F485503

General Info

Members Datasets Scaffolds Average Seq Length
912 246 1824 173

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100108677|Ga0068852_1001086773
Length 194
Sequence LSTLDGSLIRKGRGLRGSRYSRAMADQPTSGEYRSGHDPRTLRDALGCFATGVTVVTCLGPDGAPAGLTVNSFTSVSLDPPLLLVCLNRRAASTERLVAASCFAVNVLQTGQQPASIRFSTRDEDRFGTTAWDCGEAGAPILKDSLGVFECERFAVHEGGDHHILIGRVVKASFDAGVDPLLYFRGRYRRLHFD

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
197 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
198 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
199 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 3.73
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 2.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100108677 3300005616 Bacteria 2517
2 JGI24741J21665_1018096 3300001915 Bacteria 1129
3 JGI24741J21665_1042194 3300001915 Bacteria 673
4 JGI24747J21853_1000392 3300001978 Bacteria 2628
5 JGI24740J21852_10001623 3300001979 Bacteria 10352
6 JGI24740J21852_10026506 3300001979 Bacteria 1941
7 JGI24739J22299_10000129 3300001989 Bacteria 23885
8 JGI24739J22299_10013768 3300001989 Bacteria 2948
9 JGI24739J22299_10052089 3300001989 Bacteria 1317
10 JGI24737J22298_10000508 3300001990 Bacteria 13588
11 JGI24737J22298_10000636 3300001990 Bacteria 12348
12 JGI24737J22298_10006081 3300001990 Bacteria 4137
13 JGI24737J22298_10034951 3300001990 Bacteria 1556
14 JGI24735J21928_10004510 3300002067 Bacteria 4683
15 JGI24735J21928_10041653 3300002067 Bacteria 1338
16 JGI24735J21928_10076229 3300002067 Bacteria 960
17 JGI24738J21930_10000498 3300002075 Bacteria 11174
18 JGI24744J21845_10002115 3300002077 Bacteria 4028
19 JGI24034J26672_10081233 3300002239 Bacteria 592
20 Ga0065715_10124632 3300005293 Bacteria 2139
21 Ga0070658_10025214 3300005327 Bacteria 4766
22 Ga0070658_10042953 3300005327 Bacteria 3652
23 Ga0070658_10073411 3300005327 Bacteria 2805
24 Ga0070658_10081016 3300005327 Bacteria 2666
25 Ga0070658_10198681 3300005327 Bacteria 1691
26 Ga0070658_10218751 3300005327 Bacteria 1610
27 Ga0070658_10228184 3300005327 Bacteria 1576
28 Ga0070658_10438609 3300005327 Bacteria 1124
29 Ga0070658_10929154 3300005327 Bacteria 756
30 Ga0070658_10938361 3300005327 Unclassified 752
31 Ga0070658_11131244 3300005327 Bacteria 681
32 Ga0070676_10004537 3300005328 Bacteria 7315
33 Ga0070676_10020873 3300005328 Bacteria 3662
34 Ga0070676_10117425 3300005328 Bacteria 1665
35 Ga0070676_10133310 3300005328 Bacteria 1573
36 Ga0070676_10875435 3300005328 Bacteria 667
37 Ga0070683_100418367 3300005329 Bacteria 1278
38 Ga0070683_100725382 3300005329 Bacteria 952
39 Ga0070683_101069601 3300005329 Bacteria 775
40 Ga0070690_100082797 3300005330 Bacteria 2101
41 Ga0070670_100000265 3300005331 Bacteria 46560
42 Ga0070670_100017868 3300005331 Bacteria 6087
43 Ga0070670_100034147 3300005331 Bacteria 4378
44 Ga0070670_100039600 3300005331 Bacteria 4052
45 Ga0070670_100075181 3300005331 Bacteria 2902
46 Ga0070670_100219788 3300005331 Bacteria 1653
47 Ga0070670_100676531 3300005331 Bacteria 927
48 Ga0070670_100842299 3300005331 Bacteria 829
49 Ga0070677_10028550 3300005333 Bacteria 2109
50 Ga0070677_10290408 3300005333 Bacteria 827
51 Ga0068869_100003385 3300005334 Bacteria 9734
52 Ga0068869_100258884 3300005334 Bacteria 1392
53 Ga0068869_100554851 3300005334 Bacteria 965
54 Ga0070666_10000924 3300005335 Bacteria 17819
55 Ga0070666_10092143 3300005335 Bacteria 2083
56 Ga0070680_100026458 3300005336 Bacteria 4640
57 Ga0070680_100123460 3300005336 Bacteria 2163
58 Ga0070680_100201786 3300005336 Bacteria 1677
59 Ga0070682_100060208 3300005337 Bacteria 2401
60 Ga0068868_100000156 3300005338 Bacteria 44526
61 Ga0068868_100124585 3300005338 Bacteria 2104
62 Ga0068868_100134726 3300005338 Bacteria 2024
63 Ga0068868_100852235 3300005338 Bacteria 825
64 Ga0070660_100016352 3300005339 Bacteria 5384
65 Ga0070660_100027899 3300005339 Bacteria 4219
66 Ga0070660_100029535 3300005339 Bacteria 4109
67 Ga0070660_100030821 3300005339 Bacteria 4024
68 Ga0070660_100031364 3300005339 Bacteria 3991
69 Ga0070660_100083565 3300005339 Bacteria 2508
70 Ga0070660_100091342 3300005339 Bacteria 2401
71 Ga0070660_100127699 3300005339 Bacteria 2032
72 Ga0070660_100526927 3300005339 Bacteria 984
73 Ga0070689_100089758 3300005340 Bacteria 2421
74 Ga0070691_10109023 3300005341 Bacteria 1383
75 Ga0070687_100354621 3300005343 Bacteria 948
76 Ga0070661_100010414 3300005344 Bacteria 6464
77 Ga0070661_100018709 3300005344 Bacteria 4929
78 Ga0070661_100028137 3300005344 Bacteria 4053
79 Ga0070661_100357259 3300005344 Bacteria 1147
80 Ga0070661_100455658 3300005344 Bacteria 1018
81 Ga0070661_100477489 3300005344 Bacteria 995
82 Ga0070661_100609285 3300005344 Bacteria 883
83 Ga0070661_100642862 3300005344 Bacteria 861
84 Ga0070692_10004520 3300005345 Bacteria 5820
85 Ga0070692_10127662 3300005345 Bacteria 1426
86 Ga0070692_10886626 3300005345 Bacteria 616
87 Ga0070668_100028773 3300005347 Bacteria 4216
88 Ga0070668_100029497 3300005347 Bacteria 4167
89 Ga0070668_100058464 3300005347 Bacteria 2983
90 Ga0070668_100152987 3300005347 Bacteria 1867
91 Ga0070668_100919778 3300005347 Bacteria 783
92 Ga0070669_100000383 3300005353 Bacteria 33931
93 Ga0070669_100044111 3300005353 Bacteria 3249
94 Ga0070669_100119641 3300005353 Bacteria 2007
95 Ga0070669_100888360 3300005353 Bacteria 761
96 Ga0070675_100042178 3300005354 Bacteria 3728
97 Ga0070675_100055114 3300005354 Bacteria 3272
98 Ga0070675_100090426 3300005354 Bacteria 2564
99 Ga0070675_100235664 3300005354 Bacteria 1598
100 Ga0070671_100010697 3300005355 Bacteria 7367
101 Ga0070671_100020843 3300005355 Bacteria 5347
102 Ga0070671_100032493 3300005355 Bacteria 4314
103 Ga0070674_100016253 3300005356 Bacteria 4663
104 Ga0070674_100018093 3300005356 Bacteria 4447
105 Ga0070674_100065003 3300005356 Bacteria 2559
106 Ga0070674_100092337 3300005356 Bacteria 2188
107 Ga0070674_100665740 3300005356 Unclassified 886
108 Ga0070673_100000249 3300005364 Bacteria 27281
109 Ga0070673_100004608 3300005364 Bacteria 8741
110 Ga0070673_100021148 3300005364 Bacteria 4709
111 Ga0070673_100024724 3300005364 Bacteria 4408
112 Ga0070673_100068453 3300005364 Bacteria 2842
113 Ga0070673_100398386 3300005364 Bacteria 1230
114 Ga0070673_101544529 3300005364 Bacteria 626
115 Ga0070659_100000814 3300005366 Bacteria 22773
116 Ga0070659_100017184 3300005366 Bacteria 5438
117 Ga0070659_100024681 3300005366 Bacteria 4610
118 Ga0070659_100052357 3300005366 Bacteria 3210
119 Ga0070659_100127757 3300005366 Bacteria 2063
120 Ga0070659_100144685 3300005366 Bacteria 1936
121 Ga0070659_100209712 3300005366 Bacteria 1605
122 Ga0070659_100218172 3300005366 Bacteria 1573
123 Ga0070659_100221935 3300005366 Bacteria 1560
124 Ga0070659_100302855 3300005366 Bacteria 1333
125 Ga0070659_100332225 3300005366 Bacteria 1272
126 Ga0070659_100364523 3300005366 Bacteria 1215
127 Ga0070659_100669561 3300005366 Bacteria 896
128 Ga0070659_100980607 3300005366 Bacteria 741
129 Ga0070659_101154869 3300005366 Bacteria 684
130 Ga0070667_100007007 3300005367 Bacteria 9371
131 Ga0070667_100010406 3300005367 Bacteria 7677
132 Ga0070667_100168331 3300005367 Bacteria 1933
133 Ga0070667_100365501 3300005367 Bacteria 1308
134 Ga0070667_100545060 3300005367 Bacteria 1066
135 Ga0070714_100145389 3300005435 Bacteria 2132
136 Ga0070714_100349129 3300005435 Bacteria 1389
137 Ga0070714_100393588 3300005435 Bacteria 1308
138 Ga0070713_100398399 3300005436 Bacteria 1285
139 Ga0070713_100600628 3300005436 Bacteria 1045
140 Ga0070694_100016869 3300005444 Bacteria 4605
141 Ga0070663_100002083 3300005455 Bacteria 11184
142 Ga0070663_100032144 3300005455 Bacteria 3614
143 Ga0070663_100032499 3300005455 Bacteria 3597
144 Ga0070663_100061544 3300005455 Bacteria 2703
145 Ga0070663_100069080 3300005455 Bacteria 2566
146 Ga0070663_100145098 3300005455 Bacteria 1815
147 Ga0070663_100164241 3300005455 Bacteria 1711
148 Ga0070663_100253437 3300005455 Bacteria 1394
149 Ga0070663_100435802 3300005455 Bacteria 1077
150 Ga0070663_100456965 3300005455 Bacteria 1054
151 Ga0070663_100568864 3300005455 Bacteria 949
152 Ga0070663_100653226 3300005455 Bacteria 890
153 Ga0070663_100914447 3300005455 Bacteria 759
154 Ga0070678_100007228 3300005456 Bacteria 6572
155 Ga0070678_100077952 3300005456 Bacteria 2501
156 Ga0070678_100198329 3300005456 Bacteria 1655
157 Ga0070678_101590418 3300005456 Bacteria 613
158 Ga0070662_100001575 3300005457 Bacteria 14101
159 Ga0070662_100060782 3300005457 Bacteria 2756
160 Ga0070662_100227529 3300005457 Bacteria 1490
161 Ga0070662_100280581 3300005457 Bacteria 1348
162 Ga0070662_100369270 3300005457 Bacteria 1179
163 Ga0070662_100441637 3300005457 Bacteria 1079
164 Ga0070662_100566806 3300005457 Bacteria 953
165 Ga0070662_100912126 3300005457 Bacteria 750
166 Ga0070662_101167015 3300005457 Bacteria 661
167 Ga0070681_10107104 3300005458 Bacteria 2736
168 Ga0068867_100000388 3300005459 Bacteria 29345
169 Ga0068867_100004529 3300005459 Bacteria 9772
170 Ga0068867_100006303 3300005459 Bacteria 8394
171 Ga0068867_100015970 3300005459 Bacteria 5330
172 Ga0068867_100083443 3300005459 Bacteria 2412
173 Ga0068867_100612208 3300005459 Unclassified 951
174 Ga0068867_101041046 3300005459 Bacteria 744
175 Ga0070685_10227267 3300005466 Unclassified 1225
176 Ga0070679_100077766 3300005530 Bacteria 3307
177 Ga0070679_100490571 3300005530 Bacteria 1173
178 Ga0070679_100606942 3300005530 Bacteria 1037
179 Ga0070684_100041516 3300005535 Bacteria 3967
180 Ga0068853_100001793 3300005539 Bacteria 15788
181 Ga0068853_100009785 3300005539 Bacteria 7738
182 Ga0068853_100030051 3300005539 Bacteria 4587
183 Ga0068853_100145368 3300005539 Bacteria 2131
184 Ga0068853_100170665 3300005539 Bacteria 1968
185 Ga0068853_100175880 3300005539 Bacteria 1939
186 Ga0068853_100499546 3300005539 Bacteria 1148
187 Ga0068853_100765923 3300005539 Bacteria 923
188 Ga0068853_100772395 3300005539 Bacteria 919
189 Ga0068853_101097778 3300005539 Bacteria 767
190 Ga0068853_101130904 3300005539 Bacteria 755
191 Ga0068853_101265277 3300005539 Bacteria 713
192 Ga0070672_100031464 3300005543 Bacteria 3994
193 Ga0070672_100053454 3300005543 Bacteria 3157
194 Ga0070672_100114660 3300005543 Bacteria 2200
195 Ga0070672_100124720 3300005543 Bacteria 2111
196 Ga0070672_100174113 3300005543 Bacteria 1791
197 Ga0070672_100704061 3300005543 Bacteria 884
198 Ga0070672_100726290 3300005543 Bacteria 871
199 Ga0070695_100018451 3300005545 Bacteria 4237
200 Ga0070696_100003105 3300005546 Bacteria 11047
201 Ga0070693_100067549 3300005547 Bacteria 2096
202 Ga0070693_100141908 3300005547 Bacteria 1513
203 Ga0070693_100296052 3300005547 Bacteria 1089
204 Ga0070693_100318892 3300005547 Bacteria 1054
205 Ga0070665_100001571 3300005548 Bacteria 26343
206 Ga0070665_100011777 3300005548 Bacteria 8833
207 Ga0070665_100108477 3300005548 Bacteria 2778
208 Ga0070665_100314722 3300005548 Bacteria 1569
209 Ga0070704_100730089 3300005549 Bacteria 880
210 Ga0068855_100009002 3300005563 Bacteria 12062
211 Ga0068855_100033640 3300005563 Bacteria 6116
212 Ga0068855_100101268 3300005563 Bacteria 3316
213 Ga0068855_100192516 3300005563 Bacteria 2299
214 Ga0068855_100220814 3300005563 Bacteria 2125
215 Ga0068855_100546308 3300005563 Bacteria 1254
216 Ga0068855_100617225 3300005563 Bacteria 1168
217 Ga0068855_101166313 3300005563 Bacteria 802
218 Ga0068855_101394207 3300005563 Bacteria 722
219 Ga0070664_100006002 3300005564 Bacteria 9819
220 Ga0070664_100006949 3300005564 Bacteria 9121
221 Ga0070664_100021834 3300005564 Bacteria 5277
222 Ga0070664_100023925 3300005564 Bacteria 5048
223 Ga0070664_100061228 3300005564 Bacteria 3207
224 Ga0070664_100095713 3300005564 Bacteria 2575
225 Ga0070664_100110483 3300005564 Bacteria 2399
226 Ga0070664_100147732 3300005564 Bacteria 2074
227 Ga0070664_100191241 3300005564 Bacteria 1823
228 Ga0070664_100346507 3300005564 Bacteria 1350
229 Ga0070664_100514873 3300005564 Bacteria 1104
230 Ga0070664_100660736 3300005564 Bacteria 972
231 Ga0070664_101008198 3300005564 Bacteria 783
232 Ga0068857_100000282 3300005577 Bacteria 34844
233 Ga0068857_100004159 3300005577 Bacteria 12192
234 Ga0068857_100073004 3300005577 Bacteria 3057
235 Ga0068857_100087152 3300005577 Bacteria 2792
236 Ga0068857_100130912 3300005577 Bacteria 2263
237 Ga0068854_100001188 3300005578 Bacteria 15628
238 Ga0068854_100030599 3300005578 Bacteria 3735
239 Ga0068854_100217156 3300005578 Bacteria 1511
240 Ga0068854_100241935 3300005578 Bacteria 1437
241 Ga0068854_100274039 3300005578 Bacteria 1356
242 Ga0068854_100434875 3300005578 Bacteria 1093
243 Ga0068854_100484774 3300005578 Bacteria 1039
244 Ga0068854_100693022 3300005578 Bacteria 878
245 Ga0068856_100050036 3300005614 Bacteria 4119
246 Ga0068856_100054602 3300005614 Bacteria 3941
247 Ga0068856_100667595 3300005614 Bacteria 1060
248 Ga0068856_100735128 3300005614 Bacteria 1007
249 Ga0068856_101364865 3300005614 Bacteria 723
250 Ga0068852_100004611 3300005616 Bacteria 9764
251 Ga0068852_100008341 3300005616 Bacteria 7630
252 Ga0068852_100019947 3300005616 Bacteria 5321
253 Ga0068852_100045475 3300005616 Bacteria 3734
254 Ga0068852_100057707 3300005616 Bacteria 3360
255 Ga0068852_100110187 3300005616 Bacteria 2501
256 Ga0068852_100173214 3300005616 Bacteria 2024
257 Ga0068852_100182577 3300005616 Bacteria 1974
258 Ga0068852_100425503 3300005616 Bacteria 1310
259 Ga0068852_100437566 3300005616 Bacteria 1292
260 Ga0068852_101151501 3300005616 Bacteria 796
261 Ga0068859_100007893 3300005617 Bacteria 10798
262 Ga0068859_100083956 3300005617 Bacteria 3229
263 Ga0068859_100085907 3300005617 Bacteria 3192
264 Ga0068859_100605266 3300005617 Bacteria 1189
265 Ga0068864_100001720 3300005618 Bacteria 17993
266 Ga0068864_100006305 3300005618 Bacteria 9731
267 Ga0068864_100017017 3300005618 Bacteria 6059
268 Ga0068864_100089301 3300005618 Bacteria 2715
269 Ga0068866_10397393 3300005718 Bacteria 888
270 Ga0068861_100496894 3300005719 Bacteria 1102
271 Ga0068851_10001252 3300005834 Bacteria 11059
272 Ga0068851_10004999 3300005834 Bacteria 6006
273 Ga0068851_10103223 3300005834 Bacteria 1514
274 Ga0068851_10159907 3300005834 Bacteria 1237
275 Ga0068851_10307523 3300005834 Bacteria 913
276 Ga0068870_10530464 3300005840 Bacteria 789
277 Ga0068863_100000921 3300005841 Bacteria 29492
278 Ga0068863_100018083 3300005841 Bacteria 6750
279 Ga0068863_100049239 3300005841 Bacteria 3995
280 Ga0068863_100061552 3300005841 Bacteria 3549
281 Ga0068863_100129424 3300005841 Bacteria 2409
282 Ga0068863_100129576 3300005841 Bacteria 2408
283 Ga0068863_100431650 3300005841 Bacteria 1291
284 Ga0068858_100002927 3300005842 Bacteria 17178
285 Ga0068858_100005521 3300005842 Bacteria 12381
286 Ga0068858_100025505 3300005842 Bacteria 5500
287 Ga0068858_100674792 3300005842 Bacteria 1005
288 Ga0068860_100006472 3300005843 Bacteria 11762
289 Ga0068860_100016185 3300005843 Bacteria 7275
290 Ga0068860_100065747 3300005843 Bacteria 3444
291 Ga0068860_100590326 3300005843 Bacteria 1116
292 Ga0068862_100001850 3300005844 Bacteria 19179
293 Ga0068862_100063418 3300005844 Bacteria 3180
294 Ga0068862_100076199 3300005844 Bacteria 2903
295 Ga0068862_100530490 3300005844 Bacteria 1121
296 Ga0070717_10000431 3300006028 Bacteria 26731
297 Ga0070717_10328571 3300006028 Bacteria 1364
298 Ga0070717_10802747 3300006028 Unclassified 856
299 Ga0070712_100333390 3300006175 Bacteria 1237
300 Ga0070712_100449889 3300006175 Bacteria 1072
301 Ga0075366_10152968 3300006195 Bacteria 1397
302 Ga0097621_100002177 3300006237 Bacteria 13408
303 Ga0097621_100028359 3300006237 Bacteria 4412
304 Ga0097621_100131364 3300006237 Bacteria 2132
305 Ga0097621_100597743 3300006237 Bacteria 1008
306 Ga0097621_100632052 3300006237 Bacteria 981
307 Ga0068871_100168151 3300006358 Bacteria 1878
308 Ga0068871_100197759 3300006358 Bacteria 1734
309 Ga0068871_100399392 3300006358 Bacteria 1224
310 Ga0075428_100871439 3300006844 Bacteria 956
311 Ga0068865_100004164 3300006881 Bacteria 8703
312 Ga0068865_100362724 3300006881 Bacteria 1177
313 Ga0068865_100395382 3300006881 Bacteria 1131
314 Ga0068865_100417451 3300006881 Bacteria 1102
315 Ga0097620_100007893 3300006931 Bacteria 10798
316 Ga0097620_100083957 3300006931 Bacteria 3229
317 Ga0097620_100085909 3300006931 Bacteria 3192
318 Ga0097620_100605330 3300006931 Bacteria 1189
319 Ga0075435_100118535 3300007076 Bacteria 2206
320 Ga0105251_10066823 3300009011 Bacteria 1680
321 Ga0105240_10036304 3300009093 Bacteria 6342
322 Ga0105240_10451572 3300009093 Bacteria 1438
323 Ga0105240_10548316 3300009093 Bacteria 1280
324 Ga0111539_10590040 3300009094 Bacteria 1294
325 Ga0111539_10876264 3300009094 Bacteria 1044
326 Ga0105245_10000326 3300009098 Bacteria 44899
327 Ga0114129_12292882 3300009147 Bacteria 648
328 Ga0105243_10160569 3300009148 Bacteria 1937
329 Ga0105243_10412726 3300009148 Bacteria 1257
330 Ga0105243_10625744 3300009148 Bacteria 1040
331 Ga0105243_11649305 3300009148 Bacteria 669
332 Ga0105241_10294645 3300009174 Bacteria 1390
333 Ga0105241_10393790 3300009174 Bacteria 1213
334 Ga0105242_10296106 3300009176 Unclassified 1475
335 Ga0105248_10000159 3300009177 Bacteria 78504
336 Ga0105248_10019678 3300009177 Bacteria 7471
337 Ga0105248_10079959 3300009177 Bacteria 3674
338 Ga0105248_10094714 3300009177 Bacteria 3362
339 Ga0105248_10124189 3300009177 Bacteria 2911
340 Ga0105248_10433312 3300009177 Bacteria 1481
341 Ga0105237_10052857 3300009545 Bacteria 4076
342 Ga0105238_10066235 3300009551 Bacteria 3614
343 Ga0105238_10067163 3300009551 Bacteria 3587
344 Ga0105238_10110657 3300009551 Bacteria 2727
345 Ga0105238_10770889 3300009551 Bacteria 976
346 Ga0105238_11309626 3300009551 Bacteria 750
347 Ga0105249_10117892 3300009553 Bacteria 2518
348 Ga0105239_10106348 3300010375 Bacteria 3108
349 Ga0105246_10057871 3300011119 Bacteria 2684
350 Ga0105246_10387926 3300011119 Bacteria 1156
351 Ga0157373_10010771 3300013100 Bacteria 6729
352 Ga0157373_10037548 3300013100 Bacteria 3472
353 Ga0157373_10132577 3300013100 Bacteria 1752
354 Ga0157373_10181121 3300013100 Bacteria 1483
355 Ga0157373_10274585 3300013100 Bacteria 1194
356 Ga0157373_11175443 3300013100 Bacteria 577
357 Ga0157371_10009903 3300013102 Bacteria 7464
358 Ga0157371_10086012 3300013102 Bacteria 2227
359 Ga0157371_10702307 3300013102 Bacteria 757
360 Ga0157371_11073329 3300013102 Bacteria 617
361 Ga0157371_11188020 3300013102 Bacteria 587
362 Ga0157370_10056182 3300013104 Bacteria 3746
363 Ga0157370_10215314 3300013104 Bacteria 1780
364 Ga0157370_10329853 3300013104 Bacteria 1407
365 Ga0157370_10439513 3300013104 Bacteria 1200
366 Ga0157370_10479413 3300013104 Bacteria 1143
367 Ga0157369_10232269 3300013105 Bacteria 1928
368 Ga0157369_10334891 3300013105 Bacteria 1572
369 Ga0157369_10452212 3300013105 Bacteria 1330
370 Ga0157369_10594547 3300013105 Bacteria 1142
371 Ga0157369_11179659 3300013105 Bacteria 782
372 Ga0157374_10006752 3300013296 Bacteria 9754
373 Ga0157374_10010300 3300013296 Bacteria 8040
374 Ga0157374_10083972 3300013296 Bacteria 3026
375 Ga0157374_10528327 3300013296 Bacteria 1186
376 Ga0157374_11437954 3300013296 Bacteria 712
377 Ga0157378_10001240 3300013297 Bacteria 23084
378 Ga0157378_11151879 3300013297 Bacteria 814
379 Ga0163162_10010361 3300013306 Bacteria 9059
380 Ga0163162_10040095 3300013306 Bacteria 4681
381 Ga0163162_10052998 3300013306 Bacteria 4077
382 Ga0163162_10072920 3300013306 Bacteria 3488
383 Ga0163162_12673251 3300013306 Bacteria 574
384 Ga0157372_10047848 3300013307 Bacteria 4753
385 Ga0157372_10070890 3300013307 Bacteria 3923
386 Ga0157372_10152991 3300013307 Bacteria 2663
387 Ga0157372_10597052 3300013307 Bacteria 1287
388 Ga0157375_10003764 3300013308 Bacteria 13151
389 Ga0157375_10038697 3300013308 Bacteria 4581
390 Ga0157375_10089377 3300013308 Bacteria 3136
391 Ga0157375_10162050 3300013308 Bacteria 2379
392 Ga0157375_10177451 3300013308 Bacteria 2281
393 Ga0157375_10199201 3300013308 Bacteria 2158
394 Ga0157375_10275673 3300013308 Bacteria 1844
395 Ga0157375_12329127 3300013308 Bacteria 639
396 Ga0163163_10006126 3300014325 Bacteria 10476
397 Ga0163163_10027336 3300014325 Bacteria 5464
398 Ga0182008_10024738 3300014497 Bacteria 3054
399 Ga0157377_10365982 3300014745 Bacteria 972
400 Ga0157377_10374285 3300014745 Bacteria 962
401 Ga0157379_10001552 3300014968 Bacteria 18894
402 Ga0157379_10905589 3300014968 Bacteria 837
403 Ga0157376_10210123 3300014969 Bacteria 1796
404 Ga0213876_10041585 3300021384 Bacteria 2428
405 Ga0207697_10000584 3300025315 Bacteria 20797
406 Ga0207656_10009976 3300025321 Bacteria 3540
407 Ga0207656_10044756 3300025321 Bacteria 1891
408 Ga0207656_10065754 3300025321 Bacteria 1601
409 Ga0207656_10095759 3300025321 Bacteria 1354
410 Ga0207682_10050523 3300025893 Bacteria 1719
411 Ga0207682_10083373 3300025893 Bacteria 1374
412 Ga0207642_10038122 3300025899 Bacteria 2077
413 Ga0207688_10001613 3300025901 Bacteria 11897
414 Ga0207688_10078987 3300025901 Bacteria 1876
415 Ga0207688_10126230 3300025901 Bacteria 1496
416 Ga0207688_10185353 3300025901 Bacteria 1243
417 Ga0207688_10189821 3300025901 Bacteria 1228
418 Ga0207688_10242316 3300025901 Bacteria 1090
419 Ga0207680_10012122 3300025903 Bacteria 4382
420 Ga0207680_10016735 3300025903 Bacteria 3857
421 Ga0207680_10402327 3300025903 Bacteria 967
422 Ga0207647_10004783 3300025904 Bacteria 10025
423 Ga0207647_10007590 3300025904 Bacteria 7816
424 Ga0207647_10015821 3300025904 Bacteria 5163
425 Ga0207647_10019902 3300025904 Bacteria 4506
426 Ga0207647_10060159 3300025904 Bacteria 2322
427 Ga0207647_10141912 3300025904 Bacteria 1408
428 Ga0207645_10002907 3300025907 Bacteria 13235
429 Ga0207645_10008056 3300025907 Bacteria 7391
430 Ga0207645_10048314 3300025907 Bacteria 2717
431 Ga0207643_10188928 3300025908 Bacteria 1250
432 Ga0207643_10365832 3300025908 Bacteria 907
433 Ga0207705_10005540 3300025909 Bacteria 9438
434 Ga0207705_10013056 3300025909 Bacteria 5994
435 Ga0207705_10030335 3300025909 Bacteria 3858
436 Ga0207705_10076052 3300025909 Bacteria 2440
437 Ga0207705_10114485 3300025909 Bacteria 1995
438 Ga0207705_10173290 3300025909 Bacteria 1625
439 Ga0207705_10173533 3300025909 Bacteria 1624
440 Ga0207705_10189815 3300025909 Bacteria 1553
441 Ga0207705_10222431 3300025909 Bacteria 1434
442 Ga0207705_10390762 3300025909 Bacteria 1075
443 Ga0207705_10531341 3300025909 Bacteria 914
444 Ga0207705_10884519 3300025909 Bacteria 692
445 Ga0207707_10201937 3300025912 Bacteria 1733
446 Ga0207695_10181451 3300025913 Bacteria 2026
447 Ga0207695_10274505 3300025913 Bacteria 1581
448 Ga0207671_10108668 3300025914 Bacteria 2108
449 Ga0207693_10200036 3300025915 Bacteria 1571
450 Ga0207660_10097870 3300025917 Bacteria 2187
451 Ga0207660_10222963 3300025917 Bacteria 1480
452 Ga0207662_10442702 3300025918 Bacteria 887
453 Ga0207657_10001905 3300025919 Bacteria 22543
454 Ga0207657_10009589 3300025919 Bacteria 9718
455 Ga0207657_10015222 3300025919 Bacteria 7460
456 Ga0207657_10021301 3300025919 Bacteria 6104
457 Ga0207657_10023085 3300025919 Bacteria 5801
458 Ga0207657_10039085 3300025919 Bacteria 4219
459 Ga0207657_10072869 3300025919 Bacteria 2904
460 Ga0207657_10081502 3300025919 Bacteria 2718
461 Ga0207657_10136452 3300025919 Bacteria 2007
462 Ga0207657_10185047 3300025919 Bacteria 1682
463 Ga0207657_10252585 3300025919 Bacteria 1405
464 Ga0207657_10507482 3300025919 Bacteria 944
465 Ga0207649_10003504 3300025920 Bacteria 8577
466 Ga0207649_10055020 3300025920 Bacteria 2479
467 Ga0207649_10195772 3300025920 Bacteria 1424
468 Ga0207649_10291814 3300025920 Bacteria 1189
469 Ga0207649_10347103 3300025920 Bacteria 1097
470 Ga0207649_10391876 3300025920 Bacteria 1037
471 Ga0207649_10456321 3300025920 Bacteria 965
472 Ga0207649_10820366 3300025920 Bacteria 727
473 Ga0207652_10115121 3300025921 Bacteria 2388
474 Ga0207652_10138675 3300025921 Bacteria 2173
475 Ga0207652_10158021 3300025921 Bacteria 2031
476 Ga0207652_10506427 3300025921 Bacteria 1087
477 Ga0207681_10004527 3300025923 Bacteria 8560
478 Ga0207681_10031116 3300025923 Bacteria 3482
479 Ga0207681_10037134 3300025923 Bacteria 3218
480 Ga0207681_10981771 3300025923 Bacteria 708
481 Ga0207681_11007653 3300025923 Bacteria 699
482 Ga0207694_10182472 3300025924 Bacteria 1702
483 Ga0207694_11474742 3300025924 Bacteria 574
484 Ga0207650_10001366 3300025925 Bacteria 17614
485 Ga0207650_10005054 3300025925 Bacteria 8999
486 Ga0207650_10045686 3300025925 Bacteria 3222
487 Ga0207650_10121910 3300025925 Bacteria 2031
488 Ga0207650_10157225 3300025925 Bacteria 1798
489 Ga0207650_10236759 3300025925 Bacteria 1474
490 Ga0207659_10028082 3300025926 Bacteria 3819
491 Ga0207659_10078273 3300025926 Unclassified 2436
492 Ga0207659_10087276 3300025926 Bacteria 2322
493 Ga0207659_10119070 3300025926 Bacteria 2021
494 Ga0207687_10002526 3300025927 Bacteria 12416
495 Ga0207700_10031397 3300025928 Bacteria 3773
496 Ga0207700_10288227 3300025928 Unclassified 1414
497 Ga0207700_10412092 3300025928 Bacteria 1185
498 Ga0207664_10070285 3300025929 Bacteria 2817
499 Ga0207664_10331926 3300025929 Unclassified 1343
500 Ga0207644_10002867 3300025931 Bacteria 11114
501 Ga0207644_10004200 3300025931 Bacteria 9349
502 Ga0207644_10053657 3300025931 Bacteria 2901
503 Ga0207644_10258304 3300025931 Bacteria 1392
504 Ga0207690_10003550 3300025932 Bacteria 9290
505 Ga0207690_10004102 3300025932 Bacteria 8603
506 Ga0207690_10010279 3300025932 Bacteria 5557
507 Ga0207690_10021213 3300025932 Bacteria 4025
508 Ga0207690_10026080 3300025932 Bacteria 3678
509 Ga0207690_10030983 3300025932 Bacteria 3418
510 Ga0207690_10044666 3300025932 Bacteria 2922
511 Ga0207690_10060269 3300025932 Bacteria 2575
512 Ga0207690_10115607 3300025932 Bacteria 1939
513 Ga0207690_10151079 3300025932 Bacteria 1722
514 Ga0207690_10249376 3300025932 Bacteria 1371
515 Ga0207690_10311225 3300025932 Bacteria 1235
516 Ga0207690_10473336 3300025932 Bacteria 1010
517 Ga0207690_10480657 3300025932 Bacteria 1002
518 Ga0207690_10520974 3300025932 Bacteria 964
519 Ga0207690_10829917 3300025932 Bacteria 765
520 Ga0207706_10006260 3300025933 Bacteria 11065
521 Ga0207706_10007443 3300025933 Bacteria 10126
522 Ga0207706_10007464 3300025933 Bacteria 10112
523 Ga0207706_10076012 3300025933 Bacteria 2954
524 Ga0207706_10077169 3300025933 Bacteria 2930
525 Ga0207706_10096226 3300025933 Bacteria 2604
526 Ga0207706_10150506 3300025933 Bacteria 2046
527 Ga0207706_10152520 3300025933 Bacteria 2032
528 Ga0207706_10290233 3300025933 Bacteria 1426
529 Ga0207706_10293092 3300025933 Bacteria 1418
530 Ga0207706_10402337 3300025933 Bacteria 1187
531 Ga0207706_10707616 3300025933 Bacteria 860
532 Ga0207709_10115884 3300025935 Bacteria 1800
533 Ga0207670_10039769 3300025936 Bacteria 3082
534 Ga0207669_10047755 3300025937 Bacteria 2538
535 Ga0207669_10206070 3300025937 Bacteria 1431
536 Ga0207669_10657900 3300025937 Bacteria 857
537 Ga0207704_10009476 3300025938 Bacteria 4700
538 Ga0207665_10248489 3300025939 Bacteria 1313
539 Ga0207691_10002930 3300025940 Bacteria 16651
540 Ga0207691_10010969 3300025940 Bacteria 8695
541 Ga0207691_10119662 3300025940 Bacteria 2335
542 Ga0207691_10122686 3300025940 Bacteria 2301
543 Ga0207691_10190258 3300025940 Bacteria 1790
544 Ga0207691_10237986 3300025940 Bacteria 1575
545 Ga0207691_10813514 3300025940 Bacteria 785
546 Ga0207711_10002836 3300025941 Bacteria 15230
547 Ga0207711_10021290 3300025941 Bacteria 5416
548 Ga0207711_10048209 3300025941 Bacteria 3645
549 Ga0207711_10054577 3300025941 Bacteria 3430
550 Ga0207711_10119323 3300025941 Bacteria 2353
551 Ga0207711_10707641 3300025941 Bacteria 939
552 Ga0207689_10000092 3300025942 Bacteria 73254
553 Ga0207689_10118265 3300025942 Bacteria 2179
554 Ga0207689_10173953 3300025942 Bacteria 1775
555 Ga0207689_10389844 3300025942 Bacteria 1160
556 Ga0207661_10181647 3300025944 Bacteria 1838
557 Ga0207661_10230209 3300025944 Bacteria 1641
558 Ga0207661_10728043 3300025944 Bacteria 913
559 Ga0207679_10008397 3300025945 Bacteria 6578
560 Ga0207679_10083449 3300025945 Unclassified 2449
561 Ga0207679_10128884 3300025945 Bacteria 2026
562 Ga0207679_10160315 3300025945 Bacteria 1841
563 Ga0207679_10177253 3300025945 Bacteria 1760
564 Ga0207679_10376646 3300025945 Bacteria 1243
565 Ga0207679_10604325 3300025945 Bacteria 989
566 Ga0207667_10033549 3300025949 Bacteria 5518
567 Ga0207667_10041356 3300025949 Bacteria 4902
568 Ga0207667_10067246 3300025949 Bacteria 3733
569 Ga0207667_10114827 3300025949 Bacteria 2775
570 Ga0207667_10218841 3300025949 Bacteria 1951
571 Ga0207667_10235044 3300025949 Bacteria 1876
572 Ga0207667_10534669 3300025949 Bacteria 1187
573 Ga0207667_11291952 3300025949 Bacteria 706
574 Ga0207651_10000176 3300025960 Bacteria 27858
575 Ga0207651_10004585 3300025960 Bacteria 6997
576 Ga0207651_10005733 3300025960 Bacteria 6414
577 Ga0207651_10133729 3300025960 Bacteria 1903
578 Ga0207651_10378990 3300025960 Bacteria 1198
579 Ga0207668_10000080 3300025972 Bacteria 72198
580 Ga0207668_10092419 3300025972 Bacteria 2227
581 Ga0207668_10138294 3300025972 Bacteria 1869
582 Ga0207668_11018922 3300025972 Bacteria 740
583 Ga0207640_10000922 3300025981 Bacteria 16485
584 Ga0207640_10043661 3300025981 Bacteria 2866
585 Ga0207640_10169598 3300025981 Bacteria 1625
586 Ga0207640_10183365 3300025981 Bacteria 1571
587 Ga0207640_10331645 3300025981 Bacteria 1215
588 Ga0207640_10339686 3300025981 Bacteria 1202
589 Ga0207658_10002613 3300025986 Bacteria 13087
590 Ga0207658_10005004 3300025986 Bacteria 9131
591 Ga0207658_10026684 3300025986 Bacteria 4051
592 Ga0207658_10036249 3300025986 Bacteria 3535
593 Ga0207658_10061741 3300025986 Bacteria 2801
594 Ga0207658_10148227 3300025986 Bacteria 1908
595 Ga0207658_10168231 3300025986 Bacteria 1803
596 Ga0207658_10811934 3300025986 Bacteria 849
597 Ga0207677_10035727 3300026023 Bacteria 3230
598 Ga0207677_10469880 3300026023 Bacteria 1081
599 Ga0207677_10629560 3300026023 Bacteria 945
600 Ga0207677_10670976 3300026023 Bacteria 917
601 Ga0207677_11129665 3300026023 Bacteria 715
602 Ga0207703_10003524 3300026035 Bacteria 13094
603 Ga0207703_10049320 3300026035 Bacteria 3404
604 Ga0207703_10076863 3300026035 Unclassified 2770
605 Ga0207703_10635682 3300026035 Bacteria 1011
606 Ga0207639_10002035 3300026041 Bacteria 13631
607 Ga0207639_10044693 3300026041 Bacteria 3332
608 Ga0207639_10080605 3300026041 Bacteria 2575
609 Ga0207639_10109466 3300026041 Bacteria 2248
610 Ga0207639_10158683 3300026041 Bacteria 1904
611 Ga0207639_11063783 3300026041 Bacteria 758
612 Ga0207639_11178929 3300026041 Bacteria 719
613 Ga0207678_10002171 3300026067 Bacteria 17732
614 Ga0207678_10037183 3300026067 Bacteria 4236
615 Ga0207678_10039490 3300026067 Bacteria 4096
616 Ga0207678_10048450 3300026067 Bacteria 3673
617 Ga0207678_10073224 3300026067 Bacteria 2936
618 Ga0207678_10080503 3300026067 Bacteria 2789
619 Ga0207678_10089428 3300026067 Bacteria 2632
620 Ga0207678_10152771 3300026067 Bacteria 1971
621 Ga0207678_10161341 3300026067 Bacteria 1914
622 Ga0207678_10373502 3300026067 Bacteria 1232
623 Ga0207678_10428112 3300026067 Bacteria 1148
624 Ga0207678_10597118 3300026067 Bacteria 968
625 Ga0207678_10632505 3300026067 Bacteria 939
626 Ga0207678_11285743 3300026067 Bacteria 647
627 Ga0207702_10039728 3300026078 Bacteria 3944
628 Ga0207702_10116259 3300026078 Bacteria 2387
629 Ga0207702_10327591 3300026078 Bacteria 1460
630 Ga0207702_10390445 3300026078 Bacteria 1340
631 Ga0207702_10794663 3300026078 Bacteria 935
632 Ga0207641_10005367 3300026088 Bacteria 10945
633 Ga0207641_10065924 3300026088 Bacteria 3098
634 Ga0207641_10085236 3300026088 Bacteria 2752
635 Ga0207641_10105463 3300026088 Bacteria 2489
636 Ga0207641_10179897 3300026088 Bacteria 1936
637 Ga0207641_10552744 3300026088 Bacteria 1123
638 Ga0207641_11409544 3300026088 Bacteria 698
639 Ga0207648_10006195 3300026089 Bacteria 11911
640 Ga0207648_10015426 3300026089 Bacteria 7029
641 Ga0207648_10021269 3300026089 Bacteria 5832
642 Ga0207648_10054155 3300026089 Bacteria 3505
643 Ga0207648_10068115 3300026089 Bacteria 3101
644 Ga0207648_11051120 3300026089 Bacteria 763
645 Ga0207676_10002026 3300026095 Bacteria 14724
646 Ga0207676_10003843 3300026095 Bacteria 10606
647 Ga0207676_10057854 3300026095 Bacteria 3055
648 Ga0207676_10331174 3300026095 Bacteria 1401
649 Ga0207674_10000289 3300026116 Bacteria 63604
650 Ga0207674_10001784 3300026116 Bacteria 27499
651 Ga0207674_10002652 3300026116 Bacteria 22343
652 Ga0207674_10005825 3300026116 Bacteria 14616
653 Ga0207674_10059453 3300026116 Bacteria 3867
654 Ga0207674_10094205 3300026116 Bacteria 2981
655 Ga0207674_10214523 3300026116 Bacteria 1873
656 Ga0207674_10433258 3300026116 Bacteria 1271
657 Ga0207675_100367462 3300026118 Bacteria 1413
658 Ga0207675_100591946 3300026118 Bacteria 1111
659 Ga0207683_10010863 3300026121 Bacteria 7765
660 Ga0207683_10022097 3300026121 Bacteria 5459
661 Ga0207683_10180375 3300026121 Bacteria 1915
662 Ga0207683_10243304 3300026121 Bacteria 1641
663 Ga0207683_10360316 3300026121 Bacteria 1335
664 Ga0207698_10005828 3300026142 Bacteria 7652
665 Ga0207698_10006006 3300026142 Bacteria 7551
666 Ga0207698_10030930 3300026142 Bacteria 3858
667 Ga0207698_10044392 3300026142 Bacteria 3339
668 Ga0207698_10066592 3300026142 Bacteria 2836
669 Ga0207698_10095962 3300026142 Bacteria 2442
670 Ga0207698_10144996 3300026142 Bacteria 2052
671 Ga0207698_10172959 3300026142 Bacteria 1904
672 Ga0207698_10244990 3300026142 Bacteria 1636
673 Ga0207698_10273201 3300026142 Bacteria 1559
674 Ga0207698_10352299 3300026142 Bacteria 1391
675 Ga0207698_10363945 3300026142 Bacteria 1370
676 Ga0207698_10421874 3300026142 Bacteria 1280
677 Ga0209974_10021213 3300027876 Bacteria 2152
678 Ga0207428_10447453 3300027907 Bacteria 942
679 Ga0268266_10000433 3300028379 Bacteria 62887
680 Ga0268266_10006069 3300028379 Bacteria 11133
681 Ga0268266_10021288 3300028379 Bacteria 5524
682 Ga0268266_10026386 3300028379 Bacteria 4942
683 Ga0268266_10361737 3300028379 Bacteria 1365
684 Ga0268266_11769640 3300028379 Bacteria 593
685 Ga0268265_10003002 3300028380 Bacteria 12319
686 Ga0268265_10018814 3300028380 Bacteria 4791
687 Ga0268265_10052627 3300028380 Bacteria 3080
688 Ga0268265_10171791 3300028380 Bacteria 1853
689 Ga0268264_10006022 3300028381 Bacteria 10262
690 Ga0268264_10141946 3300028381 Bacteria 2143
691 Ga0268264_10168803 3300028381 Bacteria 1977
692 Ga0316182_1314351 3300030745 Bacteria 684
693 Ga0307408_100569511 3300031548 Bacteria 1002
694 Ga0307408_100760463 3300031548 Bacteria 876
695 Ga0307405_10322638 3300031731 Bacteria 1180
696 Ga0307413_10067163 3300031824 Bacteria 2241
697 Ga0307413_10796152 3300031824 Bacteria 794
698 Ga0307410_10001188 3300031852 Bacteria 11522
699 Ga0307410_10013752 3300031852 Bacteria 4736
700 Ga0307410_10055682 3300031852 Bacteria 2686
701 Ga0307410_10103207 3300031852 Bacteria 2048
702 Ga0307410_10150721 3300031852 Bacteria 1731
703 Ga0307406_10054380 3300031901 Bacteria 2555
704 Ga0307407_10444839 3300031903 Bacteria 939
705 Ga0307412_10033902 3300031911 Bacteria 3249
706 Ga0307409_100039301 3300031995 Bacteria 3509
707 Ga0307409_100140824 3300031995 Bacteria 2078
708 Ga0307409_100599668 3300031995 Bacteria 1088
709 Ga0307409_101636345 3300031995 Bacteria 672
710 Ga0307416_100021278 3300032002 Bacteria 4652
711 Ga0307416_100502502 3300032002 Bacteria 1277
712 Ga0307414_10014223 3300032004 Bacteria 4762
713 Ga0307414_10123783 3300032004 Bacteria 1993
714 Ga0307414_10514046 3300032004 Bacteria 1062
715 Ga0307411_10001321 3300032005 Bacteria 9978
716 Ga0307411_10043939 3300032005 Bacteria 2862
717 Ga0307411_10071719 3300032005 Bacteria 2349
718 Ga0307415_100025803 3300032126 Bacteria 3696
719 Ga0307415_100516455 3300032126 Bacteria 1047
720 Ga0373948_0082990 3300034817 Bacteria 734
721 Ga0373941_0186446 3300035115 Bacteria 781
722 Ga0373943_0159344 3300035170 Bacteria 1228
723 Ga0373943_0278043 3300035170 Unclassified 946
724 Ga0373946_0038978 3300035171 Bacteria 1938
725 Ga0373946_0077373 3300035171 Bacteria 1450
726 Ga0373947_0341381 3300035725 Bacteria 1004
727 Ga0373937_0265539 3300036401 Bacteria 1619
728 Ga0373937_0853648 3300036401 Bacteria 859
729 Ga0395899_0000706 3300037312 Bacteria 33556
730 Ga0395899_0014863 3300037312 Bacteria 5942
731 Ga0395899_0048017 3300037312 Bacteria 3177
732 Ga0395899_0085125 3300037312 Bacteria 2297
733 Ga0395899_0184441 3300037312 Unclassified 1463
734 Ga0395899_0266854 3300037312 Bacteria 1168
735 Ga0395899_0442614 3300037312 Bacteria 852
736 Ga0395899_0476392 3300037312 Bacteria 813
737 Ga0395899_0628025 3300037312 Bacteria 681
738 Ga0395900_0000161 3300037418 Bacteria 110637
739 Ga0395900_0000564 3300037418 Bacteria 51387
740 Ga0395900_0012370 3300037418 Bacteria 8733
741 Ga0395900_0017752 3300037418 Bacteria 7262
742 Ga0395900_0026448 3300037418 Bacteria 5942
743 Ga0395900_0029663 3300037418 Bacteria 5612
744 Ga0395900_0034914 3300037418 Bacteria 5180
745 Ga0395900_0067290 3300037418 Bacteria 3680
746 Ga0395900_0075906 3300037418 Bacteria 3454
747 Ga0395900_0088389 3300037418 Bacteria 3185
748 Ga0395900_0100504 3300037418 Bacteria 2971
749 Ga0395900_0142909 3300037418 Bacteria 2449
750 Ga0395900_0231191 3300037418 Bacteria 1859
751 Ga0395900_0250085 3300037418 Bacteria 1774
752 Ga0395900_0588598 3300037418 Bacteria 1054
753 Ga0395900_0689601 3300037418 Unclassified 955
754 Ga0395900_1258274 3300037418 Bacteria 654
755 Ga0395898_0000937 3300037466 Bacteria 46531
756 Ga0395898_0000941 3300037466 Bacteria 46344
757 Ga0395898_0061018 3300037466 Bacteria 3663
758 Ga0395898_0072812 3300037466 Bacteria 3319
759 Ga0395898_0080181 3300037466 Bacteria 3148
760 Ga0395898_0286255 3300037466 Bacteria 1572
761 Ga0395898_0358479 3300037466 Unclassified 1390
762 Ga0395898_0378417 3300037466 Bacteria 1350
763 Ga0395898_0419351 3300037466 Bacteria 1276
764 Ga0395898_1359889 3300037466 Bacteria 638
765 Ga0395905_0000120 3300037471 Bacteria 130865
766 Ga0395905_0002237 3300037471 Bacteria 21801
767 Ga0395905_0009954 3300037471 Bacteria 9265
768 Ga0395905_0031548 3300037471 Unclassified 4989
769 Ga0395905_0042032 3300037471 Bacteria 4288
770 Ga0395905_0043830 3300037471 Bacteria 4197
771 Ga0395905_0051790 3300037471 Bacteria 3845
772 Ga0395905_0058580 3300037471 Bacteria 3601
773 Ga0395905_0066201 3300037471 Bacteria 3383
774 Ga0395905_0080119 3300037471 Bacteria 3060
775 Ga0395905_0085959 3300037471 Bacteria 2947
776 Ga0395905_0102758 3300037471 Bacteria 2683
777 Ga0395905_0125701 3300037471 Bacteria 2411
778 Ga0395905_0164614 3300037471 Bacteria 2084
779 Ga0395905_0185163 3300037471 Bacteria 1954
780 Ga0395905_0228576 3300037471 Bacteria 1740
781 Ga0395905_0248917 3300037471 Bacteria 1660
782 Ga0395905_0278444 3300037471 Bacteria 1559
783 Ga0395905_0279325 3300037471 Bacteria 1556
784 Ga0395905_0327468 3300037471 Bacteria 1422
785 Ga0395905_0355374 3300037471 Bacteria 1357
786 Ga0395905_0404726 3300037471 Bacteria 1260
787 Ga0395905_0431563 3300037471 Bacteria 1214
788 Ga0395905_0468429 3300037471 Bacteria 1158
789 Ga0395905_0532280 3300037471 Bacteria 1076
790 Ga0395905_0551752 3300037471 Bacteria 1053
791 Ga0395905_0574559 3300037471 Bacteria 1029
792 Ga0395905_0753953 3300037471 Bacteria 876
793 Ga0395905_0871195 3300037471 Bacteria 804
794 Ga0395901_0006565 3300038443 Bacteria 11761
795 Ga0395901_0007586 3300038443 Bacteria 10958
796 Ga0395901_0008444 3300038443 Bacteria 10410
797 Ga0395901_0018770 3300038443 Bacteria 7065
798 Ga0395901_0036508 3300038443 Bacteria 5081
799 Ga0395901_0040608 3300038443 Bacteria 4820
800 Ga0395901_0049712 3300038443 Bacteria 4357
801 Ga0395901_0061424 3300038443 Bacteria 3910
802 Ga0395901_0067260 3300038443 Bacteria 3731
803 Ga0395901_0081031 3300038443 Bacteria 3390
804 Ga0395901_0105938 3300038443 Bacteria 2951
805 Ga0395901_0140183 3300038443 Bacteria 2541
806 Ga0395901_0145516 3300038443 Bacteria 2491
807 Ga0395901_0213705 3300038443 Bacteria 2017
808 Ga0395901_0222581 3300038443 Bacteria 1972
809 Ga0395901_0226103 3300038443 Bacteria 1955
810 Ga0395901_0226906 3300038443 Bacteria 1951
811 Ga0395901_0477186 3300038443 Bacteria 1272
812 Ga0395901_0544167 3300038443 Unclassified 1177
813 Ga0395901_0572647 3300038443 Bacteria 1142
814 Ga0395901_0608053 3300038443 Bacteria 1101
815 Ga0395901_0706865 3300038443 Bacteria 1005
816 Ga0436365_0324202 3300039437 Bacteria 10090
817 Ga0439438_050413 3300041405 Bacteria 1060
818 Ga0439448_0002214 3300042005 Bacteria 5253
819 Ga0439455_0042319 3300042012 Bacteria 1169
820 Ga0450914_000120 3300042118 Bacteria 2533
821 Ga0450905_005703 3300042142 Bacteria 1671
822 Ga0450889_000141 3300042144 Bacteria 7285
823 Ga0439458_0000032 3300042157 Bacteria 21961
824 Ga0439464_0000318 3300042439 Bacteria 9184
825 Ga0466965_0007949 3300044683 Bacteria 4890
826 Ga0466966_0661902 3300044684 Bacteria 629
827 Ga0466961_0001787 3300044693 Bacteria 13319
828 Ga0466961_0044538 3300044693 Bacteria 2839
829 Ga0466963_0007279 3300044694 Bacteria 6600
830 Ga0466963_0019285 3300044694 Bacteria 4275
831 Ga0466963_0054666 3300044694 Bacteria 2654
832 Ga0466963_0062604 3300044694 Bacteria 2488
833 Ga0466963_0097533 3300044694 Bacteria 2008
834 Ga0466963_0125358 3300044694 Bacteria 1770
835 Ga0466964_0007542 3300044706 Bacteria 4071
836 Ga0466964_0362540 3300044706 Bacteria 748
837 Ga0466971_0015717 3300044719 Bacteria 3333
838 Ga0466968_0002072 3300044735 Bacteria 7299
839 Ga0466970_0008514 3300044765 Bacteria 5165
840 Ga0466970_0352251 3300044765 Bacteria 835
841 Ga0466957_0062906 3300044842 Bacteria 2280
842 Ga0466957_0084206 3300044842 Bacteria 1984
843 Ga0466957_0123879 3300044842 Bacteria 1650
844 Ga0466957_0700745 3300044842 Bacteria 715
845 Ga0466959_0063125 3300045049 Bacteria 2691
846 Ga0466959_0064555 3300045049 Bacteria 2658
847 Ga0466958_0001793 3300045836 Bacteria 10414
848 Ga0466958_0063123 3300045836 Unclassified 2259
849 Ga0466958_0217436 3300045836 Bacteria 1218
850 Ga0466967_0035812 3300045976 Bacteria 4229
851 Ga0466967_0040293 3300045976 Bacteria 4021
852 Ga0466967_0042453 3300045976 Bacteria 3930
853 Ga0466967_0050124 3300045976 Bacteria 3655
854 Ga0466967_0050889 3300045976 Bacteria 3628
855 Ga0466967_0080551 3300045976 Bacteria 2938
856 Ga0466967_0273042 3300045976 Bacteria 1620
857 Ga0466967_1660548 3300045976 Bacteria 636
858 Ga0495629_0194208 3300046459 Bacteria 1404
859 Ga0495643_0319996 3300046522 Bacteria 702
860 Ga0495663_0155725 3300046525 Bacteria 782
861 Ga0495642_0336835 3300046528 Bacteria 662
862 Ga0495598_0002519 3300046537 Bacteria 3786
863 Ga0495621_0000065 3300046539 Bacteria 20486
864 Ga0495669_0028882 3300046684 Bacteria 2430
865 Ga0495670_0000467 3300046691 Bacteria 19301
866 Ga0495687_077649 3300047443 Bacteria 1311
867 Ga0496101_0245584 3300048904 Bacteria 1394
868 Ga0496102_0134785 3300048905 Bacteria 2313
869 Ga0496102_0203542 3300048905 Bacteria 1866
870 Ga0496102_0224122 3300048905 Bacteria 1773
871 Ga0496103_0015569 3300048906 Bacteria 4529
872 Ga0496103_0169302 3300048906 Bacteria 1402
873 Ga0496103_0306876 3300048906 Bacteria 1021
874 Ga0496104_0441615 3300048907 Bacteria 1213
875 Ga0496106_0062978 3300048909 Bacteria 2817
876 Ga0496106_0095503 3300048909 Bacteria 2300
877 Ga0496106_0491359 3300048909 Unclassified 986
878 Ga0496107_0031247 3300048910 Bacteria 3798
879 Ga0496107_0078463 3300048910 Bacteria 2406
880 Ga0496107_0097257 3300048910 Unclassified 2155
881 Ga0496107_0120068 3300048910 Bacteria 1936
882 Ga0496108_0007228 3300048911 Bacteria 8999
883 Ga0496108_0014601 3300048911 Bacteria 6411
884 Ga0496108_0686671 3300048911 Bacteria 888
885 Ga0496109_0013067 3300048912 Bacteria 7182
886 Ga0496109_0047851 3300048912 Bacteria 3889
887 Ga0496109_0291058 3300048912 Bacteria 1540
888 Ga0496109_1305252 3300048912 Bacteria 662
889 Ga0496110_0009956 3300048913 Bacteria 7710
890 Ga0496110_0032481 3300048913 Bacteria 4508
891 Ga0496110_0145859 3300048913 Bacteria 2141
892 Ga0496111_0185340 3300048914 Bacteria 1547
893 Ga0496111_0406709 3300048914 Bacteria 1005
894 Ga0496111_0694336 3300048914 Bacteria 740
895 Ga0496112_0039549 3300048915 Bacteria 4609
896 Ga0496112_0041388 3300048915 Bacteria 4508
897 Ga0496112_0525545 3300048915 Bacteria 1118
898 Ga0496113_0003926 3300048916 Bacteria 9022
899 Ga0496113_0004130 3300048916 Bacteria 8856
900 Ga0496114_0000109 3300048917 Bacteria 59733
901 Ga0501067_0104314 3300049583 Bacteria 1575
902 Ga0501068_0753920 3300049584 Bacteria 637
903 Ga0501074_0050452 3300049590 Bacteria 3004
904 Ga0501268_018527 3300049765 Bacteria 1171
905 nmdc:mga0k408_171435_c1 3300050493 Bacteria 1293
906 nmdc:mga05p37_1930054_c1 3300050507 Bacteria 562
907 nmdc:mga08y16_781908_c1 3300050511 Bacteria 949
908 nmdc:mga0n895_689219_c1 3300050512 Bacteria 1018
909 nmdc:mga0rr50_904812_c1 3300050513 Bacteria 752
910 nmdc:mga0a205_23623_c1 3300050515 Bacteria 5831
911 Ga0466962_0025314 3300061719 Bacteria 2849
912 Ga0466962_0069141 3300061719 Unclassified 1687
913 Ga0068852_100108677
914 JGI24741J21665_1018096
915 JGI24741J21665_1042194
916 JGI24747J21853_1000392
917 JGI24740J21852_10001623
918 JGI24740J21852_10026506
919 JGI24739J22299_10000129
920 JGI24739J22299_10013768
921 JGI24739J22299_10052089
922 JGI24737J22298_10000508
923 JGI24737J22298_10000636
924 JGI24737J22298_10006081
925 JGI24737J22298_10034951
926 JGI24735J21928_10004510
927 JGI24735J21928_10041653
928 JGI24735J21928_10076229
929 JGI24738J21930_10000498
930 JGI24744J21845_10002115
931 JGI24034J26672_10081233
932 Ga0065715_10124632
933 Ga0070658_10025214
934 Ga0070658_10042953
935 Ga0070658_10073411
936 Ga0070658_10081016
937 Ga0070658_10198681
938 Ga0070658_10218751
939 Ga0070658_10228184
940 Ga0070658_10438609
941 Ga0070658_10929154
942 Ga0070658_10938361
943 Ga0070658_11131244
944 Ga0070676_10004537
945 Ga0070676_10020873
946 Ga0070676_10117425
947 Ga0070676_10133310
948 Ga0070676_10875435
949 Ga0070683_100418367
950 Ga0070683_100725382
951 Ga0070683_101069601
952 Ga0070690_100082797
953 Ga0070670_100000265
954 Ga0070670_100017868
955 Ga0070670_100034147
956 Ga0070670_100039600
957 Ga0070670_100075181
958 Ga0070670_100219788
959 Ga0070670_100676531
960 Ga0070670_100842299
961 Ga0070677_10028550
962 Ga0070677_10290408
963 Ga0068869_100003385
964 Ga0068869_100258884
965 Ga0068869_100554851
966 Ga0070666_10000924
967 Ga0070666_10092143
968 Ga0070680_100026458
969 Ga0070680_100123460
970 Ga0070680_100201786
971 Ga0070682_100060208
972 Ga0068868_100000156
973 Ga0068868_100124585
974 Ga0068868_100134726
975 Ga0068868_100852235
976 Ga0070660_100016352
977 Ga0070660_100027899
978 Ga0070660_100029535
979 Ga0070660_100030821
980 Ga0070660_100031364
981 Ga0070660_100083565
982 Ga0070660_100091342
983 Ga0070660_100127699
984 Ga0070660_100526927
985 Ga0070689_100089758
986 Ga0070691_10109023
987 Ga0070687_100354621
988 Ga0070661_100010414
989 Ga0070661_100018709
990 Ga0070661_100028137
991 Ga0070661_100357259
992 Ga0070661_100455658
993 Ga0070661_100477489
994 Ga0070661_100609285
995 Ga0070661_100642862
996 Ga0070692_10004520
997 Ga0070692_10127662
998 Ga0070692_10886626
999 Ga0070668_100028773
1000 Ga0070668_100029497
1001 Ga0070668_100058464
1002 Ga0070668_100152987
1003 Ga0070668_100919778
1004 Ga0070669_100000383
1005 Ga0070669_100044111
1006 Ga0070669_100119641
1007 Ga0070669_100888360
1008 Ga0070675_100042178
1009 Ga0070675_100055114
1010 Ga0070675_100090426
1011 Ga0070675_100235664
1012 Ga0070671_100010697
1013 Ga0070671_100020843
1014 Ga0070671_100032493
1015 Ga0070674_100016253
1016 Ga0070674_100018093
1017 Ga0070674_100065003
1018 Ga0070674_100092337
1019 Ga0070674_100665740
1020 Ga0070673_100000249
1021 Ga0070673_100004608
1022 Ga0070673_100021148
1023 Ga0070673_100024724
1024 Ga0070673_100068453
1025 Ga0070673_100398386
1026 Ga0070673_101544529
1027 Ga0070659_100000814
1028 Ga0070659_100017184
1029 Ga0070659_100024681
1030 Ga0070659_100052357
1031 Ga0070659_100127757
1032 Ga0070659_100144685
1033 Ga0070659_100209712
1034 Ga0070659_100218172
1035 Ga0070659_100221935
1036 Ga0070659_100302855
1037 Ga0070659_100332225
1038 Ga0070659_100364523
1039 Ga0070659_100669561
1040 Ga0070659_100980607
1041 Ga0070659_101154869
1042 Ga0070667_100007007
1043 Ga0070667_100010406
1044 Ga0070667_100168331
1045 Ga0070667_100365501
1046 Ga0070667_100545060
1047 Ga0070714_100145389
1048 Ga0070714_100349129
1049 Ga0070714_100393588
1050 Ga0070713_100398399
1051 Ga0070713_100600628
1052 Ga0070694_100016869
1053 Ga0070663_100002083
1054 Ga0070663_100032144
1055 Ga0070663_100032499
1056 Ga0070663_100061544
1057 Ga0070663_100069080
1058 Ga0070663_100145098
1059 Ga0070663_100164241
1060 Ga0070663_100253437
1061 Ga0070663_100435802
1062 Ga0070663_100456965
1063 Ga0070663_100568864
1064 Ga0070663_100653226
1065 Ga0070663_100914447
1066 Ga0070678_100007228
1067 Ga0070678_100077952
1068 Ga0070678_100198329
1069 Ga0070678_101590418
1070 Ga0070662_100001575
1071 Ga0070662_100060782
1072 Ga0070662_100227529
1073 Ga0070662_100280581
1074 Ga0070662_100369270
1075 Ga0070662_100441637
1076 Ga0070662_100566806
1077 Ga0070662_100912126
1078 Ga0070662_101167015
1079 Ga0070681_10107104
1080 Ga0068867_100000388
1081 Ga0068867_100004529
1082 Ga0068867_100006303
1083 Ga0068867_100015970
1084 Ga0068867_100083443
1085 Ga0068867_100612208
1086 Ga0068867_101041046
1087 Ga0070685_10227267
1088 Ga0070679_100077766
1089 Ga0070679_100490571
1090 Ga0070679_100606942
1091 Ga0070684_100041516
1092 Ga0068853_100001793
1093 Ga0068853_100009785
1094 Ga0068853_100030051
1095 Ga0068853_100145368
1096 Ga0068853_100170665
1097 Ga0068853_100175880
1098 Ga0068853_100499546
1099 Ga0068853_100765923
1100 Ga0068853_100772395
1101 Ga0068853_101097778
1102 Ga0068853_101130904
1103 Ga0068853_101265277
1104 Ga0070672_100031464
1105 Ga0070672_100053454
1106 Ga0070672_100114660
1107 Ga0070672_100124720
1108 Ga0070672_100174113
1109 Ga0070672_100704061
1110 Ga0070672_100726290
1111 Ga0070695_100018451
1112 Ga0070696_100003105
1113 Ga0070693_100067549
1114 Ga0070693_100141908
1115 Ga0070693_100296052
1116 Ga0070693_100318892
1117 Ga0070665_100001571
1118 Ga0070665_100011777
1119 Ga0070665_100108477
1120 Ga0070665_100314722
1121 Ga0070704_100730089
1122 Ga0068855_100009002
1123 Ga0068855_100033640
1124 Ga0068855_100101268
1125 Ga0068855_100192516
1126 Ga0068855_100220814
1127 Ga0068855_100546308
1128 Ga0068855_100617225
1129 Ga0068855_101166313
1130 Ga0068855_101394207
1131 Ga0070664_100006002
1132 Ga0070664_100006949
1133 Ga0070664_100021834
1134 Ga0070664_100023925
1135 Ga0070664_100061228
1136 Ga0070664_100095713
1137 Ga0070664_100110483
1138 Ga0070664_100147732
1139 Ga0070664_100191241
1140 Ga0070664_100346507
1141 Ga0070664_100514873
1142 Ga0070664_100660736
1143 Ga0070664_101008198
1144 Ga0068857_100000282
1145 Ga0068857_100004159
1146 Ga0068857_100073004
1147 Ga0068857_100087152
1148 Ga0068857_100130912
1149 Ga0068854_100001188
1150 Ga0068854_100030599
1151 Ga0068854_100217156
1152 Ga0068854_100241935
1153 Ga0068854_100274039
1154 Ga0068854_100434875
1155 Ga0068854_100484774
1156 Ga0068854_100693022
1157 Ga0068856_100050036
1158 Ga0068856_100054602
1159 Ga0068856_100667595
1160 Ga0068856_100735128
1161 Ga0068856_101364865
1162 Ga0068852_100004611
1163 Ga0068852_100008341
1164 Ga0068852_100019947
1165 Ga0068852_100045475
1166 Ga0068852_100057707
1167 Ga0068852_100110187
1168 Ga0068852_100173214
1169 Ga0068852_100182577
1170 Ga0068852_100425503
1171 Ga0068852_100437566
1172 Ga0068852_101151501
1173 Ga0068859_100007893
1174 Ga0068859_100083956
1175 Ga0068859_100085907
1176 Ga0068859_100605266
1177 Ga0068864_100001720
1178 Ga0068864_100006305
1179 Ga0068864_100017017
1180 Ga0068864_100089301
1181 Ga0068866_10397393
1182 Ga0068861_100496894
1183 Ga0068851_10001252
1184 Ga0068851_10004999
1185 Ga0068851_10103223
1186 Ga0068851_10159907
1187 Ga0068851_10307523
1188 Ga0068870_10530464
1189 Ga0068863_100000921
1190 Ga0068863_100018083
1191 Ga0068863_100049239
1192 Ga0068863_100061552
1193 Ga0068863_100129424
1194 Ga0068863_100129576
1195 Ga0068863_100431650
1196 Ga0068858_100002927
1197 Ga0068858_100005521
1198 Ga0068858_100025505
1199 Ga0068858_100674792
1200 Ga0068860_100006472
1201 Ga0068860_100016185
1202 Ga0068860_100065747
1203 Ga0068860_100590326
1204 Ga0068862_100001850
1205 Ga0068862_100063418
1206 Ga0068862_100076199
1207 Ga0068862_100530490
1208 Ga0070717_10000431
1209 Ga0070717_10328571
1210 Ga0070717_10802747
1211 Ga0070712_100333390
1212 Ga0070712_100449889
1213 Ga0075366_10152968
1214 Ga0097621_100002177
1215 Ga0097621_100028359
1216 Ga0097621_100131364
1217 Ga0097621_100597743
1218 Ga0097621_100632052
1219 Ga0068871_100168151
1220 Ga0068871_100197759
1221 Ga0068871_100399392
1222 Ga0075428_100871439
1223 Ga0068865_100004164
1224 Ga0068865_100362724
1225 Ga0068865_100395382
1226 Ga0068865_100417451
1227 Ga0097620_100007893
1228 Ga0097620_100083957
1229 Ga0097620_100085909
1230 Ga0097620_100605330
1231 Ga0075435_100118535
1232 Ga0105251_10066823
1233 Ga0105240_10036304
1234 Ga0105240_10451572
1235 Ga0105240_10548316
1236 Ga0111539_10590040
1237 Ga0111539_10876264
1238 Ga0105245_10000326
1239 Ga0114129_12292882
1240 Ga0105243_10160569
1241 Ga0105243_10412726
1242 Ga0105243_10625744
1243 Ga0105243_11649305
1244 Ga0105241_10294645
1245 Ga0105241_10393790
1246 Ga0105242_10296106
1247 Ga0105248_10000159
1248 Ga0105248_10019678
1249 Ga0105248_10079959
1250 Ga0105248_10094714
1251 Ga0105248_10124189
1252 Ga0105248_10433312
1253 Ga0105237_10052857
1254 Ga0105238_10066235
1255 Ga0105238_10067163
1256 Ga0105238_10110657
1257 Ga0105238_10770889
1258 Ga0105238_11309626
1259 Ga0105249_10117892
1260 Ga0105239_10106348
1261 Ga0105246_10057871
1262 Ga0105246_10387926
1263 Ga0157373_10010771
1264 Ga0157373_10037548
1265 Ga0157373_10132577
1266 Ga0157373_10181121
1267 Ga0157373_10274585
1268 Ga0157373_11175443
1269 Ga0157371_10009903
1270 Ga0157371_10086012
1271 Ga0157371_10702307
1272 Ga0157371_11073329
1273 Ga0157371_11188020
1274 Ga0157370_10056182
1275 Ga0157370_10215314
1276 Ga0157370_10329853
1277 Ga0157370_10439513
1278 Ga0157370_10479413
1279 Ga0157369_10232269
1280 Ga0157369_10334891
1281 Ga0157369_10452212
1282 Ga0157369_10594547
1283 Ga0157369_11179659
1284 Ga0157374_10006752
1285 Ga0157374_10010300
1286 Ga0157374_10083972
1287 Ga0157374_10528327
1288 Ga0157374_11437954
1289 Ga0157378_10001240
1290 Ga0157378_11151879
1291 Ga0163162_10010361
1292 Ga0163162_10040095
1293 Ga0163162_10052998
1294 Ga0163162_10072920
1295 Ga0163162_12673251
1296 Ga0157372_10047848
1297 Ga0157372_10070890
1298 Ga0157372_10152991
1299 Ga0157372_10597052
1300 Ga0157375_10003764
1301 Ga0157375_10038697
1302 Ga0157375_10089377
1303 Ga0157375_10162050
1304 Ga0157375_10177451
1305 Ga0157375_10199201
1306 Ga0157375_10275673
1307 Ga0157375_12329127
1308 Ga0163163_10006126
1309 Ga0163163_10027336
1310 Ga0182008_10024738
1311 Ga0157377_10365982
1312 Ga0157377_10374285
1313 Ga0157379_10001552
1314 Ga0157379_10905589
1315 Ga0157376_10210123
1316 Ga0213876_10041585
1317 Ga0207697_10000584
1318 Ga0207656_10009976
1319 Ga0207656_10044756
1320 Ga0207656_10065754
1321 Ga0207656_10095759
1322 Ga0207682_10050523
1323 Ga0207682_10083373
1324 Ga0207642_10038122
1325 Ga0207688_10001613
1326 Ga0207688_10078987
1327 Ga0207688_10126230
1328 Ga0207688_10185353
1329 Ga0207688_10189821
1330 Ga0207688_10242316
1331 Ga0207680_10012122
1332 Ga0207680_10016735
1333 Ga0207680_10402327
1334 Ga0207647_10004783
1335 Ga0207647_10007590
1336 Ga0207647_10015821
1337 Ga0207647_10019902
1338 Ga0207647_10060159
1339 Ga0207647_10141912
1340 Ga0207645_10002907
1341 Ga0207645_10008056
1342 Ga0207645_10048314
1343 Ga0207643_10188928
1344 Ga0207643_10365832
1345 Ga0207705_10005540
1346 Ga0207705_10013056
1347 Ga0207705_10030335
1348 Ga0207705_10076052
1349 Ga0207705_10114485
1350 Ga0207705_10173290
1351 Ga0207705_10173533
1352 Ga0207705_10189815
1353 Ga0207705_10222431
1354 Ga0207705_10390762
1355 Ga0207705_10531341
1356 Ga0207705_10884519
1357 Ga0207707_10201937
1358 Ga0207695_10181451
1359 Ga0207695_10274505
1360 Ga0207671_10108668
1361 Ga0207693_10200036
1362 Ga0207660_10097870
1363 Ga0207660_10222963
1364 Ga0207662_10442702
1365 Ga0207657_10001905
1366 Ga0207657_10009589
1367 Ga0207657_10015222
1368 Ga0207657_10021301
1369 Ga0207657_10023085
1370 Ga0207657_10039085
1371 Ga0207657_10072869
1372 Ga0207657_10081502
1373 Ga0207657_10136452
1374 Ga0207657_10185047
1375 Ga0207657_10252585
1376 Ga0207657_10507482
1377 Ga0207649_10003504
1378 Ga0207649_10055020
1379 Ga0207649_10195772
1380 Ga0207649_10291814
1381 Ga0207649_10347103
1382 Ga0207649_10391876
1383 Ga0207649_10456321
1384 Ga0207649_10820366
1385 Ga0207652_10115121
1386 Ga0207652_10138675
1387 Ga0207652_10158021
1388 Ga0207652_10506427
1389 Ga0207681_10004527
1390 Ga0207681_10031116
1391 Ga0207681_10037134
1392 Ga0207681_10981771
1393 Ga0207681_11007653
1394 Ga0207694_10182472
1395 Ga0207694_11474742
1396 Ga0207650_10001366
1397 Ga0207650_10005054
1398 Ga0207650_10045686
1399 Ga0207650_10121910
1400 Ga0207650_10157225
1401 Ga0207650_10236759
1402 Ga0207659_10028082
1403 Ga0207659_10078273
1404 Ga0207659_10087276
1405 Ga0207659_10119070
1406 Ga0207687_10002526
1407 Ga0207700_10031397
1408 Ga0207700_10288227
1409 Ga0207700_10412092
1410 Ga0207664_10070285
1411 Ga0207664_10331926
1412 Ga0207644_10002867
1413 Ga0207644_10004200
1414 Ga0207644_10053657
1415 Ga0207644_10258304
1416 Ga0207690_10003550
1417 Ga0207690_10004102
1418 Ga0207690_10010279
1419 Ga0207690_10021213
1420 Ga0207690_10026080
1421 Ga0207690_10030983
1422 Ga0207690_10044666
1423 Ga0207690_10060269
1424 Ga0207690_10115607
1425 Ga0207690_10151079
1426 Ga0207690_10249376
1427 Ga0207690_10311225
1428 Ga0207690_10473336
1429 Ga0207690_10480657
1430 Ga0207690_10520974
1431 Ga0207690_10829917
1432 Ga0207706_10006260
1433 Ga0207706_10007443
1434 Ga0207706_10007464
1435 Ga0207706_10076012
1436 Ga0207706_10077169
1437 Ga0207706_10096226
1438 Ga0207706_10150506
1439 Ga0207706_10152520
1440 Ga0207706_10290233
1441 Ga0207706_10293092
1442 Ga0207706_10402337
1443 Ga0207706_10707616
1444 Ga0207709_10115884
1445 Ga0207670_10039769
1446 Ga0207669_10047755
1447 Ga0207669_10206070
1448 Ga0207669_10657900
1449 Ga0207704_10009476
1450 Ga0207665_10248489
1451 Ga0207691_10002930
1452 Ga0207691_10010969
1453 Ga0207691_10119662
1454 Ga0207691_10122686
1455 Ga0207691_10190258
1456 Ga0207691_10237986
1457 Ga0207691_10813514
1458 Ga0207711_10002836
1459 Ga0207711_10021290
1460 Ga0207711_10048209
1461 Ga0207711_10054577
1462 Ga0207711_10119323
1463 Ga0207711_10707641
1464 Ga0207689_10000092
1465 Ga0207689_10118265
1466 Ga0207689_10173953
1467 Ga0207689_10389844
1468 Ga0207661_10181647
1469 Ga0207661_10230209
1470 Ga0207661_10728043
1471 Ga0207679_10008397
1472 Ga0207679_10083449
1473 Ga0207679_10128884
1474 Ga0207679_10160315
1475 Ga0207679_10177253
1476 Ga0207679_10376646
1477 Ga0207679_10604325
1478 Ga0207667_10033549
1479 Ga0207667_10041356
1480 Ga0207667_10067246
1481 Ga0207667_10114827
1482 Ga0207667_10218841
1483 Ga0207667_10235044
1484 Ga0207667_10534669
1485 Ga0207667_11291952
1486 Ga0207651_10000176
1487 Ga0207651_10004585
1488 Ga0207651_10005733
1489 Ga0207651_10133729
1490 Ga0207651_10378990
1491 Ga0207668_10000080
1492 Ga0207668_10092419
1493 Ga0207668_10138294
1494 Ga0207668_11018922
1495 Ga0207640_10000922
1496 Ga0207640_10043661
1497 Ga0207640_10169598
1498 Ga0207640_10183365
1499 Ga0207640_10331645
1500 Ga0207640_10339686
1501 Ga0207658_10002613
1502 Ga0207658_10005004
1503 Ga0207658_10026684
1504 Ga0207658_10036249
1505 Ga0207658_10061741
1506 Ga0207658_10148227
1507 Ga0207658_10168231
1508 Ga0207658_10811934
1509 Ga0207677_10035727
1510 Ga0207677_10469880
1511 Ga0207677_10629560
1512 Ga0207677_10670976
1513 Ga0207677_11129665
1514 Ga0207703_10003524
1515 Ga0207703_10049320
1516 Ga0207703_10076863
1517 Ga0207703_10635682
1518 Ga0207639_10002035
1519 Ga0207639_10044693
1520 Ga0207639_10080605
1521 Ga0207639_10109466
1522 Ga0207639_10158683
1523 Ga0207639_11063783
1524 Ga0207639_11178929
1525 Ga0207678_10002171
1526 Ga0207678_10037183
1527 Ga0207678_10039490
1528 Ga0207678_10048450
1529 Ga0207678_10073224
1530 Ga0207678_10080503
1531 Ga0207678_10089428
1532 Ga0207678_10152771
1533 Ga0207678_10161341
1534 Ga0207678_10373502
1535 Ga0207678_10428112
1536 Ga0207678_10597118
1537 Ga0207678_10632505
1538 Ga0207678_11285743
1539 Ga0207702_10039728
1540 Ga0207702_10116259
1541 Ga0207702_10327591
1542 Ga0207702_10390445
1543 Ga0207702_10794663
1544 Ga0207641_10005367
1545 Ga0207641_10065924
1546 Ga0207641_10085236
1547 Ga0207641_10105463
1548 Ga0207641_10179897
1549 Ga0207641_10552744
1550 Ga0207641_11409544
1551 Ga0207648_10006195
1552 Ga0207648_10015426
1553 Ga0207648_10021269
1554 Ga0207648_10054155
1555 Ga0207648_10068115
1556 Ga0207648_11051120
1557 Ga0207676_10002026
1558 Ga0207676_10003843
1559 Ga0207676_10057854
1560 Ga0207676_10331174
1561 Ga0207674_10000289
1562 Ga0207674_10001784
1563 Ga0207674_10002652
1564 Ga0207674_10005825
1565 Ga0207674_10059453
1566 Ga0207674_10094205
1567 Ga0207674_10214523
1568 Ga0207674_10433258
1569 Ga0207675_100367462
1570 Ga0207675_100591946
1571 Ga0207683_10010863
1572 Ga0207683_10022097
1573 Ga0207683_10180375
1574 Ga0207683_10243304
1575 Ga0207683_10360316
1576 Ga0207698_10005828
1577 Ga0207698_10006006
1578 Ga0207698_10030930
1579 Ga0207698_10044392
1580 Ga0207698_10066592
1581 Ga0207698_10095962
1582 Ga0207698_10144996
1583 Ga0207698_10172959
1584 Ga0207698_10244990
1585 Ga0207698_10273201
1586 Ga0207698_10352299
1587 Ga0207698_10363945
1588 Ga0207698_10421874
1589 Ga0209974_10021213
1590 Ga0207428_10447453
1591 Ga0268266_10000433
1592 Ga0268266_10006069
1593 Ga0268266_10021288
1594 Ga0268266_10026386
1595 Ga0268266_10361737
1596 Ga0268266_11769640
1597 Ga0268265_10003002
1598 Ga0268265_10018814
1599 Ga0268265_10052627
1600 Ga0268265_10171791
1601 Ga0268264_10006022
1602 Ga0268264_10141946
1603 Ga0268264_10168803
1604 Ga0316182_1314351
1605 Ga0307408_100569511
1606 Ga0307408_100760463
1607 Ga0307405_10322638
1608 Ga0307413_10067163
1609 Ga0307413_10796152
1610 Ga0307410_10001188
1611 Ga0307410_10013752
1612 Ga0307410_10055682
1613 Ga0307410_10103207
1614 Ga0307410_10150721
1615 Ga0307406_10054380
1616 Ga0307407_10444839
1617 Ga0307412_10033902
1618 Ga0307409_100039301
1619 Ga0307409_100140824
1620 Ga0307409_100599668
1621 Ga0307409_101636345
1622 Ga0307416_100021278
1623 Ga0307416_100502502
1624 Ga0307414_10014223
1625 Ga0307414_10123783
1626 Ga0307414_10514046
1627 Ga0307411_10001321
1628 Ga0307411_10043939
1629 Ga0307411_10071719
1630 Ga0307415_100025803
1631 Ga0307415_100516455
1632 Ga0373948_0082990
1633 Ga0373941_0186446
1634 Ga0373943_0159344
1635 Ga0373943_0278043
1636 Ga0373946_0038978
1637 Ga0373946_0077373
1638 Ga0373947_0341381
1639 Ga0373937_0265539
1640 Ga0373937_0853648
1641 Ga0395899_0000706
1642 Ga0395899_0014863
1643 Ga0395899_0048017
1644 Ga0395899_0085125
1645 Ga0395899_0184441
1646 Ga0395899_0266854
1647 Ga0395899_0442614
1648 Ga0395899_0476392
1649 Ga0395899_0628025
1650 Ga0395900_0000161
1651 Ga0395900_0000564
1652 Ga0395900_0012370
1653 Ga0395900_0017752
1654 Ga0395900_0026448
1655 Ga0395900_0029663
1656 Ga0395900_0034914
1657 Ga0395900_0067290
1658 Ga0395900_0075906
1659 Ga0395900_0088389
1660 Ga0395900_0100504
1661 Ga0395900_0142909
1662 Ga0395900_0231191
1663 Ga0395900_0250085
1664 Ga0395900_0588598
1665 Ga0395900_0689601
1666 Ga0395900_1258274
1667 Ga0395898_0000937
1668 Ga0395898_0000941
1669 Ga0395898_0061018
1670 Ga0395898_0072812
1671 Ga0395898_0080181
1672 Ga0395898_0286255
1673 Ga0395898_0358479
1674 Ga0395898_0378417
1675 Ga0395898_0419351
1676 Ga0395898_1359889
1677 Ga0395905_0000120
1678 Ga0395905_0002237
1679 Ga0395905_0009954
1680 Ga0395905_0031548
1681 Ga0395905_0042032
1682 Ga0395905_0043830
1683 Ga0395905_0051790
1684 Ga0395905_0058580
1685 Ga0395905_0066201
1686 Ga0395905_0080119
1687 Ga0395905_0085959
1688 Ga0395905_0102758
1689 Ga0395905_0125701
1690 Ga0395905_0164614
1691 Ga0395905_0185163
1692 Ga0395905_0228576
1693 Ga0395905_0248917
1694 Ga0395905_0278444
1695 Ga0395905_0279325
1696 Ga0395905_0327468
1697 Ga0395905_0355374
1698 Ga0395905_0404726
1699 Ga0395905_0431563
1700 Ga0395905_0468429
1701 Ga0395905_0532280
1702 Ga0395905_0551752
1703 Ga0395905_0574559
1704 Ga0395905_0753953
1705 Ga0395905_0871195
1706 Ga0395901_0006565
1707 Ga0395901_0007586
1708 Ga0395901_0008444
1709 Ga0395901_0018770
1710 Ga0395901_0036508
1711 Ga0395901_0040608
1712 Ga0395901_0049712
1713 Ga0395901_0061424
1714 Ga0395901_0067260
1715 Ga0395901_0081031
1716 Ga0395901_0105938
1717 Ga0395901_0140183
1718 Ga0395901_0145516
1719 Ga0395901_0213705
1720 Ga0395901_0222581
1721 Ga0395901_0226103
1722 Ga0395901_0226906
1723 Ga0395901_0477186
1724 Ga0395901_0544167
1725 Ga0395901_0572647
1726 Ga0395901_0608053
1727 Ga0395901_0706865
1728 Ga0436365_0324202
1729 Ga0439438_050413
1730 Ga0439448_0002214
1731 Ga0439455_0042319
1732 Ga0450914_000120
1733 Ga0450905_005703
1734 Ga0450889_000141
1735 Ga0439458_0000032
1736 Ga0439464_0000318
1737 Ga0466965_0007949
1738 Ga0466966_0661902
1739 Ga0466961_0001787
1740 Ga0466961_0044538
1741 Ga0466963_0007279
1742 Ga0466963_0019285
1743 Ga0466963_0054666
1744 Ga0466963_0062604
1745 Ga0466963_0097533
1746 Ga0466963_0125358
1747 Ga0466964_0007542
1748 Ga0466964_0362540
1749 Ga0466971_0015717
1750 Ga0466968_0002072
1751 Ga0466970_0008514
1752 Ga0466970_0352251
1753 Ga0466957_0062906
1754 Ga0466957_0084206
1755 Ga0466957_0123879
1756 Ga0466957_0700745
1757 Ga0466959_0063125
1758 Ga0466959_0064555
1759 Ga0466958_0001793
1760 Ga0466958_0063123
1761 Ga0466958_0217436
1762 Ga0466967_0035812
1763 Ga0466967_0040293
1764 Ga0466967_0042453
1765 Ga0466967_0050124
1766 Ga0466967_0050889
1767 Ga0466967_0080551
1768 Ga0466967_0273042
1769 Ga0466967_1660548
1770 Ga0495629_0194208
1771 Ga0495643_0319996
1772 Ga0495663_0155725
1773 Ga0495642_0336835
1774 Ga0495598_0002519
1775 Ga0495621_0000065
1776 Ga0495669_0028882
1777 Ga0495670_0000467
1778 Ga0495687_077649
1779 Ga0496101_0245584
1780 Ga0496102_0134785
1781 Ga0496102_0203542
1782 Ga0496102_0224122
1783 Ga0496103_0015569
1784 Ga0496103_0169302
1785 Ga0496103_0306876
1786 Ga0496104_0441615
1787 Ga0496106_0062978
1788 Ga0496106_0095503
1789 Ga0496106_0491359
1790 Ga0496107_0031247
1791 Ga0496107_0078463
1792 Ga0496107_0097257
1793 Ga0496107_0120068
1794 Ga0496108_0007228
1795 Ga0496108_0014601
1796 Ga0496108_0686671
1797 Ga0496109_0013067
1798 Ga0496109_0047851
1799 Ga0496109_0291058
1800 Ga0496109_1305252
1801 Ga0496110_0009956
1802 Ga0496110_0032481
1803 Ga0496110_0145859
1804 Ga0496111_0185340
1805 Ga0496111_0406709
1806 Ga0496111_0694336
1807 Ga0496112_0039549
1808 Ga0496112_0041388
1809 Ga0496112_0525545
1810 Ga0496113_0003926
1811 Ga0496113_0004130
1812 Ga0496114_0000109
1813 Ga0501067_0104314
1814 Ga0501068_0753920
1815 Ga0501074_0050452
1816 Ga0501268_018527
1817 nmdc:mga0k408_171435_c1
1818 nmdc:mga05p37_1930054_c1
1819 nmdc:mga08y16_781908_c1
1820 nmdc:mga0n895_689219_c1
1821 nmdc:mga0rr50_904812_c1
1822 nmdc:mga0a205_23623_c1
1823 Ga0466962_0025314
1824 Ga0466962_0069141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

46

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bnk-assembly1.cif.gz_A x-ray crystal structure of flavoredoxin from methanosarcina acetivorans 0.871 29 153
4l82-assembly2.cif.gz_D structure of a putative oxidoreductase from rickettsia felis 0.8516 17 152
3rh7-assembly3.cif.gz_F crystal structure of a putative oxidoreductase (sma0793) from sinorhizobium meliloti 1021 at 3.00 a resolution 0.839 15 153
2d5m-assembly1.cif.gz_A-2 flavoredoxin of desulfovibrio vulgaris (miyazaki f) 0.8349 28 154
5zyr-assembly1.cif.gz_B crystal structure of the reductase (c1) component of p-hydroxyphenylacetate 3-hydroxylase (hpah) from acinetobacter baumannii 0.8346 15 152
ID Description Score Start End Superfamily
2qckA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8852 29 152 2.30.110.10
3bnkA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.871 29 153 2.30.110.10
4l82C00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.869 20 152 2.30.110.10
2r6vA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8545 29 152 2.30.110.10
3rh7E01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8376 15 153 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A3D0CHF5-F1-model_v4 deleted 0.929 29 153
AF-A0A529HSR3-F1-model_v4 Flavin reductase family protein 0.9286 32 153 GO:0006208
GO:0010181
GO:0042602
AF-A0A3N5HPN1-F1-model_v4 Flavin reductase 0.9281 27 153 GO:0010181
GO:0042602
AF-A0A229TWI1-F1-model_v4 Flavin oxidoreductase 0.9189 28 152 GO:0010181
GO:0042602
AF-A0A418Y0W9-F1-model_v4 Flavin reductase 0.9141 26 149 GO:0010181
GO:0042602

Map