Bacteria 5053
3 JGI24735J21928_10017170 3300002067 Bacteria 2238
4 JGI25406J46586_10000141 3300003203 Bacteria 31326
5 JGI25165J46597_1009535 3300003214 Bacteria 1456
6 JGI25153J46596_10001533 3300003215 Bacteria 13713
7 JGI25153J46596_10003956 3300003215 Bacteria 8114
8 JGI25153J46596_10006871 3300003215 Bacteria 5683
9 rootH1_10018627 3300003323 Bacteria 3168
10 JGI25160J50197_1001294 3300003354 Bacteria 12650
11 JGI25160J50197_1003485 3300003354 Bacteria 7028
12 JGI25404J52841_10005028 3300003659 Bacteria 2717
13 JGI25404J52841_10012886 3300003659 Bacteria 1814
14 Ga0055531_10012574 3300003794 Bacteria 3971
15 Ga0055543_1011317 3300004625 Bacteria 1830
16 Ga0065165_1002974 3300005262 Bacteria 12862
17 Ga0065165_1003005 3300005262 Bacteria 12758
18 Ga0070658_10072191 3300005327 Bacteria 2828
19 Ga0070670_100113694 3300005331 Bacteria 2333
20 Ga0070670_100125549 3300005331 Bacteria 2215
21 Ga0068869_100043228 3300005334 Bacteria 3235
22 Ga0068869_100076723 3300005334 Bacteria 2484
23 Ga0070680_100003306 3300005336 Bacteria 12032
24 Ga0070680_100090722 3300005336 Bacteria 2530
25 Ga0070682_100017578 3300005337 Bacteria 4171
26 Ga0068868_100022441 3300005338 Bacteria 4762
27 Ga0068868_100070486 3300005338 Bacteria 2787
28 Ga0070660_100028023 3300005339 Bacteria 4210
29 Ga0070668_100057652 3300005347 Bacteria 3002
30 Ga0070668_100111188 3300005347 Bacteria 2180
31 Ga0070669_100080577 3300005353 Bacteria 2423
32 Ga0070669_100121194 3300005353 Bacteria 1995
33 Ga0070674_100021952 3300005356 Bacteria 4110
34 Ga0070673_100069276 3300005364 Bacteria 2827
35 Ga0070659_100206822 3300005366 Bacteria 1617
36 Ga0070709_10000321 3300005434 Bacteria 30544
37 Ga0070709_10000693 3300005434 Bacteria 19142
38 Ga0070714_100066675 3300005435 Bacteria 3102
39 Ga0070713_100048137 3300005436 Bacteria 3508
40 Ga0070710_10004137 3300005437 Bacteria 6885
41 Ga0070710_10007933 3300005437 Bacteria 5158
42 Ga0070711_100008217 3300005439 Bacteria 6383
43 Ga0070711_100008243 3300005439 Bacteria 6375
44 Ga0070711_100046362 3300005439 Bacteria 2961
45 Ga0070705_100199257 3300005440 Bacteria 1371
46 Ga0070708_100061166 3300005445 Bacteria 3364
47 Ga0070663_100013979 3300005455 Bacteria 5139
48 Ga0070663_100031866 3300005455 Bacteria 3627
49 Ga0070663_100065901 3300005455 Bacteria 2623
50 Ga0070663_100123558 3300005455 Bacteria 1958
51 Ga0070663_100159166 3300005455 Bacteria 1737
52 Ga0070663_100163859 3300005455 Bacteria 1713
53 Ga0070663_100209212 3300005455 Bacteria 1527
54 Ga0070678_100037781 3300005456 Bacteria 3394
55 Ga0070678_100062438 3300005456 Bacteria 2751
56 Ga0070678_100177243 3300005456 Bacteria 1742
57 Ga0070662_100057412 3300005457 Bacteria 2828
58 Ga0070681_10024650 3300005458 Bacteria 6053
59 Ga0070681_10138906 3300005458 Bacteria 2360
60 Ga0068867_100033711 3300005459 Bacteria 3710
61 Ga0070706_100174202 3300005467 Bacteria 2009
62 Ga0070706_100199094 3300005467 Bacteria 1871
63 Ga0070698_100019994 3300005471 Bacteria 7020
64 Ga0070698_100134945 3300005471 Bacteria 2422
65 Ga0070679_100044585 3300005530 Bacteria 4418
66 Ga0070679_100083433 3300005530 Bacteria 3184
67 Ga0070679_100145486 3300005530 Bacteria 2348
68 Ga0068853_100005359 3300005539 Bacteria 10046
69 Ga0068853_100006900 3300005539 Bacteria 9064
70 Ga0070672_100102762 3300005543 Bacteria 2320
71 Ga0070686_100046669 3300005544 Bacteria 2734
72 Ga0070693_100008387 3300005547 Bacteria 5092
73 Ga0070693_100157265 3300005547 Bacteria 1445
74 Ga0070665_100041689 3300005548 Bacteria 4616
75 Ga0070665_100100768 3300005548 Bacteria 2892
76 Ga0070665_100119935 3300005548 Bacteria 2632
77 Ga0070665_100148619 3300005548 Bacteria 2346
78 Ga0070665_100173448 3300005548 Bacteria 2157
79 Ga0068855_100010147 3300005563 Bacteria 11351
80 Ga0068855_100030135 3300005563 Bacteria 6489
81 Ga0068855_100049630 3300005563 Bacteria 4949
82 Ga0070664_100146056 3300005564 Bacteria 2086
83 Ga0068857_100005632 3300005577 Bacteria 10705
84 Ga0068857_100016856 3300005577 Bacteria 6401
85 Ga0068857_100035005 3300005577 Bacteria 4445
86 Ga0068857_100121411 3300005577 Bacteria 2353
87 Ga0068854_100006637 3300005578 Bacteria 7372
88 Ga0068854_100040636 3300005578 Bacteria 3282
89 Ga0068854_100208017 3300005578 Bacteria 1542
90 Ga0068856_100004479 3300005614 Bacteria 13897
91 Ga0068856_100010147 3300005614 Bacteria 9153
92 Ga0068856_100029580 3300005614 Bacteria 5351
93 Ga0068856_100095543 3300005614 Bacteria 2960
94 Ga0068856_100182707 3300005614 Bacteria 2111
95 Ga0068856_100349561 3300005614 Bacteria 1497
96 Ga0068852_100031560 3300005616 Bacteria 4374
97 Ga0068852_100059333 3300005616 Bacteria 3318
98 Ga0068852_100091883 3300005616 Bacteria 2717
99 Ga0068852_100108652 3300005616 Bacteria 2518
100 Ga0068852_100185724 3300005616 Bacteria 1958
101 Ga0068859_100278154 3300005617 Bacteria 1766
102 Ga0068864_100071692 3300005618 Bacteria 3018
103 Ga0068864_100187912 3300005618 Bacteria 1892
104 Ga0068866_10022163 3300005718 Bacteria 2936
105 Ga0068861_100040987 3300005719 Bacteria 3466
106 Ga0068851_10003044 3300005834 Bacteria 7414
107 Ga0068851_10013400 3300005834 Bacteria 3881
108 Ga0068863_100118784 3300005841 Bacteria 2520
109 Ga0068863_100227909 3300005841 Bacteria 1797
110 Ga0068858_100045121 3300005842 Bacteria 4084
111 Ga0068860_100000317 3300005843 Bacteria 65673
112 Ga0068860_100127931 3300005843 Bacteria 2435
113 Ga0068860_100336545 3300005843 Bacteria 1483
114 Ga0068862_100074659 3300005844 Bacteria 2931
115 Ga0068862_100267823 3300005844 Bacteria 1561
116 Ga0081455_10066167 3300005937 Bacteria 3020
117 Ga0081455_10078300 3300005937 Bacteria 2717
118 Ga0081540_1002665 3300005983 Bacteria 14522
119 Ga0081540_1013269 3300005983 Bacteria 5368
120 Ga0081540_1022048 3300005983 Bacteria 3769
121 Ga0081540_1029768 3300005983 Bacteria 3036
122 Ga0081540_1031943 3300005983 Bacteria 2883
123 Ga0081540_1044771 3300005983 Bacteria 2256
124 Ga0081540_1074326 3300005983 Bacteria 1558
125 Ga0081540_1074971 3300005983 Bacteria 1548
126 Ga0081539_10000008 3300005985 Bacteria 525071
127 Ga0081539_10000747 3300005985 Bacteria 64612
128 Ga0070717_10006275 3300006028 Bacteria 8732
129 Ga0075365_10004123 3300006038 Bacteria 7641
130 Ga0075365_10110915 3300006038 Bacteria 1885
131 Ga0075365_10135999 3300006038 Bacteria 1703
132 Ga0075365_10153549 3300006038 Bacteria 1602
133 Ga0075363_100022580 3300006048 Bacteria 3182
134 Ga0075363_100070499 3300006048 Bacteria 1898
135 Ga0075364_10146759 3300006051 Bacteria 1588
136 Ga0070715_10013262 3300006163 Bacteria 3022
137 Ga0070715_10017382 3300006163 Bacteria 2722
138 Ga0070716_100073755 3300006173 Bacteria 2014
139 Ga0070712_100191340 3300006175 Bacteria 1601
140 Ga0075362_10010952 3300006177 Bacteria 3559
141 Ga0075362_10034916 3300006177 Bacteria 2194
142 Ga0075367_10025132 3300006178 Bacteria 3365
143 Ga0075367_10050941 3300006178 Bacteria 2446
144 Ga0075367_10057331 3300006178 Bacteria 2316
145 Ga0075369_10069000 3300006186 Bacteria 1554
146 Ga0075366_10049004 3300006195 Bacteria 2506
147 Ga0097621_100049253 3300006237 Bacteria 3422
148 Ga0097621_100154927 3300006237 Bacteria 1966
149 Ga0075370_10048777 3300006353 Bacteria 2399
150 Ga0068871_100315269 3300006358 Bacteria 1376
151 Ga0075434_100019165 3300006871 Bacteria 6617
152 Ga0097620_100278146 3300006931 Bacteria 1766
153 Ga0097620_100372329 3300006931 Bacteria 1524
154 Ga0099824_1020393 3300006942 Bacteria 4893
155 Ga0099824_1021825 3300006942 Bacteria 4368
156 Ga0099823_1006107 3300006944 Bacteria 12127
157 Ga0075435_100028341 3300007076 Bacteria 4391
158 Ga0099794_10071534 3300007265 Bacteria 1699
159 Ga0105250_10014042 3300009092 Bacteria 3297
160 Ga0105240_10015146 3300009093 Bacteria 10495
161 Ga0105240_10018856 3300009093 Bacteria 9237
162 Ga0105240_10043716 3300009093 Bacteria 5697
163 Ga0105245_10077328 3300009098 Bacteria 3034
164 Ga0105245_10177514 3300009098 Bacteria 2032
165 Ga0105245_10197387 3300009098 Bacteria 1931
166 Ga0105243_10128916 3300009148 Bacteria 2143
167 Ga0105241_10001933 3300009174 Bacteria 15677
168 Ga0105241_10056771 3300009174 Bacteria 3002
169 Ga0105241_10132916 3300009174 Bacteria 2017
170 Ga0105241_10157087 3300009174 Bacteria 1866
171 Ga0105242_10104277 3300009176 Bacteria 2407
172 Ga0105248_10085941 3300009177 Bacteria 3539
173 Ga0105248_10107522 3300009177 Bacteria 3145
174 Ga0105248_10387959 3300009177 Bacteria 1572
175 Ga0105237_10011285 3300009545 Bacteria 9453
176 Ga0105237_10026805 3300009545 Bacteria 5890
177 Ga0105237_10062996 3300009545 Bacteria 3707
178 Ga0105237_10066237 3300009545 Bacteria 3607
179 Ga0105237_10148452 3300009545 Bacteria 2340
180 Ga0105238_10003129 3300009551 Bacteria 16514
181 Ga0105238_10014347 3300009551 Bacteria 8009
182 Ga0105238_10017427 3300009551 Bacteria 7300
183 Ga0105238_10051440 3300009551 Bacteria 4144
184 Ga0105238_10055313 3300009551 Bacteria 3984
185 Ga0105238_10369344 3300009551 Bacteria 1425
186 Ga0105249_10154371 3300009553 Bacteria 2213
187 Ga0105249_10400783 3300009553 Bacteria 1402
188 Ga0105239_10011530 3300010375 Bacteria 9857
189 Ga0105239_10016473 3300010375 Bacteria 8175
190 Ga0105239_10017421 3300010375 Bacteria 7945
191 Ga0105239_10027114 3300010375 Bacteria 6306
192 Ga0105239_10057505 3300010375 Bacteria 4266
193 Ga0105239_10195037 3300010375 Bacteria 2268
194 Ga0105239_10230171 3300010375 Bacteria 2079
195 Ga0105246_10025068 3300011119 Bacteria 3885
196 Ga0105246_10201214 3300011119 Bacteria 1548
197 Ga0105246_10212835 3300011119 Bacteria 1510
198 Ga0157370_10033228 3300013104 Bacteria 5029
199 Ga0157369_10004501 3300013105 Bacteria 16421
200 Ga0157369_10094195 3300013105 Bacteria 3196
201 Ga0157374_10018451 3300013296 Bacteria 6157
202 Ga0157378_10037063 3300013297 Bacteria 4318
203 Ga0163162_10006056 3300013306 Bacteria 11706
204 Ga0163162_10091764 3300013306 Bacteria 3120
205 Ga0157375_10047639 3300013308 Bacteria 4187
206 Ga0157375_10062158 3300013308 Bacteria 3710
207 Ga0157375_10201416 3300013308 Bacteria 2147
208 Ga0163163_10026297 3300014325 Bacteria 5561
209 Ga0163163_10070466 3300014325 Bacteria 3482
210 Ga0163163_10430145 3300014325 Bacteria 1379
211 Ga0157376_10013967 3300014969 Bacteria 6007
212 Ga0157376_10023687 3300014969 Bacteria 4809
213 Ga0157376_10313863 3300014969 Bacteria 1488
214 Ga0163161_10012716 3300017792 Bacteria 5847
215 Ga0214544_1029436 3300021320 Bacteria 2026
216 Ga0214542_1032581 3300021321 Bacteria 1832
217 Ga0214545_1027280 3300021324 Bacteria 2933
218 Ga0214543_1033553 3300021327 Bacteria 1832
219 Ga0213876_10001447 3300021384 Bacteria 14763
220 Ga0213876_10065164 3300021384 Bacteria 1923
221 Ga0213871_10005236 3300021441 Bacteria 2659
222 Ga0209563_103051 3300025230 Bacteria 3573
223 Ga0209677_101241 3300025253 Bacteria 11522
224 Ga0209677_105815 3300025253 Bacteria 3105
225 Ga0209148_1005105 3300025254 Bacteria 3072
226 Ga0209148_1005191 3300025254 Bacteria 3034
227 Ga0209233_1002274 3300025261 Bacteria 7160
228 Ga0209564_1002300 3300025295 Bacteria 15530
229 Ga0209564_1003642 3300025295 Bacteria 10214
230 Ga0209758_1000407 3300025297 Bacteria 73945
231 Ga0209758_1000900 3300025297 Bacteria 40401
232 Ga0209758_1000952 3300025297 Bacteria 39040
233 Ga0209758_1003132 3300025297 Bacteria 15611
234 Ga0209758_1005367 3300025297 Bacteria 9938
235 Ga0209256_1003168 3300025299 Bacteria 11924
236 Ga0207426_1000466 3300025302 Bacteria 62533
237 Ga0207426_1001739 3300025302 Bacteria 16577
238 Ga0207426_1006892 3300025302 Bacteria 4840
239 Ga0209257_1001445 3300025304 Bacteria 28079
240 Ga0209257_1036773 3300025304 Bacteria 1500
241 Ga0207656_10007652 3300025321 Bacteria 3946
242 Ga0207656_10035242 3300025321 Bacteria 2094
243 Ga0207692_10001391 3300025898 Bacteria 9055
244 Ga0207710_10015395 3300025900 Bacteria 3231
245 Ga0207688_10039938 3300025901 Bacteria 2606
246 Ga0207688_10047486 3300025901 Bacteria 2397
247 Ga0207647_10004390 3300025904 Bacteria 10462
248 Ga0207647_10028560 3300025904 Bacteria 3621
249 Ga0207685_10007010 3300025905 Bacteria 3112
250 Ga0207685_10015708 3300025905 Bacteria 2405
251 Ga0207699_10007708 3300025906 Bacteria 5268
252 Ga0207684_10084428 3300025910 Bacteria 2704
253 Ga0207684_10297141 3300025910 Bacteria 1392
254 Ga0207707_10002025 3300025912 Bacteria 18400
255 Ga0207707_10077474 3300025912 Bacteria 2902
256 Ga0207707_10105130 3300025912 Bacteria 2467
257 Ga0207695_10000029 3300025913 Bacteria 548364
258 Ga0207695_10008678 3300025913 Bacteria 12683
259 Ga0207695_10104394 3300025913 Bacteria 2823
260 Ga0207695_10124145 3300025913 Bacteria 2546
261 Ga0207671_10028805 3300025914 Bacteria 4149
262 Ga0207671_10122721 3300025914 Bacteria 1987
263 Ga0207693_10001385 3300025915 Bacteria 21487
264 Ga0207693_10021713 3300025915 Bacteria 5103
265 Ga0207693_10032830 3300025915 Bacteria 4096
266 Ga0207693_10052790 3300025915 Bacteria 3188
267 Ga0207693_10147309 3300025915 Bacteria 1851
268 Ga0207660_10005792 3300025917 Bacteria 8021
269 Ga0207660_10019091 3300025917 Bacteria 4579
270 Ga0207657_10027513 3300025919 Bacteria 5207
271 Ga0207652_10002138 3300025921 Bacteria 16939
272 Ga0207652_10018694 3300025921 Bacteria 5686
273 Ga0207652_10064444 3300025921 Bacteria 3171
274 Ga0207652_10084200 3300025921 Bacteria 2785
275 Ga0207681_10055346 3300025923 Bacteria 2702
276 Ga0207681_10065430 3300025923 Bacteria 2513
277 Ga0207694_10000131 3300025924 Bacteria 76343
278 Ga0207694_10011328 3300025924 Bacteria 6731
279 Ga0207694_10016553 3300025924 Bacteria 5567
280 Ga0207687_10088658 3300025927 Bacteria 2251
281 Ga0207687_10142855 3300025927 Bacteria 1818
282 Ga0207700_10027110 3300025928 Bacteria 4007
283 Ga0207700_10079668 3300025928 Bacteria 2551
284 Ga0207664_10030573 3300025929 Bacteria 4114
285 Ga0207690_10053589 3300025932 Bacteria 2707
286 Ga0207690_10162230 3300025932 Bacteria 1667
287 Ga0207706_10012890 3300025933 Bacteria 7609
288 Ga0207706_10072274 3300025933 Bacteria 3034
289 Ga0207686_10076584 3300025934 Bacteria 2169
290 Ga0207709_10017362 3300025935 Bacteria 4017
291 Ga0207669_10010569 3300025937 Bacteria 4448
292 Ga0207665_10000064 3300025939 Bacteria 68931
293 Ga0207665_10068512 3300025939 Bacteria 2418
294 Ga0207691_10031947 3300025940 Bacteria 4913
295 Ga0207691_10079604 3300025940 Bacteria 2949
296 Ga0207691_10141147 3300025940 Bacteria 2123
297 Ga0207711_10225075 3300025941 Bacteria 1717
298 Ga0207689_10050405 3300025942 Bacteria 3433
299 Ga0207661_10000499 3300025944 Bacteria 25254
300 Ga0207661_10017331 3300025944 Bacteria 5326
301 Ga0207667_10008468 3300025949 Bacteria 12214
302 Ga0207667_10035714 3300025949 Bacteria 5332
303 Ga0207667_10061068 3300025949 Bacteria 3944
304 Ga0207667_10071881 3300025949 Bacteria 3596
305 Ga0207712_10214617 3300025961 Bacteria 1535
306 Ga0207668_10043719 3300025972 Bacteria 3042
307 Ga0207668_10112499 3300025972 Bacteria 2045
308 Ga0207668_10220538 3300025972 Bacteria 1522
309 Ga0207668_10269826 3300025972 Bacteria 1390
310 Ga0207640_10054622 3300025981 Bacteria 2612
311 Ga0207640_10180075 3300025981 Bacteria 1584
312 Ga0207658_10077021 3300025986 Bacteria 2543
313 Ga0207677_10008433 3300026023 Bacteria 5755
314 Ga0207677_10030095 3300026023 Bacteria 3460
315 Ga0207639_10006576 3300026041 Bacteria 7904
316 Ga0207639_10009936 3300026041 Bacteria 6575
317 Ga0207639_10011227 3300026041 Bacteria 6213
318 Ga0207678_10099619 3300026067 Bacteria 2482
319 Ga0207678_10182909 3300026067 Bacteria 1790
320 Ga0207702_10000005 3300026078 Bacteria 420296
321 Ga0207702_10001399 3300026078 Bacteria 24061
322 Ga0207702_10021621 3300026078 Bacteria 5328
323 Ga0207702_10069553 3300026078 Bacteria 3027
324 Ga0207702_10094222 3300026078 Bacteria 2628
325 Ga0207702_10155325 3300026078 Bacteria 2085
326 Ga0207641_10214713 3300026088 Bacteria 1781
327 Ga0207676_10153813 3300026095 Bacteria 1984
328 Ga0207676_10174610 3300026095 Bacteria 1875
329 Ga0207674_10003851 3300026116 Bacteria 18291
330 Ga0207674_10006041 3300026116 Bacteria 14325
331 Ga0207674_10010829 3300026116 Bacteria 10282
332 Ga0207674_10099324 3300026116 Bacteria 2893
333 Ga0207675_100103756 3300026118 Bacteria 2680
334 Ga0207675_100104899 3300026118 Bacteria 2664
335 Ga0207675_100253690 3300026118 Bacteria 1703
336 Ga0207683_10060268 3300026121 Bacteria 3336
337 Ga0207683_10196104 3300026121 Bacteria 1835
338 Ga0207683_10214891 3300026121 Bacteria 1751
339 Ga0207698_10022947 3300026142 Bacteria 4351
340 Ga0207698_10081284 3300026142 Bacteria 2615
341 Ga0207698_10118356 3300026142 Bacteria 2237
342 Ga0207698_10160163 3300026142 Bacteria 1967
343 Ga0209389_1000011 3300027296 Bacteria 223265
344 Ga0209389_1000025 3300027296 Bacteria 149588
345 Ga0209589_1000018 3300027357 Bacteria 192614
346 Ga0209589_1000066 3300027357 Bacteria 100795
347 Ga0209489_100017 3300027361 Bacteria 223265
348 Ga0209489_100026 3300027361 Bacteria 192614
349 Ga0209489_100030 3300027361 Bacteria 185999
350 Ga0209700_100027 3300027363 Bacteria 223462
351 Ga0209700_100035 3300027363 Bacteria 192614
352 Ga0268266_10021731 3300028379 Bacteria 5468
353 Ga0268266_10275358 3300028379 Bacteria 1563
354 Ga0268265_10131363 3300028380 Bacteria 2081
355 Ga0268264_10000035 3300028381 Bacteria 398196
356 Ga0268264_10057497 3300028381 Bacteria 3253
357 Ga0307517_10178269 3300028786 Bacteria 1378
358 Ga0307511_10024421 3300030521 Bacteria 5603
359 Ga0265332_10013434 3300031238 Bacteria 3628
360 Ga0265325_10013924 3300031241 Bacteria 4562
361 Ga0265331_10078112 3300031250 Bacteria 1541
362 Ga0307509_10056729 3300031507 Bacteria 4156
363 Ga0307509_10127360 3300031507 Bacteria 2509
364 Ga0307509_10220957 3300031507 Bacteria 1707
365 Ga0307508_10000090 3300031616 Bacteria 106893
366 Ga0307508_10017864 3300031616 Bacteria 6448
367 Ga0265314_10011778 3300031711 Bacteria 7193
368 Ga0265342_10023442 3300031712 Bacteria 3906
369 Ga0307516_10006295 3300031730 Bacteria 13947
370 Ga0307516_10089057 3300031730 Bacteria 2917
371 Ga0307406_10066488 3300031901 Bacteria 2347
372 Ga0307416_100065752 3300032002 Bacteria 2982
373 Ga0307415_100049699 3300032126 Bacteria 2837
374 Ga0307510_10010422 3300033180 Bacteria 11039
375 Ga0315911_1000011 3300033442 Bacteria 264678
376 Ga0373926_0010615 3300035083 Bacteria 3088
377 Ga0373944_0027927 3300035089 Bacteria 1677
378 Ga0373923_0001451 3300035111 Bacteria 6804
379 Ga0373932_0028549 3300035112 Bacteria 1534
380 Ga0373936_0012430 3300035113 Bacteria 3239
381 Ga0373945_0051853 3300035116 Bacteria 1510
382 Ga0373953_0010742 3300035117 Bacteria 3196
383 Ga0373954_0009425 3300035118 Bacteria 4294
384 Ga0373954_0015042 3300035118 Bacteria 3456
385 Ga0373954_0030575 3300035118 Bacteria 2483
386 Ga0373956_0007766 3300035119 Bacteria 4327
387 Ga0373956_0020988 3300035119 Bacteria 2784
388 Ga0373943_0036703 3300035170 Bacteria 2348
389 Ga0373946_0005371 3300035171 Bacteria 4617
390 Ga0373946_0022123 3300035171 Bacteria 2472
391 Ga0373955_0006480 3300035172 Bacteria 5333
392 Ga0373955_0050587 3300035172 Bacteria 2260
393 Ga0373924_0049397 3300035410 Bacteria 1740
394 Ga0373924_0052065 3300035410 Bacteria 1698
395 Ga0373931_0007686 3300035691 Bacteria 5088
396 Ga0373935_0000746 3300035692 Bacteria 17275
397 Ga0373935_0012759 3300035692 Bacteria 5060
398 Ga0373927_0001005 3300035695 Bacteria 21497
399 Ga0373927_0006940 3300035695 Bacteria 7689
400 Ga0373927_0021788 3300035695 Bacteria 4199
401 Ga0373927_0107960 3300035695 Bacteria 1813
402 Ga0373927_0112866 3300035695 Bacteria 1771
403 Ga0373933_0028580 3300035724 Bacteria 3218
404 Ga0373933_0115939 3300035724 Bacteria 1674
405 Ga0373947_0004336 3300035725 Bacteria 8330
406 Ga0373937_0047524 3300036401 Bacteria 3927
407 Ga0373925_0013406 3300037068 Bacteria 5931
408 Ga0373925_0213439 3300037068 Bacteria 1538
409 Ga0395899_0078611 3300037312 Bacteria 2404
410 Ga0395900_0006782 3300037418 Bacteria 11887
411 Ga0395900_0149359 3300037418 Bacteria 2388
412 Ga0395898_0002649 3300037466 Bacteria 20818
413 Ga0395898_0022383 3300037466 Bacteria 6401
414 Ga0395898_0079527 3300037466 Bacteria 3163
415 Ga0395898_0183312 3300037466 Bacteria 2001
416 Ga0395905_0065215 3300037471 Bacteria 3409
417 Ga0395905_0141627 3300037471 Bacteria 2262
418 Ga0436364_0575208 3300037853 Bacteria 1637
419 Ga0395901_0047239 3300038443 Bacteria 4470
420 Ga0395901_0200944 3300038443 Bacteria 2089
421 Ga0436365_0278067 3300039437 Bacteria 1538
422 Ga0436365_0282046 3300039437 Bacteria 2006
423 Ga0436365_0687739 3300039437 Bacteria 11594
424 Ga0436365_1006381 3300039437 Bacteria 1952
425 Ga0436360_0661609 3300039438 Bacteria 2103
426 Ga0436361_0785755 3300039447 Bacteria 4947
427 Ga0436363_1573029 3300039450 Bacteria 2564
428 Ga0436362_1292799 3300039453 Bacteria 1708
429 Ga0466965_0050738 3300044683 Bacteria 2057
430 Ga0466967_0050074 3300045976 Bacteria 3656
431 Ga0466967_0076671 3300045976 Bacteria 3008
432 Ga0495592_0001015 3300046454 Bacteria 19460
433 Ga0495592_0131071 3300046454 Bacteria 1753
434 Ga0495592_0158003 3300046454 Bacteria 1562
435 Ga0495603_0015732 3300046455 Bacteria 4575
436 Ga0495603_0025608 3300046455 Bacteria 3567
437 Ga0495603_0025704 3300046455 Bacteria 3560
438 Ga0495603_0056614 3300046455 Bacteria 2321
439 Ga0495629_0002240 3300046459 Bacteria 14904
440 Ga0495629_0020804 3300046459 Bacteria 4684
441 Ga0495629_0084676 3300046459 Bacteria 2212
442 Ga0495638_0018033 3300046460 Bacteria 4696
443 Ga0495651_0019266 3300046462 Bacteria 5288
444 Ga0495653_0017732 3300046463 Bacteria 5787
445 Ga0495653_0063362 3300046463 Bacteria 2790
446 Ga0495580_0013314 3300046472 Bacteria 6284
447 Ga0495580_0062316 3300046472 Bacteria 2617
448 Ga0495582_0000699 3300046473 Bacteria 18488
449 Ga0495582_0023756 3300046473 Bacteria 3352
450 Ga0495582_0087147 3300046473 Bacteria 1738
451 Ga0495639_0001536 3300046475 Bacteria 10297
452 Ga0495639_0004952 3300046475 Bacteria 5710
453 Ga0495664_0008004 3300046477 Bacteria 5885
454 Ga0495664_0012732 3300046477 Bacteria 4764
455 Ga0495664_0063178 3300046477 Bacteria 2206
456 Ga0495664_0094369 3300046477 Bacteria 1801
457 Ga0495585_0043686 3300046492 Bacteria 2505
458 Ga0495594_0004167 3300046499 Bacteria 7429
459 Ga0495594_0056395 3300046499 Bacteria 2168
460 Ga0495606_0001396 3300046507 Bacteria 32606
461 Ga0495606_0010364 3300046507 Bacteria 7745
462 Ga0495608_0008509 3300046511 Bacteria 7188
463 Ga0495608_0098045 3300046511 Bacteria 1892
464 Ga0495608_0206395 3300046511 Bacteria 1236
465 Ga0495610_0017492 3300046512 Bacteria 4085
466 Ga0495616_0032613 3300046513 Bacteria 2719
467 Ga0495618_0021442 3300046514 Bacteria 3984
468 Ga0495618_0022990 3300046514 Bacteria 3852
469 Ga0495628_0148725 3300046516 Bacteria 1784
470 Ga0495630_0005565 3300046517 Bacteria 8892
471 Ga0495630_0048414 3300046517 Bacteria 3181
472 Ga0495644_0031238 3300046523 Bacteria 2012
473 Ga0495648_0008834 3300046524 Bacteria 7884
474 Ga0495652_0013209 3300046529 Bacteria 7434
475 Ga0495652_0022716 3300046529 Bacteria 5566
476 Ga0495652_0045028 3300046529 Bacteria 3797
477 Ga0495652_0197908 3300046529 Bacteria 1527
478 Ga0495665_0000866 3300046531 Bacteria 15828
479 Ga0495665_0013892 3300046531 Bacteria 4349
480 Ga0495640_0015080 3300046533 Bacteria 5821
481 Ga0495640_0022481 3300046533 Bacteria 4608
482 Ga0495587_0017520 3300046536 Bacteria 4451
483 Ga0495609_0024284 3300046538 Bacteria 2781
484 Ga0495597_0045447 3300046542 Bacteria 1948
485 Ga0495645_0002189 3300046543 Bacteria 13283
486 Ga0495645_0005223 3300046543 Bacteria 8897
487 Ga0495645_0113951 3300046543 Bacteria 1911
488 Ga0495667_0010226 3300046559 Bacteria 6349
489 Ga0495667_0051604 3300046559 Bacteria 2712
490 Ga0495667_0058697 3300046559 Bacteria 2527
491 Ga0495668_0022603 3300046616 Bacteria 3594
492 Ga0495668_0025830 3300046616 Bacteria 3336
493 Ga0495634_0003047 3300046642 Bacteria 13635
494 Ga0495634_0009200 3300046642 Bacteria 7294
495 Ga0495634_0032240 3300046642 Bacteria 3604
496 Ga0495635_0001667 3300046663 Bacteria 14944
497 Ga0495635_0012928 3300046663 Bacteria 5844
498 Ga0495635_0020215 3300046663 Bacteria 4639
499 Ga0495635_0032559 3300046663 Bacteria 3616
500 Ga0495588_0086888 3300046674 Bacteria 1635
501 Ga0495657_0014702 3300046675 Bacteria 5744
502 Ga0495657_0019876 3300046675 Bacteria 4839
503 Ga0495657_0053916 3300046675 Bacteria 2688
504 Ga0495599_0003132 3300046678 Bacteria 9642
505 Ga0495623_0061738 3300046679 Bacteria 2349
506 Ga0495646_0003463 3300046680 Bacteria 9820
507 Ga0495646_0007247 3300046680 Bacteria 7047
508 Ga0495646_0019541 3300046680 Bacteria 4287
509 Ga0495647_0001096 3300046681 Bacteria 8262
510 Ga0495647_0005222 3300046681 Bacteria 4255
511 Ga0495658_0003891 3300046683 Bacteria 7392
512 Ga0495669_0004749 3300046684 Bacteria 5632
513 Ga0495669_0108673 3300046684 Bacteria 1293
514 Ga0495613_0031570 3300046689 Bacteria 3935
515 Ga0495613_0161556 3300046689 Bacteria 1593
516 Ga0495613_0172949 3300046689 Bacteria 1532
517 Ga0495624_0000079 3300046690 Bacteria 63196
518 Ga0495624_0029902 3300046690 Bacteria 3551
519 Ga0495624_0034081 3300046690 Bacteria 3296
520 Ga0495649_0065558 3300046694 Bacteria 1949
521 Ga0495600_0003617 3300046809 Bacteria 9112
522 Ga0495600_0004901 3300046809 Bacteria 8041
523 Ga0495600_0011897 3300046809 Bacteria 5435
524 Ga0495600_0021223 3300046809 Bacteria 4157
525 Ga0495581_0000260 3300047315 Bacteria 25339
526 Ga0495581_0050725 3300047315 Bacteria 2397
527 Ga0495604_0058508 3300047317 Bacteria 2959
528 Ga0495604_0059879 3300047317 Bacteria 2917
529 Ga0495604_0200130 3300047317 Bacteria 1386
530 Ga0495674_0017659 3300047319 Bacteria 6643
531 Ga0495674_0035062 3300047319 Bacteria 4530
532 Ga0495674_0046793 3300047319 Bacteria 3839
533 Ga0495674_0096617 3300047319 Bacteria 2518
534 Ga0495674_0131627 3300047319 Bacteria 2107
535 Ga0495676_0019539 3300047321 Bacteria 5958
536 Ga0495676_0027171 3300047321 Bacteria 4912
537 Ga0495676_0121703 3300047321 Bacteria 1897
538 Ga0495680_0017781 3300047322 Bacteria 6052
539 Ga0495680_0035390 3300047322 Bacteria 4022
540 Ga0495687_009133 3300047443 Bacteria 5584
541 Ga0495675_0005508 3300047444 Bacteria 7724
542 Ga0495675_0006895 3300047444 Bacteria 6977
543 Ga0495675_0054654 3300047444 Bacteria 2533
544 Ga0495673_0034885 3300047469 Bacteria 2323
545 Ga0495684_0019374 3300047471 Bacteria 5238
546 Ga0495684_0022676 3300047471 Bacteria 4829
547 Ga0495684_0023503 3300047471 Bacteria 4739
548 Ga0495686_0038303 3300047472 Bacteria 3067
549 Ga0495686_0085531 3300047472 Bacteria 1920
550 Ga0495593_0002394 3300047673 Bacteria 11278
551 Ga0495593_0017295 3300047673 Bacteria 4058
552 Ga0495593_0049876 3300047673 Bacteria 2219
553 Ga0495593_0054000 3300047673 Bacteria 2119
554 Ga0495602_0053544 3300048088 Bacteria 3573
555 Ga0495602_0143687 3300048088 Bacteria 1885
556 Ga0495614_0042211 3300048089 Bacteria 1956
557 Ga0496100_0031490 3300048903 Bacteria 3298
558 Ga0496100_0244134 3300048903 Bacteria 1326
559 Ga0496101_0006632 3300048904 Bacteria 7460
560 Ga0496101_0022754 3300048904 Bacteria 4318
561 Ga0496101_0057026 3300048904 Bacteria 2824
562 Ga0496102_0033573 3300048905 Bacteria 4611
563 Ga0496102_0140679 3300048905 Bacteria 2262
564 Ga0496102_0212801 3300048905 Bacteria 1822
565 Ga0496103_0024136 3300048906 Bacteria 3668
566 Ga0496104_0006004 3300048907 Bacteria 10645
567 Ga0496104_0034118 3300048907 Bacteria 4743
568 Ga0496104_0035515 3300048907 Bacteria 4653
569 Ga0496104_0315578 3300048907 Bacteria 1476
570 Ga0496105_0006080 3300048908 Bacteria 9238
571 Ga0496105_0052035 3300048908 Bacteria 3381
572 Ga0496106_0002853 3300048909 Bacteria 12840
573 Ga0496106_0020122 3300048909 Bacteria 4951
574 Ga0496106_0025828 3300048909 Bacteria 4370
575 Ga0496106_0029606 3300048909 Bacteria 4082
576 Ga0496106_0051357 3300048909 Bacteria 3108
577 Ga0496106_0054568 3300048909 Bacteria 3019
578 Ga0496106_0085023 3300048909 Bacteria 2435
579 Ga0496107_0022024 3300048910 Bacteria 4501
580 Ga0496107_0046653 3300048910 Bacteria 3118
581 Ga0496107_0073215 3300048910 Bacteria 2492
582 Ga0496108_0017378 3300048911 Bacteria 5885
583 Ga0496108_0130051 3300048911 Bacteria 2164
584 Ga0496109_0020594 3300048912 Bacteria 5826
585 Ga0496109_0083534 3300048912 Bacteria 2945
586 Ga0496109_0163275 3300048912 Bacteria 2087
587 Ga0496110_0043164 3300048913 Bacteria 3937
588 Ga0496110_0106096 3300048913 Bacteria 2521
589 Ga0496111_0049829 3300048914 Bacteria 3019
590 Ga0496112_0000117 3300048915 Bacteria 49274
591 Ga0496112_0002573 3300048915 Bacteria 14654
592 Ga0496112_0007576 3300048915 Bacteria 9643
593 Ga0496112_0129318 3300048915 Bacteria 2496
594 Ga0496113_0011838 3300048916 Bacteria 5844
595 Ga0496113_0041979 3300048916 Bacteria 3378
596 Ga0496113_0067973 3300048916 Bacteria 2703
597 Ga0496114_0002764 3300048917 Bacteria 13432
598 Ga0496114_0004339 3300048917 Bacteria 10979
599 Ga0496115_0025513 3300048918 Bacteria 4602
600 Ga0496115_0086269 3300048918 Bacteria 2561
601 Ga0496115_0103869 3300048918 Bacteria 2332
602 Ga0496115_0278051 3300048918 Bacteria 1375
603 Ga0496118_0006091 3300048921 Bacteria 13407
604 Ga0496118_0008006 3300048921 Bacteria 11043
605 Ga0496118_0051012 3300048921 Bacteria 3169
606 Ga0496118_0094096 3300048921 Bacteria 2050
607 Ga0496120_0011493 3300048923 Bacteria 6085
608 Ga0496121_0001006 3300048924 Bacteria 50348
609 Ga0496121_0018786 3300048924 Bacteria 6945
610 Ga0496121_0019408 3300048924 Bacteria 6797
611 Ga0496121_0019777 3300048924 Bacteria 6710
612 Ga0496121_0044584 3300048924 Bacteria 3823
613 Ga0496121_0073020 3300048924 Bacteria 2752
614 Ga0496121_0075121 3300048924 Bacteria 2701
615 Ga0496121_0165353 3300048924 Bacteria 1613
616 Ga0496122_0124956 3300048925 Bacteria 1649
617 Ga0496124_0016465 3300048927 Bacteria 7024
618 Ga0496124_0147134 3300048927 Bacteria 1853
619 Ga0496125_0044490 3300048928 Bacteria 3754
620 Ga0496125_0052475 3300048928 Bacteria 3353
621 Ga0496125_0052884 3300048928 Bacteria 3336
622 Ga0496125_0117651 3300048928 Bacteria 1905
623 Ga0496125_0139875 3300048928 Bacteria 1685
624 Ga0496126_0006291 3300048929 Bacteria 13257
625 Ga0496126_0015594 3300048929 Bacteria 7635
626 Ga0496126_0016957 3300048929 Bacteria 7267
627 Ga0496126_0024985 3300048929 Bacteria 5759
628 Ga0496126_0037222 3300048929 Bacteria 4542
629 Ga0496126_0050598 3300048929 Bacteria 3785
630 Ga0496126_0101367 3300048929 Bacteria 2518
631 Ga0496126_0150418 3300048929 Bacteria 1996
632 Ga0496126_0155153 3300048929 Bacteria 1960
633 Ga0496126_0157801 3300048929 Bacteria 1941
634 Ga0496126_0215300 3300048929 Bacteria 1616
635 Ga0495682_0013186 3300049460 Bacteria 3152
636 Ga0501047_0021432 3300049581 Bacteria 6205
637 Ga0501074_0143591 3300049590 Bacteria 1707
638 Ga0501080_0021618 3300049742 Bacteria 5956
639 Ga0501035_0168544 3300049822 Bacteria 1893
640 nmdc:mga03n38_2420_c1 3300050490 Bacteria 5764
641 nmdc:mga00v17_14964_c1 3300050491 Bacteria 4345
642 nmdc:mga00v17_75253_c1 3300050491 Bacteria 2099
643 nmdc:mga0yw44_14247_c1 3300050492 Bacteria 4215
644 nmdc:mga0yw44_17230_c1 3300050492 Bacteria 3926
645 nmdc:mga0yw44_26457_c1 3300050492 Bacteria 3314
646 nmdc:mga06z11_37379_c1 3300050494 Bacteria 2404
647 nmdc:mga06z11_37836_c1 3300050494 Bacteria 2392
648 nmdc:mga07m45_21319_c2 3300050496 Bacteria 2895
649 nmdc:mga07m45_26268_c2 3300050496 Bacteria 2850
650 nmdc:mga07m45_40836_c1 3300050496 Bacteria 2597
651 nmdc:mga0rr50_103192_c1 3300050513 Bacteria 2244
652 nmdc:mga0sz30_16099_c1 3300050516 Bacteria 2963
653 Ga0495601_0043004 3300053077 Bacteria 2837
654 Ga0495601_0078764 3300053077 Bacteria 2112
655 Ga0495612_0026418 3300053078 Bacteria 2333
656 Ga0500610_0061422 3300053079 Bacteria 1962
657 Ga0500635_0002861 3300053080 Bacteria 4297
658 Ga0495595_0012509 3300053084 Bacteria 3569
659 Ga0495619_0004673 3300053085 Bacteria 8726
660 Ga0495619_0027691 3300053085 Bacteria 3653
661 Ga0495619_0184154 3300053085 Bacteria 1445
662 Ga0500578_0055597 3300053086 Bacteria 2533
663 Ga0500643_000019 3300053087 Bacteria 294301
664 Ga0500643_038654 3300053087 Bacteria 1414
665 Ga0500583_0051411 3300053092 Bacteria 1914
666 Ga0500651_0045618 3300053093 Bacteria 2757
667 Ga0500566_0000064 3300053094 Bacteria 50908
668 Ga0500566_0000487 3300053094 Bacteria 22108
669 Ga0500566_0004143 3300053094 Bacteria 8649
670 Ga0500640_003196 3300053095 Bacteria 5647
671 Ga0500650_0081575 3300053098 Bacteria 1513
672 Ga0500555_001886 3300053103 Bacteria 6226
673 Ga0500557_000039 3300053105 Bacteria 66862
674 Ga0500562_004144 3300053108 Bacteria 3656
675 Ga0500572_000026 3300053111 Bacteria 45518
676 Ga0500572_000839 3300053111 Bacteria 9631
677 Ga0500594_0007039 3300053118 Bacteria 2539
678 Ga0500595_001234 3300053119 Bacteria 14105
679 Ga0500595_002556 3300053119 Bacteria 8912
680 Ga0500595_036983 3300053119 Bacteria 1596
681 Ga0500608_008044 3300053122 Bacteria 4405
682 Ga0500614_002715 3300053123 Bacteria 3904
683 Ga0500642_0000402 3300053130 Bacteria 14190
684 Ga0500559_0001395 3300053136 Bacteria 13743
685 Ga0500559_0004820 3300053136 Bacteria 6303
686 Ga0500568_0011027 3300053139 Bacteria 4209
687 Ga0500589_056452 3300053147 Bacteria 1810
688 Ga0500603_000109 3300053150 Bacteria 19137
689 Ga0500620_001076 3300053155 Bacteria 4828
690 Ga0500622_0042293 3300053156 Bacteria 2368
691 Ga0500627_0001288 3300053158 Bacteria 6945
692 Ga0500630_005009 3300053159 Bacteria 6446
693 Ga0500638_000124 3300053162 Bacteria 14946
694 Ga0500639_000353 3300053163 Bacteria 22721
695 Ga0500636_0000194 3300053177 Bacteria 32748
696 Ga0500637_0010349 3300053178 Bacteria 4779
697 Ga0500637_0055352 3300053178 Bacteria 2265
698 Ga0500570_036755 3300053724 Bacteria 2598
699 Ga0500625_025357 3300053729 Bacteria 2804
700 Ga0500645_013158 3300053730 Bacteria 2661
701 Ga0500645_014877 3300053730 Bacteria 2474
702 Ga0500596_005043 3300053735 Bacteria 2363
703 Ga0500599_005309 3300053736 Bacteria 1615
704 Ga0500601_000497 3300053737 Bacteria 6065

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0155153 Ga0496126_0155153_582_1766 380
2 3300006944 Ga0099823_1006107 Ga0099823_100610713 381
3 3300053111 Ga0500572_000839 Ga0500572_000839_5223_6368 381
4 3300053136 Ga0500559_0001395 Ga0500559_0001395_5207_6352 381
5 3300039437 Ga0436365_0282046 Ga0436365_0282046_60_1211 383
6 3300048913 Ga0496110_0106096 Ga0496110_0106096_599_1804 383
7 3300005436 Ga0070713_100048137 Ga0070713_1000481375 384
8 3300005437 Ga0070710_10004137 Ga0070710_100041373 384
9 3300005439 Ga0070711_100008217 Ga0070711_1000082176 384
10 3300006175 Ga0070712_100191340 Ga0070712_1001913401 384
11 3300025912 Ga0207707_10105130 Ga0207707_101051301 384
12 3300025915 Ga0207693_10021713 Ga0207693_100217136 384
13 3300025921 Ga0207652_10084200 Ga0207652_100842004 384
14 3300025928 Ga0207700_10027110 Ga0207700_100271102 384
15 3300045976 Ga0466967_0050074 Ga0466967_0050074_258_1412 384
16 iso_pu_bacteria 2824644064 2824647405 384
17 3300027357 Ga0209589_1000018 Ga0209589_100001870 386
18 3300027361 Ga0209489_100026 Ga0209489_10002670 386
19 3300027363 Ga0209700_100035 Ga0209700_10003570 386
20 3300021320 Ga0214544_1029436 Ga0214544_10294363 387
21 3300021321 Ga0214542_1032581 Ga0214542_10325812 387
22 3300021324 Ga0214545_1027280 Ga0214545_10272803 387
23 3300021327 Ga0214543_1033553 Ga0214543_10335532 387
24 iso_pu_bacteria 8016622563 8016628447 387
25 3300005262 Ga0065165_1003005 Ga0065165_10030056 388
26 3300025302 Ga0207426_1001739 Ga0207426_100173910 388
27 3300046511 Ga0495608_0206395 Ga0495608_0206395_18_1184 388
28 3300048910 Ga0496107_0073215 Ga0496107_0073215_250_1416 388
29 3300048929 Ga0496126_0050598 Ga0496126_0050598_92_1285 388
30 iso_pu_bacteria 2844315083 2844317674 388
31 iso_pu_bacteria 2879110137 2879118654 388
32 3300005455 Ga0070663_100209212 Ga0070663_1002092121 389
33 3300005539 Ga0068853_100006900 Ga0068853_10000690010 389
34 3300025913 Ga0207695_10124145 Ga0207695_101241453 389
35 3300025921 Ga0207652_10064444 Ga0207652_100644444 389
36 3300025944 Ga0207661_10000499 Ga0207661_100004993 389
37 iso_pu_bacteria 2513237096 2513660041 389
38 iso_pu_bacteria 2513237137 2513858218 389
39 iso_pu_bacteria 2513237141 2513892017 389
40 iso_pu_bacteria 2513237145 2513922149 389
41 iso_pu_bacteria 2517572143 2517893893 389
42 iso_pu_bacteria 2667528175 2671122885 389
43 iso_pu_bacteria 2728368998 2728748018 389
44 iso_pu_bacteria 2791355197 2793072470 389
45 iso_pu_bacteria 2847930680 2847934468 389
46 iso_pu_bacteria 2857509624 2857509894 389
47 iso_pu_bacteria 2874620515 2874623157 389
48 iso_pu_bacteria 2874628541 2874636103 389
49 iso_pu_bacteria 2885374607 2885382459 389
50 iso_pu_bacteria 2903748898 2903750444 389
51 iso_pu_bacteria 2904666416 2904669977 389
52 iso_pu_bacteria 2904699407 2904700687 389
53 iso_pu_bacteria 2906610324 2906610781 389
54 iso_pu_bacteria 2906635258 2906635937 389
55 iso_pu_bacteria 2906643746 2906646657 389
56 iso_pu_bacteria 2906660503 2906663965 389
57 iso_pu_bacteria 2908739725 2908744293 389
58 iso_pu_bacteria 2908756301 2908761785 389
59 iso_pu_bacteria 2922425934 2922428544 389
60 iso_pu_bacteria 2935630451 2935634523 389
61 iso_pu_bacteria 2941507105 2941509009 389
62 iso_pu_bacteria 2941515067 2941516838 389
63 iso_pu_bacteria 2941523033 2941525067 389
64 iso_pu_bacteria 3005474847 3005478674 389
65 iso_pu_bacteria 3005506211 3005508801 389
66 iso_pu_bacteria 8006933436 8006942685 389
67 iso_pu_bacteria 8006973647 8006982412 389
68 iso_pu_bacteria 8019555841 8019558451 389
69 iso_pu_bacteria 8019565922 8019566847 389
70 iso_pu_bacteria 8056689827 8056691858 389
71 3300048909 Ga0496106_0051357 Ga0496106_0051357_1901_3088 390
72 3300048929 Ga0496126_0157801 Ga0496126_0157801_221_1393 390
73 iso_pu_bacteria 2841957949 2841959429 390
74 iso_pu_bacteria 2842038055 2842038197 390
75 iso_pu_bacteria 2842045827 2842048857 390
76 iso_pu_bacteria 2849076700 2849080745 390
77 iso_pu_bacteria 2885366525 2885368877 390
78 3300037471 Ga0395905_0141627 Ga0395905_0141627_1066_2241 391
79 iso_pu_bacteria 2513237104 2513720614 391
80 3300003323 rootH1_10018627 rootH1_100186274 392
81 3300005331 Ga0070670_100125549 Ga0070670_1001255491 392
82 3300005334 Ga0068869_100043228 Ga0068869_1000432284 392
83 3300005337 Ga0070682_100017578 Ga0070682_1000175783 392
84 3300005338 Ga0068868_100022441 Ga0068868_1000224414 392
85 3300005338 Ga0068868_100070486 Ga0068868_1000704864 392
86 3300005347 Ga0070668_100057652 Ga0070668_1000576524 392
87 3300005353 Ga0070669_100121194 Ga0070669_1001211943 392
88 3300005356 Ga0070674_100021952 Ga0070674_1000219524 392
89 3300005364 Ga0070673_100069276 Ga0070673_1000692764 392
90 3300005366 Ga0070659_100206822 Ga0070659_1002068222 392
91 3300005434 Ga0070709_10000321 Ga0070709_1000032114 392
92 3300005434 Ga0070709_10000693 Ga0070709_1000069311 392
93 3300005437 Ga0070710_10007933 Ga0070710_100079335 392
94 3300005439 Ga0070711_100008243 Ga0070711_1000082433 392
95 3300005440 Ga0070705_100199257 Ga0070705_1001992571 392
96 3300005445 Ga0070708_100061166 Ga0070708_1000611663 392
97 3300005455 Ga0070663_100031866 Ga0070663_1000318665 392
98 3300005455 Ga0070663_100163859 Ga0070663_1001638591 392
99 3300005456 Ga0070678_100037781 Ga0070678_1000377815 392
100 3300005456 Ga0070678_100062438 Ga0070678_1000624382 392
101 3300005457 Ga0070662_100057412 Ga0070662_1000574124 392
102 3300005459 Ga0068867_100033711 Ga0068867_1000337115 392
103 3300005467 Ga0070706_100199094 Ga0070706_1001990943 392
104 3300005544 Ga0070686_100046669 Ga0070686_1000466694 392
105 3300005547 Ga0070693_100008387 Ga0070693_1000083875 392
106 3300005548 Ga0070665_100041689 Ga0070665_1000416895 392
107 3300005548 Ga0070665_100100768 Ga0070665_1001007682 392
108 3300005548 Ga0070665_100119935 Ga0070665_1001199352 392
109 3300005548 Ga0070665_100148619 Ga0070665_1001486192 392
110 3300005563 Ga0068855_100049630 Ga0068855_1000496306 392
111 3300005564 Ga0070664_100146056 Ga0070664_1001460563 392
112 3300005614 Ga0068856_100029580 Ga0068856_1000295805 392
113 3300005616 Ga0068852_100059333 Ga0068852_1000593333 392
114 3300005617 Ga0068859_100278154 Ga0068859_1002781543 392
115 3300005618 Ga0068864_100187912 Ga0068864_1001879122 392
116 3300005718 Ga0068866_10022163 Ga0068866_100221634 392
117 3300005719 Ga0068861_100040987 Ga0068861_1000409872 392
118 3300005841 Ga0068863_100118784 Ga0068863_1001187844 392
119 3300005842 Ga0068858_100045121 Ga0068858_1000451215 392
120 3300005843 Ga0068860_100336545 Ga0068860_1003365452 392
121 3300005844 Ga0068862_100267823 Ga0068862_1002678232 392
122 3300005983 Ga0081540_1002665 Ga0081540_100266513 392
123 3300005983 Ga0081540_1044771 Ga0081540_10447713 392
124 3300006038 Ga0075365_10153549 Ga0075365_101535492 392
125 3300006048 Ga0075363_100070499 Ga0075363_1000704992 392
126 3300006163 Ga0070715_10013262 Ga0070715_100132623 392
127 3300006173 Ga0070716_100073755 Ga0070716_1000737552 392
128 3300006178 Ga0075367_10025132 Ga0075367_100251325 392
129 3300006178 Ga0075367_10057331 Ga0075367_100573312 392
130 3300006186 Ga0075369_10069000 Ga0075369_100690002 392
131 3300006237 Ga0097621_100049253 Ga0097621_1000492534 392
132 3300006353 Ga0075370_10048777 Ga0075370_100487772 392
133 3300006358 Ga0068871_100315269 Ga0068871_1003152691 392
134 3300006871 Ga0075434_100019165 Ga0075434_1000191655 392
135 3300006931 Ga0097620_100278146 Ga0097620_1002781463 392
136 3300007076 Ga0075435_100028341 Ga0075435_1000283415 392
137 3300009092 Ga0105250_10014042 Ga0105250_100140422 392
138 3300009098 Ga0105245_10077328 Ga0105245_100773282 392
139 3300009098 Ga0105245_10177514 Ga0105245_101775142 392
140 3300009148 Ga0105243_10128916 Ga0105243_101289162 392
141 3300009174 Ga0105241_10056771 Ga0105241_100567711 392
142 3300009174 Ga0105241_10157087 Ga0105241_101570872 392
143 3300009177 Ga0105248_10107522 Ga0105248_101075224 392
144 3300009177 Ga0105248_10387959 Ga0105248_103879592 392
145 3300009545 Ga0105237_10066237 Ga0105237_100662375 392
146 3300009551 Ga0105238_10369344 Ga0105238_103693442 392
147 3300009553 Ga0105249_10154371 Ga0105249_101543712 392
148 3300010375 Ga0105239_10016473 Ga0105239_100164735 392
149 3300010375 Ga0105239_10195037 Ga0105239_101950373 392
150 3300011119 Ga0105246_10201214 Ga0105246_102012142 392
151 3300011119 Ga0105246_10212835 Ga0105246_102128351 392
152 3300013296 Ga0157374_10018451 Ga0157374_100184511 392
153 3300013297 Ga0157378_10037063 Ga0157378_100370634 392
154 3300013306 Ga0163162_10006056 Ga0163162_1000605613 392
155 3300013306 Ga0163162_10091764 Ga0163162_100917642 392
156 3300013308 Ga0157375_10047639 Ga0157375_100476392 392
157 3300013308 Ga0157375_10062158 Ga0157375_100621584 392
158 3300014325 Ga0163163_10026297 Ga0163163_100262975 392
159 3300014969 Ga0157376_10013967 Ga0157376_100139675 392
160 3300014969 Ga0157376_10023687 Ga0157376_100236875 392
161 3300017792 Ga0163161_10012716 Ga0163161_100127165 392
162 3300021384 Ga0213876_10001447 Ga0213876_100014477 392
163 3300025901 Ga0207688_10039938 Ga0207688_100399382 392
164 3300025904 Ga0207647_10028560 Ga0207647_100285604 392
165 3300025905 Ga0207685_10015708 Ga0207685_100157083 392
166 3300025906 Ga0207699_10007708 Ga0207699_100077082 392
167 3300025914 Ga0207671_10028805 Ga0207671_100288053 392
168 3300025915 Ga0207693_10032830 Ga0207693_100328305 392
169 3300025923 Ga0207681_10055346 Ga0207681_100553462 392
170 3300025927 Ga0207687_10088658 Ga0207687_100886581 392
171 3300025927 Ga0207687_10142855 Ga0207687_101428552 392
172 3300025928 Ga0207700_10079668 Ga0207700_100796683 392
173 3300025929 Ga0207664_10030573 Ga0207664_100305733 392
174 3300025932 Ga0207690_10162230 Ga0207690_101622302 392
175 3300025933 Ga0207706_10012890 Ga0207706_100128902 392
176 3300025933 Ga0207706_10072274 Ga0207706_100722742 392
177 3300025935 Ga0207709_10017362 Ga0207709_100173625 392
178 3300025937 Ga0207669_10010569 Ga0207669_100105695 392
179 3300025939 Ga0207665_10068512 Ga0207665_100685122 392
180 3300025940 Ga0207691_10031947 Ga0207691_100319474 392
181 3300025940 Ga0207691_10141147 Ga0207691_101411472 392
182 3300025942 Ga0207689_10050405 Ga0207689_100504052 392
183 3300025949 Ga0207667_10061068 Ga0207667_100610682 392
184 3300025961 Ga0207712_10214617 Ga0207712_102146172 392
185 3300025972 Ga0207668_10112499 Ga0207668_101124991 392
186 3300025972 Ga0207668_10220538 Ga0207668_102205382 392
187 3300025972 Ga0207668_10269826 Ga0207668_102698261 392
188 3300026023 Ga0207677_10008433 Ga0207677_100084333 392
189 3300026023 Ga0207677_10030095 Ga0207677_100300953 392
190 3300026067 Ga0207678_10099619 Ga0207678_100996194 392
191 3300026067 Ga0207678_10182909 Ga0207678_101829092 392
192 3300026078 Ga0207702_10021621 Ga0207702_100216214 392
193 3300026095 Ga0207676_10174610 Ga0207676_101746102 392
194 3300026116 Ga0207674_10099324 Ga0207674_100993244 392
195 3300026118 Ga0207675_100103756 Ga0207675_1001037562 392
196 3300026118 Ga0207675_100104899 Ga0207675_1001048994 392
197 3300026121 Ga0207683_10060268 Ga0207683_100602682 392
198 3300026121 Ga0207683_10196104 Ga0207683_101961042 392
199 3300026121 Ga0207683_10214891 Ga0207683_102148912 392
200 3300026142 Ga0207698_10118356 Ga0207698_101183562 392
201 3300026142 Ga0207698_10160163 Ga0207698_101601632 392
202 3300028379 Ga0268266_10021731 Ga0268266_100217316 392
203 3300028380 Ga0268265_10131363 Ga0268265_101313633 392
204 3300028381 Ga0268264_10057497 Ga0268264_100574972 392
205 3300028786 Ga0307517_10178269 Ga0307517_101782692 392
206 3300039437 Ga0436365_0278067 Ga0436365_0278067_99_1277 392
207 3300039437 Ga0436365_0687739 Ga0436365_0687739_7903_9081 392
208 3300039450 Ga0436363_1573029 Ga0436363_1573029_370_1548 392
209 3300046455 Ga0495603_0015732 Ga0495603_0015732_394_1572 392
210 3300046455 Ga0495603_0056614 Ga0495603_0056614_154_1332 392
211 3300046472 Ga0495580_0062316 Ga0495580_0062316_273_1451 392
212 3300046473 Ga0495582_0087147 Ga0495582_0087147_407_1585 392
213 3300046492 Ga0495585_0043686 Ga0495585_0043686_494_1672 392
214 3300046523 Ga0495644_0031238 Ga0495644_0031238_597_1775 392
215 3300046538 Ga0495609_0024284 Ga0495609_0024284_1001_2179 392
216 3300046542 Ga0495597_0045447 Ga0495597_0045447_313_1491 392
217 3300046674 Ga0495588_0086888 Ga0495588_0086888_155_1333 392
218 3300046684 Ga0495669_0004749 Ga0495669_0004749_1861_3039 392
219 3300046684 Ga0495669_0108673 Ga0495669_0108673_100_1278 392
220 3300047321 Ga0495676_0121703 Ga0495676_0121703_24_1202 392
221 3300048903 Ga0496100_0031490 Ga0496100_0031490_1828_3006 392
222 3300048904 Ga0496101_0022754 Ga0496101_0022754_655_1833 392
223 3300048905 Ga0496102_0033573 Ga0496102_0033573_2877_4055 392
224 3300048905 Ga0496102_0212801 Ga0496102_0212801_409_1587 392
225 3300048906 Ga0496103_0024136 Ga0496103_0024136_2070_3248 392
226 3300048907 Ga0496104_0035515 Ga0496104_0035515_2069_3247 392
227 3300048907 Ga0496104_0315578 Ga0496104_0315578_77_1255 392
228 3300048908 Ga0496105_0052035 Ga0496105_0052035_1247_2425 392
229 3300048909 Ga0496106_0020122 Ga0496106_0020122_300_1478 392
230 3300048909 Ga0496106_0029606 Ga0496106_0029606_1079_2257 392
231 3300048909 Ga0496106_0054568 Ga0496106_0054568_140_1318 392
232 3300048910 Ga0496107_0046653 Ga0496107_0046653_991_2169 392
233 3300048911 Ga0496108_0017378 Ga0496108_0017378_567_1745 392
234 3300048912 Ga0496109_0020594 Ga0496109_0020594_3905_5083 392
235 3300048915 Ga0496112_0129318 Ga0496112_0129318_943_2121 392
236 3300048916 Ga0496113_0011838 Ga0496113_0011838_3971_5149 392
237 3300048916 Ga0496113_0041979 Ga0496113_0041979_1289_2467 392
238 3300048917 Ga0496114_0004339 Ga0496114_0004339_4430_5608 392
239 3300048918 Ga0496115_0025513 Ga0496115_0025513_2115_3293 392
240 3300048918 Ga0496115_0086269 Ga0496115_0086269_486_1664 392
241 3300048918 Ga0496115_0103869 Ga0496115_0103869_732_1910 392
242 3300048921 Ga0496118_0094096 Ga0496118_0094096_327_1505 392
243 3300048924 Ga0496121_0044584 Ga0496121_0044584_89_1267 392
244 3300048924 Ga0496121_0073020 Ga0496121_0073020_1326_2504 392
245 3300048927 Ga0496124_0147134 Ga0496124_0147134_384_1562 392
246 3300048928 Ga0496125_0139875 Ga0496125_0139875_434_1612 392
247 3300048929 Ga0496126_0015594 Ga0496126_0015594_4790_5968 392
248 3300050490 nmdc:mga03n38_2420_c1 nmdc:mga03n38_2420_c1_94_1272 392
249 3300050494 nmdc:mga06z11_37379_c1 nmdc:mga06z11_37379_c1_1119_2297 392
250 3300050494 nmdc:mga06z11_37836_c1 nmdc:mga06z11_37836_c1_851_2029 392
251 3300050496 nmdc:mga07m45_21319_c2 nmdc:mga07m45_21319_c2_981_2159 392
252 3300050496 nmdc:mga07m45_40836_c1 nmdc:mga07m45_40836_c1_1102_2280 392
253 3300050513 nmdc:mga0rr50_103192_c1 nmdc:mga0rr50_103192_c1_974_2152 392
254 3300053086 Ga0500578_0055597 Ga0500578_0055597_974_2152 392
255 3300053087 Ga0500643_038654 Ga0500643_038654_76_1254 392
256 3300053093 Ga0500651_0045618 Ga0500651_0045618_1475_2653 392
257 3300053094 Ga0500566_0004143 Ga0500566_0004143_5359_6537 392
258 3300053119 Ga0500595_001234 Ga0500595_001234_7168_8346 392
259 3300053147 Ga0500589_056452 Ga0500589_056452_503_1681 392
260 3300053156 Ga0500622_0042293 Ga0500622_0042293_97_1275 392
261 3300053162 Ga0500638_000124 Ga0500638_000124_12534_13712 392
262 3300053178 Ga0500637_0010349 Ga0500637_0010349_1542_2720 392
263 3300053730 Ga0500645_014877 Ga0500645_014877_703_1881 392
264 iso_pu_bacteria 2791355196 2793059934 392
265 3300003215 JGI25153J46596_10003956 JGI25153J46596_100039568 393
266 3300003215 JGI25153J46596_10006871 JGI25153J46596_100068716 393
267 3300003354 JGI25160J50197_1003485 JGI25160J50197_10034856 393
268 3300003659 JGI25404J52841_10005028 JGI25404J52841_100050284 393
269 3300003659 JGI25404J52841_10012886 JGI25404J52841_100128863 393
270 3300003794 Ga0055531_10012574 Ga0055531_100125742 393
271 3300005456 Ga0070678_100177243 Ga0070678_1001772432 393
272 3300005467 Ga0070706_100174202 Ga0070706_1001742021 393
273 3300005471 Ga0070698_100019994 Ga0070698_1000199946 393
274 3300005841 Ga0068863_100227909 Ga0068863_1002279092 393
275 3300005937 Ga0081455_10066167 Ga0081455_100661672 393
276 3300005937 Ga0081455_10078300 Ga0081455_100783002 393
277 3300005983 Ga0081540_1013269 Ga0081540_10132695 393
278 3300005983 Ga0081540_1029768 Ga0081540_10297686 393
279 3300005983 Ga0081540_1031943 Ga0081540_10319432 393
280 3300005983 Ga0081540_1074326 Ga0081540_10743263 393
281 3300005983 Ga0081540_1074971 Ga0081540_10749712 393
282 3300005985 Ga0081539_10000747 Ga0081539_1000074753 393
283 3300006038 Ga0075365_10110915 Ga0075365_101109152 393
284 3300006178 Ga0075367_10050941 Ga0075367_100509412 393
285 3300009176 Ga0105242_10104277 Ga0105242_101042773 393
286 3300009177 Ga0105248_10085941 Ga0105248_100859415 393
287 3300010375 Ga0105239_10017421 Ga0105239_100174215 393
288 3300013104 Ga0157370_10033228 Ga0157370_100332282 393
289 3300013308 Ga0157375_10201416 Ga0157375_102014162 393
290 3300014325 Ga0163163_10430145 Ga0163163_104301452 393
291 3300021441 Ga0213871_10005236 Ga0213871_100052363 393
292 3300025261 Ga0209233_1002274 Ga0209233_10022746 393
293 3300025295 Ga0209564_1003642 Ga0209564_10036424 393
294 3300025297 Ga0209758_1000407 Ga0209758_100040743 393
295 3300025297 Ga0209758_1000952 Ga0209758_100095218 393
296 3300025299 Ga0209256_1003168 Ga0209256_10031686 393
297 3300025302 Ga0207426_1006892 Ga0207426_10068922 393
298 3300025304 Ga0209257_1001445 Ga0209257_10014456 393
299 3300025910 Ga0207684_10084428 Ga0207684_100844284 393
300 3300025934 Ga0207686_10076584 Ga0207686_100765842 393
301 3300025941 Ga0207711_10225075 Ga0207711_102250752 393
302 3300027296 Ga0209389_1000011 Ga0209389_1000011100 393
303 3300027361 Ga0209489_100017 Ga0209489_100017134 393
304 3300027363 Ga0209700_100027 Ga0209700_100027100 393
305 3300031616 Ga0307508_10017864 Ga0307508_100178645 393
306 3300031730 Ga0307516_10006295 Ga0307516_1000629513 393
307 3300032002 Ga0307416_100065752 Ga0307416_1000657524 393
308 3300033442 Ga0315911_1000011 Ga0315911_100001181 393
309 3300035112 Ga0373932_0028549 Ga0373932_0028549_22_1203 393
310 3300035113 Ga0373936_0012430 Ga0373936_0012430_222_1403 393
311 3300035691 Ga0373931_0007686 Ga0373931_0007686_1417_2598 393
312 3300035695 Ga0373927_0107960 Ga0373927_0107960_315_1496 393
313 3300035695 Ga0373927_0112866 Ga0373927_0112866_299_1480 393
314 3300037418 Ga0395900_0149359 Ga0395900_0149359_687_1868 393
315 3300037466 Ga0395898_0022383 Ga0395898_0022383_3495_4676 393
316 3300037466 Ga0395898_0183312 Ga0395898_0183312_302_1483 393
317 3300038443 Ga0395901_0200944 Ga0395901_0200944_809_1990 393
318 3300039438 Ga0436360_0661609 Ga0436360_0661609_113_1294 393
319 3300039447 Ga0436361_0785755 Ga0436361_0785755_3587_4768 393
320 3300039453 Ga0436362_1292799 Ga0436362_1292799_434_1615 393
321 3300046455 Ga0495603_0025704 Ga0495603_0025704_916_2097 393
322 3300046477 Ga0495664_0012732 Ga0495664_0012732_230_1411 393
323 3300046543 Ga0495645_0002189 Ga0495645_0002189_2529_3710 393
324 3300046616 Ga0495668_0025830 Ga0495668_0025830_347_1528 393
325 3300048904 Ga0496101_0006632 Ga0496101_0006632_4877_6058 393
326 3300048908 Ga0496105_0006080 Ga0496105_0006080_3471_4652 393
327 3300048909 Ga0496106_0085023 Ga0496106_0085023_1240_2421 393
328 3300048910 Ga0496107_0022024 Ga0496107_0022024_13_1194 393
329 3300048911 Ga0496108_0130051 Ga0496108_0130051_121_1302 393
330 3300048912 Ga0496109_0163275 Ga0496109_0163275_441_1622 393
331 3300048914 Ga0496111_0049829 Ga0496111_0049829_663_1844 393
332 3300048916 Ga0496113_0067973 Ga0496113_0067973_1355_2536 393
333 3300048917 Ga0496114_0002764 Ga0496114_0002764_2631_3812 393
334 3300048924 Ga0496121_0019777 Ga0496121_0019777_4518_5699 393
335 3300048929 Ga0496126_0016957 Ga0496126_0016957_1382_2563 393
336 3300053077 Ga0495601_0043004 Ga0495601_0043004_1497_2678 393
337 3300053085 Ga0495619_0184154 Ga0495619_0184154_159_1340 393
338 3300053094 Ga0500566_0000064 Ga0500566_0000064_29817_30998 393
339 3300053095 Ga0500640_003196 Ga0500640_003196_4425_5606 393
340 3300053111 Ga0500572_000026 Ga0500572_000026_26446_27627 393
341 3300053122 Ga0500608_008044 Ga0500608_008044_2531_3712 393
342 3300053123 Ga0500614_002715 Ga0500614_002715_306_1487 393
343 3300053136 Ga0500559_0004820 Ga0500559_0004820_4063_5244 393
344 3300053150 Ga0500603_000109 Ga0500603_000109_13921_15102 393
345 3300053155 Ga0500620_001076 Ga0500620_001076_3588_4772 393
346 3300053159 Ga0500630_005009 Ga0500630_005009_3216_4397 393
347 3300053163 Ga0500639_000353 Ga0500639_000353_19917_21098 393
348 3300053735 Ga0500596_005043 Ga0500596_005043_405_1586 393
349 iso_pu_bacteria 2507262055 2507510086 393
350 iso_pu_bacteria 2508501009 2508544088 393
351 iso_pu_bacteria 2513237092 2513628054 393
352 iso_pu_bacteria 2513237094 2513643618 393
353 iso_pu_bacteria 2513237095 2513648946 393
354 iso_pu_bacteria 2513237102 2513705408 393
355 iso_pu_bacteria 2513237139 2513878061 393
356 iso_pu_bacteria 2513237161 2514012642 393
357 iso_pu_bacteria 2515154112 2515629408 393
358 iso_pu_bacteria 2517093001 2517108433 393
359 iso_pu_bacteria 2524023205 2524439118 393
360 iso_pu_bacteria 2528768022 2528849661 393
361 iso_pu_bacteria 2617270735 2617352583 393
362 iso_pu_bacteria 2744054633 2745078769 393
363 iso_pu_bacteria 2802429603 2805920021 393
364 iso_pu_bacteria 2816332527 2818241650 393
365 iso_pu_bacteria 2824600985 2824606219 393
366 iso_pu_bacteria 2824609381 2824609799 393
367 iso_pu_bacteria 2824617872 2824622770 393
368 iso_pu_bacteria 2824626560 2824632397 393
369 iso_pu_bacteria 2824635225 2824640416 393
370 iso_pu_bacteria 2824653114 2824657682 393
371 iso_pu_bacteria 2824661429 2824668728 393
372 iso_pu_bacteria 2824671348 2824674283 393
373 iso_pu_bacteria 2824679649 2824682568 393
374 iso_pu_bacteria 2824687955 2824690905 393
375 iso_pu_bacteria 2824696289 2824698519 393
376 iso_pu_bacteria 2824704595 2824708358 393
377 iso_pu_bacteria 2824714736 2824720383 393
378 iso_pu_bacteria 2824723954 2824728704 393
379 iso_pu_bacteria 2824753945 2824758933 393
380 iso_pu_bacteria 2824763712 2824766109 393
381 iso_pu_bacteria 2824773399 2824778218 393
382 iso_pu_bacteria 2838122688 2838127472 393
383 iso_pu_bacteria 2841941048 2841941575 393
384 iso_pu_bacteria 2841949485 2841952409 393
385 iso_pu_bacteria 2841966195 2841967719 393
386 iso_pu_bacteria 2841974524 2841982115 393
387 iso_pu_bacteria 2841983080 2841986433 393
388 iso_pu_bacteria 2847939898 2847945070 393
389 iso_pu_bacteria 2874612657 2874618168 393
390 iso_pu_bacteria 2876761206 2876766750 393
391 iso_pu_bacteria 2876771140 2876773328 393
392 iso_pu_bacteria 2876818435 2876821281 393
393 iso_pu_bacteria 2879099564 2879107670 393
394 iso_pu_bacteria 2879142872 2879146714 393
395 iso_pu_bacteria 2881364244 2881365728 393
396 iso_pu_bacteria 2881665667 2881670915 393
397 iso_pu_bacteria 2885409591 2885410157 393
398 iso_pu_bacteria 2888378607 2888382399 393
399 iso_pu_bacteria 2888419890 2888422987 393
400 iso_pu_bacteria 2903727486 2903735354 393
401 iso_pu_bacteria 2904711408 2904718539 393
402 iso_pu_bacteria 2906602504 2906608727 393
403 iso_pu_bacteria 2906626472 2906634799 393
404 iso_pu_bacteria 2922368715 2922375564 393
405 iso_pu_bacteria 2929615660 2929616301 393
406 iso_pu_bacteria 2929624759 2929625045 393
407 iso_pu_bacteria 2932784394 2932787033 393
408 iso_pu_bacteria 2932809354 2932811231 393
409 iso_pu_bacteria 2932818245 2932819896 393
410 iso_pu_bacteria 2932828146 2932832377 393
411 iso_pu_bacteria 2933577622 2933578415 393
412 iso_pu_bacteria 2935616580 2935619085 393
413 iso_pu_bacteria 2935638405 2935643096 393
414 iso_pu_bacteria 2935665750 2935669723 393
415 iso_pu_bacteria 2935675223 2935677137 393
416 iso_pu_bacteria 2935684952 2935693172 393
417 iso_pu_bacteria 2935694250 2935695333 393
418 iso_pu_bacteria 2935703347 2935709558 393
419 iso_pu_bacteria 2935713505 2935719780 393
420 iso_pu_bacteria 2935722832 2935729453 393
421 iso_pu_bacteria 2935732158 2935739663 393
422 iso_pu_bacteria 2935741537 2935748701 393
423 iso_pu_bacteria 2935750917 2935756712 393
424 iso_pu_bacteria 2935760218 2935761304 393
425 iso_pu_bacteria 2935769743 2935771423 393
426 iso_pu_bacteria 2935777560 2935779112 393
427 iso_pu_bacteria 2935785616 2935788316 393
428 iso_pu_bacteria 2935793552 2935796919 393
429 iso_pu_bacteria 2935801545 2935807245 393
430 iso_pu_bacteria 2935827899 2935832759 393
431 iso_pu_bacteria 2935864058 2935864982 393
432 iso_pu_bacteria 2935873716 2935876760 393
433 iso_pu_bacteria 2935959822 2935963289 393
434 iso_pu_bacteria 2936002035 2936008350 393
435 iso_pu_bacteria 2940556831 2940562626 393
436 iso_pu_bacteria 2941538514 2941539850 393
437 iso_pu_bacteria 3005594810 3005597412 393
438 iso_pu_bacteria 3005710791 3005713439 393
439 iso_pu_bacteria 3005718088 3005720854 393
440 iso_pu_bacteria 8006926726 8006930455 393
441 iso_pu_bacteria 8016511872 8016515175 393
442 iso_pu_bacteria 8016522445 8016522963 393
443 iso_pu_bacteria 8016557553 8016560920 393
444 iso_pu_bacteria 8016566248 8016574786 393
445 iso_pu_bacteria 8016575299 8016578861 393
446 iso_pu_bacteria 8016595262 8016598788 393
447 iso_pu_bacteria 8016613128 8016621514 393
448 iso_pu_bacteria 8017057580 8017061279 393
449 iso_pu_bacteria 8019530166 8019536145 393
450 iso_pu_bacteria 8019586578 8019588481 393
451 iso_pu_bacteria 8019597564 8019602856 393
452 iso_pu_bacteria 8019619141 8019626450 393
453 iso_pu_bacteria 8019638758 8019643623 393
454 iso_pu_bacteria 8019659431 8019663807 393
455 iso_pu_bacteria 8055742211 8055747947 393
456 iso_pu_bacteria 8056967851 8056969480 393
457 3300003215 JGI25153J46596_10001533 JGI25153J46596_1000153311 394
458 3300003354 JGI25160J50197_1001294 JGI25160J50197_100129410 394
459 3300005336 Ga0070680_100090722 Ga0070680_1000907223 394
460 3300005458 Ga0070681_10138906 Ga0070681_101389063 394
461 3300005530 Ga0070679_100044585 Ga0070679_1000445852 394
462 3300005577 Ga0068857_100121411 Ga0068857_1001214111 394
463 3300006028 Ga0070717_10006275 Ga0070717_100062754 394
464 3300006942 Ga0099824_1020393 Ga0099824_10203937 394
465 3300013105 Ga0157369_10094195 Ga0157369_100941953 394
466 3300025295 Ga0209564_1002300 Ga0209564_10023003 394
467 3300025297 Ga0209758_1000900 Ga0209758_100090041 394
468 3300025302 Ga0207426_1000466 Ga0207426_100046656 394
469 3300025304 Ga0209257_1036773 Ga0209257_10367731 394
470 3300025912 Ga0207707_10002025 Ga0207707_1000202519 394
471 3300025912 Ga0207707_10077474 Ga0207707_100774742 394
472 3300025917 Ga0207660_10005792 Ga0207660_100057926 394
473 3300025917 Ga0207660_10019091 Ga0207660_100190916 394
474 3300025921 Ga0207652_10018694 Ga0207652_100186943 394
475 3300025944 Ga0207661_10017331 Ga0207661_100173316 394
476 3300035083 Ga0373926_0010615 Ga0373926_0010615_85_1269 394
477 3300035089 Ga0373944_0027927 Ga0373944_0027927_92_1276 394
478 3300035111 Ga0373923_0001451 Ga0373923_0001451_4432_5616 394
479 3300035116 Ga0373945_0051853 Ga0373945_0051853_231_1415 394
480 3300035118 Ga0373954_0030575 Ga0373954_0030575_623_1807 394
481 3300035170 Ga0373943_0036703 Ga0373943_0036703_1061_2245 394
482 3300035171 Ga0373946_0022123 Ga0373946_0022123_92_1276 394
483 3300035172 Ga0373955_0050587 Ga0373955_0050587_535_1719 394
484 3300035410 Ga0373924_0052065 Ga0373924_0052065_426_1610 394
485 3300037068 Ga0373925_0013406 Ga0373925_0013406_3993_5177 394
486 3300046454 Ga0495592_0158003 Ga0495592_0158003_76_1260 394
487 3300046472 Ga0495580_0013314 Ga0495580_0013314_2143_3327 394
488 3300046473 Ga0495582_0023756 Ga0495582_0023756_1606_2790 394
489 3300046475 Ga0495639_0004952 Ga0495639_0004952_3413_4597 394
490 3300046477 Ga0495664_0094369 Ga0495664_0094369_504_1688 394
491 3300046499 Ga0495594_0056395 Ga0495594_0056395_517_1701 394
492 3300046511 Ga0495608_0098045 Ga0495608_0098045_455_1639 394
493 3300046516 Ga0495628_0148725 Ga0495628_0148725_504_1688 394
494 3300046517 Ga0495630_0005565 Ga0495630_0005565_2654_3838 394
495 3300046531 Ga0495665_0013892 Ga0495665_0013892_1342_2526 394
496 3300046533 Ga0495640_0015080 Ga0495640_0015080_1972_3156 394
497 3300046543 Ga0495645_0113951 Ga0495645_0113951_623_1807 394
498 3300046642 Ga0495634_0032240 Ga0495634_0032240_623_1807 394
499 3300046681 Ga0495647_0005222 Ga0495647_0005222_641_1825 394
500 3300046689 Ga0495613_0172949 Ga0495613_0172949_148_1332 394
501 3300047317 Ga0495604_0200130 Ga0495604_0200130_106_1290 394
502 3300047319 Ga0495674_0017659 Ga0495674_0017659_2127_3311 394
503 3300047471 Ga0495684_0022676 Ga0495684_0022676_1482_2666 394
504 3300047673 Ga0495593_0017295 Ga0495593_0017295_1768_2952 394
505 3300048928 Ga0496125_0052475 Ga0496125_0052475_657_1844 394
506 3300049581 Ga0501047_0021432 Ga0501047_0021432_492_1688 394
507 3300049590 Ga0501074_0143591 Ga0501074_0143591_116_1312 394
508 3300049742 Ga0501080_0021618 Ga0501080_0021618_3242_4438 394
509 3300049822 Ga0501035_0168544 Ga0501035_0168544_232_1428 394
510 3300050492 nmdc:mga0yw44_17230_c1 nmdc:mga0yw44_17230_c1_2332_3519 394
511 3300050516 nmdc:mga0sz30_16099_c1 nmdc:mga0sz30_16099_c1_431_1618 394
512 3300053077 Ga0495601_0078764 Ga0495601_0078764_200_1384 394
513 iso_pu_bacteria 2617270741 2617379007 394
514 iso_pu_bacteria 2824732956 2824736323 394
515 iso_pu_bacteria 2824746037 2824749992 394
516 iso_pu_bacteria 2908775508 2908778653 394
517 iso_pu_bacteria 2922393267 2922394926 394
518 iso_pu_bacteria 2932794094 2932797264 394
519 iso_pu_bacteria 2932801729 2932804851 394
520 iso_pu_bacteria 2935883170 2935884913 394
521 iso_pu_bacteria 2941531003 2941536317 394
522 iso_pu_bacteria 3005483717 3005487880 394
523 iso_pu_bacteria 3005587118 3005589385 394
524 iso_pu_bacteria 8019648815 8019656411 394
525 3300005334 Ga0068869_100076723 Ga0068869_1000767234 395
526 3300005347 Ga0070668_100111188 Ga0070668_1001111882 395
527 3300005353 Ga0070669_100080577 Ga0070669_1000805772 395
528 3300005471 Ga0070698_100134945 Ga0070698_1001349452 395
529 3300005543 Ga0070672_100102762 Ga0070672_1001027622 395
530 3300005843 Ga0068860_100127931 Ga0068860_1001279312 395
531 3300005844 Ga0068862_100074659 Ga0068862_1000746592 395
532 3300006038 Ga0075365_10004123 Ga0075365_100041233 395
533 3300006177 Ga0075362_10034916 Ga0075362_100349162 395
534 3300009553 Ga0105249_10400783 Ga0105249_104007831 395
535 3300025923 Ga0207681_10065430 Ga0207681_100654302 395
536 3300025940 Ga0207691_10079604 Ga0207691_100796043 395
537 3300025972 Ga0207668_10043719 Ga0207668_100437194 395
538 3300026118 Ga0207675_100253690 Ga0207675_1002536901 395
539 3300031901 Ga0307406_10066488 Ga0307406_100664882 395
540 3300032126 Ga0307415_100049699 Ga0307415_1000496992 395
541 3300048918 Ga0496115_0278051 Ga0496115_0278051_158_1345 395
542 3300050491 nmdc:mga00v17_14964_c1 nmdc:mga00v17_14964_c1_2036_3229 395
543 3300050492 nmdc:mga0yw44_26457_c1 nmdc:mga0yw44_26457_c1_56_1249 395
544 iso_pu_bacteria 2874590934 2874593288 395
545 iso_pu_bacteria 2874645413 2874652937 395
546 iso_pu_bacteria 2879074833 2879077244 395
547 iso_pu_bacteria 2879127579 2879130199 395
548 iso_pu_bacteria 2935608549 2935611009 395
549 iso_pu_bacteria 2935810662 2935812381 395
550 iso_pu_bacteria 2935819856 2935820494 395
551 iso_pu_bacteria 2935837841 2935839160 395
552 iso_pu_bacteria 2935847175 2935849497 395
553 iso_pu_bacteria 2935855204 2935857450 395
554 iso_pu_bacteria 2935908558 2935911729 395
555 iso_pu_bacteria 2935916978 2935919384 395
556 iso_pu_bacteria 2935926038 2935928758 395
557 iso_pu_bacteria 2935934488 2935938403 395
558 iso_pu_bacteria 2935942939 2935945705 395
559 iso_pu_bacteria 2935951376 2935954688 395
560 iso_pu_bacteria 2935967501 2935970575 395
561 iso_pu_bacteria 2935975950 2935979189 395
562 iso_pu_bacteria 2936037263 2936038974 395
563 iso_pu_bacteria 8019538911 8019543327 395
564 iso_pu_bacteria 8019547302 8019555530 395
565 iso_pu_bacteria 8019576017 8019580750 395
566 iso_pu_bacteria 8019608314 8019615700 395
567 iso_pu_bacteria 8019629233 8019636042 395
568 iso_pu_bacteria 8019668869 8019673438 395
569 iso_pu_bacteria 8019687851 8019688374 395
570 3300003203 JGI25406J46586_10000141 JGI25406J46586_1000014114 396
571 3300004625 Ga0055543_1011317 Ga0055543_10113172 396
572 3300005262 Ga0065165_1002974 Ga0065165_10029746 396
573 3300005985 Ga0081539_10000008 Ga0081539_10000008475 396
574 3300025901 Ga0207688_10047486 Ga0207688_100474864 396
575 3300047469 Ga0495673_0034885 Ga0495673_0034885_823_2043 396
576 3300048909 Ga0496106_0025828 Ga0496106_0025828_172_1362 396
577 3300048915 Ga0496112_0007576 Ga0496112_0007576_6439_7641 396
578 3300053085 Ga0495619_0027691 Ga0495619_0027691_1947_3137 396
579 3300053098 Ga0500650_0081575 Ga0500650_0081575_210_1400 396
580 iso_pu_bacteria 2508501128 2509153755 396
581 iso_pu_bacteria 2511231028 2511398618 396
582 iso_pu_bacteria 2513237098 2513676481 396
583 iso_pu_bacteria 2524023210 2524470396 396
584 iso_pu_bacteria 2885383462 2885390048 396
585 iso_pu_bacteria 2903768456 2903771726 396
586 iso_pu_bacteria 8056681323 8056685065 396
587 3300005331 Ga0070670_100113694 Ga0070670_1001136944 397
588 3300005455 Ga0070663_100159166 Ga0070663_1001591662 397
589 3300005547 Ga0070693_100157265 Ga0070693_1001572651 397
590 3300005616 Ga0068852_100031560 Ga0068852_1000315603 397
591 3300006038 Ga0075365_10135999 Ga0075365_101359992 397
592 3300006048 Ga0075363_100022580 Ga0075363_1000225802 397
593 3300006051 Ga0075364_10146759 Ga0075364_101467592 397
594 3300006177 Ga0075362_10010952 Ga0075362_100109521 397
595 3300006195 Ga0075366_10049004 Ga0075366_100490043 397
596 3300006942 Ga0099824_1021825 Ga0099824_10218252 397
597 3300009093 Ga0105240_10043716 Ga0105240_100437165 397
598 3300009545 Ga0105237_10026805 Ga0105237_100268056 397
599 3300014969 Ga0157376_10313863 Ga0157376_103138632 397
600 3300025253 Ga0209677_105815 Ga0209677_1058153 397
601 3300025913 Ga0207695_10000029 Ga0207695_10000029154 397
602 3300025986 Ga0207658_10077021 Ga0207658_100770214 397
603 3300026088 Ga0207641_10214713 Ga0207641_102147131 397
604 3300026142 Ga0207698_10022947 Ga0207698_100229476 397
605 3300027296 Ga0209389_1000025 Ga0209389_1000025158 397
606 3300027357 Ga0209589_1000066 Ga0209589_1000066107 397
607 3300027361 Ga0209489_100030 Ga0209489_1000306 397
608 3300033180 Ga0307510_10010422 Ga0307510_1001042212 397
609 3300037312 Ga0395899_0078611 Ga0395899_0078611_72_1265 397
610 3300037418 Ga0395900_0006782 Ga0395900_0006782_3685_4878 397
611 3300037466 Ga0395898_0002649 Ga0395898_0002649_7717_8910 397
612 3300037466 Ga0395898_0079527 Ga0395898_0079527_695_1888 397
613 3300037471 Ga0395905_0065215 Ga0395905_0065215_244_1437 397
614 3300038443 Ga0395901_0047239 Ga0395901_0047239_226_1419 397
615 3300044683 Ga0466965_0050738 Ga0466965_0050738_501_1697 397
616 3300046454 Ga0495592_0131071 Ga0495592_0131071_183_1376 397
617 3300046459 Ga0495629_0020804 Ga0495629_0020804_1832_3028 397
618 3300046460 Ga0495638_0018033 Ga0495638_0018033_849_2045 397
619 3300046462 Ga0495651_0019266 Ga0495651_0019266_720_1913 397
620 3300046507 Ga0495606_0010364 Ga0495606_0010364_1525_2721 397
621 3300046512 Ga0495610_0017492 Ga0495610_0017492_2166_3362 397
622 3300046513 Ga0495616_0032613 Ga0495616_0032613_166_1362 397
623 3300046529 Ga0495652_0013209 Ga0495652_0013209_5576_6769 397
624 3300046529 Ga0495652_0045028 Ga0495652_0045028_2295_3491 397
625 3300046559 Ga0495667_0058697 Ga0495667_0058697_180_1373 397
626 3300046616 Ga0495668_0022603 Ga0495668_0022603_581_1777 397
627 3300046663 Ga0495635_0032559 Ga0495635_0032559_1483_2679 397
628 3300046675 Ga0495657_0014702 Ga0495657_0014702_2993_4189 397
629 3300046675 Ga0495657_0053916 Ga0495657_0053916_1253_2446 397
630 3300046689 Ga0495613_0031570 Ga0495613_0031570_1256_2449 397
631 3300046690 Ga0495624_0029902 Ga0495624_0029902_865_2061 397
632 3300046694 Ga0495649_0065558 Ga0495649_0065558_473_1669 397
633 3300046809 Ga0495600_0004901 Ga0495600_0004901_4473_5666 397
634 3300046809 Ga0495600_0011897 Ga0495600_0011897_3109_4305 397
635 3300047319 Ga0495674_0096617 Ga0495674_0096617_223_1416 397
636 3300047319 Ga0495674_0131627 Ga0495674_0131627_793_1986 397
637 3300047321 Ga0495676_0027171 Ga0495676_0027171_1068_2264 397
638 3300047322 Ga0495680_0017781 Ga0495680_0017781_3860_5053 397
639 3300047443 Ga0495687_009133 Ga0495687_009133_1538_2734 397
640 3300047444 Ga0495675_0054654 Ga0495675_0054654_1286_2479 397
641 3300047472 Ga0495686_0038303 Ga0495686_0038303_528_1724 397
642 3300047673 Ga0495593_0054000 Ga0495593_0054000_532_1725 397
643 3300048088 Ga0495602_0053544 Ga0495602_0053544_203_1399 397
644 3300048088 Ga0495602_0143687 Ga0495602_0143687_524_1717 397
645 3300048089 Ga0495614_0042211 Ga0495614_0042211_359_1552 397
646 3300048903 Ga0496100_0244134 Ga0496100_0244134_26_1222 397
647 3300048905 Ga0496102_0140679 Ga0496102_0140679_925_2121 397
648 3300048907 Ga0496104_0006004 Ga0496104_0006004_1703_2896 397
649 3300048923 Ga0496120_0011493 Ga0496120_0011493_1802_2998 397
650 3300048924 Ga0496121_0165353 Ga0496121_0165353_215_1411 397
651 3300048928 Ga0496125_0117651 Ga0496125_0117651_485_1678 397
652 3300048929 Ga0496126_0037222 Ga0496126_0037222_15_1211 397
653 3300049460 Ga0495682_0013186 Ga0495682_0013186_1507_2703 397
654 3300050491 nmdc:mga00v17_75253_c1 nmdc:mga00v17_75253_c1_715_1911 397
655 3300050492 nmdc:mga0yw44_14247_c1 nmdc:mga0yw44_14247_c1_2747_3946 397
656 3300050496 nmdc:mga07m45_26268_c2 nmdc:mga07m45_26268_c2_998_2194 397
657 3300053079 Ga0500610_0061422 Ga0500610_0061422_468_1664 397
658 3300053087 Ga0500643_000019 Ga0500643_000019_147173_148369 397
659 3300053092 Ga0500583_0051411 Ga0500583_0051411_491_1687 397
660 3300053094 Ga0500566_0000487 Ga0500566_0000487_11768_12964 397
661 3300053103 Ga0500555_001886 Ga0500555_001886_906_2102 397
662 3300053108 Ga0500562_004144 Ga0500562_004144_2170_3366 397
663 3300053118 Ga0500594_0007039 Ga0500594_0007039_1220_2416 397
664 3300053158 Ga0500627_0001288 Ga0500627_0001288_3420_4616 397
665 3300053177 Ga0500636_0000194 Ga0500636_0000194_26331_27527 397
666 3300053730 Ga0500645_013158 Ga0500645_013158_1178_2371 397
667 3300053736 Ga0500599_005309 Ga0500599_005309_15_1211 397
668 iso_pu_bacteria 2888388044 2888388292 397
669 iso_pu_bacteria 2935984226 2935987799 397
670 3300005614 Ga0068856_100004479 Ga0068856_1000044797 398
671 3300005843 Ga0068860_100000317 Ga0068860_10000031763 398
672 3300026078 Ga0207702_10001399 Ga0207702_100013998 398
673 3300028381 Ga0268264_10000035 Ga0268264_1000003545 398
674 3300030521 Ga0307511_10024421 Ga0307511_100244216 398
675 3300031507 Ga0307509_10056729 Ga0307509_100567292 398
676 3300031507 Ga0307509_10127360 Ga0307509_101273602 398
677 3300031507 Ga0307509_10220957 Ga0307509_102209572 398
678 3300031711 Ga0265314_10011778 Ga0265314_100117783 398
679 3300031730 Ga0307516_10089057 Ga0307516_100890573 398
680 3300035692 Ga0373935_0012759 Ga0373935_0012759_2288_3484 398
681 3300035695 Ga0373927_0001005 Ga0373927_0001005_14043_15239 398
682 3300035695 Ga0373927_0021788 Ga0373927_0021788_106_1302 398
683 3300039437 Ga0436365_1006381 Ga0436365_1006381_542_1738 398
684 3300048909 Ga0496106_0002853 Ga0496106_0002853_766_1962 398
685 3300048921 Ga0496118_0006091 Ga0496118_0006091_7205_8401 398
686 3300048924 Ga0496121_0018786 Ga0496121_0018786_4782_5978 398
687 3300048927 Ga0496124_0016465 Ga0496124_0016465_1679_2875 398
688 3300048928 Ga0496125_0052884 Ga0496125_0052884_961_2157 398
689 3300053080 Ga0500635_0002861 Ga0500635_0002861_812_2008 398
690 3300053119 Ga0500595_036983 Ga0500595_036983_312_1508 398
691 3300053178 Ga0500637_0055352 Ga0500637_0055352_251_1447 398
692 3300005616 Ga0068852_100108652 Ga0068852_1001086523 399
693 3300009098 Ga0105245_10197387 Ga0105245_101973872 399
694 3300009545 Ga0105237_10062996 Ga0105237_100629963 399
695 3300009551 Ga0105238_10017427 Ga0105238_100174274 399
696 3300010375 Ga0105239_10230171 Ga0105239_102301711 399
697 3300025297 Ga0209758_1003132 Ga0209758_100313212 399
698 3300031238 Ga0265332_10013434 Ga0265332_100134342 399
699 3300031241 Ga0265325_10013924 Ga0265325_100139243 399
700 3300031250 Ga0265331_10078112 Ga0265331_100781121 399
701 3300035118 Ga0373954_0015042 Ga0373954_0015042_871_2073 399
702 3300035171 Ga0373946_0005371 Ga0373946_0005371_1271_2473 399
703 3300035692 Ga0373935_0000746 Ga0373935_0000746_6561_7763 399
704 3300035695 Ga0373927_0006940 Ga0373927_0006940_1807_3009 399
705 3300035724 Ga0373933_0115939 Ga0373933_0115939_225_1427 399
706 3300035725 Ga0373947_0004336 Ga0373947_0004336_5116_6318 399
707 3300046455 Ga0495603_0025608 Ga0495603_0025608_1806_3008 399
708 3300046459 Ga0495629_0002240 Ga0495629_0002240_9240_10442 399
709 3300046473 Ga0495582_0000699 Ga0495582_0000699_12200_13402 399
710 3300046475 Ga0495639_0001536 Ga0495639_0001536_1144_2346 399
711 3300046477 Ga0495664_0008004 Ga0495664_0008004_924_2126 399
712 3300046499 Ga0495594_0004167 Ga0495594_0004167_5517_6719 399
713 3300046514 Ga0495618_0021442 Ga0495618_0021442_1773_2975 399
714 3300046529 Ga0495652_0197908 Ga0495652_0197908_131_1333 399
715 3300046531 Ga0495665_0000866 Ga0495665_0000866_12354_13556 399
716 3300046642 Ga0495634_0003047 Ga0495634_0003047_5493_6695 399
717 3300046663 Ga0495635_0012928 Ga0495635_0012928_2790_3992 399
718 3300046680 Ga0495646_0007247 Ga0495646_0007247_5752_6954 399
719 3300046681 Ga0495647_0001096 Ga0495647_0001096_5364_6566 399
720 3300046683 Ga0495658_0003891 Ga0495658_0003891_620_1822 399
721 3300046690 Ga0495624_0000079 Ga0495624_0000079_48981_50183 399
722 3300047315 Ga0495581_0000260 Ga0495581_0000260_3740_4942 399
723 3300047319 Ga0495674_0035062 Ga0495674_0035062_2185_3387 399
724 3300047321 Ga0495676_0019539 Ga0495676_0019539_2714_3916 399
725 3300047471 Ga0495684_0023503 Ga0495684_0023503_600_1802 399
726 3300047673 Ga0495593_0002394 Ga0495593_0002394_7096_8298 399
727 3300053119 Ga0500595_002556 Ga0500595_002556_3658_4869 399
728 3300053724 Ga0500570_036755 Ga0500570_036755_138_1349 399
729 iso_pu_bacteria 2935656913 2935657572 399
730 iso_pu_bacteria 2936011229 2936011350 399
731 iso_pu_bacteria 2936019824 2936019945 399
732 iso_pu_bacteria 2936028420 2936028541 399
733 iso_pu_bacteria 2936046547 2936046668 399
734 iso_pu_bacteria 2936055302 2936062361 399
735 iso_pu_bacteria 8016630954 8016632646 399
736 3300003214 JGI25165J46597_1009535 JGI25165J46597_10095352 400
737 3300005548 Ga0070665_100173448 Ga0070665_1001734482 400
738 3300005983 Ga0081540_1022048 Ga0081540_10220483 400
739 3300006931 Ga0097620_100372329 Ga0097620_1003723292 400
740 3300009551 Ga0105238_10055313 Ga0105238_100553135 400
741 3300021384 Ga0213876_10065164 Ga0213876_100651641 400
742 3300025230 Ga0209563_103051 Ga0209563_1030512 400
743 3300025253 Ga0209677_101241 Ga0209677_10124110 400
744 3300025254 Ga0209148_1005105 Ga0209148_10051054 400
745 3300025254 Ga0209148_1005191 Ga0209148_10051913 400
746 3300025297 Ga0209758_1005367 Ga0209758_10053675 400
747 3300028379 Ga0268266_10275358 Ga0268266_102753582 400
748 3300035117 Ga0373953_0010742 Ga0373953_0010742_1523_2725 400
749 3300035118 Ga0373954_0009425 Ga0373954_0009425_324_1526 400
750 3300035119 Ga0373956_0020988 Ga0373956_0020988_305_1507 400
751 3300035172 Ga0373955_0006480 Ga0373955_0006480_2301_3503 400
752 3300035410 Ga0373924_0049397 Ga0373924_0049397_395_1597 400
753 3300035724 Ga0373933_0028580 Ga0373933_0028580_1164_2366 400
754 3300037853 Ga0436364_0575208 Ga0436364_0575208_285_1487 400
755 3300046454 Ga0495592_0001015 Ga0495592_0001015_3320_4522 400
756 3300046463 Ga0495653_0063362 Ga0495653_0063362_354_1556 400
757 3300046507 Ga0495606_0001396 Ga0495606_0001396_14671_15873 400
758 3300046511 Ga0495608_0008509 Ga0495608_0008509_1403_2605 400
759 3300046514 Ga0495618_0022990 Ga0495618_0022990_662_1864 400
760 3300046529 Ga0495652_0022716 Ga0495652_0022716_2695_3897 400
761 3300046533 Ga0495640_0022481 Ga0495640_0022481_3154_4356 400
762 3300046559 Ga0495667_0051604 Ga0495667_0051604_347_1549 400
763 3300046642 Ga0495634_0009200 Ga0495634_0009200_129_1331 400
764 3300046663 Ga0495635_0001667 Ga0495635_0001667_259_1461 400
765 3300046678 Ga0495599_0003132 Ga0495599_0003132_141_1343 400
766 3300046679 Ga0495623_0061738 Ga0495623_0061738_336_1538 400
767 3300046680 Ga0495646_0003463 Ga0495646_0003463_2300_3502 400
768 3300046689 Ga0495613_0161556 Ga0495613_0161556_287_1489 400
769 3300046809 Ga0495600_0003617 Ga0495600_0003617_4456_5658 400
770 3300047315 Ga0495581_0050725 Ga0495581_0050725_1001_2203 400
771 3300047317 Ga0495604_0058508 Ga0495604_0058508_216_1418 400
772 3300047444 Ga0495675_0005508 Ga0495675_0005508_1920_3122 400
773 3300047471 Ga0495684_0019374 Ga0495684_0019374_3710_4912 400
774 3300047472 Ga0495686_0085531 Ga0495686_0085531_340_1542 400
775 3300047673 Ga0495593_0049876 Ga0495593_0049876_890_2092 400
776 3300048921 Ga0496118_0008006 Ga0496118_0008006_7018_8220 400
777 3300048921 Ga0496118_0051012 Ga0496118_0051012_1935_3137 400
778 3300048924 Ga0496121_0019408 Ga0496121_0019408_1142_2344 400
779 3300048924 Ga0496121_0075121 Ga0496121_0075121_1352_2554 400
780 3300048925 Ga0496122_0124956 Ga0496122_0124956_370_1572 400
781 3300048928 Ga0496125_0044490 Ga0496125_0044490_1980_3182 400
782 3300048929 Ga0496126_0024985 Ga0496126_0024985_1382_2584 400
783 3300048929 Ga0496126_0101367 Ga0496126_0101367_698_1900 400
784 3300048929 Ga0496126_0150418 Ga0496126_0150418_414_1616 400
785 3300053084 Ga0495595_0012509 Ga0495595_0012509_2111_3313 400
786 3300053085 Ga0495619_0004673 Ga0495619_0004673_6562_7764 400
787 3300053105 Ga0500557_000039 Ga0500557_000039_54110_55318 400
788 3300053130 Ga0500642_0000402 Ga0500642_0000402_2604_3812 400
789 3300053729 Ga0500625_025357 Ga0500625_025357_846_2054 400
790 3300053737 Ga0500601_000497 Ga0500601_000497_227_1432 400
791 3300005336 Ga0070680_100003306 Ga0070680_1000033066 401
792 3300005339 Ga0070660_100028023 Ga0070660_1000280232 401
793 3300005455 Ga0070663_100013979 Ga0070663_1000139796 401
794 3300005458 Ga0070681_10024650 Ga0070681_100246505 401
795 3300005530 Ga0070679_100083433 Ga0070679_1000834332 401
796 3300005539 Ga0068853_100005359 Ga0068853_1000053593 401
797 3300005563 Ga0068855_100010147 Ga0068855_1000101477 401
798 3300005577 Ga0068857_100016856 Ga0068857_1000168561 401
799 3300005578 Ga0068854_100208017 Ga0068854_1002080172 401
800 3300005834 Ga0068851_10013400 Ga0068851_100134005 401
801 3300006237 Ga0097621_100154927 Ga0097621_1001549272 401
802 3300009545 Ga0105237_10011285 Ga0105237_100112857 401
803 3300009551 Ga0105238_10003129 Ga0105238_1000312911 401
804 3300010375 Ga0105239_10057505 Ga0105239_100575053 401
805 3300013105 Ga0157369_10004501 Ga0157369_1000450110 401
806 3300025321 Ga0207656_10007652 Ga0207656_100076522 401
807 3300025900 Ga0207710_10015395 Ga0207710_100153952 401
808 3300025915 Ga0207693_10052790 Ga0207693_100527903 401
809 3300025915 Ga0207693_10147309 Ga0207693_101473092 401
810 3300025919 Ga0207657_10027513 Ga0207657_100275136 401
811 3300025921 Ga0207652_10002138 Ga0207652_1000213814 401
812 3300025924 Ga0207694_10011328 Ga0207694_100113285 401
813 3300025949 Ga0207667_10008468 Ga0207667_100084687 401
814 3300025981 Ga0207640_10180075 Ga0207640_101800752 401
815 3300026041 Ga0207639_10006576 Ga0207639_100065765 401
816 3300026116 Ga0207674_10010829 Ga0207674_100108296 401
817 3300031616 Ga0307508_10000090 Ga0307508_1000009064 401
818 3300031712 Ga0265342_10023442 Ga0265342_100234425 401
819 3300036401 Ga0373937_0047524 Ga0373937_0047524_444_1649 401
820 3300037068 Ga0373925_0213439 Ga0373925_0213439_16_1221 401
821 3300045976 Ga0466967_0076671 Ga0466967_0076671_1264_2469 401
822 3300046543 Ga0495645_0005223 Ga0495645_0005223_7410_8621 401
823 3300046690 Ga0495624_0034081 Ga0495624_0034081_1591_2796 401
824 3300048915 Ga0496112_0000117 Ga0496112_0000117_5456_6661 401
825 3300048929 Ga0496126_0006291 Ga0496126_0006291_9152_10375 401
826 3300048929 Ga0496126_0215300 Ga0496126_0215300_117_1322 401
827 3300005327 Ga0070658_10072191 Ga0070658_100721915 402
828 3300005435 Ga0070714_100066675 Ga0070714_1000666755 403
829 3300005439 Ga0070711_100046362 Ga0070711_1000463624 403
830 3300005530 Ga0070679_100145486 Ga0070679_1001454863 403
831 3300005614 Ga0068856_100182707 Ga0068856_1001827072 403
832 3300006163 Ga0070715_10017382 Ga0070715_100173823 403
833 3300007265 Ga0099794_10071534 Ga0099794_100715342 403
834 3300025898 Ga0207692_10001391 Ga0207692_100013914 403
835 3300025905 Ga0207685_10007010 Ga0207685_100070103 403
836 3300025910 Ga0207684_10297141 Ga0207684_102971412 403
837 3300025915 Ga0207693_10001385 Ga0207693_1000138518 403
838 3300025932 Ga0207690_10053589 Ga0207690_100535891 403
839 3300025939 Ga0207665_10000064 Ga0207665_1000006457 403
840 3300026078 Ga0207702_10094222 Ga0207702_100942224 403
841 3300035119 Ga0373956_0007766 Ga0373956_0007766_943_2166 403
842 3300046459 Ga0495629_0084676 Ga0495629_0084676_864_2087 403
843 3300046463 Ga0495653_0017732 Ga0495653_0017732_3553_4776 403
844 3300046477 Ga0495664_0063178 Ga0495664_0063178_906_2129 403
845 3300046517 Ga0495630_0048414 Ga0495630_0048414_1873_3096 403
846 3300046524 Ga0495648_0008834 Ga0495648_0008834_4149_5369 403
847 3300046536 Ga0495587_0017520 Ga0495587_0017520_1735_2958 403
848 3300046559 Ga0495667_0010226 Ga0495667_0010226_3849_5072 403
849 3300046663 Ga0495635_0020215 Ga0495635_0020215_1862_3085 403
850 3300046675 Ga0495657_0019876 Ga0495657_0019876_1536_2759 403
851 3300046680 Ga0495646_0019541 Ga0495646_0019541_1145_2368 403
852 3300046809 Ga0495600_0021223 Ga0495600_0021223_1015_2238 403
853 3300047317 Ga0495604_0059879 Ga0495604_0059879_968_2191 403
854 3300047319 Ga0495674_0046793 Ga0495674_0046793_579_1802 403
855 3300047322 Ga0495680_0035390 Ga0495680_0035390_1890_3113 403
856 3300047444 Ga0495675_0006895 Ga0495675_0006895_975_2198 403
857 3300048924 Ga0496121_0001006 Ga0496121_0001006_24781_26004 403
858 3300053078 Ga0495612_0026418 Ga0495612_0026418_522_1745 403
859 3300053139 Ga0500568_0011027 Ga0500568_0011027_1027_2250 403
860 3300001979 JGI24740J21852_10004609 JGI24740J21852_100046095 404
861 3300001990 JGI24737J22298_10004171 JGI24737J22298_100041715 404
862 3300002067 JGI24735J21928_10017170 JGI24735J21928_100171703 404
863 3300005455 Ga0070663_100065901 Ga0070663_1000659012 404
864 3300005455 Ga0070663_100123558 Ga0070663_1001235582 404
865 3300005563 Ga0068855_100030135 Ga0068855_1000301356 404
866 3300005577 Ga0068857_100005632 Ga0068857_1000056329 404
867 3300005577 Ga0068857_100035005 Ga0068857_1000350055 404
868 3300005578 Ga0068854_100006637 Ga0068854_1000066376 404
869 3300005578 Ga0068854_100040636 Ga0068854_1000406363 404
870 3300005614 Ga0068856_100010147 Ga0068856_10001014712 404
871 3300005614 Ga0068856_100095543 Ga0068856_1000955432 404
872 3300005614 Ga0068856_100349561 Ga0068856_1003495611 404
873 3300005616 Ga0068852_100091883 Ga0068852_1000918833 404
874 3300005616 Ga0068852_100185724 Ga0068852_1001857241 404
875 3300005618 Ga0068864_100071692 Ga0068864_1000716922 404
876 3300005834 Ga0068851_10003044 Ga0068851_100030446 404
877 3300009093 Ga0105240_10015146 Ga0105240_100151467 404
878 3300009093 Ga0105240_10018856 Ga0105240_100188566 404
879 3300009174 Ga0105241_10001933 Ga0105241_100019338 404
880 3300009174 Ga0105241_10132916 Ga0105241_101329161 404
881 3300009545 Ga0105237_10148452 Ga0105237_101484522 404
882 3300009551 Ga0105238_10014347 Ga0105238_100143473 404
883 3300009551 Ga0105238_10051440 Ga0105238_100514403 404
884 3300010375 Ga0105239_10011530 Ga0105239_100115305 404
885 3300010375 Ga0105239_10027114 Ga0105239_100271144 404
886 3300011119 Ga0105246_10025068 Ga0105246_100250682 404
887 3300014325 Ga0163163_10070466 Ga0163163_100704662 404
888 3300025321 Ga0207656_10035242 Ga0207656_100352422 404
889 3300025904 Ga0207647_10004390 Ga0207647_100043903 404
890 3300025913 Ga0207695_10008678 Ga0207695_100086788 404
891 3300025913 Ga0207695_10104394 Ga0207695_101043943 404
892 3300025914 Ga0207671_10122721 Ga0207671_101227213 404
893 3300025924 Ga0207694_10000131 Ga0207694_1000013149 404
894 3300025924 Ga0207694_10016553 Ga0207694_100165533 404
895 3300025949 Ga0207667_10035714 Ga0207667_100357146 404
896 3300025949 Ga0207667_10071881 Ga0207667_100718813 404
897 3300025981 Ga0207640_10054622 Ga0207640_100546222 404
898 3300026041 Ga0207639_10009936 Ga0207639_100099364 404
899 3300026041 Ga0207639_10011227 Ga0207639_100112276 404
900 3300026078 Ga0207702_10000005 Ga0207702_10000005373 404
901 3300026078 Ga0207702_10069553 Ga0207702_100695533 404
902 3300026078 Ga0207702_10155325 Ga0207702_101553252 404
903 3300026095 Ga0207676_10153813 Ga0207676_101538132 404
904 3300026116 Ga0207674_10003851 Ga0207674_1000385112 404
905 3300026116 Ga0207674_10006041 Ga0207674_1000604110 404
906 3300026142 Ga0207698_10081284 Ga0207698_100812843 404
907 3300048904 Ga0496101_0057026 Ga0496101_0057026_1163_2392 404
908 3300048907 Ga0496104_0034118 Ga0496104_0034118_1600_2829 404
909 3300048912 Ga0496109_0083534 Ga0496109_0083534_739_1968 404
910 3300048913 Ga0496110_0043164 Ga0496110_0043164_269_1498 404
911 3300048915 Ga0496112_0002573 Ga0496112_0002573_9715_10944 404

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06772

LtrA

Bacterial low temperature requirement A protein (LtrA)

17

323

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qru-assembly1.cif.gz_G structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.704 279 389
6w8o-assembly1.cif.gz_B structure of an apo membrane protein 0.6057 23 392
7qru-assembly1.cif.gz_G structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.5862 279 389
6w8p-assembly1.cif.gz_B structure of membrane protein with ions 0.5717 23 392
6z16-assembly1.cif.gz_g structure of the mrp antiporter complex 0.5677 288 389
ID Description Score Start End Superfamily
af_Q2G2H9_13_94_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7226 289 360 1.10.287.3510
af_Q2G2H9_13_94_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6391 289 360 1.10.287.3510
af_Q1ZXE9_716_918_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.5124 204 389 1.20.1410.10
af_A0A2R8QGP7_1291_1477_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4855 203 385 1.20.1410.10
af_Q1ZXE9_716_918_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4723 204 389 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A6L6QCQ8-F1-model_v4 Low temperature requirement protein A 0.975 25 387 GO:0016020
AF-A0A4Q7X3A4-F1-model_v4 deleted 0.9746 9 387
AF-A0A5F0FC24-F1-model_v4 deleted 0.9693 10 389
AF-A0A537NR88-F1-model_v4 Low temperature requirement protein A 0.9683 12 342 GO:0016020
AF-A9HN09-F1-model_v4 Putative low temperature requirement A protein (LtrA) 0.9683 22 387 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.83 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map