F485491
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 911 | 557 | 704 | 396 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2844315083|2844317674 |
| Length | 438 |
| Sequence | NPRGAMFRVIVPNQPSRVTNAELFFDLVFVFAVTQVSHTLLNHFTPSGALEVTLLFLAVWWVWVYTAWVTNWLNPDLTPVRILIFLMMLGGLVLSTTIPTAFDGRGLWFAIAYAAMQVGRTAFWLFATPRHRTAVRHNAIRILVWLCGSAVFWILGGLAHGEARLWFWSAALGIEYVSPAVRFWVPKLGFSSVEAWAVEGGHMAERCAGFIIIALGEAVVVNGATFAELTWSADNILAFVACLVGSIAMWWVYFHKGAEAGSEVISKAAESGRVARLAYTYLHMPIVAGIILTAVSDELVLKHPTGHSDLRTIVSTIGGSPGVSGRHHPVQALDPRLPPALPRHRHHPVAGAVVVRRRSLAALADGRDERDHDRRRGVGVGVARIEAGRGQGALRRRSFYSAASSACTENIFAESVQLSRTRQPAPCASAAKRSRLYL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 23 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 24 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 25 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 26 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 27 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 28 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 29 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 32 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 33 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 34 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 35 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 36 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 37 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 38 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 39 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 40 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 41 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 42 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 43 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 44 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 45 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 46 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 47 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 48 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 49 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 50 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 51 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 52 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 53 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 54 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 55 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 56 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 57 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 58 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 59 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 60 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 61 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 62 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 63 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 64 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 65 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 66 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 67 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 68 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 69 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 70 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 71 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 72 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 73 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 74 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 75 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 76 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 77 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 78 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 79 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 80 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 81 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 82 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 83 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 84 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 85 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 86 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 87 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 88 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 89 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 90 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 91 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 92 | 2904699407 | |||
| 93 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 94 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 95 | 2906610324 | |||
| 96 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 97 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 98 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 99 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 100 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 101 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 102 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 103 | 2922368715 | |||
| 104 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 105 | 2922425934 | |||
| 106 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 107 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 108 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 109 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 110 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 111 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 112 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 113 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 114 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 115 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 116 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 117 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 118 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 119 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 120 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 121 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 122 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 123 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 124 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 125 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 126 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 127 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 128 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 129 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 130 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 131 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 132 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 133 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 134 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 135 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 136 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 137 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 138 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 139 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 140 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 141 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 142 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 143 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 144 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 145 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 146 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 147 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 148 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 149 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 150 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 151 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 152 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 153 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 154 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 155 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 156 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 157 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 158 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 159 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 160 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 161 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 162 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 163 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 164 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 165 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 166 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 167 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 168 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 169 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 170 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 171 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 172 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 173 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 174 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 175 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 176 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 177 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 178 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 179 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 180 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 181 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 182 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 183 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 184 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 185 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 186 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 187 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 190 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 191 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 192 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 193 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 210 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 211 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 214 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 215 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 217 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 220 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 222 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 223 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 224 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 225 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 226 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 227 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 228 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 229 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 230 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 231 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 232 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 233 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 234 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 235 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 236 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 237 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 239 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 240 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 241 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 242 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 244 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 245 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 246 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 247 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 248 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 250 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 251 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 252 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 254 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 255 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 256 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 257 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 279 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 280 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 281 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 282 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 283 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 284 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 289 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 291 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 339 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 340 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 341 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 342 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 346 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 347 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 348 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 349 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 350 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 351 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 352 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 353 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 354 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 355 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 356 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 357 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 358 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 359 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 360 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 361 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 362 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 363 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 364 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 365 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 366 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 367 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 368 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 369 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 370 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 371 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 372 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 373 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 374 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 375 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 376 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 377 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 378 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 379 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 380 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 381 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 382 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 383 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 384 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 385 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 386 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 387 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 388 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 389 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 390 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 391 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 392 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 393 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 451 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 452 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 453 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 454 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 455 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 456 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 457 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 458 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 459 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 460 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 461 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 462 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 463 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 464 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 465 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 466 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 467 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 468 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 469 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 470 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 471 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 472 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 473 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 479 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 481 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 482 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 483 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 485 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 489 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 492 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 493 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 494 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 495 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 496 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 497 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 498 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 499 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 500 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 501 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 502 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 503 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 504 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 505 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 506 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 507 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 508 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 509 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 510 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 512 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 513 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 515 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 516 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 517 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 518 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 519 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 520 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 521 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 523 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 524 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 525 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 526 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 527 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 528 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 529 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 530 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 531 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 532 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 533 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 534 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 535 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 536 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 537 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 538 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 539 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 540 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 541 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 542 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 543 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 544 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 545 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 546 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 547 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 548 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 549 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 550 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 551 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 552 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 553 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 554 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 555 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 556 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 557 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.62 |
| Metatranscriptomes | 0 |
| Isolates | 22.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.09 |
| Nodule | 18.22 |
| Rhizoplane | 5.16 |
| Rhizosphere | 53.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004609 | 3300001979 | Bacteria | 5922 |
| 2 | JGI24737J22298_10004171 | 3300001990 | Bacteria | 5053 |
| 3 | JGI24735J21928_10017170 | 3300002067 | Bacteria | 2238 |
| 4 | JGI25406J46586_10000141 | 3300003203 | Bacteria | 31326 |
| 5 | JGI25165J46597_1009535 | 3300003214 | Bacteria | 1456 |
| 6 | JGI25153J46596_10001533 | 3300003215 | Bacteria | 13713 |
| 7 | JGI25153J46596_10003956 | 3300003215 | Bacteria | 8114 |
| 8 | JGI25153J46596_10006871 | 3300003215 | Bacteria | 5683 |
| 9 | rootH1_10018627 | 3300003323 | Bacteria | 3168 |
| 10 | JGI25160J50197_1001294 | 3300003354 | Bacteria | 12650 |
| 11 | JGI25160J50197_1003485 | 3300003354 | Bacteria | 7028 |
| 12 | JGI25404J52841_10005028 | 3300003659 | Bacteria | 2717 |
| 13 | JGI25404J52841_10012886 | 3300003659 | Bacteria | 1814 |
| 14 | Ga0055531_10012574 | 3300003794 | Bacteria | 3971 |
| 15 | Ga0055543_1011317 | 3300004625 | Bacteria | 1830 |
| 16 | Ga0065165_1002974 | 3300005262 | Bacteria | 12862 |
| 17 | Ga0065165_1003005 | 3300005262 | Bacteria | 12758 |
| 18 | Ga0070658_10072191 | 3300005327 | Bacteria | 2828 |
| 19 | Ga0070670_100113694 | 3300005331 | Bacteria | 2333 |
| 20 | Ga0070670_100125549 | 3300005331 | Bacteria | 2215 |
| 21 | Ga0068869_100043228 | 3300005334 | Bacteria | 3235 |
| 22 | Ga0068869_100076723 | 3300005334 | Bacteria | 2484 |
| 23 | Ga0070680_100003306 | 3300005336 | Bacteria | 12032 |
| 24 | Ga0070680_100090722 | 3300005336 | Bacteria | 2530 |
| 25 | Ga0070682_100017578 | 3300005337 | Bacteria | 4171 |
| 26 | Ga0068868_100022441 | 3300005338 | Bacteria | 4762 |
| 27 | Ga0068868_100070486 | 3300005338 | Bacteria | 2787 |
| 28 | Ga0070660_100028023 | 3300005339 | Bacteria | 4210 |
| 29 | Ga0070668_100057652 | 3300005347 | Bacteria | 3002 |
| 30 | Ga0070668_100111188 | 3300005347 | Bacteria | 2180 |
| 31 | Ga0070669_100080577 | 3300005353 | Bacteria | 2423 |
| 32 | Ga0070669_100121194 | 3300005353 | Bacteria | 1995 |
| 33 | Ga0070674_100021952 | 3300005356 | Bacteria | 4110 |
| 34 | Ga0070673_100069276 | 3300005364 | Bacteria | 2827 |
| 35 | Ga0070659_100206822 | 3300005366 | Bacteria | 1617 |
| 36 | Ga0070709_10000321 | 3300005434 | Bacteria | 30544 |
| 37 | Ga0070709_10000693 | 3300005434 | Bacteria | 19142 |
| 38 | Ga0070714_100066675 | 3300005435 | Bacteria | 3102 |
| 39 | Ga0070713_100048137 | 3300005436 | Bacteria | 3508 |
| 40 | Ga0070710_10004137 | 3300005437 | Bacteria | 6885 |
| 41 | Ga0070710_10007933 | 3300005437 | Bacteria | 5158 |
| 42 | Ga0070711_100008217 | 3300005439 | Bacteria | 6383 |
| 43 | Ga0070711_100008243 | 3300005439 | Bacteria | 6375 |
| 44 | Ga0070711_100046362 | 3300005439 | Bacteria | 2961 |
| 45 | Ga0070705_100199257 | 3300005440 | Bacteria | 1371 |
| 46 | Ga0070708_100061166 | 3300005445 | Bacteria | 3364 |
| 47 | Ga0070663_100013979 | 3300005455 | Bacteria | 5139 |
| 48 | Ga0070663_100031866 | 3300005455 | Bacteria | 3627 |
| 49 | Ga0070663_100065901 | 3300005455 | Bacteria | 2623 |
| 50 | Ga0070663_100123558 | 3300005455 | Bacteria | 1958 |
| 51 | Ga0070663_100159166 | 3300005455 | Bacteria | 1737 |
| 52 | Ga0070663_100163859 | 3300005455 | Bacteria | 1713 |
| 53 | Ga0070663_100209212 | 3300005455 | Bacteria | 1527 |
| 54 | Ga0070678_100037781 | 3300005456 | Bacteria | 3394 |
| 55 | Ga0070678_100062438 | 3300005456 | Bacteria | 2751 |
| 56 | Ga0070678_100177243 | 3300005456 | Bacteria | 1742 |
| 57 | Ga0070662_100057412 | 3300005457 | Bacteria | 2828 |
| 58 | Ga0070681_10024650 | 3300005458 | Bacteria | 6053 |
| 59 | Ga0070681_10138906 | 3300005458 | Bacteria | 2360 |
| 60 | Ga0068867_100033711 | 3300005459 | Bacteria | 3710 |
| 61 | Ga0070706_100174202 | 3300005467 | Bacteria | 2009 |
| 62 | Ga0070706_100199094 | 3300005467 | Bacteria | 1871 |
| 63 | Ga0070698_100019994 | 3300005471 | Bacteria | 7020 |
| 64 | Ga0070698_100134945 | 3300005471 | Bacteria | 2422 |
| 65 | Ga0070679_100044585 | 3300005530 | Bacteria | 4418 |
| 66 | Ga0070679_100083433 | 3300005530 | Bacteria | 3184 |
| 67 | Ga0070679_100145486 | 3300005530 | Bacteria | 2348 |
| 68 | Ga0068853_100005359 | 3300005539 | Bacteria | 10046 |
| 69 | Ga0068853_100006900 | 3300005539 | Bacteria | 9064 |
| 70 | Ga0070672_100102762 | 3300005543 | Bacteria | 2320 |
| 71 | Ga0070686_100046669 | 3300005544 | Bacteria | 2734 |
| 72 | Ga0070693_100008387 | 3300005547 | Bacteria | 5092 |
| 73 | Ga0070693_100157265 | 3300005547 | Bacteria | 1445 |
| 74 | Ga0070665_100041689 | 3300005548 | Bacteria | 4616 |
| 75 | Ga0070665_100100768 | 3300005548 | Bacteria | 2892 |
| 76 | Ga0070665_100119935 | 3300005548 | Bacteria | 2632 |
| 77 | Ga0070665_100148619 | 3300005548 | Bacteria | 2346 |
| 78 | Ga0070665_100173448 | 3300005548 | Bacteria | 2157 |
| 79 | Ga0068855_100010147 | 3300005563 | Bacteria | 11351 |
| 80 | Ga0068855_100030135 | 3300005563 | Bacteria | 6489 |
| 81 | Ga0068855_100049630 | 3300005563 | Bacteria | 4949 |
| 82 | Ga0070664_100146056 | 3300005564 | Bacteria | 2086 |
| 83 | Ga0068857_100005632 | 3300005577 | Bacteria | 10705 |
| 84 | Ga0068857_100016856 | 3300005577 | Bacteria | 6401 |
| 85 | Ga0068857_100035005 | 3300005577 | Bacteria | 4445 |
| 86 | Ga0068857_100121411 | 3300005577 | Bacteria | 2353 |
| 87 | Ga0068854_100006637 | 3300005578 | Bacteria | 7372 |
| 88 | Ga0068854_100040636 | 3300005578 | Bacteria | 3282 |
| 89 | Ga0068854_100208017 | 3300005578 | Bacteria | 1542 |
| 90 | Ga0068856_100004479 | 3300005614 | Bacteria | 13897 |
| 91 | Ga0068856_100010147 | 3300005614 | Bacteria | 9153 |
| 92 | Ga0068856_100029580 | 3300005614 | Bacteria | 5351 |
| 93 | Ga0068856_100095543 | 3300005614 | Bacteria | 2960 |
| 94 | Ga0068856_100182707 | 3300005614 | Bacteria | 2111 |
| 95 | Ga0068856_100349561 | 3300005614 | Bacteria | 1497 |
| 96 | Ga0068852_100031560 | 3300005616 | Bacteria | 4374 |
| 97 | Ga0068852_100059333 | 3300005616 | Bacteria | 3318 |
| 98 | Ga0068852_100091883 | 3300005616 | Bacteria | 2717 |
| 99 | Ga0068852_100108652 | 3300005616 | Bacteria | 2518 |
| 100 | Ga0068852_100185724 | 3300005616 | Bacteria | 1958 |
| 101 | Ga0068859_100278154 | 3300005617 | Bacteria | 1766 |
| 102 | Ga0068864_100071692 | 3300005618 | Bacteria | 3018 |
| 103 | Ga0068864_100187912 | 3300005618 | Bacteria | 1892 |
| 104 | Ga0068866_10022163 | 3300005718 | Bacteria | 2936 |
| 105 | Ga0068861_100040987 | 3300005719 | Bacteria | 3466 |
| 106 | Ga0068851_10003044 | 3300005834 | Bacteria | 7414 |
| 107 | Ga0068851_10013400 | 3300005834 | Bacteria | 3881 |
| 108 | Ga0068863_100118784 | 3300005841 | Bacteria | 2520 |
| 109 | Ga0068863_100227909 | 3300005841 | Bacteria | 1797 |
| 110 | Ga0068858_100045121 | 3300005842 | Bacteria | 4084 |
| 111 | Ga0068860_100000317 | 3300005843 | Bacteria | 65673 |
| 112 | Ga0068860_100127931 | 3300005843 | Bacteria | 2435 |
| 113 | Ga0068860_100336545 | 3300005843 | Bacteria | 1483 |
| 114 | Ga0068862_100074659 | 3300005844 | Bacteria | 2931 |
| 115 | Ga0068862_100267823 | 3300005844 | Bacteria | 1561 |
| 116 | Ga0081455_10066167 | 3300005937 | Bacteria | 3020 |
| 117 | Ga0081455_10078300 | 3300005937 | Bacteria | 2717 |
| 118 | Ga0081540_1002665 | 3300005983 | Bacteria | 14522 |
| 119 | Ga0081540_1013269 | 3300005983 | Bacteria | 5368 |
| 120 | Ga0081540_1022048 | 3300005983 | Bacteria | 3769 |
| 121 | Ga0081540_1029768 | 3300005983 | Bacteria | 3036 |
| 122 | Ga0081540_1031943 | 3300005983 | Bacteria | 2883 |
| 123 | Ga0081540_1044771 | 3300005983 | Bacteria | 2256 |
| 124 | Ga0081540_1074326 | 3300005983 | Bacteria | 1558 |
| 125 | Ga0081540_1074971 | 3300005983 | Bacteria | 1548 |
| 126 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 127 | Ga0081539_10000747 | 3300005985 | Bacteria | 64612 |
| 128 | Ga0070717_10006275 | 3300006028 | Bacteria | 8732 |
| 129 | Ga0075365_10004123 | 3300006038 | Bacteria | 7641 |
| 130 | Ga0075365_10110915 | 3300006038 | Bacteria | 1885 |
| 131 | Ga0075365_10135999 | 3300006038 | Bacteria | 1703 |
| 132 | Ga0075365_10153549 | 3300006038 | Bacteria | 1602 |
| 133 | Ga0075363_100022580 | 3300006048 | Bacteria | 3182 |
| 134 | Ga0075363_100070499 | 3300006048 | Bacteria | 1898 |
| 135 | Ga0075364_10146759 | 3300006051 | Bacteria | 1588 |
| 136 | Ga0070715_10013262 | 3300006163 | Bacteria | 3022 |
| 137 | Ga0070715_10017382 | 3300006163 | Bacteria | 2722 |
| 138 | Ga0070716_100073755 | 3300006173 | Bacteria | 2014 |
| 139 | Ga0070712_100191340 | 3300006175 | Bacteria | 1601 |
| 140 | Ga0075362_10010952 | 3300006177 | Bacteria | 3559 |
| 141 | Ga0075362_10034916 | 3300006177 | Bacteria | 2194 |
| 142 | Ga0075367_10025132 | 3300006178 | Bacteria | 3365 |
| 143 | Ga0075367_10050941 | 3300006178 | Bacteria | 2446 |
| 144 | Ga0075367_10057331 | 3300006178 | Bacteria | 2316 |
| 145 | Ga0075369_10069000 | 3300006186 | Bacteria | 1554 |
| 146 | Ga0075366_10049004 | 3300006195 | Bacteria | 2506 |
| 147 | Ga0097621_100049253 | 3300006237 | Bacteria | 3422 |
| 148 | Ga0097621_100154927 | 3300006237 | Bacteria | 1966 |
| 149 | Ga0075370_10048777 | 3300006353 | Bacteria | 2399 |
| 150 | Ga0068871_100315269 | 3300006358 | Bacteria | 1376 |
| 151 | Ga0075434_100019165 | 3300006871 | Bacteria | 6617 |
| 152 | Ga0097620_100278146 | 3300006931 | Bacteria | 1766 |
| 153 | Ga0097620_100372329 | 3300006931 | Bacteria | 1524 |
| 154 | Ga0099824_1020393 | 3300006942 | Bacteria | 4893 |
| 155 | Ga0099824_1021825 | 3300006942 | Bacteria | 4368 |
| 156 | Ga0099823_1006107 | 3300006944 | Bacteria | 12127 |
| 157 | Ga0075435_100028341 | 3300007076 | Bacteria | 4391 |
| 158 | Ga0099794_10071534 | 3300007265 | Bacteria | 1699 |
| 159 | Ga0105250_10014042 | 3300009092 | Bacteria | 3297 |
| 160 | Ga0105240_10015146 | 3300009093 | Bacteria | 10495 |
| 161 | Ga0105240_10018856 | 3300009093 | Bacteria | 9237 |
| 162 | Ga0105240_10043716 | 3300009093 | Bacteria | 5697 |
| 163 | Ga0105245_10077328 | 3300009098 | Bacteria | 3034 |
| 164 | Ga0105245_10177514 | 3300009098 | Bacteria | 2032 |
| 165 | Ga0105245_10197387 | 3300009098 | Bacteria | 1931 |
| 166 | Ga0105243_10128916 | 3300009148 | Bacteria | 2143 |
| 167 | Ga0105241_10001933 | 3300009174 | Bacteria | 15677 |
| 168 | Ga0105241_10056771 | 3300009174 | Bacteria | 3002 |
| 169 | Ga0105241_10132916 | 3300009174 | Bacteria | 2017 |
| 170 | Ga0105241_10157087 | 3300009174 | Bacteria | 1866 |
| 171 | Ga0105242_10104277 | 3300009176 | Bacteria | 2407 |
| 172 | Ga0105248_10085941 | 3300009177 | Bacteria | 3539 |
| 173 | Ga0105248_10107522 | 3300009177 | Bacteria | 3145 |
| 174 | Ga0105248_10387959 | 3300009177 | Bacteria | 1572 |
| 175 | Ga0105237_10011285 | 3300009545 | Bacteria | 9453 |
| 176 | Ga0105237_10026805 | 3300009545 | Bacteria | 5890 |
| 177 | Ga0105237_10062996 | 3300009545 | Bacteria | 3707 |
| 178 | Ga0105237_10066237 | 3300009545 | Bacteria | 3607 |
| 179 | Ga0105237_10148452 | 3300009545 | Bacteria | 2340 |
| 180 | Ga0105238_10003129 | 3300009551 | Bacteria | 16514 |
| 181 | Ga0105238_10014347 | 3300009551 | Bacteria | 8009 |
| 182 | Ga0105238_10017427 | 3300009551 | Bacteria | 7300 |
| 183 | Ga0105238_10051440 | 3300009551 | Bacteria | 4144 |
| 184 | Ga0105238_10055313 | 3300009551 | Bacteria | 3984 |
| 185 | Ga0105238_10369344 | 3300009551 | Bacteria | 1425 |
| 186 | Ga0105249_10154371 | 3300009553 | Bacteria | 2213 |
| 187 | Ga0105249_10400783 | 3300009553 | Bacteria | 1402 |
| 188 | Ga0105239_10011530 | 3300010375 | Bacteria | 9857 |
| 189 | Ga0105239_10016473 | 3300010375 | Bacteria | 8175 |
| 190 | Ga0105239_10017421 | 3300010375 | Bacteria | 7945 |
| 191 | Ga0105239_10027114 | 3300010375 | Bacteria | 6306 |
| 192 | Ga0105239_10057505 | 3300010375 | Bacteria | 4266 |
| 193 | Ga0105239_10195037 | 3300010375 | Bacteria | 2268 |
| 194 | Ga0105239_10230171 | 3300010375 | Bacteria | 2079 |
| 195 | Ga0105246_10025068 | 3300011119 | Bacteria | 3885 |
| 196 | Ga0105246_10201214 | 3300011119 | Bacteria | 1548 |
| 197 | Ga0105246_10212835 | 3300011119 | Bacteria | 1510 |
| 198 | Ga0157370_10033228 | 3300013104 | Bacteria | 5029 |
| 199 | Ga0157369_10004501 | 3300013105 | Bacteria | 16421 |
| 200 | Ga0157369_10094195 | 3300013105 | Bacteria | 3196 |
| 201 | Ga0157374_10018451 | 3300013296 | Bacteria | 6157 |
| 202 | Ga0157378_10037063 | 3300013297 | Bacteria | 4318 |
| 203 | Ga0163162_10006056 | 3300013306 | Bacteria | 11706 |
| 204 | Ga0163162_10091764 | 3300013306 | Bacteria | 3120 |
| 205 | Ga0157375_10047639 | 3300013308 | Bacteria | 4187 |
| 206 | Ga0157375_10062158 | 3300013308 | Bacteria | 3710 |
| 207 | Ga0157375_10201416 | 3300013308 | Bacteria | 2147 |
| 208 | Ga0163163_10026297 | 3300014325 | Bacteria | 5561 |
| 209 | Ga0163163_10070466 | 3300014325 | Bacteria | 3482 |
| 210 | Ga0163163_10430145 | 3300014325 | Bacteria | 1379 |
| 211 | Ga0157376_10013967 | 3300014969 | Bacteria | 6007 |
| 212 | Ga0157376_10023687 | 3300014969 | Bacteria | 4809 |
| 213 | Ga0157376_10313863 | 3300014969 | Bacteria | 1488 |
| 214 | Ga0163161_10012716 | 3300017792 | Bacteria | 5847 |
| 215 | Ga0214544_1029436 | 3300021320 | Bacteria | 2026 |
| 216 | Ga0214542_1032581 | 3300021321 | Bacteria | 1832 |
| 217 | Ga0214545_1027280 | 3300021324 | Bacteria | 2933 |
| 218 | Ga0214543_1033553 | 3300021327 | Bacteria | 1832 |
| 219 | Ga0213876_10001447 | 3300021384 | Bacteria | 14763 |
| 220 | Ga0213876_10065164 | 3300021384 | Bacteria | 1923 |
| 221 | Ga0213871_10005236 | 3300021441 | Bacteria | 2659 |
| 222 | Ga0209563_103051 | 3300025230 | Bacteria | 3573 |
| 223 | Ga0209677_101241 | 3300025253 | Bacteria | 11522 |
| 224 | Ga0209677_105815 | 3300025253 | Bacteria | 3105 |
| 225 | Ga0209148_1005105 | 3300025254 | Bacteria | 3072 |
| 226 | Ga0209148_1005191 | 3300025254 | Bacteria | 3034 |
| 227 | Ga0209233_1002274 | 3300025261 | Bacteria | 7160 |
| 228 | Ga0209564_1002300 | 3300025295 | Bacteria | 15530 |
| 229 | Ga0209564_1003642 | 3300025295 | Bacteria | 10214 |
| 230 | Ga0209758_1000407 | 3300025297 | Bacteria | 73945 |
| 231 | Ga0209758_1000900 | 3300025297 | Bacteria | 40401 |
| 232 | Ga0209758_1000952 | 3300025297 | Bacteria | 39040 |
| 233 | Ga0209758_1003132 | 3300025297 | Bacteria | 15611 |
| 234 | Ga0209758_1005367 | 3300025297 | Bacteria | 9938 |
| 235 | Ga0209256_1003168 | 3300025299 | Bacteria | 11924 |
| 236 | Ga0207426_1000466 | 3300025302 | Bacteria | 62533 |
| 237 | Ga0207426_1001739 | 3300025302 | Bacteria | 16577 |
| 238 | Ga0207426_1006892 | 3300025302 | Bacteria | 4840 |
| 239 | Ga0209257_1001445 | 3300025304 | Bacteria | 28079 |
| 240 | Ga0209257_1036773 | 3300025304 | Bacteria | 1500 |
| 241 | Ga0207656_10007652 | 3300025321 | Bacteria | 3946 |
| 242 | Ga0207656_10035242 | 3300025321 | Bacteria | 2094 |
| 243 | Ga0207692_10001391 | 3300025898 | Bacteria | 9055 |
| 244 | Ga0207710_10015395 | 3300025900 | Bacteria | 3231 |
| 245 | Ga0207688_10039938 | 3300025901 | Bacteria | 2606 |
| 246 | Ga0207688_10047486 | 3300025901 | Bacteria | 2397 |
| 247 | Ga0207647_10004390 | 3300025904 | Bacteria | 10462 |
| 248 | Ga0207647_10028560 | 3300025904 | Bacteria | 3621 |
| 249 | Ga0207685_10007010 | 3300025905 | Bacteria | 3112 |
| 250 | Ga0207685_10015708 | 3300025905 | Bacteria | 2405 |
| 251 | Ga0207699_10007708 | 3300025906 | Bacteria | 5268 |
| 252 | Ga0207684_10084428 | 3300025910 | Bacteria | 2704 |
| 253 | Ga0207684_10297141 | 3300025910 | Bacteria | 1392 |
| 254 | Ga0207707_10002025 | 3300025912 | Bacteria | 18400 |
| 255 | Ga0207707_10077474 | 3300025912 | Bacteria | 2902 |
| 256 | Ga0207707_10105130 | 3300025912 | Bacteria | 2467 |
| 257 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 258 | Ga0207695_10008678 | 3300025913 | Bacteria | 12683 |
| 259 | Ga0207695_10104394 | 3300025913 | Bacteria | 2823 |
| 260 | Ga0207695_10124145 | 3300025913 | Bacteria | 2546 |
| 261 | Ga0207671_10028805 | 3300025914 | Bacteria | 4149 |
| 262 | Ga0207671_10122721 | 3300025914 | Bacteria | 1987 |
| 263 | Ga0207693_10001385 | 3300025915 | Bacteria | 21487 |
| 264 | Ga0207693_10021713 | 3300025915 | Bacteria | 5103 |
| 265 | Ga0207693_10032830 | 3300025915 | Bacteria | 4096 |
| 266 | Ga0207693_10052790 | 3300025915 | Bacteria | 3188 |
| 267 | Ga0207693_10147309 | 3300025915 | Bacteria | 1851 |
| 268 | Ga0207660_10005792 | 3300025917 | Bacteria | 8021 |
| 269 | Ga0207660_10019091 | 3300025917 | Bacteria | 4579 |
| 270 | Ga0207657_10027513 | 3300025919 | Bacteria | 5207 |
| 271 | Ga0207652_10002138 | 3300025921 | Bacteria | 16939 |
| 272 | Ga0207652_10018694 | 3300025921 | Bacteria | 5686 |
| 273 | Ga0207652_10064444 | 3300025921 | Bacteria | 3171 |
| 274 | Ga0207652_10084200 | 3300025921 | Bacteria | 2785 |
| 275 | Ga0207681_10055346 | 3300025923 | Bacteria | 2702 |
| 276 | Ga0207681_10065430 | 3300025923 | Bacteria | 2513 |
| 277 | Ga0207694_10000131 | 3300025924 | Bacteria | 76343 |
| 278 | Ga0207694_10011328 | 3300025924 | Bacteria | 6731 |
| 279 | Ga0207694_10016553 | 3300025924 | Bacteria | 5567 |
| 280 | Ga0207687_10088658 | 3300025927 | Bacteria | 2251 |
| 281 | Ga0207687_10142855 | 3300025927 | Bacteria | 1818 |
| 282 | Ga0207700_10027110 | 3300025928 | Bacteria | 4007 |
| 283 | Ga0207700_10079668 | 3300025928 | Bacteria | 2551 |
| 284 | Ga0207664_10030573 | 3300025929 | Bacteria | 4114 |
| 285 | Ga0207690_10053589 | 3300025932 | Bacteria | 2707 |
| 286 | Ga0207690_10162230 | 3300025932 | Bacteria | 1667 |
| 287 | Ga0207706_10012890 | 3300025933 | Bacteria | 7609 |
| 288 | Ga0207706_10072274 | 3300025933 | Bacteria | 3034 |
| 289 | Ga0207686_10076584 | 3300025934 | Bacteria | 2169 |
| 290 | Ga0207709_10017362 | 3300025935 | Bacteria | 4017 |
| 291 | Ga0207669_10010569 | 3300025937 | Bacteria | 4448 |
| 292 | Ga0207665_10000064 | 3300025939 | Bacteria | 68931 |
| 293 | Ga0207665_10068512 | 3300025939 | Bacteria | 2418 |
| 294 | Ga0207691_10031947 | 3300025940 | Bacteria | 4913 |
| 295 | Ga0207691_10079604 | 3300025940 | Bacteria | 2949 |
| 296 | Ga0207691_10141147 | 3300025940 | Bacteria | 2123 |
| 297 | Ga0207711_10225075 | 3300025941 | Bacteria | 1717 |
| 298 | Ga0207689_10050405 | 3300025942 | Bacteria | 3433 |
| 299 | Ga0207661_10000499 | 3300025944 | Bacteria | 25254 |
| 300 | Ga0207661_10017331 | 3300025944 | Bacteria | 5326 |
| 301 | Ga0207667_10008468 | 3300025949 | Bacteria | 12214 |
| 302 | Ga0207667_10035714 | 3300025949 | Bacteria | 5332 |
| 303 | Ga0207667_10061068 | 3300025949 | Bacteria | 3944 |
| 304 | Ga0207667_10071881 | 3300025949 | Bacteria | 3596 |
| 305 | Ga0207712_10214617 | 3300025961 | Bacteria | 1535 |
| 306 | Ga0207668_10043719 | 3300025972 | Bacteria | 3042 |
| 307 | Ga0207668_10112499 | 3300025972 | Bacteria | 2045 |
| 308 | Ga0207668_10220538 | 3300025972 | Bacteria | 1522 |
| 309 | Ga0207668_10269826 | 3300025972 | Bacteria | 1390 |
| 310 | Ga0207640_10054622 | 3300025981 | Bacteria | 2612 |
| 311 | Ga0207640_10180075 | 3300025981 | Bacteria | 1584 |
| 312 | Ga0207658_10077021 | 3300025986 | Bacteria | 2543 |
| 313 | Ga0207677_10008433 | 3300026023 | Bacteria | 5755 |
| 314 | Ga0207677_10030095 | 3300026023 | Bacteria | 3460 |
| 315 | Ga0207639_10006576 | 3300026041 | Bacteria | 7904 |
| 316 | Ga0207639_10009936 | 3300026041 | Bacteria | 6575 |
| 317 | Ga0207639_10011227 | 3300026041 | Bacteria | 6213 |
| 318 | Ga0207678_10099619 | 3300026067 | Bacteria | 2482 |
| 319 | Ga0207678_10182909 | 3300026067 | Bacteria | 1790 |
| 320 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 321 | Ga0207702_10001399 | 3300026078 | Bacteria | 24061 |
| 322 | Ga0207702_10021621 | 3300026078 | Bacteria | 5328 |
| 323 | Ga0207702_10069553 | 3300026078 | Bacteria | 3027 |
| 324 | Ga0207702_10094222 | 3300026078 | Bacteria | 2628 |
| 325 | Ga0207702_10155325 | 3300026078 | Bacteria | 2085 |
| 326 | Ga0207641_10214713 | 3300026088 | Bacteria | 1781 |
| 327 | Ga0207676_10153813 | 3300026095 | Bacteria | 1984 |
| 328 | Ga0207676_10174610 | 3300026095 | Bacteria | 1875 |
| 329 | Ga0207674_10003851 | 3300026116 | Bacteria | 18291 |
| 330 | Ga0207674_10006041 | 3300026116 | Bacteria | 14325 |
| 331 | Ga0207674_10010829 | 3300026116 | Bacteria | 10282 |
| 332 | Ga0207674_10099324 | 3300026116 | Bacteria | 2893 |
| 333 | Ga0207675_100103756 | 3300026118 | Bacteria | 2680 |
| 334 | Ga0207675_100104899 | 3300026118 | Bacteria | 2664 |
| 335 | Ga0207675_100253690 | 3300026118 | Bacteria | 1703 |
| 336 | Ga0207683_10060268 | 3300026121 | Bacteria | 3336 |
| 337 | Ga0207683_10196104 | 3300026121 | Bacteria | 1835 |
| 338 | Ga0207683_10214891 | 3300026121 | Bacteria | 1751 |
| 339 | Ga0207698_10022947 | 3300026142 | Bacteria | 4351 |
| 340 | Ga0207698_10081284 | 3300026142 | Bacteria | 2615 |
| 341 | Ga0207698_10118356 | 3300026142 | Bacteria | 2237 |
| 342 | Ga0207698_10160163 | 3300026142 | Bacteria | 1967 |
| 343 | Ga0209389_1000011 | 3300027296 | Bacteria | 223265 |
| 344 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 345 | Ga0209589_1000018 | 3300027357 | Bacteria | 192614 |
| 346 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 347 | Ga0209489_100017 | 3300027361 | Bacteria | 223265 |
| 348 | Ga0209489_100026 | 3300027361 | Bacteria | 192614 |
| 349 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 350 | Ga0209700_100027 | 3300027363 | Bacteria | 223462 |
| 351 | Ga0209700_100035 | 3300027363 | Bacteria | 192614 |
| 352 | Ga0268266_10021731 | 3300028379 | Bacteria | 5468 |
| 353 | Ga0268266_10275358 | 3300028379 | Bacteria | 1563 |
| 354 | Ga0268265_10131363 | 3300028380 | Bacteria | 2081 |
| 355 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 356 | Ga0268264_10057497 | 3300028381 | Bacteria | 3253 |
| 357 | Ga0307517_10178269 | 3300028786 | Bacteria | 1378 |
| 358 | Ga0307511_10024421 | 3300030521 | Bacteria | 5603 |
| 359 | Ga0265332_10013434 | 3300031238 | Bacteria | 3628 |
| 360 | Ga0265325_10013924 | 3300031241 | Bacteria | 4562 |
| 361 | Ga0265331_10078112 | 3300031250 | Bacteria | 1541 |
| 362 | Ga0307509_10056729 | 3300031507 | Bacteria | 4156 |
| 363 | Ga0307509_10127360 | 3300031507 | Bacteria | 2509 |
| 364 | Ga0307509_10220957 | 3300031507 | Bacteria | 1707 |
| 365 | Ga0307508_10000090 | 3300031616 | Bacteria | 106893 |
| 366 | Ga0307508_10017864 | 3300031616 | Bacteria | 6448 |
| 367 | Ga0265314_10011778 | 3300031711 | Bacteria | 7193 |
| 368 | Ga0265342_10023442 | 3300031712 | Bacteria | 3906 |
| 369 | Ga0307516_10006295 | 3300031730 | Bacteria | 13947 |
| 370 | Ga0307516_10089057 | 3300031730 | Bacteria | 2917 |
| 371 | Ga0307406_10066488 | 3300031901 | Bacteria | 2347 |
| 372 | Ga0307416_100065752 | 3300032002 | Bacteria | 2982 |
| 373 | Ga0307415_100049699 | 3300032126 | Bacteria | 2837 |
| 374 | Ga0307510_10010422 | 3300033180 | Bacteria | 11039 |
| 375 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 376 | Ga0373926_0010615 | 3300035083 | Bacteria | 3088 |
| 377 | Ga0373944_0027927 | 3300035089 | Bacteria | 1677 |
| 378 | Ga0373923_0001451 | 3300035111 | Bacteria | 6804 |
| 379 | Ga0373932_0028549 | 3300035112 | Bacteria | 1534 |
| 380 | Ga0373936_0012430 | 3300035113 | Bacteria | 3239 |
| 381 | Ga0373945_0051853 | 3300035116 | Bacteria | 1510 |
| 382 | Ga0373953_0010742 | 3300035117 | Bacteria | 3196 |
| 383 | Ga0373954_0009425 | 3300035118 | Bacteria | 4294 |
| 384 | Ga0373954_0015042 | 3300035118 | Bacteria | 3456 |
| 385 | Ga0373954_0030575 | 3300035118 | Bacteria | 2483 |
| 386 | Ga0373956_0007766 | 3300035119 | Bacteria | 4327 |
| 387 | Ga0373956_0020988 | 3300035119 | Bacteria | 2784 |
| 388 | Ga0373943_0036703 | 3300035170 | Bacteria | 2348 |
| 389 | Ga0373946_0005371 | 3300035171 | Bacteria | 4617 |
| 390 | Ga0373946_0022123 | 3300035171 | Bacteria | 2472 |
| 391 | Ga0373955_0006480 | 3300035172 | Bacteria | 5333 |
| 392 | Ga0373955_0050587 | 3300035172 | Bacteria | 2260 |
| 393 | Ga0373924_0049397 | 3300035410 | Bacteria | 1740 |
| 394 | Ga0373924_0052065 | 3300035410 | Bacteria | 1698 |
| 395 | Ga0373931_0007686 | 3300035691 | Bacteria | 5088 |
| 396 | Ga0373935_0000746 | 3300035692 | Bacteria | 17275 |
| 397 | Ga0373935_0012759 | 3300035692 | Bacteria | 5060 |
| 398 | Ga0373927_0001005 | 3300035695 | Bacteria | 21497 |
| 399 | Ga0373927_0006940 | 3300035695 | Bacteria | 7689 |
| 400 | Ga0373927_0021788 | 3300035695 | Bacteria | 4199 |
| 401 | Ga0373927_0107960 | 3300035695 | Bacteria | 1813 |
| 402 | Ga0373927_0112866 | 3300035695 | Bacteria | 1771 |
| 403 | Ga0373933_0028580 | 3300035724 | Bacteria | 3218 |
| 404 | Ga0373933_0115939 | 3300035724 | Bacteria | 1674 |
| 405 | Ga0373947_0004336 | 3300035725 | Bacteria | 8330 |
| 406 | Ga0373937_0047524 | 3300036401 | Bacteria | 3927 |
| 407 | Ga0373925_0013406 | 3300037068 | Bacteria | 5931 |
| 408 | Ga0373925_0213439 | 3300037068 | Bacteria | 1538 |
| 409 | Ga0395899_0078611 | 3300037312 | Bacteria | 2404 |
| 410 | Ga0395900_0006782 | 3300037418 | Bacteria | 11887 |
| 411 | Ga0395900_0149359 | 3300037418 | Bacteria | 2388 |
| 412 | Ga0395898_0002649 | 3300037466 | Bacteria | 20818 |
| 413 | Ga0395898_0022383 | 3300037466 | Bacteria | 6401 |
| 414 | Ga0395898_0079527 | 3300037466 | Bacteria | 3163 |
| 415 | Ga0395898_0183312 | 3300037466 | Bacteria | 2001 |
| 416 | Ga0395905_0065215 | 3300037471 | Bacteria | 3409 |
| 417 | Ga0395905_0141627 | 3300037471 | Bacteria | 2262 |
| 418 | Ga0436364_0575208 | 3300037853 | Bacteria | 1637 |
| 419 | Ga0395901_0047239 | 3300038443 | Bacteria | 4470 |
| 420 | Ga0395901_0200944 | 3300038443 | Bacteria | 2089 |
| 421 | Ga0436365_0278067 | 3300039437 | Bacteria | 1538 |
| 422 | Ga0436365_0282046 | 3300039437 | Bacteria | 2006 |
| 423 | Ga0436365_0687739 | 3300039437 | Bacteria | 11594 |
| 424 | Ga0436365_1006381 | 3300039437 | Bacteria | 1952 |
| 425 | Ga0436360_0661609 | 3300039438 | Bacteria | 2103 |
| 426 | Ga0436361_0785755 | 3300039447 | Bacteria | 4947 |
| 427 | Ga0436363_1573029 | 3300039450 | Bacteria | 2564 |
| 428 | Ga0436362_1292799 | 3300039453 | Bacteria | 1708 |
| 429 | Ga0466965_0050738 | 3300044683 | Bacteria | 2057 |
| 430 | Ga0466967_0050074 | 3300045976 | Bacteria | 3656 |
| 431 | Ga0466967_0076671 | 3300045976 | Bacteria | 3008 |
| 432 | Ga0495592_0001015 | 3300046454 | Bacteria | 19460 |
| 433 | Ga0495592_0131071 | 3300046454 | Bacteria | 1753 |
| 434 | Ga0495592_0158003 | 3300046454 | Bacteria | 1562 |
| 435 | Ga0495603_0015732 | 3300046455 | Bacteria | 4575 |
| 436 | Ga0495603_0025608 | 3300046455 | Bacteria | 3567 |
| 437 | Ga0495603_0025704 | 3300046455 | Bacteria | 3560 |
| 438 | Ga0495603_0056614 | 3300046455 | Bacteria | 2321 |
| 439 | Ga0495629_0002240 | 3300046459 | Bacteria | 14904 |
| 440 | Ga0495629_0020804 | 3300046459 | Bacteria | 4684 |
| 441 | Ga0495629_0084676 | 3300046459 | Bacteria | 2212 |
| 442 | Ga0495638_0018033 | 3300046460 | Bacteria | 4696 |
| 443 | Ga0495651_0019266 | 3300046462 | Bacteria | 5288 |
| 444 | Ga0495653_0017732 | 3300046463 | Bacteria | 5787 |
| 445 | Ga0495653_0063362 | 3300046463 | Bacteria | 2790 |
| 446 | Ga0495580_0013314 | 3300046472 | Bacteria | 6284 |
| 447 | Ga0495580_0062316 | 3300046472 | Bacteria | 2617 |
| 448 | Ga0495582_0000699 | 3300046473 | Bacteria | 18488 |
| 449 | Ga0495582_0023756 | 3300046473 | Bacteria | 3352 |
| 450 | Ga0495582_0087147 | 3300046473 | Bacteria | 1738 |
| 451 | Ga0495639_0001536 | 3300046475 | Bacteria | 10297 |
| 452 | Ga0495639_0004952 | 3300046475 | Bacteria | 5710 |
| 453 | Ga0495664_0008004 | 3300046477 | Bacteria | 5885 |
| 454 | Ga0495664_0012732 | 3300046477 | Bacteria | 4764 |
| 455 | Ga0495664_0063178 | 3300046477 | Bacteria | 2206 |
| 456 | Ga0495664_0094369 | 3300046477 | Bacteria | 1801 |
| 457 | Ga0495585_0043686 | 3300046492 | Bacteria | 2505 |
| 458 | Ga0495594_0004167 | 3300046499 | Bacteria | 7429 |
| 459 | Ga0495594_0056395 | 3300046499 | Bacteria | 2168 |
| 460 | Ga0495606_0001396 | 3300046507 | Bacteria | 32606 |
| 461 | Ga0495606_0010364 | 3300046507 | Bacteria | 7745 |
| 462 | Ga0495608_0008509 | 3300046511 | Bacteria | 7188 |
| 463 | Ga0495608_0098045 | 3300046511 | Bacteria | 1892 |
| 464 | Ga0495608_0206395 | 3300046511 | Bacteria | 1236 |
| 465 | Ga0495610_0017492 | 3300046512 | Bacteria | 4085 |
| 466 | Ga0495616_0032613 | 3300046513 | Bacteria | 2719 |
| 467 | Ga0495618_0021442 | 3300046514 | Bacteria | 3984 |
| 468 | Ga0495618_0022990 | 3300046514 | Bacteria | 3852 |
| 469 | Ga0495628_0148725 | 3300046516 | Bacteria | 1784 |
| 470 | Ga0495630_0005565 | 3300046517 | Bacteria | 8892 |
| 471 | Ga0495630_0048414 | 3300046517 | Bacteria | 3181 |
| 472 | Ga0495644_0031238 | 3300046523 | Bacteria | 2012 |
| 473 | Ga0495648_0008834 | 3300046524 | Bacteria | 7884 |
| 474 | Ga0495652_0013209 | 3300046529 | Bacteria | 7434 |
| 475 | Ga0495652_0022716 | 3300046529 | Bacteria | 5566 |
| 476 | Ga0495652_0045028 | 3300046529 | Bacteria | 3797 |
| 477 | Ga0495652_0197908 | 3300046529 | Bacteria | 1527 |
| 478 | Ga0495665_0000866 | 3300046531 | Bacteria | 15828 |
| 479 | Ga0495665_0013892 | 3300046531 | Bacteria | 4349 |
| 480 | Ga0495640_0015080 | 3300046533 | Bacteria | 5821 |
| 481 | Ga0495640_0022481 | 3300046533 | Bacteria | 4608 |
| 482 | Ga0495587_0017520 | 3300046536 | Bacteria | 4451 |
| 483 | Ga0495609_0024284 | 3300046538 | Bacteria | 2781 |
| 484 | Ga0495597_0045447 | 3300046542 | Bacteria | 1948 |
| 485 | Ga0495645_0002189 | 3300046543 | Bacteria | 13283 |
| 486 | Ga0495645_0005223 | 3300046543 | Bacteria | 8897 |
| 487 | Ga0495645_0113951 | 3300046543 | Bacteria | 1911 |
| 488 | Ga0495667_0010226 | 3300046559 | Bacteria | 6349 |
| 489 | Ga0495667_0051604 | 3300046559 | Bacteria | 2712 |
| 490 | Ga0495667_0058697 | 3300046559 | Bacteria | 2527 |
| 491 | Ga0495668_0022603 | 3300046616 | Bacteria | 3594 |
| 492 | Ga0495668_0025830 | 3300046616 | Bacteria | 3336 |
| 493 | Ga0495634_0003047 | 3300046642 | Bacteria | 13635 |
| 494 | Ga0495634_0009200 | 3300046642 | Bacteria | 7294 |
| 495 | Ga0495634_0032240 | 3300046642 | Bacteria | 3604 |
| 496 | Ga0495635_0001667 | 3300046663 | Bacteria | 14944 |
| 497 | Ga0495635_0012928 | 3300046663 | Bacteria | 5844 |
| 498 | Ga0495635_0020215 | 3300046663 | Bacteria | 4639 |
| 499 | Ga0495635_0032559 | 3300046663 | Bacteria | 3616 |
| 500 | Ga0495588_0086888 | 3300046674 | Bacteria | 1635 |
| 501 | Ga0495657_0014702 | 3300046675 | Bacteria | 5744 |
| 502 | Ga0495657_0019876 | 3300046675 | Bacteria | 4839 |
| 503 | Ga0495657_0053916 | 3300046675 | Bacteria | 2688 |
| 504 | Ga0495599_0003132 | 3300046678 | Bacteria | 9642 |
| 505 | Ga0495623_0061738 | 3300046679 | Bacteria | 2349 |
| 506 | Ga0495646_0003463 | 3300046680 | Bacteria | 9820 |
| 507 | Ga0495646_0007247 | 3300046680 | Bacteria | 7047 |
| 508 | Ga0495646_0019541 | 3300046680 | Bacteria | 4287 |
| 509 | Ga0495647_0001096 | 3300046681 | Bacteria | 8262 |
| 510 | Ga0495647_0005222 | 3300046681 | Bacteria | 4255 |
| 511 | Ga0495658_0003891 | 3300046683 | Bacteria | 7392 |
| 512 | Ga0495669_0004749 | 3300046684 | Bacteria | 5632 |
| 513 | Ga0495669_0108673 | 3300046684 | Bacteria | 1293 |
| 514 | Ga0495613_0031570 | 3300046689 | Bacteria | 3935 |
| 515 | Ga0495613_0161556 | 3300046689 | Bacteria | 1593 |
| 516 | Ga0495613_0172949 | 3300046689 | Bacteria | 1532 |
| 517 | Ga0495624_0000079 | 3300046690 | Bacteria | 63196 |
| 518 | Ga0495624_0029902 | 3300046690 | Bacteria | 3551 |
| 519 | Ga0495624_0034081 | 3300046690 | Bacteria | 3296 |
| 520 | Ga0495649_0065558 | 3300046694 | Bacteria | 1949 |
| 521 | Ga0495600_0003617 | 3300046809 | Bacteria | 9112 |
| 522 | Ga0495600_0004901 | 3300046809 | Bacteria | 8041 |
| 523 | Ga0495600_0011897 | 3300046809 | Bacteria | 5435 |
| 524 | Ga0495600_0021223 | 3300046809 | Bacteria | 4157 |
| 525 | Ga0495581_0000260 | 3300047315 | Bacteria | 25339 |
| 526 | Ga0495581_0050725 | 3300047315 | Bacteria | 2397 |
| 527 | Ga0495604_0058508 | 3300047317 | Bacteria | 2959 |
| 528 | Ga0495604_0059879 | 3300047317 | Bacteria | 2917 |
| 529 | Ga0495604_0200130 | 3300047317 | Bacteria | 1386 |
| 530 | Ga0495674_0017659 | 3300047319 | Bacteria | 6643 |
| 531 | Ga0495674_0035062 | 3300047319 | Bacteria | 4530 |
| 532 | Ga0495674_0046793 | 3300047319 | Bacteria | 3839 |
| 533 | Ga0495674_0096617 | 3300047319 | Bacteria | 2518 |
| 534 | Ga0495674_0131627 | 3300047319 | Bacteria | 2107 |
| 535 | Ga0495676_0019539 | 3300047321 | Bacteria | 5958 |
| 536 | Ga0495676_0027171 | 3300047321 | Bacteria | 4912 |
| 537 | Ga0495676_0121703 | 3300047321 | Bacteria | 1897 |
| 538 | Ga0495680_0017781 | 3300047322 | Bacteria | 6052 |
| 539 | Ga0495680_0035390 | 3300047322 | Bacteria | 4022 |
| 540 | Ga0495687_009133 | 3300047443 | Bacteria | 5584 |
| 541 | Ga0495675_0005508 | 3300047444 | Bacteria | 7724 |
| 542 | Ga0495675_0006895 | 3300047444 | Bacteria | 6977 |
| 543 | Ga0495675_0054654 | 3300047444 | Bacteria | 2533 |
| 544 | Ga0495673_0034885 | 3300047469 | Bacteria | 2323 |
| 545 | Ga0495684_0019374 | 3300047471 | Bacteria | 5238 |
| 546 | Ga0495684_0022676 | 3300047471 | Bacteria | 4829 |
| 547 | Ga0495684_0023503 | 3300047471 | Bacteria | 4739 |
| 548 | Ga0495686_0038303 | 3300047472 | Bacteria | 3067 |
| 549 | Ga0495686_0085531 | 3300047472 | Bacteria | 1920 |
| 550 | Ga0495593_0002394 | 3300047673 | Bacteria | 11278 |
| 551 | Ga0495593_0017295 | 3300047673 | Bacteria | 4058 |
| 552 | Ga0495593_0049876 | 3300047673 | Bacteria | 2219 |
| 553 | Ga0495593_0054000 | 3300047673 | Bacteria | 2119 |
| 554 | Ga0495602_0053544 | 3300048088 | Bacteria | 3573 |
| 555 | Ga0495602_0143687 | 3300048088 | Bacteria | 1885 |
| 556 | Ga0495614_0042211 | 3300048089 | Bacteria | 1956 |
| 557 | Ga0496100_0031490 | 3300048903 | Bacteria | 3298 |
| 558 | Ga0496100_0244134 | 3300048903 | Bacteria | 1326 |
| 559 | Ga0496101_0006632 | 3300048904 | Bacteria | 7460 |
| 560 | Ga0496101_0022754 | 3300048904 | Bacteria | 4318 |
| 561 | Ga0496101_0057026 | 3300048904 | Bacteria | 2824 |
| 562 | Ga0496102_0033573 | 3300048905 | Bacteria | 4611 |
| 563 | Ga0496102_0140679 | 3300048905 | Bacteria | 2262 |
| 564 | Ga0496102_0212801 | 3300048905 | Bacteria | 1822 |
| 565 | Ga0496103_0024136 | 3300048906 | Bacteria | 3668 |
| 566 | Ga0496104_0006004 | 3300048907 | Bacteria | 10645 |
| 567 | Ga0496104_0034118 | 3300048907 | Bacteria | 4743 |
| 568 | Ga0496104_0035515 | 3300048907 | Bacteria | 4653 |
| 569 | Ga0496104_0315578 | 3300048907 | Bacteria | 1476 |
| 570 | Ga0496105_0006080 | 3300048908 | Bacteria | 9238 |
| 571 | Ga0496105_0052035 | 3300048908 | Bacteria | 3381 |
| 572 | Ga0496106_0002853 | 3300048909 | Bacteria | 12840 |
| 573 | Ga0496106_0020122 | 3300048909 | Bacteria | 4951 |
| 574 | Ga0496106_0025828 | 3300048909 | Bacteria | 4370 |
| 575 | Ga0496106_0029606 | 3300048909 | Bacteria | 4082 |
| 576 | Ga0496106_0051357 | 3300048909 | Bacteria | 3108 |
| 577 | Ga0496106_0054568 | 3300048909 | Bacteria | 3019 |
| 578 | Ga0496106_0085023 | 3300048909 | Bacteria | 2435 |
| 579 | Ga0496107_0022024 | 3300048910 | Bacteria | 4501 |
| 580 | Ga0496107_0046653 | 3300048910 | Bacteria | 3118 |
| 581 | Ga0496107_0073215 | 3300048910 | Bacteria | 2492 |
| 582 | Ga0496108_0017378 | 3300048911 | Bacteria | 5885 |
| 583 | Ga0496108_0130051 | 3300048911 | Bacteria | 2164 |
| 584 | Ga0496109_0020594 | 3300048912 | Bacteria | 5826 |
| 585 | Ga0496109_0083534 | 3300048912 | Bacteria | 2945 |
| 586 | Ga0496109_0163275 | 3300048912 | Bacteria | 2087 |
| 587 | Ga0496110_0043164 | 3300048913 | Bacteria | 3937 |
| 588 | Ga0496110_0106096 | 3300048913 | Bacteria | 2521 |
| 589 | Ga0496111_0049829 | 3300048914 | Bacteria | 3019 |
| 590 | Ga0496112_0000117 | 3300048915 | Bacteria | 49274 |
| 591 | Ga0496112_0002573 | 3300048915 | Bacteria | 14654 |
| 592 | Ga0496112_0007576 | 3300048915 | Bacteria | 9643 |
| 593 | Ga0496112_0129318 | 3300048915 | Bacteria | 2496 |
| 594 | Ga0496113_0011838 | 3300048916 | Bacteria | 5844 |
| 595 | Ga0496113_0041979 | 3300048916 | Bacteria | 3378 |
| 596 | Ga0496113_0067973 | 3300048916 | Bacteria | 2703 |
| 597 | Ga0496114_0002764 | 3300048917 | Bacteria | 13432 |
| 598 | Ga0496114_0004339 | 3300048917 | Bacteria | 10979 |
| 599 | Ga0496115_0025513 | 3300048918 | Bacteria | 4602 |
| 600 | Ga0496115_0086269 | 3300048918 | Bacteria | 2561 |
| 601 | Ga0496115_0103869 | 3300048918 | Bacteria | 2332 |
| 602 | Ga0496115_0278051 | 3300048918 | Bacteria | 1375 |
| 603 | Ga0496118_0006091 | 3300048921 | Bacteria | 13407 |
| 604 | Ga0496118_0008006 | 3300048921 | Bacteria | 11043 |
| 605 | Ga0496118_0051012 | 3300048921 | Bacteria | 3169 |
| 606 | Ga0496118_0094096 | 3300048921 | Bacteria | 2050 |
| 607 | Ga0496120_0011493 | 3300048923 | Bacteria | 6085 |
| 608 | Ga0496121_0001006 | 3300048924 | Bacteria | 50348 |
| 609 | Ga0496121_0018786 | 3300048924 | Bacteria | 6945 |
| 610 | Ga0496121_0019408 | 3300048924 | Bacteria | 6797 |
| 611 | Ga0496121_0019777 | 3300048924 | Bacteria | 6710 |
| 612 | Ga0496121_0044584 | 3300048924 | Bacteria | 3823 |
| 613 | Ga0496121_0073020 | 3300048924 | Bacteria | 2752 |
| 614 | Ga0496121_0075121 | 3300048924 | Bacteria | 2701 |
| 615 | Ga0496121_0165353 | 3300048924 | Bacteria | 1613 |
| 616 | Ga0496122_0124956 | 3300048925 | Bacteria | 1649 |
| 617 | Ga0496124_0016465 | 3300048927 | Bacteria | 7024 |
| 618 | Ga0496124_0147134 | 3300048927 | Bacteria | 1853 |
| 619 | Ga0496125_0044490 | 3300048928 | Bacteria | 3754 |
| 620 | Ga0496125_0052475 | 3300048928 | Bacteria | 3353 |
| 621 | Ga0496125_0052884 | 3300048928 | Bacteria | 3336 |
| 622 | Ga0496125_0117651 | 3300048928 | Bacteria | 1905 |
| 623 | Ga0496125_0139875 | 3300048928 | Bacteria | 1685 |
| 624 | Ga0496126_0006291 | 3300048929 | Bacteria | 13257 |
| 625 | Ga0496126_0015594 | 3300048929 | Bacteria | 7635 |
| 626 | Ga0496126_0016957 | 3300048929 | Bacteria | 7267 |
| 627 | Ga0496126_0024985 | 3300048929 | Bacteria | 5759 |
| 628 | Ga0496126_0037222 | 3300048929 | Bacteria | 4542 |
| 629 | Ga0496126_0050598 | 3300048929 | Bacteria | 3785 |
| 630 | Ga0496126_0101367 | 3300048929 | Bacteria | 2518 |
| 631 | Ga0496126_0150418 | 3300048929 | Bacteria | 1996 |
| 632 | Ga0496126_0155153 | 3300048929 | Bacteria | 1960 |
| 633 | Ga0496126_0157801 | 3300048929 | Bacteria | 1941 |
| 634 | Ga0496126_0215300 | 3300048929 | Bacteria | 1616 |
| 635 | Ga0495682_0013186 | 3300049460 | Bacteria | 3152 |
| 636 | Ga0501047_0021432 | 3300049581 | Bacteria | 6205 |
| 637 | Ga0501074_0143591 | 3300049590 | Bacteria | 1707 |
| 638 | Ga0501080_0021618 | 3300049742 | Bacteria | 5956 |
| 639 | Ga0501035_0168544 | 3300049822 | Bacteria | 1893 |
| 640 | nmdc:mga03n38_2420_c1 | 3300050490 | Bacteria | 5764 |
| 641 | nmdc:mga00v17_14964_c1 | 3300050491 | Bacteria | 4345 |
| 642 | nmdc:mga00v17_75253_c1 | 3300050491 | Bacteria | 2099 |
| 643 | nmdc:mga0yw44_14247_c1 | 3300050492 | Bacteria | 4215 |
| 644 | nmdc:mga0yw44_17230_c1 | 3300050492 | Bacteria | 3926 |
| 645 | nmdc:mga0yw44_26457_c1 | 3300050492 | Bacteria | 3314 |
| 646 | nmdc:mga06z11_37379_c1 | 3300050494 | Bacteria | 2404 |
| 647 | nmdc:mga06z11_37836_c1 | 3300050494 | Bacteria | 2392 |
| 648 | nmdc:mga07m45_21319_c2 | 3300050496 | Bacteria | 2895 |
| 649 | nmdc:mga07m45_26268_c2 | 3300050496 | Bacteria | 2850 |
| 650 | nmdc:mga07m45_40836_c1 | 3300050496 | Bacteria | 2597 |
| 651 | nmdc:mga0rr50_103192_c1 | 3300050513 | Bacteria | 2244 |
| 652 | nmdc:mga0sz30_16099_c1 | 3300050516 | Bacteria | 2963 |
| 653 | Ga0495601_0043004 | 3300053077 | Bacteria | 2837 |
| 654 | Ga0495601_0078764 | 3300053077 | Bacteria | 2112 |
| 655 | Ga0495612_0026418 | 3300053078 | Bacteria | 2333 |
| 656 | Ga0500610_0061422 | 3300053079 | Bacteria | 1962 |
| 657 | Ga0500635_0002861 | 3300053080 | Bacteria | 4297 |
| 658 | Ga0495595_0012509 | 3300053084 | Bacteria | 3569 |
| 659 | Ga0495619_0004673 | 3300053085 | Bacteria | 8726 |
| 660 | Ga0495619_0027691 | 3300053085 | Bacteria | 3653 |
| 661 | Ga0495619_0184154 | 3300053085 | Bacteria | 1445 |
| 662 | Ga0500578_0055597 | 3300053086 | Bacteria | 2533 |
| 663 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 664 | Ga0500643_038654 | 3300053087 | Bacteria | 1414 |
| 665 | Ga0500583_0051411 | 3300053092 | Bacteria | 1914 |
| 666 | Ga0500651_0045618 | 3300053093 | Bacteria | 2757 |
| 667 | Ga0500566_0000064 | 3300053094 | Bacteria | 50908 |
| 668 | Ga0500566_0000487 | 3300053094 | Bacteria | 22108 |
| 669 | Ga0500566_0004143 | 3300053094 | Bacteria | 8649 |
| 670 | Ga0500640_003196 | 3300053095 | Bacteria | 5647 |
| 671 | Ga0500650_0081575 | 3300053098 | Bacteria | 1513 |
| 672 | Ga0500555_001886 | 3300053103 | Bacteria | 6226 |
| 673 | Ga0500557_000039 | 3300053105 | Bacteria | 66862 |
| 674 | Ga0500562_004144 | 3300053108 | Bacteria | 3656 |
| 675 | Ga0500572_000026 | 3300053111 | Bacteria | 45518 |
| 676 | Ga0500572_000839 | 3300053111 | Bacteria | 9631 |
| 677 | Ga0500594_0007039 | 3300053118 | Bacteria | 2539 |
| 678 | Ga0500595_001234 | 3300053119 | Bacteria | 14105 |
| 679 | Ga0500595_002556 | 3300053119 | Bacteria | 8912 |
| 680 | Ga0500595_036983 | 3300053119 | Bacteria | 1596 |
| 681 | Ga0500608_008044 | 3300053122 | Bacteria | 4405 |
| 682 | Ga0500614_002715 | 3300053123 | Bacteria | 3904 |
| 683 | Ga0500642_0000402 | 3300053130 | Bacteria | 14190 |
| 684 | Ga0500559_0001395 | 3300053136 | Bacteria | 13743 |
| 685 | Ga0500559_0004820 | 3300053136 | Bacteria | 6303 |
| 686 | Ga0500568_0011027 | 3300053139 | Bacteria | 4209 |
| 687 | Ga0500589_056452 | 3300053147 | Bacteria | 1810 |
| 688 | Ga0500603_000109 | 3300053150 | Bacteria | 19137 |
| 689 | Ga0500620_001076 | 3300053155 | Bacteria | 4828 |
| 690 | Ga0500622_0042293 | 3300053156 | Bacteria | 2368 |
| 691 | Ga0500627_0001288 | 3300053158 | Bacteria | 6945 |
| 692 | Ga0500630_005009 | 3300053159 | Bacteria | 6446 |
| 693 | Ga0500638_000124 | 3300053162 | Bacteria | 14946 |
| 694 | Ga0500639_000353 | 3300053163 | Bacteria | 22721 |
| 695 | Ga0500636_0000194 | 3300053177 | Bacteria | 32748 |
| 696 | Ga0500637_0010349 | 3300053178 | Bacteria | 4779 |
| 697 | Ga0500637_0055352 | 3300053178 | Bacteria | 2265 |
| 698 | Ga0500570_036755 | 3300053724 | Bacteria | 2598 |
| 699 | Ga0500625_025357 | 3300053729 | Bacteria | 2804 |
| 700 | Ga0500645_013158 | 3300053730 | Bacteria | 2661 |
| 701 | Ga0500645_014877 | 3300053730 | Bacteria | 2474 |
| 702 | Ga0500596_005043 | 3300053735 | Bacteria | 2363 |
| 703 | Ga0500599_005309 | 3300053736 | Bacteria | 1615 |
| 704 | Ga0500601_000497 | 3300053737 | Bacteria | 6065 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0155153 | Ga0496126_0155153_582_1766 | 380 |
| 2 | 3300006944 | Ga0099823_1006107 | Ga0099823_100610713 | 381 |
| 3 | 3300053111 | Ga0500572_000839 | Ga0500572_000839_5223_6368 | 381 |
| 4 | 3300053136 | Ga0500559_0001395 | Ga0500559_0001395_5207_6352 | 381 |
| 5 | 3300039437 | Ga0436365_0282046 | Ga0436365_0282046_60_1211 | 383 |
| 6 | 3300048913 | Ga0496110_0106096 | Ga0496110_0106096_599_1804 | 383 |
| 7 | 3300005436 | Ga0070713_100048137 | Ga0070713_1000481375 | 384 |
| 8 | 3300005437 | Ga0070710_10004137 | Ga0070710_100041373 | 384 |
| 9 | 3300005439 | Ga0070711_100008217 | Ga0070711_1000082176 | 384 |
| 10 | 3300006175 | Ga0070712_100191340 | Ga0070712_1001913401 | 384 |
| 11 | 3300025912 | Ga0207707_10105130 | Ga0207707_101051301 | 384 |
| 12 | 3300025915 | Ga0207693_10021713 | Ga0207693_100217136 | 384 |
| 13 | 3300025921 | Ga0207652_10084200 | Ga0207652_100842004 | 384 |
| 14 | 3300025928 | Ga0207700_10027110 | Ga0207700_100271102 | 384 |
| 15 | 3300045976 | Ga0466967_0050074 | Ga0466967_0050074_258_1412 | 384 |
| 16 | iso_pu_bacteria | 2824644064 | 2824647405 | 384 |
| 17 | 3300027357 | Ga0209589_1000018 | Ga0209589_100001870 | 386 |
| 18 | 3300027361 | Ga0209489_100026 | Ga0209489_10002670 | 386 |
| 19 | 3300027363 | Ga0209700_100035 | Ga0209700_10003570 | 386 |
| 20 | 3300021320 | Ga0214544_1029436 | Ga0214544_10294363 | 387 |
| 21 | 3300021321 | Ga0214542_1032581 | Ga0214542_10325812 | 387 |
| 22 | 3300021324 | Ga0214545_1027280 | Ga0214545_10272803 | 387 |
| 23 | 3300021327 | Ga0214543_1033553 | Ga0214543_10335532 | 387 |
| 24 | iso_pu_bacteria | 8016622563 | 8016628447 | 387 |
| 25 | 3300005262 | Ga0065165_1003005 | Ga0065165_10030056 | 388 |
| 26 | 3300025302 | Ga0207426_1001739 | Ga0207426_100173910 | 388 |
| 27 | 3300046511 | Ga0495608_0206395 | Ga0495608_0206395_18_1184 | 388 |
| 28 | 3300048910 | Ga0496107_0073215 | Ga0496107_0073215_250_1416 | 388 |
| 29 | 3300048929 | Ga0496126_0050598 | Ga0496126_0050598_92_1285 | 388 |
| 30 | iso_pu_bacteria | 2844315083 | 2844317674 | 388 |
| 31 | iso_pu_bacteria | 2879110137 | 2879118654 | 388 |
| 32 | 3300005455 | Ga0070663_100209212 | Ga0070663_1002092121 | 389 |
| 33 | 3300005539 | Ga0068853_100006900 | Ga0068853_10000690010 | 389 |
| 34 | 3300025913 | Ga0207695_10124145 | Ga0207695_101241453 | 389 |
| 35 | 3300025921 | Ga0207652_10064444 | Ga0207652_100644444 | 389 |
| 36 | 3300025944 | Ga0207661_10000499 | Ga0207661_100004993 | 389 |
| 37 | iso_pu_bacteria | 2513237096 | 2513660041 | 389 |
| 38 | iso_pu_bacteria | 2513237137 | 2513858218 | 389 |
| 39 | iso_pu_bacteria | 2513237141 | 2513892017 | 389 |
| 40 | iso_pu_bacteria | 2513237145 | 2513922149 | 389 |
| 41 | iso_pu_bacteria | 2517572143 | 2517893893 | 389 |
| 42 | iso_pu_bacteria | 2667528175 | 2671122885 | 389 |
| 43 | iso_pu_bacteria | 2728368998 | 2728748018 | 389 |
| 44 | iso_pu_bacteria | 2791355197 | 2793072470 | 389 |
| 45 | iso_pu_bacteria | 2847930680 | 2847934468 | 389 |
| 46 | iso_pu_bacteria | 2857509624 | 2857509894 | 389 |
| 47 | iso_pu_bacteria | 2874620515 | 2874623157 | 389 |
| 48 | iso_pu_bacteria | 2874628541 | 2874636103 | 389 |
| 49 | iso_pu_bacteria | 2885374607 | 2885382459 | 389 |
| 50 | iso_pu_bacteria | 2903748898 | 2903750444 | 389 |
| 51 | iso_pu_bacteria | 2904666416 | 2904669977 | 389 |
| 52 | iso_pu_bacteria | 2904699407 | 2904700687 | 389 |
| 53 | iso_pu_bacteria | 2906610324 | 2906610781 | 389 |
| 54 | iso_pu_bacteria | 2906635258 | 2906635937 | 389 |
| 55 | iso_pu_bacteria | 2906643746 | 2906646657 | 389 |
| 56 | iso_pu_bacteria | 2906660503 | 2906663965 | 389 |
| 57 | iso_pu_bacteria | 2908739725 | 2908744293 | 389 |
| 58 | iso_pu_bacteria | 2908756301 | 2908761785 | 389 |
| 59 | iso_pu_bacteria | 2922425934 | 2922428544 | 389 |
| 60 | iso_pu_bacteria | 2935630451 | 2935634523 | 389 |
| 61 | iso_pu_bacteria | 2941507105 | 2941509009 | 389 |
| 62 | iso_pu_bacteria | 2941515067 | 2941516838 | 389 |
| 63 | iso_pu_bacteria | 2941523033 | 2941525067 | 389 |
| 64 | iso_pu_bacteria | 3005474847 | 3005478674 | 389 |
| 65 | iso_pu_bacteria | 3005506211 | 3005508801 | 389 |
| 66 | iso_pu_bacteria | 8006933436 | 8006942685 | 389 |
| 67 | iso_pu_bacteria | 8006973647 | 8006982412 | 389 |
| 68 | iso_pu_bacteria | 8019555841 | 8019558451 | 389 |
| 69 | iso_pu_bacteria | 8019565922 | 8019566847 | 389 |
| 70 | iso_pu_bacteria | 8056689827 | 8056691858 | 389 |
| 71 | 3300048909 | Ga0496106_0051357 | Ga0496106_0051357_1901_3088 | 390 |
| 72 | 3300048929 | Ga0496126_0157801 | Ga0496126_0157801_221_1393 | 390 |
| 73 | iso_pu_bacteria | 2841957949 | 2841959429 | 390 |
| 74 | iso_pu_bacteria | 2842038055 | 2842038197 | 390 |
| 75 | iso_pu_bacteria | 2842045827 | 2842048857 | 390 |
| 76 | iso_pu_bacteria | 2849076700 | 2849080745 | 390 |
| 77 | iso_pu_bacteria | 2885366525 | 2885368877 | 390 |
| 78 | 3300037471 | Ga0395905_0141627 | Ga0395905_0141627_1066_2241 | 391 |
| 79 | iso_pu_bacteria | 2513237104 | 2513720614 | 391 |
| 80 | 3300003323 | rootH1_10018627 | rootH1_100186274 | 392 |
| 81 | 3300005331 | Ga0070670_100125549 | Ga0070670_1001255491 | 392 |
| 82 | 3300005334 | Ga0068869_100043228 | Ga0068869_1000432284 | 392 |
| 83 | 3300005337 | Ga0070682_100017578 | Ga0070682_1000175783 | 392 |
| 84 | 3300005338 | Ga0068868_100022441 | Ga0068868_1000224414 | 392 |
| 85 | 3300005338 | Ga0068868_100070486 | Ga0068868_1000704864 | 392 |
| 86 | 3300005347 | Ga0070668_100057652 | Ga0070668_1000576524 | 392 |
| 87 | 3300005353 | Ga0070669_100121194 | Ga0070669_1001211943 | 392 |
| 88 | 3300005356 | Ga0070674_100021952 | Ga0070674_1000219524 | 392 |
| 89 | 3300005364 | Ga0070673_100069276 | Ga0070673_1000692764 | 392 |
| 90 | 3300005366 | Ga0070659_100206822 | Ga0070659_1002068222 | 392 |
| 91 | 3300005434 | Ga0070709_10000321 | Ga0070709_1000032114 | 392 |
| 92 | 3300005434 | Ga0070709_10000693 | Ga0070709_1000069311 | 392 |
| 93 | 3300005437 | Ga0070710_10007933 | Ga0070710_100079335 | 392 |
| 94 | 3300005439 | Ga0070711_100008243 | Ga0070711_1000082433 | 392 |
| 95 | 3300005440 | Ga0070705_100199257 | Ga0070705_1001992571 | 392 |
| 96 | 3300005445 | Ga0070708_100061166 | Ga0070708_1000611663 | 392 |
| 97 | 3300005455 | Ga0070663_100031866 | Ga0070663_1000318665 | 392 |
| 98 | 3300005455 | Ga0070663_100163859 | Ga0070663_1001638591 | 392 |
| 99 | 3300005456 | Ga0070678_100037781 | Ga0070678_1000377815 | 392 |
| 100 | 3300005456 | Ga0070678_100062438 | Ga0070678_1000624382 | 392 |
| 101 | 3300005457 | Ga0070662_100057412 | Ga0070662_1000574124 | 392 |
| 102 | 3300005459 | Ga0068867_100033711 | Ga0068867_1000337115 | 392 |
| 103 | 3300005467 | Ga0070706_100199094 | Ga0070706_1001990943 | 392 |
| 104 | 3300005544 | Ga0070686_100046669 | Ga0070686_1000466694 | 392 |
| 105 | 3300005547 | Ga0070693_100008387 | Ga0070693_1000083875 | 392 |
| 106 | 3300005548 | Ga0070665_100041689 | Ga0070665_1000416895 | 392 |
| 107 | 3300005548 | Ga0070665_100100768 | Ga0070665_1001007682 | 392 |
| 108 | 3300005548 | Ga0070665_100119935 | Ga0070665_1001199352 | 392 |
| 109 | 3300005548 | Ga0070665_100148619 | Ga0070665_1001486192 | 392 |
| 110 | 3300005563 | Ga0068855_100049630 | Ga0068855_1000496306 | 392 |
| 111 | 3300005564 | Ga0070664_100146056 | Ga0070664_1001460563 | 392 |
| 112 | 3300005614 | Ga0068856_100029580 | Ga0068856_1000295805 | 392 |
| 113 | 3300005616 | Ga0068852_100059333 | Ga0068852_1000593333 | 392 |
| 114 | 3300005617 | Ga0068859_100278154 | Ga0068859_1002781543 | 392 |
| 115 | 3300005618 | Ga0068864_100187912 | Ga0068864_1001879122 | 392 |
| 116 | 3300005718 | Ga0068866_10022163 | Ga0068866_100221634 | 392 |
| 117 | 3300005719 | Ga0068861_100040987 | Ga0068861_1000409872 | 392 |
| 118 | 3300005841 | Ga0068863_100118784 | Ga0068863_1001187844 | 392 |
| 119 | 3300005842 | Ga0068858_100045121 | Ga0068858_1000451215 | 392 |
| 120 | 3300005843 | Ga0068860_100336545 | Ga0068860_1003365452 | 392 |
| 121 | 3300005844 | Ga0068862_100267823 | Ga0068862_1002678232 | 392 |
| 122 | 3300005983 | Ga0081540_1002665 | Ga0081540_100266513 | 392 |
| 123 | 3300005983 | Ga0081540_1044771 | Ga0081540_10447713 | 392 |
| 124 | 3300006038 | Ga0075365_10153549 | Ga0075365_101535492 | 392 |
| 125 | 3300006048 | Ga0075363_100070499 | Ga0075363_1000704992 | 392 |
| 126 | 3300006163 | Ga0070715_10013262 | Ga0070715_100132623 | 392 |
| 127 | 3300006173 | Ga0070716_100073755 | Ga0070716_1000737552 | 392 |
| 128 | 3300006178 | Ga0075367_10025132 | Ga0075367_100251325 | 392 |
| 129 | 3300006178 | Ga0075367_10057331 | Ga0075367_100573312 | 392 |
| 130 | 3300006186 | Ga0075369_10069000 | Ga0075369_100690002 | 392 |
| 131 | 3300006237 | Ga0097621_100049253 | Ga0097621_1000492534 | 392 |
| 132 | 3300006353 | Ga0075370_10048777 | Ga0075370_100487772 | 392 |
| 133 | 3300006358 | Ga0068871_100315269 | Ga0068871_1003152691 | 392 |
| 134 | 3300006871 | Ga0075434_100019165 | Ga0075434_1000191655 | 392 |
| 135 | 3300006931 | Ga0097620_100278146 | Ga0097620_1002781463 | 392 |
| 136 | 3300007076 | Ga0075435_100028341 | Ga0075435_1000283415 | 392 |
| 137 | 3300009092 | Ga0105250_10014042 | Ga0105250_100140422 | 392 |
| 138 | 3300009098 | Ga0105245_10077328 | Ga0105245_100773282 | 392 |
| 139 | 3300009098 | Ga0105245_10177514 | Ga0105245_101775142 | 392 |
| 140 | 3300009148 | Ga0105243_10128916 | Ga0105243_101289162 | 392 |
| 141 | 3300009174 | Ga0105241_10056771 | Ga0105241_100567711 | 392 |
| 142 | 3300009174 | Ga0105241_10157087 | Ga0105241_101570872 | 392 |
| 143 | 3300009177 | Ga0105248_10107522 | Ga0105248_101075224 | 392 |
| 144 | 3300009177 | Ga0105248_10387959 | Ga0105248_103879592 | 392 |
| 145 | 3300009545 | Ga0105237_10066237 | Ga0105237_100662375 | 392 |
| 146 | 3300009551 | Ga0105238_10369344 | Ga0105238_103693442 | 392 |
| 147 | 3300009553 | Ga0105249_10154371 | Ga0105249_101543712 | 392 |
| 148 | 3300010375 | Ga0105239_10016473 | Ga0105239_100164735 | 392 |
| 149 | 3300010375 | Ga0105239_10195037 | Ga0105239_101950373 | 392 |
| 150 | 3300011119 | Ga0105246_10201214 | Ga0105246_102012142 | 392 |
| 151 | 3300011119 | Ga0105246_10212835 | Ga0105246_102128351 | 392 |
| 152 | 3300013296 | Ga0157374_10018451 | Ga0157374_100184511 | 392 |
| 153 | 3300013297 | Ga0157378_10037063 | Ga0157378_100370634 | 392 |
| 154 | 3300013306 | Ga0163162_10006056 | Ga0163162_1000605613 | 392 |
| 155 | 3300013306 | Ga0163162_10091764 | Ga0163162_100917642 | 392 |
| 156 | 3300013308 | Ga0157375_10047639 | Ga0157375_100476392 | 392 |
| 157 | 3300013308 | Ga0157375_10062158 | Ga0157375_100621584 | 392 |
| 158 | 3300014325 | Ga0163163_10026297 | Ga0163163_100262975 | 392 |
| 159 | 3300014969 | Ga0157376_10013967 | Ga0157376_100139675 | 392 |
| 160 | 3300014969 | Ga0157376_10023687 | Ga0157376_100236875 | 392 |
| 161 | 3300017792 | Ga0163161_10012716 | Ga0163161_100127165 | 392 |
| 162 | 3300021384 | Ga0213876_10001447 | Ga0213876_100014477 | 392 |
| 163 | 3300025901 | Ga0207688_10039938 | Ga0207688_100399382 | 392 |
| 164 | 3300025904 | Ga0207647_10028560 | Ga0207647_100285604 | 392 |
| 165 | 3300025905 | Ga0207685_10015708 | Ga0207685_100157083 | 392 |
| 166 | 3300025906 | Ga0207699_10007708 | Ga0207699_100077082 | 392 |
| 167 | 3300025914 | Ga0207671_10028805 | Ga0207671_100288053 | 392 |
| 168 | 3300025915 | Ga0207693_10032830 | Ga0207693_100328305 | 392 |
| 169 | 3300025923 | Ga0207681_10055346 | Ga0207681_100553462 | 392 |
| 170 | 3300025927 | Ga0207687_10088658 | Ga0207687_100886581 | 392 |
| 171 | 3300025927 | Ga0207687_10142855 | Ga0207687_101428552 | 392 |
| 172 | 3300025928 | Ga0207700_10079668 | Ga0207700_100796683 | 392 |
| 173 | 3300025929 | Ga0207664_10030573 | Ga0207664_100305733 | 392 |
| 174 | 3300025932 | Ga0207690_10162230 | Ga0207690_101622302 | 392 |
| 175 | 3300025933 | Ga0207706_10012890 | Ga0207706_100128902 | 392 |
| 176 | 3300025933 | Ga0207706_10072274 | Ga0207706_100722742 | 392 |
| 177 | 3300025935 | Ga0207709_10017362 | Ga0207709_100173625 | 392 |
| 178 | 3300025937 | Ga0207669_10010569 | Ga0207669_100105695 | 392 |
| 179 | 3300025939 | Ga0207665_10068512 | Ga0207665_100685122 | 392 |
| 180 | 3300025940 | Ga0207691_10031947 | Ga0207691_100319474 | 392 |
| 181 | 3300025940 | Ga0207691_10141147 | Ga0207691_101411472 | 392 |
| 182 | 3300025942 | Ga0207689_10050405 | Ga0207689_100504052 | 392 |
| 183 | 3300025949 | Ga0207667_10061068 | Ga0207667_100610682 | 392 |
| 184 | 3300025961 | Ga0207712_10214617 | Ga0207712_102146172 | 392 |
| 185 | 3300025972 | Ga0207668_10112499 | Ga0207668_101124991 | 392 |
| 186 | 3300025972 | Ga0207668_10220538 | Ga0207668_102205382 | 392 |
| 187 | 3300025972 | Ga0207668_10269826 | Ga0207668_102698261 | 392 |
| 188 | 3300026023 | Ga0207677_10008433 | Ga0207677_100084333 | 392 |
| 189 | 3300026023 | Ga0207677_10030095 | Ga0207677_100300953 | 392 |
| 190 | 3300026067 | Ga0207678_10099619 | Ga0207678_100996194 | 392 |
| 191 | 3300026067 | Ga0207678_10182909 | Ga0207678_101829092 | 392 |
| 192 | 3300026078 | Ga0207702_10021621 | Ga0207702_100216214 | 392 |
| 193 | 3300026095 | Ga0207676_10174610 | Ga0207676_101746102 | 392 |
| 194 | 3300026116 | Ga0207674_10099324 | Ga0207674_100993244 | 392 |
| 195 | 3300026118 | Ga0207675_100103756 | Ga0207675_1001037562 | 392 |
| 196 | 3300026118 | Ga0207675_100104899 | Ga0207675_1001048994 | 392 |
| 197 | 3300026121 | Ga0207683_10060268 | Ga0207683_100602682 | 392 |
| 198 | 3300026121 | Ga0207683_10196104 | Ga0207683_101961042 | 392 |
| 199 | 3300026121 | Ga0207683_10214891 | Ga0207683_102148912 | 392 |
| 200 | 3300026142 | Ga0207698_10118356 | Ga0207698_101183562 | 392 |
| 201 | 3300026142 | Ga0207698_10160163 | Ga0207698_101601632 | 392 |
| 202 | 3300028379 | Ga0268266_10021731 | Ga0268266_100217316 | 392 |
| 203 | 3300028380 | Ga0268265_10131363 | Ga0268265_101313633 | 392 |
| 204 | 3300028381 | Ga0268264_10057497 | Ga0268264_100574972 | 392 |
| 205 | 3300028786 | Ga0307517_10178269 | Ga0307517_101782692 | 392 |
| 206 | 3300039437 | Ga0436365_0278067 | Ga0436365_0278067_99_1277 | 392 |
| 207 | 3300039437 | Ga0436365_0687739 | Ga0436365_0687739_7903_9081 | 392 |
| 208 | 3300039450 | Ga0436363_1573029 | Ga0436363_1573029_370_1548 | 392 |
| 209 | 3300046455 | Ga0495603_0015732 | Ga0495603_0015732_394_1572 | 392 |
| 210 | 3300046455 | Ga0495603_0056614 | Ga0495603_0056614_154_1332 | 392 |
| 211 | 3300046472 | Ga0495580_0062316 | Ga0495580_0062316_273_1451 | 392 |
| 212 | 3300046473 | Ga0495582_0087147 | Ga0495582_0087147_407_1585 | 392 |
| 213 | 3300046492 | Ga0495585_0043686 | Ga0495585_0043686_494_1672 | 392 |
| 214 | 3300046523 | Ga0495644_0031238 | Ga0495644_0031238_597_1775 | 392 |
| 215 | 3300046538 | Ga0495609_0024284 | Ga0495609_0024284_1001_2179 | 392 |
| 216 | 3300046542 | Ga0495597_0045447 | Ga0495597_0045447_313_1491 | 392 |
| 217 | 3300046674 | Ga0495588_0086888 | Ga0495588_0086888_155_1333 | 392 |
| 218 | 3300046684 | Ga0495669_0004749 | Ga0495669_0004749_1861_3039 | 392 |
| 219 | 3300046684 | Ga0495669_0108673 | Ga0495669_0108673_100_1278 | 392 |
| 220 | 3300047321 | Ga0495676_0121703 | Ga0495676_0121703_24_1202 | 392 |
| 221 | 3300048903 | Ga0496100_0031490 | Ga0496100_0031490_1828_3006 | 392 |
| 222 | 3300048904 | Ga0496101_0022754 | Ga0496101_0022754_655_1833 | 392 |
| 223 | 3300048905 | Ga0496102_0033573 | Ga0496102_0033573_2877_4055 | 392 |
| 224 | 3300048905 | Ga0496102_0212801 | Ga0496102_0212801_409_1587 | 392 |
| 225 | 3300048906 | Ga0496103_0024136 | Ga0496103_0024136_2070_3248 | 392 |
| 226 | 3300048907 | Ga0496104_0035515 | Ga0496104_0035515_2069_3247 | 392 |
| 227 | 3300048907 | Ga0496104_0315578 | Ga0496104_0315578_77_1255 | 392 |
| 228 | 3300048908 | Ga0496105_0052035 | Ga0496105_0052035_1247_2425 | 392 |
| 229 | 3300048909 | Ga0496106_0020122 | Ga0496106_0020122_300_1478 | 392 |
| 230 | 3300048909 | Ga0496106_0029606 | Ga0496106_0029606_1079_2257 | 392 |
| 231 | 3300048909 | Ga0496106_0054568 | Ga0496106_0054568_140_1318 | 392 |
| 232 | 3300048910 | Ga0496107_0046653 | Ga0496107_0046653_991_2169 | 392 |
| 233 | 3300048911 | Ga0496108_0017378 | Ga0496108_0017378_567_1745 | 392 |
| 234 | 3300048912 | Ga0496109_0020594 | Ga0496109_0020594_3905_5083 | 392 |
| 235 | 3300048915 | Ga0496112_0129318 | Ga0496112_0129318_943_2121 | 392 |
| 236 | 3300048916 | Ga0496113_0011838 | Ga0496113_0011838_3971_5149 | 392 |
| 237 | 3300048916 | Ga0496113_0041979 | Ga0496113_0041979_1289_2467 | 392 |
| 238 | 3300048917 | Ga0496114_0004339 | Ga0496114_0004339_4430_5608 | 392 |
| 239 | 3300048918 | Ga0496115_0025513 | Ga0496115_0025513_2115_3293 | 392 |
| 240 | 3300048918 | Ga0496115_0086269 | Ga0496115_0086269_486_1664 | 392 |
| 241 | 3300048918 | Ga0496115_0103869 | Ga0496115_0103869_732_1910 | 392 |
| 242 | 3300048921 | Ga0496118_0094096 | Ga0496118_0094096_327_1505 | 392 |
| 243 | 3300048924 | Ga0496121_0044584 | Ga0496121_0044584_89_1267 | 392 |
| 244 | 3300048924 | Ga0496121_0073020 | Ga0496121_0073020_1326_2504 | 392 |
| 245 | 3300048927 | Ga0496124_0147134 | Ga0496124_0147134_384_1562 | 392 |
| 246 | 3300048928 | Ga0496125_0139875 | Ga0496125_0139875_434_1612 | 392 |
| 247 | 3300048929 | Ga0496126_0015594 | Ga0496126_0015594_4790_5968 | 392 |
| 248 | 3300050490 | nmdc:mga03n38_2420_c1 | nmdc:mga03n38_2420_c1_94_1272 | 392 |
| 249 | 3300050494 | nmdc:mga06z11_37379_c1 | nmdc:mga06z11_37379_c1_1119_2297 | 392 |
| 250 | 3300050494 | nmdc:mga06z11_37836_c1 | nmdc:mga06z11_37836_c1_851_2029 | 392 |
| 251 | 3300050496 | nmdc:mga07m45_21319_c2 | nmdc:mga07m45_21319_c2_981_2159 | 392 |
| 252 | 3300050496 | nmdc:mga07m45_40836_c1 | nmdc:mga07m45_40836_c1_1102_2280 | 392 |
| 253 | 3300050513 | nmdc:mga0rr50_103192_c1 | nmdc:mga0rr50_103192_c1_974_2152 | 392 |
| 254 | 3300053086 | Ga0500578_0055597 | Ga0500578_0055597_974_2152 | 392 |
| 255 | 3300053087 | Ga0500643_038654 | Ga0500643_038654_76_1254 | 392 |
| 256 | 3300053093 | Ga0500651_0045618 | Ga0500651_0045618_1475_2653 | 392 |
| 257 | 3300053094 | Ga0500566_0004143 | Ga0500566_0004143_5359_6537 | 392 |
| 258 | 3300053119 | Ga0500595_001234 | Ga0500595_001234_7168_8346 | 392 |
| 259 | 3300053147 | Ga0500589_056452 | Ga0500589_056452_503_1681 | 392 |
| 260 | 3300053156 | Ga0500622_0042293 | Ga0500622_0042293_97_1275 | 392 |
| 261 | 3300053162 | Ga0500638_000124 | Ga0500638_000124_12534_13712 | 392 |
| 262 | 3300053178 | Ga0500637_0010349 | Ga0500637_0010349_1542_2720 | 392 |
| 263 | 3300053730 | Ga0500645_014877 | Ga0500645_014877_703_1881 | 392 |
| 264 | iso_pu_bacteria | 2791355196 | 2793059934 | 392 |
| 265 | 3300003215 | JGI25153J46596_10003956 | JGI25153J46596_100039568 | 393 |
| 266 | 3300003215 | JGI25153J46596_10006871 | JGI25153J46596_100068716 | 393 |
| 267 | 3300003354 | JGI25160J50197_1003485 | JGI25160J50197_10034856 | 393 |
| 268 | 3300003659 | JGI25404J52841_10005028 | JGI25404J52841_100050284 | 393 |
| 269 | 3300003659 | JGI25404J52841_10012886 | JGI25404J52841_100128863 | 393 |
| 270 | 3300003794 | Ga0055531_10012574 | Ga0055531_100125742 | 393 |
| 271 | 3300005456 | Ga0070678_100177243 | Ga0070678_1001772432 | 393 |
| 272 | 3300005467 | Ga0070706_100174202 | Ga0070706_1001742021 | 393 |
| 273 | 3300005471 | Ga0070698_100019994 | Ga0070698_1000199946 | 393 |
| 274 | 3300005841 | Ga0068863_100227909 | Ga0068863_1002279092 | 393 |
| 275 | 3300005937 | Ga0081455_10066167 | Ga0081455_100661672 | 393 |
| 276 | 3300005937 | Ga0081455_10078300 | Ga0081455_100783002 | 393 |
| 277 | 3300005983 | Ga0081540_1013269 | Ga0081540_10132695 | 393 |
| 278 | 3300005983 | Ga0081540_1029768 | Ga0081540_10297686 | 393 |
| 279 | 3300005983 | Ga0081540_1031943 | Ga0081540_10319432 | 393 |
| 280 | 3300005983 | Ga0081540_1074326 | Ga0081540_10743263 | 393 |
| 281 | 3300005983 | Ga0081540_1074971 | Ga0081540_10749712 | 393 |
| 282 | 3300005985 | Ga0081539_10000747 | Ga0081539_1000074753 | 393 |
| 283 | 3300006038 | Ga0075365_10110915 | Ga0075365_101109152 | 393 |
| 284 | 3300006178 | Ga0075367_10050941 | Ga0075367_100509412 | 393 |
| 285 | 3300009176 | Ga0105242_10104277 | Ga0105242_101042773 | 393 |
| 286 | 3300009177 | Ga0105248_10085941 | Ga0105248_100859415 | 393 |
| 287 | 3300010375 | Ga0105239_10017421 | Ga0105239_100174215 | 393 |
| 288 | 3300013104 | Ga0157370_10033228 | Ga0157370_100332282 | 393 |
| 289 | 3300013308 | Ga0157375_10201416 | Ga0157375_102014162 | 393 |
| 290 | 3300014325 | Ga0163163_10430145 | Ga0163163_104301452 | 393 |
| 291 | 3300021441 | Ga0213871_10005236 | Ga0213871_100052363 | 393 |
| 292 | 3300025261 | Ga0209233_1002274 | Ga0209233_10022746 | 393 |
| 293 | 3300025295 | Ga0209564_1003642 | Ga0209564_10036424 | 393 |
| 294 | 3300025297 | Ga0209758_1000407 | Ga0209758_100040743 | 393 |
| 295 | 3300025297 | Ga0209758_1000952 | Ga0209758_100095218 | 393 |
| 296 | 3300025299 | Ga0209256_1003168 | Ga0209256_10031686 | 393 |
| 297 | 3300025302 | Ga0207426_1006892 | Ga0207426_10068922 | 393 |
| 298 | 3300025304 | Ga0209257_1001445 | Ga0209257_10014456 | 393 |
| 299 | 3300025910 | Ga0207684_10084428 | Ga0207684_100844284 | 393 |
| 300 | 3300025934 | Ga0207686_10076584 | Ga0207686_100765842 | 393 |
| 301 | 3300025941 | Ga0207711_10225075 | Ga0207711_102250752 | 393 |
| 302 | 3300027296 | Ga0209389_1000011 | Ga0209389_1000011100 | 393 |
| 303 | 3300027361 | Ga0209489_100017 | Ga0209489_100017134 | 393 |
| 304 | 3300027363 | Ga0209700_100027 | Ga0209700_100027100 | 393 |
| 305 | 3300031616 | Ga0307508_10017864 | Ga0307508_100178645 | 393 |
| 306 | 3300031730 | Ga0307516_10006295 | Ga0307516_1000629513 | 393 |
| 307 | 3300032002 | Ga0307416_100065752 | Ga0307416_1000657524 | 393 |
| 308 | 3300033442 | Ga0315911_1000011 | Ga0315911_100001181 | 393 |
| 309 | 3300035112 | Ga0373932_0028549 | Ga0373932_0028549_22_1203 | 393 |
| 310 | 3300035113 | Ga0373936_0012430 | Ga0373936_0012430_222_1403 | 393 |
| 311 | 3300035691 | Ga0373931_0007686 | Ga0373931_0007686_1417_2598 | 393 |
| 312 | 3300035695 | Ga0373927_0107960 | Ga0373927_0107960_315_1496 | 393 |
| 313 | 3300035695 | Ga0373927_0112866 | Ga0373927_0112866_299_1480 | 393 |
| 314 | 3300037418 | Ga0395900_0149359 | Ga0395900_0149359_687_1868 | 393 |
| 315 | 3300037466 | Ga0395898_0022383 | Ga0395898_0022383_3495_4676 | 393 |
| 316 | 3300037466 | Ga0395898_0183312 | Ga0395898_0183312_302_1483 | 393 |
| 317 | 3300038443 | Ga0395901_0200944 | Ga0395901_0200944_809_1990 | 393 |
| 318 | 3300039438 | Ga0436360_0661609 | Ga0436360_0661609_113_1294 | 393 |
| 319 | 3300039447 | Ga0436361_0785755 | Ga0436361_0785755_3587_4768 | 393 |
| 320 | 3300039453 | Ga0436362_1292799 | Ga0436362_1292799_434_1615 | 393 |
| 321 | 3300046455 | Ga0495603_0025704 | Ga0495603_0025704_916_2097 | 393 |
| 322 | 3300046477 | Ga0495664_0012732 | Ga0495664_0012732_230_1411 | 393 |
| 323 | 3300046543 | Ga0495645_0002189 | Ga0495645_0002189_2529_3710 | 393 |
| 324 | 3300046616 | Ga0495668_0025830 | Ga0495668_0025830_347_1528 | 393 |
| 325 | 3300048904 | Ga0496101_0006632 | Ga0496101_0006632_4877_6058 | 393 |
| 326 | 3300048908 | Ga0496105_0006080 | Ga0496105_0006080_3471_4652 | 393 |
| 327 | 3300048909 | Ga0496106_0085023 | Ga0496106_0085023_1240_2421 | 393 |
| 328 | 3300048910 | Ga0496107_0022024 | Ga0496107_0022024_13_1194 | 393 |
| 329 | 3300048911 | Ga0496108_0130051 | Ga0496108_0130051_121_1302 | 393 |
| 330 | 3300048912 | Ga0496109_0163275 | Ga0496109_0163275_441_1622 | 393 |
| 331 | 3300048914 | Ga0496111_0049829 | Ga0496111_0049829_663_1844 | 393 |
| 332 | 3300048916 | Ga0496113_0067973 | Ga0496113_0067973_1355_2536 | 393 |
| 333 | 3300048917 | Ga0496114_0002764 | Ga0496114_0002764_2631_3812 | 393 |
| 334 | 3300048924 | Ga0496121_0019777 | Ga0496121_0019777_4518_5699 | 393 |
| 335 | 3300048929 | Ga0496126_0016957 | Ga0496126_0016957_1382_2563 | 393 |
| 336 | 3300053077 | Ga0495601_0043004 | Ga0495601_0043004_1497_2678 | 393 |
| 337 | 3300053085 | Ga0495619_0184154 | Ga0495619_0184154_159_1340 | 393 |
| 338 | 3300053094 | Ga0500566_0000064 | Ga0500566_0000064_29817_30998 | 393 |
| 339 | 3300053095 | Ga0500640_003196 | Ga0500640_003196_4425_5606 | 393 |
| 340 | 3300053111 | Ga0500572_000026 | Ga0500572_000026_26446_27627 | 393 |
| 341 | 3300053122 | Ga0500608_008044 | Ga0500608_008044_2531_3712 | 393 |
| 342 | 3300053123 | Ga0500614_002715 | Ga0500614_002715_306_1487 | 393 |
| 343 | 3300053136 | Ga0500559_0004820 | Ga0500559_0004820_4063_5244 | 393 |
| 344 | 3300053150 | Ga0500603_000109 | Ga0500603_000109_13921_15102 | 393 |
| 345 | 3300053155 | Ga0500620_001076 | Ga0500620_001076_3588_4772 | 393 |
| 346 | 3300053159 | Ga0500630_005009 | Ga0500630_005009_3216_4397 | 393 |
| 347 | 3300053163 | Ga0500639_000353 | Ga0500639_000353_19917_21098 | 393 |
| 348 | 3300053735 | Ga0500596_005043 | Ga0500596_005043_405_1586 | 393 |
| 349 | iso_pu_bacteria | 2507262055 | 2507510086 | 393 |
| 350 | iso_pu_bacteria | 2508501009 | 2508544088 | 393 |
| 351 | iso_pu_bacteria | 2513237092 | 2513628054 | 393 |
| 352 | iso_pu_bacteria | 2513237094 | 2513643618 | 393 |
| 353 | iso_pu_bacteria | 2513237095 | 2513648946 | 393 |
| 354 | iso_pu_bacteria | 2513237102 | 2513705408 | 393 |
| 355 | iso_pu_bacteria | 2513237139 | 2513878061 | 393 |
| 356 | iso_pu_bacteria | 2513237161 | 2514012642 | 393 |
| 357 | iso_pu_bacteria | 2515154112 | 2515629408 | 393 |
| 358 | iso_pu_bacteria | 2517093001 | 2517108433 | 393 |
| 359 | iso_pu_bacteria | 2524023205 | 2524439118 | 393 |
| 360 | iso_pu_bacteria | 2528768022 | 2528849661 | 393 |
| 361 | iso_pu_bacteria | 2617270735 | 2617352583 | 393 |
| 362 | iso_pu_bacteria | 2744054633 | 2745078769 | 393 |
| 363 | iso_pu_bacteria | 2802429603 | 2805920021 | 393 |
| 364 | iso_pu_bacteria | 2816332527 | 2818241650 | 393 |
| 365 | iso_pu_bacteria | 2824600985 | 2824606219 | 393 |
| 366 | iso_pu_bacteria | 2824609381 | 2824609799 | 393 |
| 367 | iso_pu_bacteria | 2824617872 | 2824622770 | 393 |
| 368 | iso_pu_bacteria | 2824626560 | 2824632397 | 393 |
| 369 | iso_pu_bacteria | 2824635225 | 2824640416 | 393 |
| 370 | iso_pu_bacteria | 2824653114 | 2824657682 | 393 |
| 371 | iso_pu_bacteria | 2824661429 | 2824668728 | 393 |
| 372 | iso_pu_bacteria | 2824671348 | 2824674283 | 393 |
| 373 | iso_pu_bacteria | 2824679649 | 2824682568 | 393 |
| 374 | iso_pu_bacteria | 2824687955 | 2824690905 | 393 |
| 375 | iso_pu_bacteria | 2824696289 | 2824698519 | 393 |
| 376 | iso_pu_bacteria | 2824704595 | 2824708358 | 393 |
| 377 | iso_pu_bacteria | 2824714736 | 2824720383 | 393 |
| 378 | iso_pu_bacteria | 2824723954 | 2824728704 | 393 |
| 379 | iso_pu_bacteria | 2824753945 | 2824758933 | 393 |
| 380 | iso_pu_bacteria | 2824763712 | 2824766109 | 393 |
| 381 | iso_pu_bacteria | 2824773399 | 2824778218 | 393 |
| 382 | iso_pu_bacteria | 2838122688 | 2838127472 | 393 |
| 383 | iso_pu_bacteria | 2841941048 | 2841941575 | 393 |
| 384 | iso_pu_bacteria | 2841949485 | 2841952409 | 393 |
| 385 | iso_pu_bacteria | 2841966195 | 2841967719 | 393 |
| 386 | iso_pu_bacteria | 2841974524 | 2841982115 | 393 |
| 387 | iso_pu_bacteria | 2841983080 | 2841986433 | 393 |
| 388 | iso_pu_bacteria | 2847939898 | 2847945070 | 393 |
| 389 | iso_pu_bacteria | 2874612657 | 2874618168 | 393 |
| 390 | iso_pu_bacteria | 2876761206 | 2876766750 | 393 |
| 391 | iso_pu_bacteria | 2876771140 | 2876773328 | 393 |
| 392 | iso_pu_bacteria | 2876818435 | 2876821281 | 393 |
| 393 | iso_pu_bacteria | 2879099564 | 2879107670 | 393 |
| 394 | iso_pu_bacteria | 2879142872 | 2879146714 | 393 |
| 395 | iso_pu_bacteria | 2881364244 | 2881365728 | 393 |
| 396 | iso_pu_bacteria | 2881665667 | 2881670915 | 393 |
| 397 | iso_pu_bacteria | 2885409591 | 2885410157 | 393 |
| 398 | iso_pu_bacteria | 2888378607 | 2888382399 | 393 |
| 399 | iso_pu_bacteria | 2888419890 | 2888422987 | 393 |
| 400 | iso_pu_bacteria | 2903727486 | 2903735354 | 393 |
| 401 | iso_pu_bacteria | 2904711408 | 2904718539 | 393 |
| 402 | iso_pu_bacteria | 2906602504 | 2906608727 | 393 |
| 403 | iso_pu_bacteria | 2906626472 | 2906634799 | 393 |
| 404 | iso_pu_bacteria | 2922368715 | 2922375564 | 393 |
| 405 | iso_pu_bacteria | 2929615660 | 2929616301 | 393 |
| 406 | iso_pu_bacteria | 2929624759 | 2929625045 | 393 |
| 407 | iso_pu_bacteria | 2932784394 | 2932787033 | 393 |
| 408 | iso_pu_bacteria | 2932809354 | 2932811231 | 393 |
| 409 | iso_pu_bacteria | 2932818245 | 2932819896 | 393 |
| 410 | iso_pu_bacteria | 2932828146 | 2932832377 | 393 |
| 411 | iso_pu_bacteria | 2933577622 | 2933578415 | 393 |
| 412 | iso_pu_bacteria | 2935616580 | 2935619085 | 393 |
| 413 | iso_pu_bacteria | 2935638405 | 2935643096 | 393 |
| 414 | iso_pu_bacteria | 2935665750 | 2935669723 | 393 |
| 415 | iso_pu_bacteria | 2935675223 | 2935677137 | 393 |
| 416 | iso_pu_bacteria | 2935684952 | 2935693172 | 393 |
| 417 | iso_pu_bacteria | 2935694250 | 2935695333 | 393 |
| 418 | iso_pu_bacteria | 2935703347 | 2935709558 | 393 |
| 419 | iso_pu_bacteria | 2935713505 | 2935719780 | 393 |
| 420 | iso_pu_bacteria | 2935722832 | 2935729453 | 393 |
| 421 | iso_pu_bacteria | 2935732158 | 2935739663 | 393 |
| 422 | iso_pu_bacteria | 2935741537 | 2935748701 | 393 |
| 423 | iso_pu_bacteria | 2935750917 | 2935756712 | 393 |
| 424 | iso_pu_bacteria | 2935760218 | 2935761304 | 393 |
| 425 | iso_pu_bacteria | 2935769743 | 2935771423 | 393 |
| 426 | iso_pu_bacteria | 2935777560 | 2935779112 | 393 |
| 427 | iso_pu_bacteria | 2935785616 | 2935788316 | 393 |
| 428 | iso_pu_bacteria | 2935793552 | 2935796919 | 393 |
| 429 | iso_pu_bacteria | 2935801545 | 2935807245 | 393 |
| 430 | iso_pu_bacteria | 2935827899 | 2935832759 | 393 |
| 431 | iso_pu_bacteria | 2935864058 | 2935864982 | 393 |
| 432 | iso_pu_bacteria | 2935873716 | 2935876760 | 393 |
| 433 | iso_pu_bacteria | 2935959822 | 2935963289 | 393 |
| 434 | iso_pu_bacteria | 2936002035 | 2936008350 | 393 |
| 435 | iso_pu_bacteria | 2940556831 | 2940562626 | 393 |
| 436 | iso_pu_bacteria | 2941538514 | 2941539850 | 393 |
| 437 | iso_pu_bacteria | 3005594810 | 3005597412 | 393 |
| 438 | iso_pu_bacteria | 3005710791 | 3005713439 | 393 |
| 439 | iso_pu_bacteria | 3005718088 | 3005720854 | 393 |
| 440 | iso_pu_bacteria | 8006926726 | 8006930455 | 393 |
| 441 | iso_pu_bacteria | 8016511872 | 8016515175 | 393 |
| 442 | iso_pu_bacteria | 8016522445 | 8016522963 | 393 |
| 443 | iso_pu_bacteria | 8016557553 | 8016560920 | 393 |
| 444 | iso_pu_bacteria | 8016566248 | 8016574786 | 393 |
| 445 | iso_pu_bacteria | 8016575299 | 8016578861 | 393 |
| 446 | iso_pu_bacteria | 8016595262 | 8016598788 | 393 |
| 447 | iso_pu_bacteria | 8016613128 | 8016621514 | 393 |
| 448 | iso_pu_bacteria | 8017057580 | 8017061279 | 393 |
| 449 | iso_pu_bacteria | 8019530166 | 8019536145 | 393 |
| 450 | iso_pu_bacteria | 8019586578 | 8019588481 | 393 |
| 451 | iso_pu_bacteria | 8019597564 | 8019602856 | 393 |
| 452 | iso_pu_bacteria | 8019619141 | 8019626450 | 393 |
| 453 | iso_pu_bacteria | 8019638758 | 8019643623 | 393 |
| 454 | iso_pu_bacteria | 8019659431 | 8019663807 | 393 |
| 455 | iso_pu_bacteria | 8055742211 | 8055747947 | 393 |
| 456 | iso_pu_bacteria | 8056967851 | 8056969480 | 393 |
| 457 | 3300003215 | JGI25153J46596_10001533 | JGI25153J46596_1000153311 | 394 |
| 458 | 3300003354 | JGI25160J50197_1001294 | JGI25160J50197_100129410 | 394 |
| 459 | 3300005336 | Ga0070680_100090722 | Ga0070680_1000907223 | 394 |
| 460 | 3300005458 | Ga0070681_10138906 | Ga0070681_101389063 | 394 |
| 461 | 3300005530 | Ga0070679_100044585 | Ga0070679_1000445852 | 394 |
| 462 | 3300005577 | Ga0068857_100121411 | Ga0068857_1001214111 | 394 |
| 463 | 3300006028 | Ga0070717_10006275 | Ga0070717_100062754 | 394 |
| 464 | 3300006942 | Ga0099824_1020393 | Ga0099824_10203937 | 394 |
| 465 | 3300013105 | Ga0157369_10094195 | Ga0157369_100941953 | 394 |
| 466 | 3300025295 | Ga0209564_1002300 | Ga0209564_10023003 | 394 |
| 467 | 3300025297 | Ga0209758_1000900 | Ga0209758_100090041 | 394 |
| 468 | 3300025302 | Ga0207426_1000466 | Ga0207426_100046656 | 394 |
| 469 | 3300025304 | Ga0209257_1036773 | Ga0209257_10367731 | 394 |
| 470 | 3300025912 | Ga0207707_10002025 | Ga0207707_1000202519 | 394 |
| 471 | 3300025912 | Ga0207707_10077474 | Ga0207707_100774742 | 394 |
| 472 | 3300025917 | Ga0207660_10005792 | Ga0207660_100057926 | 394 |
| 473 | 3300025917 | Ga0207660_10019091 | Ga0207660_100190916 | 394 |
| 474 | 3300025921 | Ga0207652_10018694 | Ga0207652_100186943 | 394 |
| 475 | 3300025944 | Ga0207661_10017331 | Ga0207661_100173316 | 394 |
| 476 | 3300035083 | Ga0373926_0010615 | Ga0373926_0010615_85_1269 | 394 |
| 477 | 3300035089 | Ga0373944_0027927 | Ga0373944_0027927_92_1276 | 394 |
| 478 | 3300035111 | Ga0373923_0001451 | Ga0373923_0001451_4432_5616 | 394 |
| 479 | 3300035116 | Ga0373945_0051853 | Ga0373945_0051853_231_1415 | 394 |
| 480 | 3300035118 | Ga0373954_0030575 | Ga0373954_0030575_623_1807 | 394 |
| 481 | 3300035170 | Ga0373943_0036703 | Ga0373943_0036703_1061_2245 | 394 |
| 482 | 3300035171 | Ga0373946_0022123 | Ga0373946_0022123_92_1276 | 394 |
| 483 | 3300035172 | Ga0373955_0050587 | Ga0373955_0050587_535_1719 | 394 |
| 484 | 3300035410 | Ga0373924_0052065 | Ga0373924_0052065_426_1610 | 394 |
| 485 | 3300037068 | Ga0373925_0013406 | Ga0373925_0013406_3993_5177 | 394 |
| 486 | 3300046454 | Ga0495592_0158003 | Ga0495592_0158003_76_1260 | 394 |
| 487 | 3300046472 | Ga0495580_0013314 | Ga0495580_0013314_2143_3327 | 394 |
| 488 | 3300046473 | Ga0495582_0023756 | Ga0495582_0023756_1606_2790 | 394 |
| 489 | 3300046475 | Ga0495639_0004952 | Ga0495639_0004952_3413_4597 | 394 |
| 490 | 3300046477 | Ga0495664_0094369 | Ga0495664_0094369_504_1688 | 394 |
| 491 | 3300046499 | Ga0495594_0056395 | Ga0495594_0056395_517_1701 | 394 |
| 492 | 3300046511 | Ga0495608_0098045 | Ga0495608_0098045_455_1639 | 394 |
| 493 | 3300046516 | Ga0495628_0148725 | Ga0495628_0148725_504_1688 | 394 |
| 494 | 3300046517 | Ga0495630_0005565 | Ga0495630_0005565_2654_3838 | 394 |
| 495 | 3300046531 | Ga0495665_0013892 | Ga0495665_0013892_1342_2526 | 394 |
| 496 | 3300046533 | Ga0495640_0015080 | Ga0495640_0015080_1972_3156 | 394 |
| 497 | 3300046543 | Ga0495645_0113951 | Ga0495645_0113951_623_1807 | 394 |
| 498 | 3300046642 | Ga0495634_0032240 | Ga0495634_0032240_623_1807 | 394 |
| 499 | 3300046681 | Ga0495647_0005222 | Ga0495647_0005222_641_1825 | 394 |
| 500 | 3300046689 | Ga0495613_0172949 | Ga0495613_0172949_148_1332 | 394 |
| 501 | 3300047317 | Ga0495604_0200130 | Ga0495604_0200130_106_1290 | 394 |
| 502 | 3300047319 | Ga0495674_0017659 | Ga0495674_0017659_2127_3311 | 394 |
| 503 | 3300047471 | Ga0495684_0022676 | Ga0495684_0022676_1482_2666 | 394 |
| 504 | 3300047673 | Ga0495593_0017295 | Ga0495593_0017295_1768_2952 | 394 |
| 505 | 3300048928 | Ga0496125_0052475 | Ga0496125_0052475_657_1844 | 394 |
| 506 | 3300049581 | Ga0501047_0021432 | Ga0501047_0021432_492_1688 | 394 |
| 507 | 3300049590 | Ga0501074_0143591 | Ga0501074_0143591_116_1312 | 394 |
| 508 | 3300049742 | Ga0501080_0021618 | Ga0501080_0021618_3242_4438 | 394 |
| 509 | 3300049822 | Ga0501035_0168544 | Ga0501035_0168544_232_1428 | 394 |
| 510 | 3300050492 | nmdc:mga0yw44_17230_c1 | nmdc:mga0yw44_17230_c1_2332_3519 | 394 |
| 511 | 3300050516 | nmdc:mga0sz30_16099_c1 | nmdc:mga0sz30_16099_c1_431_1618 | 394 |
| 512 | 3300053077 | Ga0495601_0078764 | Ga0495601_0078764_200_1384 | 394 |
| 513 | iso_pu_bacteria | 2617270741 | 2617379007 | 394 |
| 514 | iso_pu_bacteria | 2824732956 | 2824736323 | 394 |
| 515 | iso_pu_bacteria | 2824746037 | 2824749992 | 394 |
| 516 | iso_pu_bacteria | 2908775508 | 2908778653 | 394 |
| 517 | iso_pu_bacteria | 2922393267 | 2922394926 | 394 |
| 518 | iso_pu_bacteria | 2932794094 | 2932797264 | 394 |
| 519 | iso_pu_bacteria | 2932801729 | 2932804851 | 394 |
| 520 | iso_pu_bacteria | 2935883170 | 2935884913 | 394 |
| 521 | iso_pu_bacteria | 2941531003 | 2941536317 | 394 |
| 522 | iso_pu_bacteria | 3005483717 | 3005487880 | 394 |
| 523 | iso_pu_bacteria | 3005587118 | 3005589385 | 394 |
| 524 | iso_pu_bacteria | 8019648815 | 8019656411 | 394 |
| 525 | 3300005334 | Ga0068869_100076723 | Ga0068869_1000767234 | 395 |
| 526 | 3300005347 | Ga0070668_100111188 | Ga0070668_1001111882 | 395 |
| 527 | 3300005353 | Ga0070669_100080577 | Ga0070669_1000805772 | 395 |
| 528 | 3300005471 | Ga0070698_100134945 | Ga0070698_1001349452 | 395 |
| 529 | 3300005543 | Ga0070672_100102762 | Ga0070672_1001027622 | 395 |
| 530 | 3300005843 | Ga0068860_100127931 | Ga0068860_1001279312 | 395 |
| 531 | 3300005844 | Ga0068862_100074659 | Ga0068862_1000746592 | 395 |
| 532 | 3300006038 | Ga0075365_10004123 | Ga0075365_100041233 | 395 |
| 533 | 3300006177 | Ga0075362_10034916 | Ga0075362_100349162 | 395 |
| 534 | 3300009553 | Ga0105249_10400783 | Ga0105249_104007831 | 395 |
| 535 | 3300025923 | Ga0207681_10065430 | Ga0207681_100654302 | 395 |
| 536 | 3300025940 | Ga0207691_10079604 | Ga0207691_100796043 | 395 |
| 537 | 3300025972 | Ga0207668_10043719 | Ga0207668_100437194 | 395 |
| 538 | 3300026118 | Ga0207675_100253690 | Ga0207675_1002536901 | 395 |
| 539 | 3300031901 | Ga0307406_10066488 | Ga0307406_100664882 | 395 |
| 540 | 3300032126 | Ga0307415_100049699 | Ga0307415_1000496992 | 395 |
| 541 | 3300048918 | Ga0496115_0278051 | Ga0496115_0278051_158_1345 | 395 |
| 542 | 3300050491 | nmdc:mga00v17_14964_c1 | nmdc:mga00v17_14964_c1_2036_3229 | 395 |
| 543 | 3300050492 | nmdc:mga0yw44_26457_c1 | nmdc:mga0yw44_26457_c1_56_1249 | 395 |
| 544 | iso_pu_bacteria | 2874590934 | 2874593288 | 395 |
| 545 | iso_pu_bacteria | 2874645413 | 2874652937 | 395 |
| 546 | iso_pu_bacteria | 2879074833 | 2879077244 | 395 |
| 547 | iso_pu_bacteria | 2879127579 | 2879130199 | 395 |
| 548 | iso_pu_bacteria | 2935608549 | 2935611009 | 395 |
| 549 | iso_pu_bacteria | 2935810662 | 2935812381 | 395 |
| 550 | iso_pu_bacteria | 2935819856 | 2935820494 | 395 |
| 551 | iso_pu_bacteria | 2935837841 | 2935839160 | 395 |
| 552 | iso_pu_bacteria | 2935847175 | 2935849497 | 395 |
| 553 | iso_pu_bacteria | 2935855204 | 2935857450 | 395 |
| 554 | iso_pu_bacteria | 2935908558 | 2935911729 | 395 |
| 555 | iso_pu_bacteria | 2935916978 | 2935919384 | 395 |
| 556 | iso_pu_bacteria | 2935926038 | 2935928758 | 395 |
| 557 | iso_pu_bacteria | 2935934488 | 2935938403 | 395 |
| 558 | iso_pu_bacteria | 2935942939 | 2935945705 | 395 |
| 559 | iso_pu_bacteria | 2935951376 | 2935954688 | 395 |
| 560 | iso_pu_bacteria | 2935967501 | 2935970575 | 395 |
| 561 | iso_pu_bacteria | 2935975950 | 2935979189 | 395 |
| 562 | iso_pu_bacteria | 2936037263 | 2936038974 | 395 |
| 563 | iso_pu_bacteria | 8019538911 | 8019543327 | 395 |
| 564 | iso_pu_bacteria | 8019547302 | 8019555530 | 395 |
| 565 | iso_pu_bacteria | 8019576017 | 8019580750 | 395 |
| 566 | iso_pu_bacteria | 8019608314 | 8019615700 | 395 |
| 567 | iso_pu_bacteria | 8019629233 | 8019636042 | 395 |
| 568 | iso_pu_bacteria | 8019668869 | 8019673438 | 395 |
| 569 | iso_pu_bacteria | 8019687851 | 8019688374 | 395 |
| 570 | 3300003203 | JGI25406J46586_10000141 | JGI25406J46586_1000014114 | 396 |
| 571 | 3300004625 | Ga0055543_1011317 | Ga0055543_10113172 | 396 |
| 572 | 3300005262 | Ga0065165_1002974 | Ga0065165_10029746 | 396 |
| 573 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008475 | 396 |
| 574 | 3300025901 | Ga0207688_10047486 | Ga0207688_100474864 | 396 |
| 575 | 3300047469 | Ga0495673_0034885 | Ga0495673_0034885_823_2043 | 396 |
| 576 | 3300048909 | Ga0496106_0025828 | Ga0496106_0025828_172_1362 | 396 |
| 577 | 3300048915 | Ga0496112_0007576 | Ga0496112_0007576_6439_7641 | 396 |
| 578 | 3300053085 | Ga0495619_0027691 | Ga0495619_0027691_1947_3137 | 396 |
| 579 | 3300053098 | Ga0500650_0081575 | Ga0500650_0081575_210_1400 | 396 |
| 580 | iso_pu_bacteria | 2508501128 | 2509153755 | 396 |
| 581 | iso_pu_bacteria | 2511231028 | 2511398618 | 396 |
| 582 | iso_pu_bacteria | 2513237098 | 2513676481 | 396 |
| 583 | iso_pu_bacteria | 2524023210 | 2524470396 | 396 |
| 584 | iso_pu_bacteria | 2885383462 | 2885390048 | 396 |
| 585 | iso_pu_bacteria | 2903768456 | 2903771726 | 396 |
| 586 | iso_pu_bacteria | 8056681323 | 8056685065 | 396 |
| 587 | 3300005331 | Ga0070670_100113694 | Ga0070670_1001136944 | 397 |
| 588 | 3300005455 | Ga0070663_100159166 | Ga0070663_1001591662 | 397 |
| 589 | 3300005547 | Ga0070693_100157265 | Ga0070693_1001572651 | 397 |
| 590 | 3300005616 | Ga0068852_100031560 | Ga0068852_1000315603 | 397 |
| 591 | 3300006038 | Ga0075365_10135999 | Ga0075365_101359992 | 397 |
| 592 | 3300006048 | Ga0075363_100022580 | Ga0075363_1000225802 | 397 |
| 593 | 3300006051 | Ga0075364_10146759 | Ga0075364_101467592 | 397 |
| 594 | 3300006177 | Ga0075362_10010952 | Ga0075362_100109521 | 397 |
| 595 | 3300006195 | Ga0075366_10049004 | Ga0075366_100490043 | 397 |
| 596 | 3300006942 | Ga0099824_1021825 | Ga0099824_10218252 | 397 |
| 597 | 3300009093 | Ga0105240_10043716 | Ga0105240_100437165 | 397 |
| 598 | 3300009545 | Ga0105237_10026805 | Ga0105237_100268056 | 397 |
| 599 | 3300014969 | Ga0157376_10313863 | Ga0157376_103138632 | 397 |
| 600 | 3300025253 | Ga0209677_105815 | Ga0209677_1058153 | 397 |
| 601 | 3300025913 | Ga0207695_10000029 | Ga0207695_10000029154 | 397 |
| 602 | 3300025986 | Ga0207658_10077021 | Ga0207658_100770214 | 397 |
| 603 | 3300026088 | Ga0207641_10214713 | Ga0207641_102147131 | 397 |
| 604 | 3300026142 | Ga0207698_10022947 | Ga0207698_100229476 | 397 |
| 605 | 3300027296 | Ga0209389_1000025 | Ga0209389_1000025158 | 397 |
| 606 | 3300027357 | Ga0209589_1000066 | Ga0209589_1000066107 | 397 |
| 607 | 3300027361 | Ga0209489_100030 | Ga0209489_1000306 | 397 |
| 608 | 3300033180 | Ga0307510_10010422 | Ga0307510_1001042212 | 397 |
| 609 | 3300037312 | Ga0395899_0078611 | Ga0395899_0078611_72_1265 | 397 |
| 610 | 3300037418 | Ga0395900_0006782 | Ga0395900_0006782_3685_4878 | 397 |
| 611 | 3300037466 | Ga0395898_0002649 | Ga0395898_0002649_7717_8910 | 397 |
| 612 | 3300037466 | Ga0395898_0079527 | Ga0395898_0079527_695_1888 | 397 |
| 613 | 3300037471 | Ga0395905_0065215 | Ga0395905_0065215_244_1437 | 397 |
| 614 | 3300038443 | Ga0395901_0047239 | Ga0395901_0047239_226_1419 | 397 |
| 615 | 3300044683 | Ga0466965_0050738 | Ga0466965_0050738_501_1697 | 397 |
| 616 | 3300046454 | Ga0495592_0131071 | Ga0495592_0131071_183_1376 | 397 |
| 617 | 3300046459 | Ga0495629_0020804 | Ga0495629_0020804_1832_3028 | 397 |
| 618 | 3300046460 | Ga0495638_0018033 | Ga0495638_0018033_849_2045 | 397 |
| 619 | 3300046462 | Ga0495651_0019266 | Ga0495651_0019266_720_1913 | 397 |
| 620 | 3300046507 | Ga0495606_0010364 | Ga0495606_0010364_1525_2721 | 397 |
| 621 | 3300046512 | Ga0495610_0017492 | Ga0495610_0017492_2166_3362 | 397 |
| 622 | 3300046513 | Ga0495616_0032613 | Ga0495616_0032613_166_1362 | 397 |
| 623 | 3300046529 | Ga0495652_0013209 | Ga0495652_0013209_5576_6769 | 397 |
| 624 | 3300046529 | Ga0495652_0045028 | Ga0495652_0045028_2295_3491 | 397 |
| 625 | 3300046559 | Ga0495667_0058697 | Ga0495667_0058697_180_1373 | 397 |
| 626 | 3300046616 | Ga0495668_0022603 | Ga0495668_0022603_581_1777 | 397 |
| 627 | 3300046663 | Ga0495635_0032559 | Ga0495635_0032559_1483_2679 | 397 |
| 628 | 3300046675 | Ga0495657_0014702 | Ga0495657_0014702_2993_4189 | 397 |
| 629 | 3300046675 | Ga0495657_0053916 | Ga0495657_0053916_1253_2446 | 397 |
| 630 | 3300046689 | Ga0495613_0031570 | Ga0495613_0031570_1256_2449 | 397 |
| 631 | 3300046690 | Ga0495624_0029902 | Ga0495624_0029902_865_2061 | 397 |
| 632 | 3300046694 | Ga0495649_0065558 | Ga0495649_0065558_473_1669 | 397 |
| 633 | 3300046809 | Ga0495600_0004901 | Ga0495600_0004901_4473_5666 | 397 |
| 634 | 3300046809 | Ga0495600_0011897 | Ga0495600_0011897_3109_4305 | 397 |
| 635 | 3300047319 | Ga0495674_0096617 | Ga0495674_0096617_223_1416 | 397 |
| 636 | 3300047319 | Ga0495674_0131627 | Ga0495674_0131627_793_1986 | 397 |
| 637 | 3300047321 | Ga0495676_0027171 | Ga0495676_0027171_1068_2264 | 397 |
| 638 | 3300047322 | Ga0495680_0017781 | Ga0495680_0017781_3860_5053 | 397 |
| 639 | 3300047443 | Ga0495687_009133 | Ga0495687_009133_1538_2734 | 397 |
| 640 | 3300047444 | Ga0495675_0054654 | Ga0495675_0054654_1286_2479 | 397 |
| 641 | 3300047472 | Ga0495686_0038303 | Ga0495686_0038303_528_1724 | 397 |
| 642 | 3300047673 | Ga0495593_0054000 | Ga0495593_0054000_532_1725 | 397 |
| 643 | 3300048088 | Ga0495602_0053544 | Ga0495602_0053544_203_1399 | 397 |
| 644 | 3300048088 | Ga0495602_0143687 | Ga0495602_0143687_524_1717 | 397 |
| 645 | 3300048089 | Ga0495614_0042211 | Ga0495614_0042211_359_1552 | 397 |
| 646 | 3300048903 | Ga0496100_0244134 | Ga0496100_0244134_26_1222 | 397 |
| 647 | 3300048905 | Ga0496102_0140679 | Ga0496102_0140679_925_2121 | 397 |
| 648 | 3300048907 | Ga0496104_0006004 | Ga0496104_0006004_1703_2896 | 397 |
| 649 | 3300048923 | Ga0496120_0011493 | Ga0496120_0011493_1802_2998 | 397 |
| 650 | 3300048924 | Ga0496121_0165353 | Ga0496121_0165353_215_1411 | 397 |
| 651 | 3300048928 | Ga0496125_0117651 | Ga0496125_0117651_485_1678 | 397 |
| 652 | 3300048929 | Ga0496126_0037222 | Ga0496126_0037222_15_1211 | 397 |
| 653 | 3300049460 | Ga0495682_0013186 | Ga0495682_0013186_1507_2703 | 397 |
| 654 | 3300050491 | nmdc:mga00v17_75253_c1 | nmdc:mga00v17_75253_c1_715_1911 | 397 |
| 655 | 3300050492 | nmdc:mga0yw44_14247_c1 | nmdc:mga0yw44_14247_c1_2747_3946 | 397 |
| 656 | 3300050496 | nmdc:mga07m45_26268_c2 | nmdc:mga07m45_26268_c2_998_2194 | 397 |
| 657 | 3300053079 | Ga0500610_0061422 | Ga0500610_0061422_468_1664 | 397 |
| 658 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_147173_148369 | 397 |
| 659 | 3300053092 | Ga0500583_0051411 | Ga0500583_0051411_491_1687 | 397 |
| 660 | 3300053094 | Ga0500566_0000487 | Ga0500566_0000487_11768_12964 | 397 |
| 661 | 3300053103 | Ga0500555_001886 | Ga0500555_001886_906_2102 | 397 |
| 662 | 3300053108 | Ga0500562_004144 | Ga0500562_004144_2170_3366 | 397 |
| 663 | 3300053118 | Ga0500594_0007039 | Ga0500594_0007039_1220_2416 | 397 |
| 664 | 3300053158 | Ga0500627_0001288 | Ga0500627_0001288_3420_4616 | 397 |
| 665 | 3300053177 | Ga0500636_0000194 | Ga0500636_0000194_26331_27527 | 397 |
| 666 | 3300053730 | Ga0500645_013158 | Ga0500645_013158_1178_2371 | 397 |
| 667 | 3300053736 | Ga0500599_005309 | Ga0500599_005309_15_1211 | 397 |
| 668 | iso_pu_bacteria | 2888388044 | 2888388292 | 397 |
| 669 | iso_pu_bacteria | 2935984226 | 2935987799 | 397 |
| 670 | 3300005614 | Ga0068856_100004479 | Ga0068856_1000044797 | 398 |
| 671 | 3300005843 | Ga0068860_100000317 | Ga0068860_10000031763 | 398 |
| 672 | 3300026078 | Ga0207702_10001399 | Ga0207702_100013998 | 398 |
| 673 | 3300028381 | Ga0268264_10000035 | Ga0268264_1000003545 | 398 |
| 674 | 3300030521 | Ga0307511_10024421 | Ga0307511_100244216 | 398 |
| 675 | 3300031507 | Ga0307509_10056729 | Ga0307509_100567292 | 398 |
| 676 | 3300031507 | Ga0307509_10127360 | Ga0307509_101273602 | 398 |
| 677 | 3300031507 | Ga0307509_10220957 | Ga0307509_102209572 | 398 |
| 678 | 3300031711 | Ga0265314_10011778 | Ga0265314_100117783 | 398 |
| 679 | 3300031730 | Ga0307516_10089057 | Ga0307516_100890573 | 398 |
| 680 | 3300035692 | Ga0373935_0012759 | Ga0373935_0012759_2288_3484 | 398 |
| 681 | 3300035695 | Ga0373927_0001005 | Ga0373927_0001005_14043_15239 | 398 |
| 682 | 3300035695 | Ga0373927_0021788 | Ga0373927_0021788_106_1302 | 398 |
| 683 | 3300039437 | Ga0436365_1006381 | Ga0436365_1006381_542_1738 | 398 |
| 684 | 3300048909 | Ga0496106_0002853 | Ga0496106_0002853_766_1962 | 398 |
| 685 | 3300048921 | Ga0496118_0006091 | Ga0496118_0006091_7205_8401 | 398 |
| 686 | 3300048924 | Ga0496121_0018786 | Ga0496121_0018786_4782_5978 | 398 |
| 687 | 3300048927 | Ga0496124_0016465 | Ga0496124_0016465_1679_2875 | 398 |
| 688 | 3300048928 | Ga0496125_0052884 | Ga0496125_0052884_961_2157 | 398 |
| 689 | 3300053080 | Ga0500635_0002861 | Ga0500635_0002861_812_2008 | 398 |
| 690 | 3300053119 | Ga0500595_036983 | Ga0500595_036983_312_1508 | 398 |
| 691 | 3300053178 | Ga0500637_0055352 | Ga0500637_0055352_251_1447 | 398 |
| 692 | 3300005616 | Ga0068852_100108652 | Ga0068852_1001086523 | 399 |
| 693 | 3300009098 | Ga0105245_10197387 | Ga0105245_101973872 | 399 |
| 694 | 3300009545 | Ga0105237_10062996 | Ga0105237_100629963 | 399 |
| 695 | 3300009551 | Ga0105238_10017427 | Ga0105238_100174274 | 399 |
| 696 | 3300010375 | Ga0105239_10230171 | Ga0105239_102301711 | 399 |
| 697 | 3300025297 | Ga0209758_1003132 | Ga0209758_100313212 | 399 |
| 698 | 3300031238 | Ga0265332_10013434 | Ga0265332_100134342 | 399 |
| 699 | 3300031241 | Ga0265325_10013924 | Ga0265325_100139243 | 399 |
| 700 | 3300031250 | Ga0265331_10078112 | Ga0265331_100781121 | 399 |
| 701 | 3300035118 | Ga0373954_0015042 | Ga0373954_0015042_871_2073 | 399 |
| 702 | 3300035171 | Ga0373946_0005371 | Ga0373946_0005371_1271_2473 | 399 |
| 703 | 3300035692 | Ga0373935_0000746 | Ga0373935_0000746_6561_7763 | 399 |
| 704 | 3300035695 | Ga0373927_0006940 | Ga0373927_0006940_1807_3009 | 399 |
| 705 | 3300035724 | Ga0373933_0115939 | Ga0373933_0115939_225_1427 | 399 |
| 706 | 3300035725 | Ga0373947_0004336 | Ga0373947_0004336_5116_6318 | 399 |
| 707 | 3300046455 | Ga0495603_0025608 | Ga0495603_0025608_1806_3008 | 399 |
| 708 | 3300046459 | Ga0495629_0002240 | Ga0495629_0002240_9240_10442 | 399 |
| 709 | 3300046473 | Ga0495582_0000699 | Ga0495582_0000699_12200_13402 | 399 |
| 710 | 3300046475 | Ga0495639_0001536 | Ga0495639_0001536_1144_2346 | 399 |
| 711 | 3300046477 | Ga0495664_0008004 | Ga0495664_0008004_924_2126 | 399 |
| 712 | 3300046499 | Ga0495594_0004167 | Ga0495594_0004167_5517_6719 | 399 |
| 713 | 3300046514 | Ga0495618_0021442 | Ga0495618_0021442_1773_2975 | 399 |
| 714 | 3300046529 | Ga0495652_0197908 | Ga0495652_0197908_131_1333 | 399 |
| 715 | 3300046531 | Ga0495665_0000866 | Ga0495665_0000866_12354_13556 | 399 |
| 716 | 3300046642 | Ga0495634_0003047 | Ga0495634_0003047_5493_6695 | 399 |
| 717 | 3300046663 | Ga0495635_0012928 | Ga0495635_0012928_2790_3992 | 399 |
| 718 | 3300046680 | Ga0495646_0007247 | Ga0495646_0007247_5752_6954 | 399 |
| 719 | 3300046681 | Ga0495647_0001096 | Ga0495647_0001096_5364_6566 | 399 |
| 720 | 3300046683 | Ga0495658_0003891 | Ga0495658_0003891_620_1822 | 399 |
| 721 | 3300046690 | Ga0495624_0000079 | Ga0495624_0000079_48981_50183 | 399 |
| 722 | 3300047315 | Ga0495581_0000260 | Ga0495581_0000260_3740_4942 | 399 |
| 723 | 3300047319 | Ga0495674_0035062 | Ga0495674_0035062_2185_3387 | 399 |
| 724 | 3300047321 | Ga0495676_0019539 | Ga0495676_0019539_2714_3916 | 399 |
| 725 | 3300047471 | Ga0495684_0023503 | Ga0495684_0023503_600_1802 | 399 |
| 726 | 3300047673 | Ga0495593_0002394 | Ga0495593_0002394_7096_8298 | 399 |
| 727 | 3300053119 | Ga0500595_002556 | Ga0500595_002556_3658_4869 | 399 |
| 728 | 3300053724 | Ga0500570_036755 | Ga0500570_036755_138_1349 | 399 |
| 729 | iso_pu_bacteria | 2935656913 | 2935657572 | 399 |
| 730 | iso_pu_bacteria | 2936011229 | 2936011350 | 399 |
| 731 | iso_pu_bacteria | 2936019824 | 2936019945 | 399 |
| 732 | iso_pu_bacteria | 2936028420 | 2936028541 | 399 |
| 733 | iso_pu_bacteria | 2936046547 | 2936046668 | 399 |
| 734 | iso_pu_bacteria | 2936055302 | 2936062361 | 399 |
| 735 | iso_pu_bacteria | 8016630954 | 8016632646 | 399 |
| 736 | 3300003214 | JGI25165J46597_1009535 | JGI25165J46597_10095352 | 400 |
| 737 | 3300005548 | Ga0070665_100173448 | Ga0070665_1001734482 | 400 |
| 738 | 3300005983 | Ga0081540_1022048 | Ga0081540_10220483 | 400 |
| 739 | 3300006931 | Ga0097620_100372329 | Ga0097620_1003723292 | 400 |
| 740 | 3300009551 | Ga0105238_10055313 | Ga0105238_100553135 | 400 |
| 741 | 3300021384 | Ga0213876_10065164 | Ga0213876_100651641 | 400 |
| 742 | 3300025230 | Ga0209563_103051 | Ga0209563_1030512 | 400 |
| 743 | 3300025253 | Ga0209677_101241 | Ga0209677_10124110 | 400 |
| 744 | 3300025254 | Ga0209148_1005105 | Ga0209148_10051054 | 400 |
| 745 | 3300025254 | Ga0209148_1005191 | Ga0209148_10051913 | 400 |
| 746 | 3300025297 | Ga0209758_1005367 | Ga0209758_10053675 | 400 |
| 747 | 3300028379 | Ga0268266_10275358 | Ga0268266_102753582 | 400 |
| 748 | 3300035117 | Ga0373953_0010742 | Ga0373953_0010742_1523_2725 | 400 |
| 749 | 3300035118 | Ga0373954_0009425 | Ga0373954_0009425_324_1526 | 400 |
| 750 | 3300035119 | Ga0373956_0020988 | Ga0373956_0020988_305_1507 | 400 |
| 751 | 3300035172 | Ga0373955_0006480 | Ga0373955_0006480_2301_3503 | 400 |
| 752 | 3300035410 | Ga0373924_0049397 | Ga0373924_0049397_395_1597 | 400 |
| 753 | 3300035724 | Ga0373933_0028580 | Ga0373933_0028580_1164_2366 | 400 |
| 754 | 3300037853 | Ga0436364_0575208 | Ga0436364_0575208_285_1487 | 400 |
| 755 | 3300046454 | Ga0495592_0001015 | Ga0495592_0001015_3320_4522 | 400 |
| 756 | 3300046463 | Ga0495653_0063362 | Ga0495653_0063362_354_1556 | 400 |
| 757 | 3300046507 | Ga0495606_0001396 | Ga0495606_0001396_14671_15873 | 400 |
| 758 | 3300046511 | Ga0495608_0008509 | Ga0495608_0008509_1403_2605 | 400 |
| 759 | 3300046514 | Ga0495618_0022990 | Ga0495618_0022990_662_1864 | 400 |
| 760 | 3300046529 | Ga0495652_0022716 | Ga0495652_0022716_2695_3897 | 400 |
| 761 | 3300046533 | Ga0495640_0022481 | Ga0495640_0022481_3154_4356 | 400 |
| 762 | 3300046559 | Ga0495667_0051604 | Ga0495667_0051604_347_1549 | 400 |
| 763 | 3300046642 | Ga0495634_0009200 | Ga0495634_0009200_129_1331 | 400 |
| 764 | 3300046663 | Ga0495635_0001667 | Ga0495635_0001667_259_1461 | 400 |
| 765 | 3300046678 | Ga0495599_0003132 | Ga0495599_0003132_141_1343 | 400 |
| 766 | 3300046679 | Ga0495623_0061738 | Ga0495623_0061738_336_1538 | 400 |
| 767 | 3300046680 | Ga0495646_0003463 | Ga0495646_0003463_2300_3502 | 400 |
| 768 | 3300046689 | Ga0495613_0161556 | Ga0495613_0161556_287_1489 | 400 |
| 769 | 3300046809 | Ga0495600_0003617 | Ga0495600_0003617_4456_5658 | 400 |
| 770 | 3300047315 | Ga0495581_0050725 | Ga0495581_0050725_1001_2203 | 400 |
| 771 | 3300047317 | Ga0495604_0058508 | Ga0495604_0058508_216_1418 | 400 |
| 772 | 3300047444 | Ga0495675_0005508 | Ga0495675_0005508_1920_3122 | 400 |
| 773 | 3300047471 | Ga0495684_0019374 | Ga0495684_0019374_3710_4912 | 400 |
| 774 | 3300047472 | Ga0495686_0085531 | Ga0495686_0085531_340_1542 | 400 |
| 775 | 3300047673 | Ga0495593_0049876 | Ga0495593_0049876_890_2092 | 400 |
| 776 | 3300048921 | Ga0496118_0008006 | Ga0496118_0008006_7018_8220 | 400 |
| 777 | 3300048921 | Ga0496118_0051012 | Ga0496118_0051012_1935_3137 | 400 |
| 778 | 3300048924 | Ga0496121_0019408 | Ga0496121_0019408_1142_2344 | 400 |
| 779 | 3300048924 | Ga0496121_0075121 | Ga0496121_0075121_1352_2554 | 400 |
| 780 | 3300048925 | Ga0496122_0124956 | Ga0496122_0124956_370_1572 | 400 |
| 781 | 3300048928 | Ga0496125_0044490 | Ga0496125_0044490_1980_3182 | 400 |
| 782 | 3300048929 | Ga0496126_0024985 | Ga0496126_0024985_1382_2584 | 400 |
| 783 | 3300048929 | Ga0496126_0101367 | Ga0496126_0101367_698_1900 | 400 |
| 784 | 3300048929 | Ga0496126_0150418 | Ga0496126_0150418_414_1616 | 400 |
| 785 | 3300053084 | Ga0495595_0012509 | Ga0495595_0012509_2111_3313 | 400 |
| 786 | 3300053085 | Ga0495619_0004673 | Ga0495619_0004673_6562_7764 | 400 |
| 787 | 3300053105 | Ga0500557_000039 | Ga0500557_000039_54110_55318 | 400 |
| 788 | 3300053130 | Ga0500642_0000402 | Ga0500642_0000402_2604_3812 | 400 |
| 789 | 3300053729 | Ga0500625_025357 | Ga0500625_025357_846_2054 | 400 |
| 790 | 3300053737 | Ga0500601_000497 | Ga0500601_000497_227_1432 | 400 |
| 791 | 3300005336 | Ga0070680_100003306 | Ga0070680_1000033066 | 401 |
| 792 | 3300005339 | Ga0070660_100028023 | Ga0070660_1000280232 | 401 |
| 793 | 3300005455 | Ga0070663_100013979 | Ga0070663_1000139796 | 401 |
| 794 | 3300005458 | Ga0070681_10024650 | Ga0070681_100246505 | 401 |
| 795 | 3300005530 | Ga0070679_100083433 | Ga0070679_1000834332 | 401 |
| 796 | 3300005539 | Ga0068853_100005359 | Ga0068853_1000053593 | 401 |
| 797 | 3300005563 | Ga0068855_100010147 | Ga0068855_1000101477 | 401 |
| 798 | 3300005577 | Ga0068857_100016856 | Ga0068857_1000168561 | 401 |
| 799 | 3300005578 | Ga0068854_100208017 | Ga0068854_1002080172 | 401 |
| 800 | 3300005834 | Ga0068851_10013400 | Ga0068851_100134005 | 401 |
| 801 | 3300006237 | Ga0097621_100154927 | Ga0097621_1001549272 | 401 |
| 802 | 3300009545 | Ga0105237_10011285 | Ga0105237_100112857 | 401 |
| 803 | 3300009551 | Ga0105238_10003129 | Ga0105238_1000312911 | 401 |
| 804 | 3300010375 | Ga0105239_10057505 | Ga0105239_100575053 | 401 |
| 805 | 3300013105 | Ga0157369_10004501 | Ga0157369_1000450110 | 401 |
| 806 | 3300025321 | Ga0207656_10007652 | Ga0207656_100076522 | 401 |
| 807 | 3300025900 | Ga0207710_10015395 | Ga0207710_100153952 | 401 |
| 808 | 3300025915 | Ga0207693_10052790 | Ga0207693_100527903 | 401 |
| 809 | 3300025915 | Ga0207693_10147309 | Ga0207693_101473092 | 401 |
| 810 | 3300025919 | Ga0207657_10027513 | Ga0207657_100275136 | 401 |
| 811 | 3300025921 | Ga0207652_10002138 | Ga0207652_1000213814 | 401 |
| 812 | 3300025924 | Ga0207694_10011328 | Ga0207694_100113285 | 401 |
| 813 | 3300025949 | Ga0207667_10008468 | Ga0207667_100084687 | 401 |
| 814 | 3300025981 | Ga0207640_10180075 | Ga0207640_101800752 | 401 |
| 815 | 3300026041 | Ga0207639_10006576 | Ga0207639_100065765 | 401 |
| 816 | 3300026116 | Ga0207674_10010829 | Ga0207674_100108296 | 401 |
| 817 | 3300031616 | Ga0307508_10000090 | Ga0307508_1000009064 | 401 |
| 818 | 3300031712 | Ga0265342_10023442 | Ga0265342_100234425 | 401 |
| 819 | 3300036401 | Ga0373937_0047524 | Ga0373937_0047524_444_1649 | 401 |
| 820 | 3300037068 | Ga0373925_0213439 | Ga0373925_0213439_16_1221 | 401 |
| 821 | 3300045976 | Ga0466967_0076671 | Ga0466967_0076671_1264_2469 | 401 |
| 822 | 3300046543 | Ga0495645_0005223 | Ga0495645_0005223_7410_8621 | 401 |
| 823 | 3300046690 | Ga0495624_0034081 | Ga0495624_0034081_1591_2796 | 401 |
| 824 | 3300048915 | Ga0496112_0000117 | Ga0496112_0000117_5456_6661 | 401 |
| 825 | 3300048929 | Ga0496126_0006291 | Ga0496126_0006291_9152_10375 | 401 |
| 826 | 3300048929 | Ga0496126_0215300 | Ga0496126_0215300_117_1322 | 401 |
| 827 | 3300005327 | Ga0070658_10072191 | Ga0070658_100721915 | 402 |
| 828 | 3300005435 | Ga0070714_100066675 | Ga0070714_1000666755 | 403 |
| 829 | 3300005439 | Ga0070711_100046362 | Ga0070711_1000463624 | 403 |
| 830 | 3300005530 | Ga0070679_100145486 | Ga0070679_1001454863 | 403 |
| 831 | 3300005614 | Ga0068856_100182707 | Ga0068856_1001827072 | 403 |
| 832 | 3300006163 | Ga0070715_10017382 | Ga0070715_100173823 | 403 |
| 833 | 3300007265 | Ga0099794_10071534 | Ga0099794_100715342 | 403 |
| 834 | 3300025898 | Ga0207692_10001391 | Ga0207692_100013914 | 403 |
| 835 | 3300025905 | Ga0207685_10007010 | Ga0207685_100070103 | 403 |
| 836 | 3300025910 | Ga0207684_10297141 | Ga0207684_102971412 | 403 |
| 837 | 3300025915 | Ga0207693_10001385 | Ga0207693_1000138518 | 403 |
| 838 | 3300025932 | Ga0207690_10053589 | Ga0207690_100535891 | 403 |
| 839 | 3300025939 | Ga0207665_10000064 | Ga0207665_1000006457 | 403 |
| 840 | 3300026078 | Ga0207702_10094222 | Ga0207702_100942224 | 403 |
| 841 | 3300035119 | Ga0373956_0007766 | Ga0373956_0007766_943_2166 | 403 |
| 842 | 3300046459 | Ga0495629_0084676 | Ga0495629_0084676_864_2087 | 403 |
| 843 | 3300046463 | Ga0495653_0017732 | Ga0495653_0017732_3553_4776 | 403 |
| 844 | 3300046477 | Ga0495664_0063178 | Ga0495664_0063178_906_2129 | 403 |
| 845 | 3300046517 | Ga0495630_0048414 | Ga0495630_0048414_1873_3096 | 403 |
| 846 | 3300046524 | Ga0495648_0008834 | Ga0495648_0008834_4149_5369 | 403 |
| 847 | 3300046536 | Ga0495587_0017520 | Ga0495587_0017520_1735_2958 | 403 |
| 848 | 3300046559 | Ga0495667_0010226 | Ga0495667_0010226_3849_5072 | 403 |
| 849 | 3300046663 | Ga0495635_0020215 | Ga0495635_0020215_1862_3085 | 403 |
| 850 | 3300046675 | Ga0495657_0019876 | Ga0495657_0019876_1536_2759 | 403 |
| 851 | 3300046680 | Ga0495646_0019541 | Ga0495646_0019541_1145_2368 | 403 |
| 852 | 3300046809 | Ga0495600_0021223 | Ga0495600_0021223_1015_2238 | 403 |
| 853 | 3300047317 | Ga0495604_0059879 | Ga0495604_0059879_968_2191 | 403 |
| 854 | 3300047319 | Ga0495674_0046793 | Ga0495674_0046793_579_1802 | 403 |
| 855 | 3300047322 | Ga0495680_0035390 | Ga0495680_0035390_1890_3113 | 403 |
| 856 | 3300047444 | Ga0495675_0006895 | Ga0495675_0006895_975_2198 | 403 |
| 857 | 3300048924 | Ga0496121_0001006 | Ga0496121_0001006_24781_26004 | 403 |
| 858 | 3300053078 | Ga0495612_0026418 | Ga0495612_0026418_522_1745 | 403 |
| 859 | 3300053139 | Ga0500568_0011027 | Ga0500568_0011027_1027_2250 | 403 |
| 860 | 3300001979 | JGI24740J21852_10004609 | JGI24740J21852_100046095 | 404 |
| 861 | 3300001990 | JGI24737J22298_10004171 | JGI24737J22298_100041715 | 404 |
| 862 | 3300002067 | JGI24735J21928_10017170 | JGI24735J21928_100171703 | 404 |
| 863 | 3300005455 | Ga0070663_100065901 | Ga0070663_1000659012 | 404 |
| 864 | 3300005455 | Ga0070663_100123558 | Ga0070663_1001235582 | 404 |
| 865 | 3300005563 | Ga0068855_100030135 | Ga0068855_1000301356 | 404 |
| 866 | 3300005577 | Ga0068857_100005632 | Ga0068857_1000056329 | 404 |
| 867 | 3300005577 | Ga0068857_100035005 | Ga0068857_1000350055 | 404 |
| 868 | 3300005578 | Ga0068854_100006637 | Ga0068854_1000066376 | 404 |
| 869 | 3300005578 | Ga0068854_100040636 | Ga0068854_1000406363 | 404 |
| 870 | 3300005614 | Ga0068856_100010147 | Ga0068856_10001014712 | 404 |
| 871 | 3300005614 | Ga0068856_100095543 | Ga0068856_1000955432 | 404 |
| 872 | 3300005614 | Ga0068856_100349561 | Ga0068856_1003495611 | 404 |
| 873 | 3300005616 | Ga0068852_100091883 | Ga0068852_1000918833 | 404 |
| 874 | 3300005616 | Ga0068852_100185724 | Ga0068852_1001857241 | 404 |
| 875 | 3300005618 | Ga0068864_100071692 | Ga0068864_1000716922 | 404 |
| 876 | 3300005834 | Ga0068851_10003044 | Ga0068851_100030446 | 404 |
| 877 | 3300009093 | Ga0105240_10015146 | Ga0105240_100151467 | 404 |
| 878 | 3300009093 | Ga0105240_10018856 | Ga0105240_100188566 | 404 |
| 879 | 3300009174 | Ga0105241_10001933 | Ga0105241_100019338 | 404 |
| 880 | 3300009174 | Ga0105241_10132916 | Ga0105241_101329161 | 404 |
| 881 | 3300009545 | Ga0105237_10148452 | Ga0105237_101484522 | 404 |
| 882 | 3300009551 | Ga0105238_10014347 | Ga0105238_100143473 | 404 |
| 883 | 3300009551 | Ga0105238_10051440 | Ga0105238_100514403 | 404 |
| 884 | 3300010375 | Ga0105239_10011530 | Ga0105239_100115305 | 404 |
| 885 | 3300010375 | Ga0105239_10027114 | Ga0105239_100271144 | 404 |
| 886 | 3300011119 | Ga0105246_10025068 | Ga0105246_100250682 | 404 |
| 887 | 3300014325 | Ga0163163_10070466 | Ga0163163_100704662 | 404 |
| 888 | 3300025321 | Ga0207656_10035242 | Ga0207656_100352422 | 404 |
| 889 | 3300025904 | Ga0207647_10004390 | Ga0207647_100043903 | 404 |
| 890 | 3300025913 | Ga0207695_10008678 | Ga0207695_100086788 | 404 |
| 891 | 3300025913 | Ga0207695_10104394 | Ga0207695_101043943 | 404 |
| 892 | 3300025914 | Ga0207671_10122721 | Ga0207671_101227213 | 404 |
| 893 | 3300025924 | Ga0207694_10000131 | Ga0207694_1000013149 | 404 |
| 894 | 3300025924 | Ga0207694_10016553 | Ga0207694_100165533 | 404 |
| 895 | 3300025949 | Ga0207667_10035714 | Ga0207667_100357146 | 404 |
| 896 | 3300025949 | Ga0207667_10071881 | Ga0207667_100718813 | 404 |
| 897 | 3300025981 | Ga0207640_10054622 | Ga0207640_100546222 | 404 |
| 898 | 3300026041 | Ga0207639_10009936 | Ga0207639_100099364 | 404 |
| 899 | 3300026041 | Ga0207639_10011227 | Ga0207639_100112276 | 404 |
| 900 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005373 | 404 |
| 901 | 3300026078 | Ga0207702_10069553 | Ga0207702_100695533 | 404 |
| 902 | 3300026078 | Ga0207702_10155325 | Ga0207702_101553252 | 404 |
| 903 | 3300026095 | Ga0207676_10153813 | Ga0207676_101538132 | 404 |
| 904 | 3300026116 | Ga0207674_10003851 | Ga0207674_1000385112 | 404 |
| 905 | 3300026116 | Ga0207674_10006041 | Ga0207674_1000604110 | 404 |
| 906 | 3300026142 | Ga0207698_10081284 | Ga0207698_100812843 | 404 |
| 907 | 3300048904 | Ga0496101_0057026 | Ga0496101_0057026_1163_2392 | 404 |
| 908 | 3300048907 | Ga0496104_0034118 | Ga0496104_0034118_1600_2829 | 404 |
| 909 | 3300048912 | Ga0496109_0083534 | Ga0496109_0083534_739_1968 | 404 |
| 910 | 3300048913 | Ga0496110_0043164 | Ga0496110_0043164_269_1498 | 404 |
| 911 | 3300048915 | Ga0496112_0002573 | Ga0496112_0002573_9715_10944 | 404 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qru-assembly1.cif.gz_G | structure of bacillus pseudofirmus mrp antiporter complex, monomer | 0.704 | 279 | 389 |
| 6w8o-assembly1.cif.gz_B | structure of an apo membrane protein | 0.6057 | 23 | 392 |
| 7qru-assembly1.cif.gz_G | structure of bacillus pseudofirmus mrp antiporter complex, monomer | 0.5862 | 279 | 389 |
| 6w8p-assembly1.cif.gz_B | structure of membrane protein with ions | 0.5717 | 23 | 392 |
| 6z16-assembly1.cif.gz_g | structure of the mrp antiporter complex | 0.5677 | 288 | 389 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2H9_13_94_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7226 | 289 | 360 | 1.10.287.3510 |
| af_Q2G2H9_13_94_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6391 | 289 | 360 | 1.10.287.3510 |
| af_Q1ZXE9_716_918_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.5124 | 204 | 389 | 1.20.1410.10 |
| af_A0A2R8QGP7_1291_1477_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.4855 | 203 | 385 | 1.20.1410.10 |
| af_Q1ZXE9_716_918_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.4723 | 204 | 389 | 1.20.1410.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L6QCQ8-F1-model_v4 | Low temperature requirement protein A | 0.975 | 25 | 387 |
GO:0016020
|
| AF-A0A4Q7X3A4-F1-model_v4 | deleted | 0.9746 | 9 | 387 |
|
| AF-A0A5F0FC24-F1-model_v4 | deleted | 0.9693 | 10 | 389 |
|
| AF-A0A537NR88-F1-model_v4 | Low temperature requirement protein A | 0.9683 | 12 | 342 |
GO:0016020
|
| AF-A9HN09-F1-model_v4 | Putative low temperature requirement A protein (LtrA) | 0.9683 | 22 | 387 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar