F485571

General Info

Members Datasets Scaffolds Average Seq Length
914 450 1828 312

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10018316|Ga0207707_100183164
Length 357
Sequence LGLGWRHARHEAGGTYGFGVSKEKCRRGVRRVVHDNGEAFRGAVSPLLFVDEHTPVLVGEALAALALQAGGYYVDATFGRGGHTALILQALGREGRLLAIDRDPQAIAAGRQRFADEVRLTLVHASFADLAALVPAHAHGLPCGGVLFDLGVSSPQLDDPRRGFSFRSDGPIDMRMDTSRGEPVSAWLARASLDEIREVISTLGEERFARRIAQAIVATRTEHPLTRTNELAALVSRAVRTREPGKHPATRTFQALRMFINDELGQLNRGLNAAVDVISRGGRLAVISFHSLEDRVVKNFFRDESQIDPVFLDLPAIPPEAQPRLRLVGRKSRPSDAEVKRNPRARSALLRVAEKVV

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
184 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
200 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
210 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
223 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
224 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
240 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
254 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
255 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
261 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
262 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
263 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
264 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
265 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
266 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
267 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
268 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
269 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
270 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
271 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
277 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
278 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
279 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
336 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
380 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
381 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
385 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
386 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
399 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
400 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
401 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
402 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
403 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
404 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
405 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
406 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
407 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
408 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
409 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
410 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
411 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
412 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
413 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
414 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
415 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
416 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
417 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
418 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
419 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
420 2547132181 Kosakonia sacchari SP1 Isolate Stem
421 2561511199 Enterobacter sp. R4-368 Isolate Nodule
422 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
423 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
424 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
425 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
426 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
427 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
428 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
429 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
430 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
431 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
432 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
433 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
434 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
435 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
436 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
437 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
438 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
439 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
440 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
441 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
442 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
443 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
444 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
445 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
446 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
447 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
448 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
449 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
450 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0.88
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 2.95
Nodule 0.66
Rhizoplane 3.5
Rhizosphere 84.46
Stem 0.11
Stem Tuber 0.33
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10018316 3300025912 Bacteria 6104
2 JGI24739J22299_10000036 3300001989 Bacteria 37579
3 JGI25162J39368_1002447 3300002737 Bacteria 7205
4 JGI25162J39368_1002514 3300002737 Bacteria 7013
5 JGI25162J39368_1002516 3300002737 Bacteria 7010
6 JGI25152J39213_1000187 3300002773 Bacteria 41763
7 rootH2_10023964 3300003320 Bacteria 15066
8 Ga0058692_1001649 3300003856 Bacteria 8011
9 Ga0058692_1001730 3300003856 Bacteria 7778
10 Ga0058692_1006192 3300003856 Bacteria 3313
11 Ga0065715_10223441 3300005293 Bacteria 1262
12 Ga0070690_100007666 3300005330 Bacteria 6187
13 Ga0070690_100011534 3300005330 Bacteria 5172
14 Ga0070670_100059524 3300005331 Bacteria 3279
15 Ga0070670_100178451 3300005331 Bacteria 1843
16 Ga0070677_10003986 3300005333 Bacteria 4800
17 Ga0068869_100000179 3300005334 Bacteria 32307
18 Ga0068869_100102967 3300005334 Bacteria 2162
19 Ga0068869_100213838 3300005334 Bacteria 1525
20 Ga0070666_10004842 3300005335 Bacteria 8227
21 Ga0070666_10009494 3300005335 Bacteria 6067
22 Ga0070666_10013205 3300005335 Bacteria 5235
23 Ga0070666_10066444 3300005335 Bacteria 2447
24 Ga0070666_10077658 3300005335 Bacteria 2266
25 Ga0070680_100002041 3300005336 Bacteria 14890
26 Ga0070680_100047098 3300005336 Bacteria 3510
27 Ga0070680_100054104 3300005336 Bacteria 3276
28 Ga0070682_100026425 3300005337 Bacteria 3474
29 Ga0068868_100226032 3300005338 Bacteria 1568
30 Ga0070691_10000201 3300005341 Bacteria 20122
31 Ga0070691_10025383 3300005341 Bacteria 2759
32 Ga0070687_100004423 3300005343 Bacteria 5602
33 Ga0070687_100158552 3300005343 Bacteria 1335
34 Ga0070668_100021905 3300005347 Bacteria 4828
35 Ga0070668_100165739 3300005347 Bacteria 1795
36 Ga0070675_100035869 3300005354 Bacteria 4032
37 Ga0070675_100351868 3300005354 Bacteria 1306
38 Ga0070671_100002044 3300005355 Bacteria 15550
39 Ga0070671_100018662 3300005355 Bacteria 5635
40 Ga0070671_100034652 3300005355 Bacteria 4179
41 Ga0070671_100073677 3300005355 Bacteria 2852
42 Ga0070674_100034839 3300005356 Bacteria 3366
43 Ga0070674_100092380 3300005356 Bacteria 2187
44 Ga0070674_100109440 3300005356 Bacteria 2026
45 Ga0070673_100059240 3300005364 Bacteria 3031
46 Ga0070673_100066144 3300005364 Bacteria 2886
47 Ga0070673_100136437 3300005364 Bacteria 2065
48 Ga0070667_100000184 3300005367 Bacteria 75408
49 Ga0070667_100013808 3300005367 Bacteria 6677
50 Ga0070667_100024865 3300005367 Bacteria 4975
51 Ga0070667_100065708 3300005367 Bacteria 3080
52 Ga0070709_10000132 3300005434 Bacteria 49598
53 Ga0070709_10006539 3300005434 Bacteria 6356
54 Ga0070709_10011218 3300005434 Bacteria 4985
55 Ga0070714_100001047 3300005435 Bacteria 19734
56 Ga0070714_100024629 3300005435 Bacteria 4959
57 Ga0070714_100085145 3300005435 Bacteria 2760
58 Ga0070713_100000696 3300005436 Bacteria 21617
59 Ga0070713_100003974 3300005436 Bacteria 9835
60 Ga0070713_100121978 3300005436 Bacteria 2287
61 Ga0070710_10001105 3300005437 Bacteria 12767
62 Ga0070710_10034787 3300005437 Bacteria 2743
63 Ga0070701_10000441 3300005438 Bacteria 14159
64 Ga0070701_10070603 3300005438 Bacteria 1866
65 Ga0070711_100055982 3300005439 Bacteria 2726
66 Ga0070711_100288281 3300005439 Bacteria 1301
67 Ga0070705_100000428 3300005440 Bacteria 24201
68 Ga0070705_100237544 3300005440 Bacteria 1271
69 Ga0070700_100002394 3300005441 Bacteria 9557
70 Ga0070700_100113612 3300005441 Bacteria 1804
71 Ga0070700_100198944 3300005441 Bacteria 1406
72 Ga0070694_100000620 3300005444 Bacteria 19535
73 Ga0070694_100341638 3300005444 Bacteria 1157
74 Ga0070708_100105955 3300005445 Bacteria 2580
75 Ga0070663_100037888 3300005455 Bacteria 3359
76 Ga0070663_100231036 3300005455 Bacteria 1456
77 Ga0070678_100007333 3300005456 Bacteria 6533
78 Ga0070662_100116940 3300005457 Bacteria 2039
79 Ga0070681_10000131 3300005458 Bacteria 56441
80 Ga0070681_10000231 3300005458 Bacteria 43967
81 Ga0070681_10004886 3300005458 Bacteria 12856
82 Ga0070681_10009857 3300005458 Bacteria 9412
83 Ga0070681_10010910 3300005458 Bacteria 8984
84 Ga0070681_10029157 3300005458 Bacteria 5540
85 Ga0070681_10070970 3300005458 Bacteria 3448
86 Ga0070681_10089146 3300005458 Bacteria 3036
87 Ga0070681_10112367 3300005458 Bacteria 2664
88 Ga0068867_100001899 3300005459 Bacteria 14533
89 Ga0068867_100042614 3300005459 Bacteria 3321
90 Ga0068867_100085315 3300005459 Bacteria 2387
91 Ga0070685_10111860 3300005466 Bacteria 1683
92 Ga0070685_10264085 3300005466 Bacteria 1146
93 Ga0070706_100003733 3300005467 Bacteria 14884
94 Ga0070706_100041096 3300005467 Bacteria 4269
95 Ga0070707_100077507 3300005468 Bacteria 3207
96 Ga0070707_100241824 3300005468 Bacteria 1757
97 Ga0070698_100000354 3300005471 Bacteria 47476
98 Ga0070698_100005850 3300005471 Bacteria 13439
99 Ga0070698_100020872 3300005471 Bacteria 6864
100 Ga0070698_100051215 3300005471 Bacteria 4207
101 Ga0070699_100063452 3300005518 Bacteria 3203
102 Ga0070699_100144625 3300005518 Bacteria 2101
103 Ga0070699_100187509 3300005518 Bacteria 1837
104 Ga0070679_100019019 3300005530 Bacteria 6672
105 Ga0070679_100079717 3300005530 Bacteria 3264
106 Ga0070679_100147308 3300005530 Bacteria 2332
107 Ga0070679_100190653 3300005530 Bacteria 2019
108 Ga0070684_100138929 3300005535 Bacteria 2196
109 Ga0070684_100144282 3300005535 Bacteria 2154
110 Ga0070684_100340440 3300005535 Bacteria 1379
111 Ga0070697_100074834 3300005536 Bacteria 2783
112 Ga0070697_100176041 3300005536 Bacteria 1812
113 Ga0068853_100074893 3300005539 Bacteria 2954
114 Ga0070672_100021356 3300005543 Bacteria 4735
115 Ga0070686_100013640 3300005544 Bacteria 4660
116 Ga0070686_100022906 3300005544 Bacteria 3726
117 Ga0070686_100093129 3300005544 Bacteria 2020
118 Ga0070695_100005505 3300005545 Bacteria 7461
119 Ga0070695_100011219 3300005545 Bacteria 5358
120 Ga0070696_100000037 3300005546 Bacteria 62186
121 Ga0070696_100026580 3300005546 Bacteria 3937
122 Ga0070693_100000225 3300005547 Bacteria 26343
123 Ga0070665_100003573 3300005548 Bacteria 16475
124 Ga0070665_100005905 3300005548 Bacteria 12540
125 Ga0070665_100008678 3300005548 Bacteria 10288
126 Ga0070665_100012130 3300005548 Bacteria 8694
127 Ga0070665_100026498 3300005548 Bacteria 5837
128 Ga0070665_100037380 3300005548 Bacteria 4883
129 Ga0070665_100090572 3300005548 Bacteria 3064
130 Ga0070665_100227305 3300005548 Bacteria 1866
131 Ga0070704_100006185 3300005549 Bacteria 7031
132 Ga0068855_100008724 3300005563 Bacteria 12255
133 Ga0068855_100018159 3300005563 Bacteria 8450
134 Ga0068855_100020453 3300005563 Bacteria 7937
135 Ga0068855_100036225 3300005563 Bacteria 5874
136 Ga0068855_100079790 3300005563 Bacteria 3795
137 Ga0068855_100258503 3300005563 Bacteria 1941
138 Ga0070664_100010321 3300005564 Bacteria 7579
139 Ga0068857_100258121 3300005577 Unclassified 1599
140 Ga0068854_100014490 3300005578 Bacteria 5198
141 Ga0068856_100023424 3300005614 Bacteria 6003
142 Ga0068856_100041447 3300005614 Bacteria 4524
143 Ga0068856_100143811 3300005614 Bacteria 2393
144 Ga0068856_100263674 3300005614 Bacteria 1739
145 Ga0068852_100072254 3300005616 Bacteria 3032
146 Ga0068859_100004269 3300005617 Bacteria 14594
147 Ga0068859_100007815 3300005617 Bacteria 10857
148 Ga0068859_100048836 3300005617 Bacteria 4251
149 Ga0068859_100099223 3300005617 Bacteria 2967
150 Ga0068859_100204778 3300005617 Bacteria 2058
151 Ga0068859_100428480 3300005617 Bacteria 1419
152 Ga0068864_100018240 3300005618 Bacteria 5858
153 Ga0068864_100064649 3300005618 Bacteria 3173
154 Ga0068864_100181691 3300005618 Bacteria 1923
155 Ga0068864_100428436 3300005618 Bacteria 1262
156 Ga0068864_100457037 3300005618 Bacteria 1222
157 Ga0068866_10007417 3300005718 Bacteria 4589
158 Ga0068866_10009466 3300005718 Bacteria 4136
159 Ga0068861_100000538 3300005719 Bacteria 22249
160 Ga0068861_100040357 3300005719 Bacteria 3490
161 Ga0068861_100051338 3300005719 Bacteria 3130
162 Ga0068861_100157116 3300005719 Bacteria 1872
163 Ga0068861_100222452 3300005719 Bacteria 1596
164 Ga0068851_10065242 3300005834 Bacteria 1873
165 Ga0068863_100005874 3300005841 Bacteria 12025
166 Ga0068863_100009793 3300005841 Bacteria 9343
167 Ga0068863_100095074 3300005841 Bacteria 2828
168 Ga0068863_100168201 3300005841 Bacteria 2102
169 Ga0068858_100004263 3300005842 Bacteria 14060
170 Ga0068858_100007132 3300005842 Bacteria 10855
171 Ga0068858_100026808 3300005842 Bacteria 5353
172 Ga0068860_100002783 3300005843 Bacteria 18194
173 Ga0068860_100024367 3300005843 Bacteria 5847
174 Ga0068860_100028398 3300005843 Bacteria 5384
175 Ga0068860_100029624 3300005843 Bacteria 5267
176 Ga0068862_100011319 3300005844 Bacteria 7366
177 Ga0068862_100026123 3300005844 Bacteria 4909
178 Ga0068862_100041886 3300005844 Bacteria 3898
179 Ga0068862_100107325 3300005844 Bacteria 2448
180 Ga0068862_100199098 3300005844 Bacteria 1805
181 Ga0068862_100310143 3300005844 Bacteria 1454
182 Ga0068862_100345359 3300005844 Bacteria 1379
183 Ga0081455_10000679 3300005937 Bacteria 44123
184 Ga0081455_10004105 3300005937 Bacteria 16479
185 Ga0081539_10000006 3300005985 Bacteria 534555
186 Ga0070717_10003728 3300006028 Bacteria 10945
187 Ga0070717_10010793 3300006028 Bacteria 6911
188 Ga0070717_10074698 3300006028 Bacteria 2834
189 Ga0070715_10021861 3300006163 Bacteria 2486
190 Ga0070715_10026537 3300006163 Bacteria 2306
191 Ga0070715_10031022 3300006163 Bacteria 2166
192 Ga0070716_100000088 3300006173 Bacteria 36109
193 Ga0070716_100002763 3300006173 Bacteria 8149
194 Ga0070716_100006147 3300006173 Bacteria 5860
195 Ga0070716_100084949 3300006173 Bacteria 1899
196 Ga0070716_100230181 3300006173 Bacteria 1251
197 Ga0070712_100043363 3300006175 Bacteria 3097
198 Ga0070712_100055963 3300006175 Bacteria 2765
199 Ga0097621_100004518 3300006237 Bacteria 9696
200 Ga0097621_100149636 3300006237 Bacteria 2001
201 Ga0068871_100000772 3300006358 Bacteria 21551
202 Ga0068871_100180168 3300006358 Bacteria 1815
203 Ga0075428_100004730 3300006844 Bacteria 15076
204 Ga0075428_100162789 3300006844 Bacteria 2421
205 Ga0075430_100064425 3300006846 Bacteria 3079
206 Ga0075430_100219712 3300006846 Bacteria 1577
207 Ga0075431_100039561 3300006847 Bacteria 4858
208 Ga0075431_100073118 3300006847 Bacteria 3537
209 Ga0075433_10006653 3300006852 Bacteria 9153
210 Ga0075433_10022836 3300006852 Bacteria 5256
211 Ga0075433_10065305 3300006852 Bacteria 3192
212 Ga0075434_100013542 3300006871 Bacteria 7767
213 Ga0075434_100358853 3300006871 Bacteria 1478
214 Ga0075429_100002677 3300006880 Bacteria 14995
215 Ga0075429_100326419 3300006880 Bacteria 1343
216 Ga0068865_100000628 3300006881 Bacteria 19880
217 Ga0068865_100018665 3300006881 Bacteria 4479
218 Ga0068865_100074213 3300006881 Bacteria 2421
219 Ga0068865_100097540 3300006881 Bacteria 2145
220 Ga0075436_100006378 3300006914 Bacteria 8083
221 Ga0075436_100090533 3300006914 Bacteria 2127
222 Ga0075436_100108320 3300006914 Bacteria 1938
223 Ga0097620_100004269 3300006931 Bacteria 14594
224 Ga0097620_100007814 3300006931 Bacteria 10857
225 Ga0097620_100048836 3300006931 Bacteria 4251
226 Ga0097620_100099227 3300006931 Bacteria 2967
227 Ga0097620_100204784 3300006931 Bacteria 2058
228 Ga0097620_100428449 3300006931 Bacteria 1419
229 Ga0079104_1000308 3300006946 Bacteria 61968
230 Ga0079104_1001380 3300006946 Bacteria 16519
231 Ga0079104_1003875 3300006946 Bacteria 6697
232 Ga0075435_100007394 3300007076 Bacteria 7823
233 Ga0075435_100387134 3300007076 Bacteria 1201
234 Ga0099794_10008883 3300007265 Bacteria 4189
235 Ga0099795_10008084 3300007788 Bacteria 2979
236 Ga0105251_10002158 3300009011 Bacteria 15783
237 Ga0105251_10015033 3300009011 Bacteria 4246
238 Ga0105244_10000293 3300009036 Bacteria 49039
239 Ga0105240_10008075 3300009093 Bacteria 15126
240 Ga0105240_10085320 3300009093 Bacteria 3869
241 Ga0105240_10088147 3300009093 Bacteria 3798
242 Ga0105240_10517562 3300009093 Bacteria 1324
243 Ga0111539_10455538 3300009094 Unclassified 1490
244 Ga0105245_10000951 3300009098 Bacteria 26343
245 Ga0105247_10002396 3300009101 Bacteria 12742
246 Ga0105247_10061333 3300009101 Bacteria 2331
247 Ga0114129_10000841 3300009147 Bacteria 39754
248 Ga0114129_10007905 3300009147 Bacteria 15138
249 Ga0105243_10002746 3300009148 Bacteria 14634
250 Ga0105241_10095262 3300009174 Bacteria 2356
251 Ga0105242_10000779 3300009176 Bacteria 24760
252 Ga0105242_10021808 3300009176 Bacteria 5034
253 Ga0105248_10006682 3300009177 Bacteria 12658
254 Ga0105248_10057294 3300009177 Bacteria 4373
255 Ga0105248_10197860 3300009177 Bacteria 2264
256 Ga0105237_10140737 3300009545 Bacteria 2407
257 Ga0105237_10258577 3300009545 Bacteria 1744
258 Ga0105237_10278974 3300009545 Bacteria 1674
259 Ga0105237_10302991 3300009545 Bacteria 1601
260 Ga0105237_10433665 3300009545 Bacteria 1320
261 Ga0105237_10495323 3300009545 Bacteria 1228
262 Ga0105249_10000995 3300009553 Bacteria 25125
263 Ga0105249_10017575 3300009553 Bacteria 6349
264 Ga0105249_10043968 3300009553 Bacteria 4062
265 Ga0105249_10180346 3300009553 Bacteria 2054
266 Ga0105239_10010533 3300010375 Bacteria 10337
267 Ga0105239_10037988 3300010375 Bacteria 5276
268 Ga0105239_10052409 3300010375 Bacteria 4474
269 Ga0105239_10233331 3300010375 Bacteria 2065
270 Ga0105239_10491273 3300010375 Bacteria 1395
271 Ga0105246_10027556 3300011119 Bacteria 3724
272 Ga0105246_10118887 3300011119 Bacteria 1955
273 Ga0105246_10129408 3300011119 Bacteria 1883
274 Ga0157373_10009701 3300013100 Bacteria 7105
275 Ga0157371_10014930 3300013102 Bacteria 5844
276 Ga0157371_10016478 3300013102 Bacteria 5513
277 Ga0157371_10035692 3300013102 Bacteria 3562
278 Ga0157370_10000452 3300013104 Bacteria 51362
279 Ga0157370_10118437 3300013104 Bacteria 2473
280 Ga0157369_10001732 3300013105 Bacteria 26524
281 Ga0157369_10035219 3300013105 Bacteria 5490
282 Ga0157369_10140326 3300013105 Bacteria 2557
283 Ga0157369_10620257 3300013105 Bacteria 1116
284 Ga0157374_10023374 3300013296 Bacteria 5530
285 Ga0157374_10238651 3300013296 Bacteria 1787
286 Ga0157374_10304336 3300013296 Bacteria 1577
287 Ga0157378_10000590 3300013297 Bacteria 34084
288 Ga0157378_10054853 3300013297 Bacteria 3549
289 Ga0163162_10072025 3300013306 Bacteria 3510
290 Ga0163162_10288648 3300013306 Bacteria 1772
291 Ga0163162_10376876 3300013306 Bacteria 1552
292 Ga0157372_10001062 3300013307 Bacteria 30024
293 Ga0157372_10341051 3300013307 Bacteria 1745
294 Ga0157375_10061997 3300013308 Bacteria 3714
295 Ga0157375_10288654 3300013308 Bacteria 1803
296 Ga0163163_10018471 3300014325 Bacteria 6528
297 Ga0163163_10029120 3300014325 Bacteria 5310
298 Ga0163163_10146475 3300014325 Bacteria 2405
299 Ga0163163_10202981 3300014325 Bacteria 2031
300 Ga0157379_10036534 3300014968 Bacteria 4380
301 Ga0157379_10225498 3300014968 Bacteria 1698
302 Ga0157376_10005783 3300014969 Bacteria 8664
303 Ga0157376_10007674 3300014969 Bacteria 7727
304 Ga0157376_10184983 3300014969 Bacteria 1907
305 Ga0182006_1007687 3300015261 Bacteria 4923
306 Ga0163161_10120572 3300017792 Bacteria 1970
307 Ga0206353_11229857 3300020082 Bacteria 1166
308 Ga0213874_10012646 3300021377 Bacteria 2169
309 Ga0213875_10017205 3300021388 Bacteria 3498
310 Ga0213875_10074012 3300021388 Bacteria 1589
311 Ga0224712_10021090 3300022467 Bacteria 2224
312 Ga0224572_1000869 3300024225 Bacteria 4061
313 Ga0207425_1006279 3300025245 Bacteria 3268
314 Ga0209759_1008745 3300025256 Bacteria 3129
315 Ga0209129_1000008 3300025258 Bacteria 640959
316 Ga0209256_1020720 3300025299 Unclassified 2042
317 Ga0207655_1000026 3300025728 Bacteria 445528
318 Ga0207655_1001273 3300025728 Bacteria 24068
319 Ga0207655_1003937 3300025728 Bacteria 10769
320 Ga0207655_1031276 3300025728 Bacteria 2456
321 Ga0207692_10000891 3300025898 Bacteria 10795
322 Ga0207692_10035485 3300025898 Bacteria 2423
323 Ga0207692_10202050 3300025898 Bacteria 1169
324 Ga0207642_10055381 3300025899 Bacteria 1814
325 Ga0207642_10273093 3300025899 Bacteria 969
326 Ga0207710_10001639 3300025900 Bacteria 10932
327 Ga0207680_10006851 3300025903 Bacteria 5530
328 Ga0207680_10134934 3300025903 Bacteria 1630
329 Ga0207680_10141296 3300025903 Bacteria 1596
330 Ga0207685_10002959 3300025905 Bacteria 4025
331 Ga0207685_10017353 3300025905 Bacteria 2325
332 Ga0207685_10047295 3300025905 Bacteria 1641
333 Ga0207699_10000165 3300025906 Bacteria 40682
334 Ga0207699_10002296 3300025906 Bacteria 9033
335 Ga0207699_10123006 3300025906 Bacteria 1681
336 Ga0207699_10298086 3300025906 Bacteria 1125
337 Ga0207643_10058094 3300025908 Bacteria 2203
338 Ga0207643_10071466 3300025908 Bacteria 1998
339 Ga0207684_10132377 3300025910 Bacteria 2140
340 Ga0207654_10049177 3300025911 Bacteria 2417
341 Ga0207654_10253900 3300025911 Bacteria 1180
342 Ga0207707_10000075 3300025912 Bacteria 101459
343 Ga0207707_10000115 3300025912 Bacteria 81416
344 Ga0207707_10000140 3300025912 Bacteria 74787
345 Ga0207707_10000148 3300025912 Bacteria 73167
346 Ga0207707_10001203 3300025912 Bacteria 24355
347 Ga0207707_10002174 3300025912 Bacteria 17735
348 Ga0207707_10064108 3300025912 Bacteria 3198
349 Ga0207707_10086326 3300025912 Bacteria 2742
350 Ga0207707_10192374 3300025912 Bacteria 1780
351 Ga0207695_10012932 3300025913 Bacteria 9985
352 Ga0207695_10020357 3300025913 Bacteria 7603
353 Ga0207695_10021988 3300025913 Bacteria 7259
354 Ga0207695_10052459 3300025913 Bacteria 4273
355 Ga0207695_10129619 3300025913 Bacteria 2481
356 Ga0207693_10000711 3300025915 Bacteria 29948
357 Ga0207693_10000836 3300025915 Bacteria 27414
358 Ga0207693_10012599 3300025915 Bacteria 6831
359 Ga0207693_10167930 3300025915 Bacteria 1728
360 Ga0207663_10044739 3300025916 Bacteria 2719
361 Ga0207663_10082137 3300025916 Bacteria 2113
362 Ga0207663_10147814 3300025916 Bacteria 1645
363 Ga0207660_10010953 3300025917 Bacteria 5894
364 Ga0207660_10045704 3300025917 Bacteria 3085
365 Ga0207660_10068410 3300025917 Bacteria 2575
366 Ga0207660_10218379 3300025917 Unclassified 1495
367 Ga0207662_10000144 3300025918 Bacteria 34347
368 Ga0207649_10248195 3300025920 Bacteria 1281
369 Ga0207652_10019843 3300025921 Bacteria 5533
370 Ga0207652_10024846 3300025921 Bacteria 4973
371 Ga0207652_10042962 3300025921 Bacteria 3848
372 Ga0207652_10066650 3300025921 Bacteria 3121
373 Ga0207652_10069283 3300025921 Bacteria 3062
374 Ga0207652_10162625 3300025921 Bacteria 2001
375 Ga0207646_10039379 3300025922 Bacteria 4255
376 Ga0207646_10354989 3300025922 Bacteria 1325
377 Ga0207694_10046411 3300025924 Bacteria 3358
378 Ga0207694_10056274 3300025924 Unclassified 3054
379 Ga0207650_10113946 3300025925 Bacteria 2097
380 Ga0207650_10119403 3300025925 Bacteria 2050
381 Ga0207659_10055705 3300025926 Bacteria 2829
382 Ga0207687_10000617 3300025927 Bacteria 23998
383 Ga0207687_10126406 3300025927 Bacteria 1920
384 Ga0207700_10000297 3300025928 Bacteria 29514
385 Ga0207700_10043034 3300025928 Bacteria 3315
386 Ga0207700_10095243 3300025928 Bacteria 2361
387 Ga0207700_10220300 3300025928 Bacteria 1608
388 Ga0207664_10000224 3300025929 Bacteria 42785
389 Ga0207644_10000718 3300025931 Bacteria 20967
390 Ga0207644_10027518 3300025931 Bacteria 3928
391 Ga0207690_10155587 3300025932 Bacteria 1699
392 Ga0207686_10000533 3300025934 Bacteria 24601
393 Ga0207686_10068527 3300025934 Bacteria 2273
394 Ga0207709_10000671 3300025935 Bacteria 27699
395 Ga0207670_10002758 3300025936 Bacteria 9248
396 Ga0207669_10009150 3300025937 Bacteria 4701
397 Ga0207704_10071469 3300025938 Bacteria 2202
398 Ga0207704_10392890 3300025938 Bacteria 1092
399 Ga0207665_10000698 3300025939 Bacteria 22766
400 Ga0207665_10013863 3300025939 Bacteria 5301
401 Ga0207665_10014003 3300025939 Bacteria 5275
402 Ga0207665_10019995 3300025939 Bacteria 4400
403 Ga0207665_10049980 3300025939 Bacteria 2811
404 Ga0207665_10335800 3300025939 Bacteria 1137
405 Ga0207691_10361689 3300025940 Bacteria 1241
406 Ga0207711_10037440 3300025941 Bacteria 4120
407 Ga0207711_10317464 3300025941 Bacteria 1439
408 Ga0207689_10014975 3300025942 Bacteria 6579
409 Ga0207661_10077971 3300025944 Bacteria 2726
410 Ga0207661_10089530 3300025944 Bacteria 2561
411 Ga0207679_10009229 3300025945 Bacteria 6306
412 Ga0207679_10012674 3300025945 Bacteria 5503
413 Ga0207667_10006818 3300025949 Bacteria 13802
414 Ga0207667_10017408 3300025949 Bacteria 8089
415 Ga0207667_10067590 3300025949 Bacteria 3722
416 Ga0207651_10121974 3300025960 Bacteria 1978
417 Ga0207651_10167307 3300025960 Bacteria 1730
418 Ga0207712_10009011 3300025961 Bacteria 6312
419 Ga0207712_10025418 3300025961 Bacteria 3934
420 Ga0207712_10026592 3300025961 Bacteria 3857
421 Ga0207712_10396989 3300025961 Bacteria 1158
422 Ga0207640_10003394 3300025981 Bacteria 8581
423 Ga0207658_10001013 3300025986 Bacteria 22929
424 Ga0207658_10009144 3300025986 Bacteria 6722
425 Ga0207677_10073331 3300026023 Bacteria 2424
426 Ga0207677_10108147 3300026023 Bacteria 2064
427 Ga0207703_10001997 3300026035 Bacteria 17998
428 Ga0207703_10027866 3300026035 Bacteria 4449
429 Ga0207639_10183137 3300026041 Bacteria 1783
430 Ga0207639_10215465 3300026041 Bacteria 1655
431 Ga0207678_10015060 3300026067 Bacteria 6803
432 Ga0207678_10116209 3300026067 Bacteria 2282
433 Ga0207708_10000427 3300026075 Bacteria 32845
434 Ga0207708_10249449 3300026075 Bacteria 1430
435 Ga0207702_10187012 3300026078 Bacteria 1911
436 Ga0207702_10327155 3300026078 Bacteria 1461
437 Ga0207641_10001033 3300026088 Bacteria 28219
438 Ga0207641_10094596 3300026088 Unclassified 2621
439 Ga0207641_10134247 3300026088 Bacteria 2226
440 Ga0207648_10000018 3300026089 Bacteria 148157
441 Ga0207648_10055430 3300026089 Bacteria 3460
442 Ga0207648_10168017 3300026089 Bacteria 1938
443 Ga0207648_10200052 3300026089 Bacteria 1772
444 Ga0207648_10455939 3300026089 Bacteria 1165
445 Ga0207676_10010945 3300026095 Bacteria 6475
446 Ga0207676_10462659 3300026095 Bacteria 1198
447 Ga0207675_100000050 3300026118 Bacteria 83832
448 Ga0207675_100102318 3300026118 Bacteria 2700
449 Ga0207675_100195591 3300026118 Bacteria 1941
450 Ga0207683_10017307 3300026121 Bacteria 6141
451 Ga0207683_10019930 3300026121 Bacteria 5731
452 Ga0207683_10098090 3300026121 Bacteria 2614
453 Ga0207698_10012742 3300026142 Bacteria 5518
454 Ga0207698_10529242 3300026142 Bacteria 1152
455 Ga0209281_1000058 3300027111 Bacteria 300244
456 Ga0209281_1001193 3300027111 Bacteria 17757
457 Ga0209371_1000014 3300027312 Bacteria 661118
458 Ga0209371_1000054 3300027312 Bacteria 259676
459 Ga0209984_1002678 3300027424 Bacteria 2000
460 Ga0209995_1000886 3300027471 Bacteria 4644
461 Ga0209995_1014840 3300027471 Bacteria 1277
462 Ga0209179_1001321 3300027512 Bacteria 2996
463 Ga0209970_1005815 3300027614 Bacteria 2027
464 Ga0209983_1003351 3300027665 Bacteria 3433
465 Ga0209588_1014068 3300027671 Bacteria 2447
466 Ga0209588_1016014 3300027671 Bacteria 2310
467 Ga0209971_1001514 3300027682 Bacteria 5753
468 Ga0209974_10008018 3300027876 Bacteria 3620
469 Ga0207428_10001317 3300027907 Bacteria 26410
470 Ga0268266_10002891 3300028379 Bacteria 17806
471 Ga0268266_10007953 3300028379 Bacteria 9481
472 Ga0268266_10022791 3300028379 Bacteria 5331
473 Ga0268266_10049644 3300028379 Bacteria 3598
474 Ga0268266_10062739 3300028379 Bacteria 3208
475 Ga0268266_10108480 3300028379 Bacteria 2456
476 Ga0268266_10120601 3300028379 Bacteria 2333
477 Ga0268266_10379280 3300028379 Bacteria 1333
478 Ga0268265_10017012 3300028380 Bacteria 5007
479 Ga0268265_10039433 3300028380 Bacteria 3482
480 Ga0268265_10050324 3300028380 Bacteria 3139
481 Ga0268265_10072968 3300028380 Bacteria 2679
482 Ga0268265_10151055 3300028380 Bacteria 1959
483 Ga0268265_10220746 3300028380 Bacteria 1658
484 Ga0268264_10000198 3300028381 Bacteria 122906
485 Ga0268264_10001294 3300028381 Bacteria 23624
486 Ga0268264_10018094 3300028381 Bacteria 5763
487 Ga0268264_10185648 3300028381 Unclassified 1892
488 Ga0307515_10003416 3300028794 Bacteria 33442
489 Ga0265338_10034673 3300028800 Bacteria 4873
490 Ga0268256_1000012 3300030500 Bacteria 794553
491 Ga0268256_1000021 3300030500 Bacteria 542735
492 Ga0307511_10000048 3300030521 Bacteria 98665
493 Ga0307511_10009582 3300030521 Bacteria 9647
494 Ga0265328_10014425 3300031239 Bacteria 3112
495 Ga0265340_10024043 3300031247 Bacteria 3098
496 Ga0265340_10054871 3300031247 Bacteria 1921
497 Ga0265339_10107866 3300031249 Bacteria 1444
498 Ga0265331_10010845 3300031250 Bacteria 5012
499 Ga0265327_10003233 3300031251 Bacteria 15840
500 Ga0307513_10013985 3300031456 Bacteria 9831
501 Ga0307513_10028805 3300031456 Bacteria 6343
502 Ga0307513_10156325 3300031456 Bacteria 2179
503 Ga0307509_10000017 3300031507 Bacteria 265012
504 Ga0307509_10000803 3300031507 Bacteria 53898
505 Ga0307509_10136691 3300031507 Bacteria 2395
506 Ga0307408_100027435 3300031548 Bacteria 3924
507 Ga0316575_10034701 3300031665 Bacteria 1982
508 Ga0316579_10000158 3300031691 Bacteria 19318
509 Ga0316579_10006029 3300031691 Bacteria 4922
510 Ga0316576_10009427 3300031727 Bacteria 6299
511 Ga0316576_10024964 3300031727 Bacteria 4180
512 Ga0316576_10029895 3300031727 Bacteria 3854
513 Ga0316576_10136287 3300031727 Bacteria 1847
514 Ga0316578_10056886 3300031728 Bacteria 2297
515 Ga0316578_10127593 3300031728 Bacteria 1530
516 Ga0316577_10003059 3300031733 Bacteria 8392
517 Ga0316577_10072152 3300031733 Bacteria 1927
518 Ga0307413_10004776 3300031824 Bacteria 5950
519 Ga0307410_10000500 3300031852 Bacteria 15951
520 Ga0307407_10021514 3300031903 Bacteria 3328
521 Ga0307412_10077641 3300031911 Bacteria 2285
522 Ga0307409_100000732 3300031995 Bacteria 14712
523 Ga0307409_100438604 3300031995 Bacteria 1257
524 Ga0307416_100146625 3300032002 Bacteria 2156
525 Ga0307416_100178547 3300032002 Bacteria 1987
526 Ga0307414_10143163 3300032004 Bacteria 1875
527 Ga0307414_10264018 3300032004 Bacteria 1438
528 Ga0307411_10060016 3300032005 Bacteria 2523
529 Ga0307411_10282903 3300032005 Bacteria 1321
530 Ga0316583_10021096 3300032133 Bacteria 2336
531 Ga0316585_10001855 3300032137 Bacteria 5648
532 Ga0316593_10004339 3300032168 Bacteria 3632
533 Ga0316593_10004729 3300032168 Unclassified 3523
534 Ga0316593_10007343 3300032168 Bacteria 3023
535 Ga0316593_10023661 3300032168 Bacteria 1941
536 Ga0316593_10026155 3300032168 Bacteria 1863
537 Ga0316593_10103175 3300032168 Bacteria 1013
538 Ga0307510_10000002 3300033180 Bacteria 801565
539 Ga0307510_10063197 3300033180 Bacteria 3773
540 Ga0373938_0036310 3300034957 Bacteria 1078
541 Ga0373926_0002919 3300035083 Bacteria 5481
542 Ga0373926_0005260 3300035083 Bacteria 4259
543 Ga0373926_0028007 3300035083 Bacteria 1976
544 Ga0373934_0003089 3300035086 Bacteria 6079
545 Ga0373944_0000876 3300035089 Bacteria 7419
546 Ga0373949_0028016 3300035090 Bacteria 1328
547 Ga0373923_0074354 3300035111 Bacteria 1464
548 Ga0373923_0088128 3300035111 Bacteria 1354
549 Ga0373932_0001979 3300035112 Bacteria 5406
550 Ga0373936_0000488 3300035113 Bacteria 13427
551 Ga0373936_0006850 3300035113 Bacteria 4288
552 Ga0373936_0033970 3300035113 Bacteria 2024
553 Ga0373945_0004013 3300035116 Bacteria 4654
554 Ga0373945_0008747 3300035116 Bacteria 3304
555 Ga0373954_0002373 3300035118 Bacteria 7874
556 Ga0373954_0055222 3300035118 Bacteria 1868
557 Ga0373956_0077750 3300035119 Bacteria 1519
558 Ga0373943_0004831 3300035170 Bacteria 6092
559 Ga0373943_0016313 3300035170 Bacteria 3385
560 Ga0373943_0078886 3300035170 Bacteria 1684
561 Ga0373946_0000439 3300035171 Bacteria 13619
562 Ga0373946_0026733 3300035171 Bacteria 2278
563 Ga0373946_0029774 3300035171 Bacteria 2176
564 Ga0373946_0032111 3300035171 Bacteria 2107
565 Ga0373955_0059225 3300035172 Bacteria 2109
566 Ga0373955_0099325 3300035172 Bacteria 1668
567 Ga0316574_0007609 3300035398 Bacteria 5950
568 Ga0316574_0016469 3300035398 Bacteria 4309
569 Ga0316574_0033450 3300035398 Bacteria 3129
570 Ga0316574_0037376 3300035398 Bacteria 2978
571 Ga0316574_0073569 3300035398 Bacteria 2161
572 Ga0316574_0074137 3300035398 Bacteria 2153
573 Ga0316574_0099000 3300035398 Bacteria 1865
574 Ga0316574_0134428 3300035398 Bacteria 1592
575 Ga0373931_0030542 3300035691 Bacteria 2774
576 Ga0373931_0134062 3300035691 Bacteria 1428
577 Ga0373935_0000618 3300035692 Bacteria 18647
578 Ga0373935_0004234 3300035692 Bacteria 8414
579 Ga0373927_0000383 3300035695 Bacteria 34290
580 Ga0373927_0117777 3300035695 Bacteria 1732
581 Ga0373933_0010727 3300035724 Bacteria 5026
582 Ga0373947_0000002 3300035725 Bacteria 383924
583 Ga0373947_0005590 3300035725 Bacteria 7330
584 Ga0373947_0059036 3300035725 Bacteria 2325
585 Ga0373947_0109028 3300035725 Bacteria 1747
586 Ga0373937_0035130 3300036401 Bacteria 4560
587 Ga0316582_0004967 3300036647 Bacteria 6795
588 Ga0316582_0064613 3300036647 Bacteria 2354
589 Ga0316582_0084293 3300036647 Bacteria 2080
590 Ga0316584_0030898 3300036712 Bacteria 3959
591 Ga0316584_0053695 3300036712 Bacteria 3016
592 Ga0316584_0066260 3300036712 Bacteria 2706
593 Ga0373925_0005223 3300037068 Bacteria 9707
594 Ga0373925_0008937 3300037068 Bacteria 7300
595 Ga0373925_0013418 3300037068 Bacteria 5928
596 Ga0373925_0038319 3300037068 Bacteria 3543
597 Ga0395900_0000060 3300037418 Bacteria 205509
598 Ga0395900_0089295 3300037418 Bacteria 3168
599 Ga0395900_0216386 3300037418 Bacteria 1933
600 Ga0395898_0083235 3300037466 Bacteria 3084
601 Ga0436364_0260906 3300037853 Bacteria 21582
602 Ga0400484_23031 3300038725 Bacteria 6518
603 Ga0400484_27744 3300038725 Bacteria 2344
604 Ga0400490_45667 3300038726 Bacteria 1291
605 Ga0400483_055564 3300039062 Bacteria 3939
606 Ga0400483_086083 3300039062 Bacteria 1660
607 Ga0400483_093671 3300039062 Bacteria 1758
608 Ga0400483_201732 3300039062 Bacteria 4012
609 Ga0400483_280570 3300039062 Bacteria 2951
610 Ga0436365_0360171 3300039437 Bacteria 13869
611 Ga0436365_1274404 3300039437 Bacteria 1696
612 Ga0436365_1414349 3300039437 Bacteria 6345
613 Ga0436360_1005797 3300039438 Bacteria 6145
614 Ga0436361_0576483 3300039447 Bacteria 1996
615 Ga0436363_0296494 3300039450 Bacteria 2831
616 Ga0436363_0375975 3300039450 Bacteria 36949
617 Ga0436363_1127370 3300039450 Bacteria 2313
618 Ga0436363_1153079 3300039450 Bacteria 1351
619 Ga0436363_1648012 3300039450 Bacteria 2447
620 Ga0439436_0011487 3300041404 Bacteria 2689
621 Ga0439447_003544 3300041407 Bacteria 5531
622 Ga0451789_1314313 3300041443 Bacteria 3094
623 Ga0451793_0368982 3300041452 Bacteria 1212
624 Ga0451802_1342131 3300041460 Bacteria 1915
625 Ga0451837_0466646 3300041494 Bacteria 1810
626 Ga0451841_0078952 3300041498 Bacteria 1172
627 Ga0439432_002736 3300042006 Bacteria 6589
628 Ga0439432_004394 3300042006 Bacteria 5151
629 Ga0439451_005425 3300042009 Bacteria 2599
630 Ga0439451_007565 3300042009 Bacteria 2211
631 Ga0439452_000004 3300042010 Bacteria 764268
632 Ga0439452_000005 3300042010 Bacteria 646919
633 Ga0439452_000428 3300042010 Bacteria 24279
634 Ga0439452_008326 3300042010 Bacteria 3129
635 Ga0439444_0001930 3300042437 Bacteria 2765
636 Ga0439460_0000378 3300042461 Bacteria 9469
637 Ga0451577_0016678 3300042876 Bacteria 6793
638 Ga0451577_0057889 3300042876 Bacteria 3454
639 Ga0466969_0000960 3300044656 Bacteria 15534
640 Ga0466969_0005735 3300044656 Bacteria 6600
641 Ga0466969_0118262 3300044656 Bacteria 1235
642 Ga0466966_0009008 3300044684 Bacteria 6614
643 Ga0466966_0053439 3300044684 Bacteria 2563
644 Ga0466963_0112886 3300044694 Bacteria 1866
645 Ga0453684_0045609 3300044712 Bacteria 5844
646 Ga0466971_0001123 3300044719 Bacteria 11133
647 Ga0466968_0027250 3300044735 Bacteria 2351
648 Ga0466970_0046170 3300044765 Bacteria 2320
649 Ga0466957_0024169 3300044842 Bacteria 3595
650 Ga0466960_0013133 3300044901 Bacteria 3512
651 Ga0466959_0014029 3300045049 Bacteria 5816
652 Ga0466959_0034640 3300045049 Bacteria 3735
653 Ga0466959_0053806 3300045049 Bacteria 2942
654 Ga0451576_0000217 3300045051 Bacteria 142222
655 Ga0451576_0067931 3300045051 Bacteria 3710
656 Ga0451576_0091467 3300045051 Bacteria 3165
657 Ga0466958_0036183 3300045836 Bacteria 2954
658 Ga0466958_0072990 3300045836 Bacteria 2102
659 Ga0466967_0042746 3300045976 Bacteria 3918
660 Ga0466967_0161509 3300045976 Bacteria 2103
661 Ga0495592_0010288 3300046454 Bacteria 7053
662 Ga0495592_0120274 3300046454 Bacteria 1848
663 Ga0495603_0010466 3300046455 Bacteria 5619
664 Ga0495590_0002047 3300046457 Bacteria 8457
665 Ga0495629_0347594 3300046459 Bacteria 1012
666 Ga0495638_0076082 3300046460 Bacteria 2045
667 Ga0495638_0160552 3300046460 Bacteria 1297
668 Ga0495641_0042287 3300046461 Bacteria 2112
669 Ga0495653_0006412 3300046463 Bacteria 9646
670 Ga0495580_0001506 3300046472 Bacteria 20489
671 Ga0495580_0015225 3300046472 Bacteria 5811
672 Ga0495580_0043965 3300046472 Bacteria 3178
673 Ga0495582_0037643 3300046473 Bacteria 2661
674 Ga0495639_0002165 3300046475 Bacteria 8661
675 Ga0495639_0032526 3300046475 Bacteria 2326
676 Ga0495662_0013627 3300046476 Bacteria 3958
677 Ga0495664_0004691 3300046477 Bacteria 7476
678 Ga0495584_0023980 3300046491 Bacteria 3093
679 Ga0495594_0082982 3300046499 Bacteria 1791
680 Ga0495594_0151865 3300046499 Bacteria 1315
681 Ga0495596_0027282 3300046500 Bacteria 2298
682 Ga0495583_0021099 3300046506 Bacteria 3356
683 Ga0495608_0144824 3300046511 Bacteria 1515
684 Ga0495618_0093151 3300046514 Bacteria 1926
685 Ga0495628_0056228 3300046516 Bacteria 3098
686 Ga0495630_0028591 3300046517 Bacteria 4143
687 Ga0495630_0039960 3300046517 Bacteria 3506
688 Ga0495630_0293994 3300046517 Bacteria 1241
689 Ga0495648_0013861 3300046524 Bacteria 5935
690 Ga0495648_0117804 3300046524 Bacteria 1433
691 Ga0495666_0046639 3300046526 Bacteria 2088
692 Ga0495665_0051846 3300046531 Bacteria 2173
693 Ga0495640_0053821 3300046533 Bacteria 2758
694 Ga0495586_0004720 3300046535 Bacteria 7284
695 Ga0495586_0004892 3300046535 Bacteria 7164
696 Ga0495587_0097364 3300046536 Bacteria 1696
697 Ga0495667_0036525 3300046559 Bacteria 3279
698 Ga0495667_0068892 3300046559 Bacteria 2309
699 Ga0495656_0004463 3300046615 Bacteria 4796
700 Ga0495668_0148242 3300046616 Bacteria 1285
701 Ga0495634_0041752 3300046642 Bacteria 3114
702 Ga0495625_0029573 3300046660 Bacteria 4095
703 Ga0495635_0000464 3300046663 Bacteria 25665
704 Ga0495657_0088806 3300046675 Bacteria 1986
705 Ga0495657_0166310 3300046675 Bacteria 1361
706 Ga0495599_0046240 3300046678 Bacteria 2729
707 Ga0495599_0065356 3300046678 Bacteria 2273
708 Ga0495646_0129415 3300046680 Bacteria 1422
709 Ga0495647_0001482 3300046681 Bacteria 7280
710 Ga0495647_0003243 3300046681 Bacteria 5205
711 Ga0495658_0006801 3300046683 Bacteria 5628
712 Ga0495658_0085759 3300046683 Bacteria 1856
713 Ga0495671_0024188 3300046692 Bacteria 3166
714 Ga0495649_0003326 3300046694 Bacteria 10920
715 Ga0495600_0003135 3300046809 Bacteria 9677
716 Ga0495581_0064804 3300047315 Bacteria 2111
717 Ga0495604_0155405 3300047317 Bacteria 1621
718 Ga0495674_0094152 3300047319 Bacteria 2555
719 Ga0495676_0038206 3300047321 Bacteria 3989
720 Ga0495676_0116557 3300047321 Bacteria 1950
721 Ga0495680_0035758 3300047322 Bacteria 3996
722 Ga0495675_0036099 3300047444 Bacteria 3154
723 Ga0495681_0133669 3300047470 Bacteria 1054
724 Ga0495684_0024315 3300047471 Bacteria 4663
725 Ga0495602_0083747 3300048088 Bacteria 2671
726 Ga0495602_0238165 3300048088 Bacteria 1363
727 Ga0495615_0025199 3300048090 Bacteria 1379
728 Ga0495626_0097765 3300048091 Bacteria 1283
729 Ga0496100_0077976 3300048903 Bacteria 2229
730 Ga0496100_0117923 3300048903 Bacteria 1853
731 Ga0496102_0024944 3300048905 Bacteria 5318
732 Ga0496102_0032576 3300048905 Bacteria 4682
733 Ga0496103_0078166 3300048906 Bacteria 2078
734 Ga0496104_0448094 3300048907 Bacteria 1203
735 Ga0496105_0121352 3300048908 Bacteria 2155
736 Ga0496107_0099375 3300048910 Bacteria 2132
737 Ga0496108_0021701 3300048911 Bacteria 5279
738 Ga0496108_0446951 3300048911 Bacteria 1129
739 Ga0496109_0028132 3300048912 Bacteria 5026
740 Ga0496109_0200936 3300048912 Bacteria 1874
741 Ga0496110_0038938 3300048913 Bacteria 4138
742 Ga0496111_0003521 3300048914 Bacteria 9689
743 Ga0496112_0113896 3300048915 Bacteria 2675
744 Ga0496112_0175623 3300048915 Bacteria 2107
745 Ga0496112_0290370 3300048915 Bacteria 1581
746 Ga0496113_0086931 3300048916 Bacteria 2403
747 Ga0496114_0034713 3300048917 Bacteria 4162
748 Ga0496115_0021506 3300048918 Bacteria 4985
749 Ga0496115_0127037 3300048918 Bacteria 2101
750 Ga0496115_0194916 3300048918 Bacteria 1674
751 Ga0496116_0000217 3300048919 Bacteria 108128
752 Ga0496116_0032636 3300048919 Bacteria 3707
753 Ga0496116_0089752 3300048919 Bacteria 1873
754 Ga0496117_0000135 3300048920 Bacteria 160708
755 Ga0496117_0001101 3300048920 Bacteria 40741
756 Ga0496117_0005290 3300048920 Bacteria 13669
757 Ga0496118_0000098 3300048921 Bacteria 160610
758 Ga0496118_0002338 3300048921 Bacteria 25715
759 Ga0496118_0085298 3300048921 Bacteria 2199
760 Ga0496119_0000026 3300048922 Bacteria 254759
761 Ga0496119_0081790 3300048922 Bacteria 1859
762 Ga0496120_0000543 3300048923 Bacteria 57596
763 Ga0496120_0031913 3300048923 Bacteria 3182
764 Ga0496120_0071899 3300048923 Bacteria 1897
765 Ga0496121_0023475 3300048924 Bacteria 5938
766 Ga0496121_0166063 3300048924 Bacteria 1608
767 Ga0496124_0000142 3300048927 Bacteria 147311
768 Ga0496124_0007498 3300048927 Bacteria 11584
769 Ga0496124_0078346 3300048927 Bacteria 2724
770 Ga0496125_0002765 3300048928 Bacteria 22202
771 Ga0496125_0014965 3300048928 Bacteria 7531
772 Ga0496125_0028906 3300048928 Bacteria 4993
773 Ga0496126_0026574 3300048929 Bacteria 5547
774 Ga0496126_0035411 3300048929 Bacteria 4679
775 Ga0496126_0085718 3300048929 Bacteria 2776
776 Ga0496126_0248437 3300048929 Bacteria 1483
777 Ga0501033_0191500 3300049570 Bacteria 1463
778 Ga0501034_0070053 3300049571 Bacteria 3518
779 Ga0501034_0390282 3300049571 Bacteria 1316
780 Ga0501036_0026800 3300049572 Bacteria 4869
781 Ga0501036_0206502 3300049572 Bacteria 1651
782 Ga0501037_0109540 3300049573 Bacteria 1990
783 Ga0501037_0113504 3300049573 Bacteria 1951
784 Ga0501038_0054535 3300049574 Bacteria 3438
785 Ga0501038_0193941 3300049574 Bacteria 1633
786 Ga0501039_0014722 3300049575 Bacteria 5984
787 Ga0501040_0014832 3300049576 Bacteria 5143
788 Ga0501040_0070544 3300049576 Bacteria 2411
789 Ga0501041_0022500 3300049577 Bacteria 3774
790 Ga0501042_0004832 3300049578 Bacteria 8614
791 Ga0501046_0024641 3300049580 Bacteria 4932
792 Ga0501047_0045918 3300049581 Bacteria 4223
793 Ga0501048_0017183 3300049582 Bacteria 5331
794 Ga0501048_0043811 3300049582 Bacteria 3202
795 Ga0501067_0016549 3300049583 Bacteria 4075
796 Ga0501067_0021788 3300049583 Bacteria 3546
797 Ga0501068_0000804 3300049584 Bacteria 16286
798 Ga0501070_0011456 3300049586 Bacteria 7491
799 Ga0501071_0002075 3300049587 Bacteria 12010
800 Ga0501071_0013048 3300049587 Bacteria 5654
801 Ga0501071_0295976 3300049587 Bacteria 1226
802 Ga0501072_0006963 3300049588 Bacteria 8581
803 Ga0501072_0019946 3300049588 Bacteria 5189
804 Ga0501072_0020139 3300049588 Bacteria 5166
805 Ga0501073_0006025 3300049589 Bacteria 9045
806 Ga0501074_0005572 3300049590 Bacteria 9057
807 Ga0501074_0033465 3300049590 Bacteria 3725
808 Ga0501074_0046875 3300049590 Bacteria 3125
809 Ga0501074_0105954 3300049590 Bacteria 2013
810 Ga0501075_0018337 3300049591 Bacteria 5065
811 Ga0501075_0134707 3300049591 Bacteria 1882
812 Ga0501076_0000300 3300049592 Bacteria 30853
813 Ga0501076_0010795 3300049592 Bacteria 6791
814 Ga0501076_0048350 3300049592 Bacteria 3363
815 Ga0501076_0179238 3300049592 Bacteria 1727
816 Ga0501076_0224221 3300049592 Bacteria 1536
817 Ga0501077_0004667 3300049593 Bacteria 8327
818 Ga0501079_0001458 3300049741 Bacteria 16725
819 Ga0501079_0024720 3300049741 Bacteria 4609
820 Ga0501079_0142134 3300049741 Bacteria 1869
821 Ga0501079_0302674 3300049741 Bacteria 1251
822 Ga0501080_0017301 3300049742 Bacteria 6663
823 Ga0501080_0032012 3300049742 Bacteria 4902
824 Ga0501080_0269684 3300049742 Bacteria 1549
825 Ga0501081_0035049 3300049743 Bacteria 3416
826 Ga0501081_0234111 3300049743 Bacteria 1338
827 Ga0501083_0009175 3300049744 Bacteria 6989
828 Ga0501083_0246352 3300049744 Bacteria 1163
829 Ga0501045_0002979 3300049824 Bacteria 11587
830 Ga0501045_0017362 3300049824 Bacteria 5108
831 Ga0501045_0116759 3300049824 Bacteria 1980
832 nmdc:mga05p37_13712_c1 3300050507 Bacteria 9714
833 nmdc:mga05p37_2253_c1 3300050507 Bacteria 22457
834 nmdc:mga09592_997_c1 3300050508 Bacteria 22431
835 nmdc:mga06r32_55832_c1 3300050510 Bacteria 3789
836 nmdc:mga08y16_6690_c1 3300050511 Bacteria 12097
837 nmdc:mga0n895_1033_c1 3300050512 Bacteria 20242
838 nmdc:mga0n895_250449_c1 3300050512 Bacteria 1798
839 nmdc:mga0n895_266530_c1 3300050512 Bacteria 1738
840 nmdc:mga0rr50_10423_c1 3300050513 Bacteria 5896
841 nmdc:mga0rr50_1805_c1 3300050513 Bacteria 11829
842 nmdc:mga0rr50_202081_c1 3300050513 Bacteria 1633
843 nmdc:mga08x19_100134_c1 3300050514 Bacteria 1922
844 nmdc:mga08x19_4186_c1 3300050514 Bacteria 8549
845 nmdc:mga08x19_5920_c1 3300050514 Bacteria 7233
846 nmdc:mga0a205_24706_c1 3300050515 Bacteria 5716
847 nmdc:mga0a205_25504_c1 3300050515 Bacteria 5632
848 nmdc:mga0a205_38742_c1 3300050515 Bacteria 4587
849 Ga0495601_0001851 3300053077 Bacteria 11771
850 Ga0495595_0025927 3300053084 Bacteria 2600
851 Ga0495619_0032252 3300053085 Bacteria 3398
852 Ga0500583_0014665 3300053092 Bacteria 3076
853 Ga0500583_0042636 3300053092 Bacteria 2068
854 Ga0500651_0135718 3300053093 Bacteria 1485
855 Ga0500641_0063851 3300053096 Bacteria 1537
856 Ga0500556_0000589 3300053104 Bacteria 23953
857 Ga0500562_043559 3300053108 Bacteria 1195
858 Ga0500594_0010636 3300053118 Bacteria 2140
859 Ga0500614_006711 3300053123 Bacteria 2422
860 Ga0500617_019162 3300053124 Bacteria 2988
861 Ga0500642_0128512 3300053130 Bacteria 1187
862 Ga0500652_074859 3300053131 Bacteria 1406
863 Ga0500658_0015386 3300053134 Bacteria 2840
864 Ga0500568_0010327 3300053139 Bacteria 4379
865 Ga0500568_0044626 3300053139 Bacteria 1767
866 Ga0500588_0004664 3300053146 Bacteria 2983
867 Ga0500616_0000018 3300053153 Bacteria 610976
868 Ga0500616_0040981 3300053153 Unclassified 2487
869 Ga0500622_0018631 3300053156 Bacteria 3689
870 Ga0500622_0115656 3300053156 Bacteria 1306
871 Ga0500633_0007765 3300053160 Bacteria 2724
872 Ga0501084_0011370 3300054114 Bacteria 7372
873 Ga0501084_0014474 3300054114 Bacteria 6539
874 Ga0501084_0037220 3300054114 Bacteria 4065
875 Ga0590077_017742 3300059426 Bacteria 1499
876 Ga0501082_0015602 3300060353 Bacteria 6539
877 Ga0501082_0140118 3300060353 Bacteria 2099
878 Ga0501082_0250136 3300060353 Bacteria 1542
879 Ga0530510_0003481 3300061734 Bacteria 10822
880 Ga0530510_0010479 3300061734 Bacteria 6501
881 Ga0530510_0010649 3300061734 Bacteria 6450
882 2510283929 2510065053 Bacteria 5005518
883 2510312890 2510065058 Bacteria 5005894
884 2547696612 2547132181 Bacteria 4945084
885 2562465973 2561511199 Bacteria 5155034
886 2599928202 2599185299 Bacteria 4854625
887 2601534023 2600255256 Bacteria 5597742
888 2601540191 2600255257 Bacteria 5597196
889 2601758826 2600255310 Bacteria 5600903
890 2601762823 2600255311 Bacteria 5598766
891 2603640676 2602042046 Bacteria 5483348
892 2650900141 2648501693 Bacteria 5069560
893 2686354381 2684622997 Bacteria 4624240
894 2729146261 2728369097 Bacteria 4333476
895 2735816575 2734482258 Unclassified 2930739
896 2792313387 2791355010 Bacteria 4864581
897 2813730563 2811995292 Bacteria 5303342
898 2814698170 2814123068 Bacteria 5687681
899 2847801232 2847797336 Bacteria 5176640
900 2854602939 2854601825 Bacteria 4797592
901 2858469617 2858466076 Bacteria 4722413
902 2871273612 2871272651 Bacteria 5042015
903 2919128136 2919125081 Bacteria 5385106
904 2935627975 2935625433 Bacteria 5042964
905 2974437004 2974435778 Bacteria 4876478
906 2984498059 2984494565 Bacteria 5000175
907 2984503776 2984499530 Bacteria 5020881
908 2984507642 2984504281 Bacteria 5262371
909 2990264427 2990261002 Bacteria 4919493
910 3000380481 3000376612 Bacteria 4705565
911 640487032 640427133 Bacteria 4567418
912 651174904 651053060 Bacteria 4689946
913 8001525637 8001522603 Bacteria 4726425
914 8016730218 8016728285 Bacteria 5263933
915 Ga0207707_10018316
916 JGI24739J22299_10000036
917 JGI25162J39368_1002447
918 JGI25162J39368_1002514
919 JGI25162J39368_1002516
920 JGI25152J39213_1000187
921 rootH2_10023964
922 Ga0058692_1001649
923 Ga0058692_1001730
924 Ga0058692_1006192
925 Ga0065715_10223441
926 Ga0070690_100007666
927 Ga0070690_100011534
928 Ga0070670_100059524
929 Ga0070670_100178451
930 Ga0070677_10003986
931 Ga0068869_100000179
932 Ga0068869_100102967
933 Ga0068869_100213838
934 Ga0070666_10004842
935 Ga0070666_10009494
936 Ga0070666_10013205
937 Ga0070666_10066444
938 Ga0070666_10077658
939 Ga0070680_100002041
940 Ga0070680_100047098
941 Ga0070680_100054104
942 Ga0070682_100026425
943 Ga0068868_100226032
944 Ga0070691_10000201
945 Ga0070691_10025383
946 Ga0070687_100004423
947 Ga0070687_100158552
948 Ga0070668_100021905
949 Ga0070668_100165739
950 Ga0070675_100035869
951 Ga0070675_100351868
952 Ga0070671_100002044
953 Ga0070671_100018662
954 Ga0070671_100034652
955 Ga0070671_100073677
956 Ga0070674_100034839
957 Ga0070674_100092380
958 Ga0070674_100109440
959 Ga0070673_100059240
960 Ga0070673_100066144
961 Ga0070673_100136437
962 Ga0070667_100000184
963 Ga0070667_100013808
964 Ga0070667_100024865
965 Ga0070667_100065708
966 Ga0070709_10000132
967 Ga0070709_10006539
968 Ga0070709_10011218
969 Ga0070714_100001047
970 Ga0070714_100024629
971 Ga0070714_100085145
972 Ga0070713_100000696
973 Ga0070713_100003974
974 Ga0070713_100121978
975 Ga0070710_10001105
976 Ga0070710_10034787
977 Ga0070701_10000441
978 Ga0070701_10070603
979 Ga0070711_100055982
980 Ga0070711_100288281
981 Ga0070705_100000428
982 Ga0070705_100237544
983 Ga0070700_100002394
984 Ga0070700_100113612
985 Ga0070700_100198944
986 Ga0070694_100000620
987 Ga0070694_100341638
988 Ga0070708_100105955
989 Ga0070663_100037888
990 Ga0070663_100231036
991 Ga0070678_100007333
992 Ga0070662_100116940
993 Ga0070681_10000131
994 Ga0070681_10000231
995 Ga0070681_10004886
996 Ga0070681_10009857
997 Ga0070681_10010910
998 Ga0070681_10029157
999 Ga0070681_10070970
1000 Ga0070681_10089146
1001 Ga0070681_10112367
1002 Ga0068867_100001899
1003 Ga0068867_100042614
1004 Ga0068867_100085315
1005 Ga0070685_10111860
1006 Ga0070685_10264085
1007 Ga0070706_100003733
1008 Ga0070706_100041096
1009 Ga0070707_100077507
1010 Ga0070707_100241824
1011 Ga0070698_100000354
1012 Ga0070698_100005850
1013 Ga0070698_100020872
1014 Ga0070698_100051215
1015 Ga0070699_100063452
1016 Ga0070699_100144625
1017 Ga0070699_100187509
1018 Ga0070679_100019019
1019 Ga0070679_100079717
1020 Ga0070679_100147308
1021 Ga0070679_100190653
1022 Ga0070684_100138929
1023 Ga0070684_100144282
1024 Ga0070684_100340440
1025 Ga0070697_100074834
1026 Ga0070697_100176041
1027 Ga0068853_100074893
1028 Ga0070672_100021356
1029 Ga0070686_100013640
1030 Ga0070686_100022906
1031 Ga0070686_100093129
1032 Ga0070695_100005505
1033 Ga0070695_100011219
1034 Ga0070696_100000037
1035 Ga0070696_100026580
1036 Ga0070693_100000225
1037 Ga0070665_100003573
1038 Ga0070665_100005905
1039 Ga0070665_100008678
1040 Ga0070665_100012130
1041 Ga0070665_100026498
1042 Ga0070665_100037380
1043 Ga0070665_100090572
1044 Ga0070665_100227305
1045 Ga0070704_100006185
1046 Ga0068855_100008724
1047 Ga0068855_100018159
1048 Ga0068855_100020453
1049 Ga0068855_100036225
1050 Ga0068855_100079790
1051 Ga0068855_100258503
1052 Ga0070664_100010321
1053 Ga0068857_100258121
1054 Ga0068854_100014490
1055 Ga0068856_100023424
1056 Ga0068856_100041447
1057 Ga0068856_100143811
1058 Ga0068856_100263674
1059 Ga0068852_100072254
1060 Ga0068859_100004269
1061 Ga0068859_100007815
1062 Ga0068859_100048836
1063 Ga0068859_100099223
1064 Ga0068859_100204778
1065 Ga0068859_100428480
1066 Ga0068864_100018240
1067 Ga0068864_100064649
1068 Ga0068864_100181691
1069 Ga0068864_100428436
1070 Ga0068864_100457037
1071 Ga0068866_10007417
1072 Ga0068866_10009466
1073 Ga0068861_100000538
1074 Ga0068861_100040357
1075 Ga0068861_100051338
1076 Ga0068861_100157116
1077 Ga0068861_100222452
1078 Ga0068851_10065242
1079 Ga0068863_100005874
1080 Ga0068863_100009793
1081 Ga0068863_100095074
1082 Ga0068863_100168201
1083 Ga0068858_100004263
1084 Ga0068858_100007132
1085 Ga0068858_100026808
1086 Ga0068860_100002783
1087 Ga0068860_100024367
1088 Ga0068860_100028398
1089 Ga0068860_100029624
1090 Ga0068862_100011319
1091 Ga0068862_100026123
1092 Ga0068862_100041886
1093 Ga0068862_100107325
1094 Ga0068862_100199098
1095 Ga0068862_100310143
1096 Ga0068862_100345359
1097 Ga0081455_10000679
1098 Ga0081455_10004105
1099 Ga0081539_10000006
1100 Ga0070717_10003728
1101 Ga0070717_10010793
1102 Ga0070717_10074698
1103 Ga0070715_10021861
1104 Ga0070715_10026537
1105 Ga0070715_10031022
1106 Ga0070716_100000088
1107 Ga0070716_100002763
1108 Ga0070716_100006147
1109 Ga0070716_100084949
1110 Ga0070716_100230181
1111 Ga0070712_100043363
1112 Ga0070712_100055963
1113 Ga0097621_100004518
1114 Ga0097621_100149636
1115 Ga0068871_100000772
1116 Ga0068871_100180168
1117 Ga0075428_100004730
1118 Ga0075428_100162789
1119 Ga0075430_100064425
1120 Ga0075430_100219712
1121 Ga0075431_100039561
1122 Ga0075431_100073118
1123 Ga0075433_10006653
1124 Ga0075433_10022836
1125 Ga0075433_10065305
1126 Ga0075434_100013542
1127 Ga0075434_100358853
1128 Ga0075429_100002677
1129 Ga0075429_100326419
1130 Ga0068865_100000628
1131 Ga0068865_100018665
1132 Ga0068865_100074213
1133 Ga0068865_100097540
1134 Ga0075436_100006378
1135 Ga0075436_100090533
1136 Ga0075436_100108320
1137 Ga0097620_100004269
1138 Ga0097620_100007814
1139 Ga0097620_100048836
1140 Ga0097620_100099227
1141 Ga0097620_100204784
1142 Ga0097620_100428449
1143 Ga0079104_1000308
1144 Ga0079104_1001380
1145 Ga0079104_1003875
1146 Ga0075435_100007394
1147 Ga0075435_100387134
1148 Ga0099794_10008883
1149 Ga0099795_10008084
1150 Ga0105251_10002158
1151 Ga0105251_10015033
1152 Ga0105244_10000293
1153 Ga0105240_10008075
1154 Ga0105240_10085320
1155 Ga0105240_10088147
1156 Ga0105240_10517562
1157 Ga0111539_10455538
1158 Ga0105245_10000951
1159 Ga0105247_10002396
1160 Ga0105247_10061333
1161 Ga0114129_10000841
1162 Ga0114129_10007905
1163 Ga0105243_10002746
1164 Ga0105241_10095262
1165 Ga0105242_10000779
1166 Ga0105242_10021808
1167 Ga0105248_10006682
1168 Ga0105248_10057294
1169 Ga0105248_10197860
1170 Ga0105237_10140737
1171 Ga0105237_10258577
1172 Ga0105237_10278974
1173 Ga0105237_10302991
1174 Ga0105237_10433665
1175 Ga0105237_10495323
1176 Ga0105249_10000995
1177 Ga0105249_10017575
1178 Ga0105249_10043968
1179 Ga0105249_10180346
1180 Ga0105239_10010533
1181 Ga0105239_10037988
1182 Ga0105239_10052409
1183 Ga0105239_10233331
1184 Ga0105239_10491273
1185 Ga0105246_10027556
1186 Ga0105246_10118887
1187 Ga0105246_10129408
1188 Ga0157373_10009701
1189 Ga0157371_10014930
1190 Ga0157371_10016478
1191 Ga0157371_10035692
1192 Ga0157370_10000452
1193 Ga0157370_10118437
1194 Ga0157369_10001732
1195 Ga0157369_10035219
1196 Ga0157369_10140326
1197 Ga0157369_10620257
1198 Ga0157374_10023374
1199 Ga0157374_10238651
1200 Ga0157374_10304336
1201 Ga0157378_10000590
1202 Ga0157378_10054853
1203 Ga0163162_10072025
1204 Ga0163162_10288648
1205 Ga0163162_10376876
1206 Ga0157372_10001062
1207 Ga0157372_10341051
1208 Ga0157375_10061997
1209 Ga0157375_10288654
1210 Ga0163163_10018471
1211 Ga0163163_10029120
1212 Ga0163163_10146475
1213 Ga0163163_10202981
1214 Ga0157379_10036534
1215 Ga0157379_10225498
1216 Ga0157376_10005783
1217 Ga0157376_10007674
1218 Ga0157376_10184983
1219 Ga0182006_1007687
1220 Ga0163161_10120572
1221 Ga0206353_11229857
1222 Ga0213874_10012646
1223 Ga0213875_10017205
1224 Ga0213875_10074012
1225 Ga0224712_10021090
1226 Ga0224572_1000869
1227 Ga0207425_1006279
1228 Ga0209759_1008745
1229 Ga0209129_1000008
1230 Ga0209256_1020720
1231 Ga0207655_1000026
1232 Ga0207655_1001273
1233 Ga0207655_1003937
1234 Ga0207655_1031276
1235 Ga0207692_10000891
1236 Ga0207692_10035485
1237 Ga0207692_10202050
1238 Ga0207642_10055381
1239 Ga0207642_10273093
1240 Ga0207710_10001639
1241 Ga0207680_10006851
1242 Ga0207680_10134934
1243 Ga0207680_10141296
1244 Ga0207685_10002959
1245 Ga0207685_10017353
1246 Ga0207685_10047295
1247 Ga0207699_10000165
1248 Ga0207699_10002296
1249 Ga0207699_10123006
1250 Ga0207699_10298086
1251 Ga0207643_10058094
1252 Ga0207643_10071466
1253 Ga0207684_10132377
1254 Ga0207654_10049177
1255 Ga0207654_10253900
1256 Ga0207707_10000075
1257 Ga0207707_10000115
1258 Ga0207707_10000140
1259 Ga0207707_10000148
1260 Ga0207707_10001203
1261 Ga0207707_10002174
1262 Ga0207707_10064108
1263 Ga0207707_10086326
1264 Ga0207707_10192374
1265 Ga0207695_10012932
1266 Ga0207695_10020357
1267 Ga0207695_10021988
1268 Ga0207695_10052459
1269 Ga0207695_10129619
1270 Ga0207693_10000711
1271 Ga0207693_10000836
1272 Ga0207693_10012599
1273 Ga0207693_10167930
1274 Ga0207663_10044739
1275 Ga0207663_10082137
1276 Ga0207663_10147814
1277 Ga0207660_10010953
1278 Ga0207660_10045704
1279 Ga0207660_10068410
1280 Ga0207660_10218379
1281 Ga0207662_10000144
1282 Ga0207649_10248195
1283 Ga0207652_10019843
1284 Ga0207652_10024846
1285 Ga0207652_10042962
1286 Ga0207652_10066650
1287 Ga0207652_10069283
1288 Ga0207652_10162625
1289 Ga0207646_10039379
1290 Ga0207646_10354989
1291 Ga0207694_10046411
1292 Ga0207694_10056274
1293 Ga0207650_10113946
1294 Ga0207650_10119403
1295 Ga0207659_10055705
1296 Ga0207687_10000617
1297 Ga0207687_10126406
1298 Ga0207700_10000297
1299 Ga0207700_10043034
1300 Ga0207700_10095243
1301 Ga0207700_10220300
1302 Ga0207664_10000224
1303 Ga0207644_10000718
1304 Ga0207644_10027518
1305 Ga0207690_10155587
1306 Ga0207686_10000533
1307 Ga0207686_10068527
1308 Ga0207709_10000671
1309 Ga0207670_10002758
1310 Ga0207669_10009150
1311 Ga0207704_10071469
1312 Ga0207704_10392890
1313 Ga0207665_10000698
1314 Ga0207665_10013863
1315 Ga0207665_10014003
1316 Ga0207665_10019995
1317 Ga0207665_10049980
1318 Ga0207665_10335800
1319 Ga0207691_10361689
1320 Ga0207711_10037440
1321 Ga0207711_10317464
1322 Ga0207689_10014975
1323 Ga0207661_10077971
1324 Ga0207661_10089530
1325 Ga0207679_10009229
1326 Ga0207679_10012674
1327 Ga0207667_10006818
1328 Ga0207667_10017408
1329 Ga0207667_10067590
1330 Ga0207651_10121974
1331 Ga0207651_10167307
1332 Ga0207712_10009011
1333 Ga0207712_10025418
1334 Ga0207712_10026592
1335 Ga0207712_10396989
1336 Ga0207640_10003394
1337 Ga0207658_10001013
1338 Ga0207658_10009144
1339 Ga0207677_10073331
1340 Ga0207677_10108147
1341 Ga0207703_10001997
1342 Ga0207703_10027866
1343 Ga0207639_10183137
1344 Ga0207639_10215465
1345 Ga0207678_10015060
1346 Ga0207678_10116209
1347 Ga0207708_10000427
1348 Ga0207708_10249449
1349 Ga0207702_10187012
1350 Ga0207702_10327155
1351 Ga0207641_10001033
1352 Ga0207641_10094596
1353 Ga0207641_10134247
1354 Ga0207648_10000018
1355 Ga0207648_10055430
1356 Ga0207648_10168017
1357 Ga0207648_10200052
1358 Ga0207648_10455939
1359 Ga0207676_10010945
1360 Ga0207676_10462659
1361 Ga0207675_100000050
1362 Ga0207675_100102318
1363 Ga0207675_100195591
1364 Ga0207683_10017307
1365 Ga0207683_10019930
1366 Ga0207683_10098090
1367 Ga0207698_10012742
1368 Ga0207698_10529242
1369 Ga0209281_1000058
1370 Ga0209281_1001193
1371 Ga0209371_1000014
1372 Ga0209371_1000054
1373 Ga0209984_1002678
1374 Ga0209995_1000886
1375 Ga0209995_1014840
1376 Ga0209179_1001321
1377 Ga0209970_1005815
1378 Ga0209983_1003351
1379 Ga0209588_1014068
1380 Ga0209588_1016014
1381 Ga0209971_1001514
1382 Ga0209974_10008018
1383 Ga0207428_10001317
1384 Ga0268266_10002891
1385 Ga0268266_10007953
1386 Ga0268266_10022791
1387 Ga0268266_10049644
1388 Ga0268266_10062739
1389 Ga0268266_10108480
1390 Ga0268266_10120601
1391 Ga0268266_10379280
1392 Ga0268265_10017012
1393 Ga0268265_10039433
1394 Ga0268265_10050324
1395 Ga0268265_10072968
1396 Ga0268265_10151055
1397 Ga0268265_10220746
1398 Ga0268264_10000198
1399 Ga0268264_10001294
1400 Ga0268264_10018094
1401 Ga0268264_10185648
1402 Ga0307515_10003416
1403 Ga0265338_10034673
1404 Ga0268256_1000012
1405 Ga0268256_1000021
1406 Ga0307511_10000048
1407 Ga0307511_10009582
1408 Ga0265328_10014425
1409 Ga0265340_10024043
1410 Ga0265340_10054871
1411 Ga0265339_10107866
1412 Ga0265331_10010845
1413 Ga0265327_10003233
1414 Ga0307513_10013985
1415 Ga0307513_10028805
1416 Ga0307513_10156325
1417 Ga0307509_10000017
1418 Ga0307509_10000803
1419 Ga0307509_10136691
1420 Ga0307408_100027435
1421 Ga0316575_10034701
1422 Ga0316579_10000158
1423 Ga0316579_10006029
1424 Ga0316576_10009427
1425 Ga0316576_10024964
1426 Ga0316576_10029895
1427 Ga0316576_10136287
1428 Ga0316578_10056886
1429 Ga0316578_10127593
1430 Ga0316577_10003059
1431 Ga0316577_10072152
1432 Ga0307413_10004776
1433 Ga0307410_10000500
1434 Ga0307407_10021514
1435 Ga0307412_10077641
1436 Ga0307409_100000732
1437 Ga0307409_100438604
1438 Ga0307416_100146625
1439 Ga0307416_100178547
1440 Ga0307414_10143163
1441 Ga0307414_10264018
1442 Ga0307411_10060016
1443 Ga0307411_10282903
1444 Ga0316583_10021096
1445 Ga0316585_10001855
1446 Ga0316593_10004339
1447 Ga0316593_10004729
1448 Ga0316593_10007343
1449 Ga0316593_10023661
1450 Ga0316593_10026155
1451 Ga0316593_10103175
1452 Ga0307510_10000002
1453 Ga0307510_10063197
1454 Ga0373938_0036310
1455 Ga0373926_0002919
1456 Ga0373926_0005260
1457 Ga0373926_0028007
1458 Ga0373934_0003089
1459 Ga0373944_0000876
1460 Ga0373949_0028016
1461 Ga0373923_0074354
1462 Ga0373923_0088128
1463 Ga0373932_0001979
1464 Ga0373936_0000488
1465 Ga0373936_0006850
1466 Ga0373936_0033970
1467 Ga0373945_0004013
1468 Ga0373945_0008747
1469 Ga0373954_0002373
1470 Ga0373954_0055222
1471 Ga0373956_0077750
1472 Ga0373943_0004831
1473 Ga0373943_0016313
1474 Ga0373943_0078886
1475 Ga0373946_0000439
1476 Ga0373946_0026733
1477 Ga0373946_0029774
1478 Ga0373946_0032111
1479 Ga0373955_0059225
1480 Ga0373955_0099325
1481 Ga0316574_0007609
1482 Ga0316574_0016469
1483 Ga0316574_0033450
1484 Ga0316574_0037376
1485 Ga0316574_0073569
1486 Ga0316574_0074137
1487 Ga0316574_0099000
1488 Ga0316574_0134428
1489 Ga0373931_0030542
1490 Ga0373931_0134062
1491 Ga0373935_0000618
1492 Ga0373935_0004234
1493 Ga0373927_0000383
1494 Ga0373927_0117777
1495 Ga0373933_0010727
1496 Ga0373947_0000002
1497 Ga0373947_0005590
1498 Ga0373947_0059036
1499 Ga0373947_0109028
1500 Ga0373937_0035130
1501 Ga0316582_0004967
1502 Ga0316582_0064613
1503 Ga0316582_0084293
1504 Ga0316584_0030898
1505 Ga0316584_0053695
1506 Ga0316584_0066260
1507 Ga0373925_0005223
1508 Ga0373925_0008937
1509 Ga0373925_0013418
1510 Ga0373925_0038319
1511 Ga0395900_0000060
1512 Ga0395900_0089295
1513 Ga0395900_0216386
1514 Ga0395898_0083235
1515 Ga0436364_0260906
1516 Ga0400484_23031
1517 Ga0400484_27744
1518 Ga0400490_45667
1519 Ga0400483_055564
1520 Ga0400483_086083
1521 Ga0400483_093671
1522 Ga0400483_201732
1523 Ga0400483_280570
1524 Ga0436365_0360171
1525 Ga0436365_1274404
1526 Ga0436365_1414349
1527 Ga0436360_1005797
1528 Ga0436361_0576483
1529 Ga0436363_0296494
1530 Ga0436363_0375975
1531 Ga0436363_1127370
1532 Ga0436363_1153079
1533 Ga0436363_1648012
1534 Ga0439436_0011487
1535 Ga0439447_003544
1536 Ga0451789_1314313
1537 Ga0451793_0368982
1538 Ga0451802_1342131
1539 Ga0451837_0466646
1540 Ga0451841_0078952
1541 Ga0439432_002736
1542 Ga0439432_004394
1543 Ga0439451_005425
1544 Ga0439451_007565
1545 Ga0439452_000004
1546 Ga0439452_000005
1547 Ga0439452_000428
1548 Ga0439452_008326
1549 Ga0439444_0001930
1550 Ga0439460_0000378
1551 Ga0451577_0016678
1552 Ga0451577_0057889
1553 Ga0466969_0000960
1554 Ga0466969_0005735
1555 Ga0466969_0118262
1556 Ga0466966_0009008
1557 Ga0466966_0053439
1558 Ga0466963_0112886
1559 Ga0453684_0045609
1560 Ga0466971_0001123
1561 Ga0466968_0027250
1562 Ga0466970_0046170
1563 Ga0466957_0024169
1564 Ga0466960_0013133
1565 Ga0466959_0014029
1566 Ga0466959_0034640
1567 Ga0466959_0053806
1568 Ga0451576_0000217
1569 Ga0451576_0067931
1570 Ga0451576_0091467
1571 Ga0466958_0036183
1572 Ga0466958_0072990
1573 Ga0466967_0042746
1574 Ga0466967_0161509
1575 Ga0495592_0010288
1576 Ga0495592_0120274
1577 Ga0495603_0010466
1578 Ga0495590_0002047
1579 Ga0495629_0347594
1580 Ga0495638_0076082
1581 Ga0495638_0160552
1582 Ga0495641_0042287
1583 Ga0495653_0006412
1584 Ga0495580_0001506
1585 Ga0495580_0015225
1586 Ga0495580_0043965
1587 Ga0495582_0037643
1588 Ga0495639_0002165
1589 Ga0495639_0032526
1590 Ga0495662_0013627
1591 Ga0495664_0004691
1592 Ga0495584_0023980
1593 Ga0495594_0082982
1594 Ga0495594_0151865
1595 Ga0495596_0027282
1596 Ga0495583_0021099
1597 Ga0495608_0144824
1598 Ga0495618_0093151
1599 Ga0495628_0056228
1600 Ga0495630_0028591
1601 Ga0495630_0039960
1602 Ga0495630_0293994
1603 Ga0495648_0013861
1604 Ga0495648_0117804
1605 Ga0495666_0046639
1606 Ga0495665_0051846
1607 Ga0495640_0053821
1608 Ga0495586_0004720
1609 Ga0495586_0004892
1610 Ga0495587_0097364
1611 Ga0495667_0036525
1612 Ga0495667_0068892
1613 Ga0495656_0004463
1614 Ga0495668_0148242
1615 Ga0495634_0041752
1616 Ga0495625_0029573
1617 Ga0495635_0000464
1618 Ga0495657_0088806
1619 Ga0495657_0166310
1620 Ga0495599_0046240
1621 Ga0495599_0065356
1622 Ga0495646_0129415
1623 Ga0495647_0001482
1624 Ga0495647_0003243
1625 Ga0495658_0006801
1626 Ga0495658_0085759
1627 Ga0495671_0024188
1628 Ga0495649_0003326
1629 Ga0495600_0003135
1630 Ga0495581_0064804
1631 Ga0495604_0155405
1632 Ga0495674_0094152
1633 Ga0495676_0038206
1634 Ga0495676_0116557
1635 Ga0495680_0035758
1636 Ga0495675_0036099
1637 Ga0495681_0133669
1638 Ga0495684_0024315
1639 Ga0495602_0083747
1640 Ga0495602_0238165
1641 Ga0495615_0025199
1642 Ga0495626_0097765
1643 Ga0496100_0077976
1644 Ga0496100_0117923
1645 Ga0496102_0024944
1646 Ga0496102_0032576
1647 Ga0496103_0078166
1648 Ga0496104_0448094
1649 Ga0496105_0121352
1650 Ga0496107_0099375
1651 Ga0496108_0021701
1652 Ga0496108_0446951
1653 Ga0496109_0028132
1654 Ga0496109_0200936
1655 Ga0496110_0038938
1656 Ga0496111_0003521
1657 Ga0496112_0113896
1658 Ga0496112_0175623
1659 Ga0496112_0290370
1660 Ga0496113_0086931
1661 Ga0496114_0034713
1662 Ga0496115_0021506
1663 Ga0496115_0127037
1664 Ga0496115_0194916
1665 Ga0496116_0000217
1666 Ga0496116_0032636
1667 Ga0496116_0089752
1668 Ga0496117_0000135
1669 Ga0496117_0001101
1670 Ga0496117_0005290
1671 Ga0496118_0000098
1672 Ga0496118_0002338
1673 Ga0496118_0085298
1674 Ga0496119_0000026
1675 Ga0496119_0081790
1676 Ga0496120_0000543
1677 Ga0496120_0031913
1678 Ga0496120_0071899
1679 Ga0496121_0023475
1680 Ga0496121_0166063
1681 Ga0496124_0000142
1682 Ga0496124_0007498
1683 Ga0496124_0078346
1684 Ga0496125_0002765
1685 Ga0496125_0014965
1686 Ga0496125_0028906
1687 Ga0496126_0026574
1688 Ga0496126_0035411
1689 Ga0496126_0085718
1690 Ga0496126_0248437
1691 Ga0501033_0191500
1692 Ga0501034_0070053
1693 Ga0501034_0390282
1694 Ga0501036_0026800
1695 Ga0501036_0206502
1696 Ga0501037_0109540
1697 Ga0501037_0113504
1698 Ga0501038_0054535
1699 Ga0501038_0193941
1700 Ga0501039_0014722
1701 Ga0501040_0014832
1702 Ga0501040_0070544
1703 Ga0501041_0022500
1704 Ga0501042_0004832
1705 Ga0501046_0024641
1706 Ga0501047_0045918
1707 Ga0501048_0017183
1708 Ga0501048_0043811
1709 Ga0501067_0016549
1710 Ga0501067_0021788
1711 Ga0501068_0000804
1712 Ga0501070_0011456
1713 Ga0501071_0002075
1714 Ga0501071_0013048
1715 Ga0501071_0295976
1716 Ga0501072_0006963
1717 Ga0501072_0019946
1718 Ga0501072_0020139
1719 Ga0501073_0006025
1720 Ga0501074_0005572
1721 Ga0501074_0033465
1722 Ga0501074_0046875
1723 Ga0501074_0105954
1724 Ga0501075_0018337
1725 Ga0501075_0134707
1726 Ga0501076_0000300
1727 Ga0501076_0010795
1728 Ga0501076_0048350
1729 Ga0501076_0179238
1730 Ga0501076_0224221
1731 Ga0501077_0004667
1732 Ga0501079_0001458
1733 Ga0501079_0024720
1734 Ga0501079_0142134
1735 Ga0501079_0302674
1736 Ga0501080_0017301
1737 Ga0501080_0032012
1738 Ga0501080_0269684
1739 Ga0501081_0035049
1740 Ga0501081_0234111
1741 Ga0501083_0009175
1742 Ga0501083_0246352
1743 Ga0501045_0002979
1744 Ga0501045_0017362
1745 Ga0501045_0116759
1746 nmdc:mga05p37_13712_c1
1747 nmdc:mga05p37_2253_c1
1748 nmdc:mga09592_997_c1
1749 nmdc:mga06r32_55832_c1
1750 nmdc:mga08y16_6690_c1
1751 nmdc:mga0n895_1033_c1
1752 nmdc:mga0n895_250449_c1
1753 nmdc:mga0n895_266530_c1
1754 nmdc:mga0rr50_10423_c1
1755 nmdc:mga0rr50_1805_c1
1756 nmdc:mga0rr50_202081_c1
1757 nmdc:mga08x19_100134_c1
1758 nmdc:mga08x19_4186_c1
1759 nmdc:mga08x19_5920_c1
1760 nmdc:mga0a205_24706_c1
1761 nmdc:mga0a205_25504_c1
1762 nmdc:mga0a205_38742_c1
1763 Ga0495601_0001851
1764 Ga0495595_0025927
1765 Ga0495619_0032252
1766 Ga0500583_0014665
1767 Ga0500583_0042636
1768 Ga0500651_0135718
1769 Ga0500641_0063851
1770 Ga0500556_0000589
1771 Ga0500562_043559
1772 Ga0500594_0010636
1773 Ga0500614_006711
1774 Ga0500617_019162
1775 Ga0500642_0128512
1776 Ga0500652_074859
1777 Ga0500658_0015386
1778 Ga0500568_0010327
1779 Ga0500568_0044626
1780 Ga0500588_0004664
1781 Ga0500616_0000018
1782 Ga0500616_0040981
1783 Ga0500622_0018631
1784 Ga0500622_0115656
1785 Ga0500633_0007765
1786 Ga0501084_0011370
1787 Ga0501084_0014474
1788 Ga0501084_0037220
1789 Ga0590077_017742
1790 Ga0501082_0015602
1791 Ga0501082_0140118
1792 Ga0501082_0250136
1793 Ga0530510_0003481
1794 Ga0530510_0010479
1795 Ga0530510_0010649
1796 2510283929
1797 2510312890
1798 2547696612
1799 2562465973
1800 2599928202
1801 2601534023
1802 2601540191
1803 2601758826
1804 2601762823
1805 2603640676
1806 2650900141
1807 2686354381
1808 2729146261
1809 2735816575
1810 2792313387
1811 2813730563
1812 2814698170
1813 2847801232
1814 2854602939
1815 2858469617
1816 2871273612
1817 2919128136
1818 2935627975
1819 2974437004
1820 2984498059
1821 2984503776
1822 2984507642
1823 2990264427
1824 3000380481
1825 640487032
1826 651174904
1827 8001525637
1828 8016730218

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

51

356

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9838 8 313
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9804 8 313
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9576 6 311
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9509 6 311
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9114 7 310
ID Description Score Start End Superfamily
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9982 113 213 1.10.150.170
af_P60390_9_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9906 9 313 3.40.50.150
af_P60390_9_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9874 9 313 3.40.50.150
3tkaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9727 8 313 3.40.50.150
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9682 113 213 1.10.150.170
ID Description Score Start End GO Terms
AF-A0A2X1N3B5-F1-model_v4 S-adenosyl-methyltransferase MraW (EC 2.1.1.199) 0.9995 52 252 GO:0005737
GO:0070475
GO:0071424
AF-A0A656GR36-F1-model_v4 deleted 0.9905 75 259
AF-A0A2X2BFM0-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9857 64 313 GO:0005737
GO:0070475
GO:0071424
AF-A0A2S5LTZ9-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9855 7 150 GO:0005737
GO:0070475
GO:0071424
AF-A0A257X594-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9852 7 250 GO:0005737
GO:0070475
GO:0071424

Map