F485571
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 914 | 450 | 1828 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300025912|Ga0207707_10018316|Ga0207707_100183164 |
| Length | 357 |
| Sequence | LGLGWRHARHEAGGTYGFGVSKEKCRRGVRRVVHDNGEAFRGAVSPLLFVDEHTPVLVGEALAALALQAGGYYVDATFGRGGHTALILQALGREGRLLAIDRDPQAIAAGRQRFADEVRLTLVHASFADLAALVPAHAHGLPCGGVLFDLGVSSPQLDDPRRGFSFRSDGPIDMRMDTSRGEPVSAWLARASLDEIREVISTLGEERFARRIAQAIVATRTEHPLTRTNELAALVSRAVRTREPGKHPATRTFQALRMFINDELGQLNRGLNAAVDVISRGGRLAVISFHSLEDRVVKNFFRDESQIDPVFLDLPAIPPEAQPRLRLVGRKSRPSDAEVKRNPRARSALLRVAEKVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 210 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 223 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 224 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 254 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 255 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 261 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 262 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 266 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 267 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 268 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 269 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 270 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 271 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 272 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 273 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 276 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 277 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 278 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 279 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 280 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 281 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 339 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 353 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 354 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 355 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 356 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 399 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 400 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 403 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 404 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 405 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 406 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 407 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 408 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 410 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 411 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 413 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 414 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 416 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 418 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 419 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 420 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 421 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 422 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 423 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 424 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 425 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 426 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 427 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 428 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 429 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 430 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 431 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 432 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 433 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 434 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 435 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 436 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 437 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 438 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 439 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 440 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 441 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 442 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 443 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 444 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 445 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 446 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 447 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 448 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 449 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 450 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.51 |
| Metatranscriptomes | 0.88 |
| Isolates | 3.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.44 |
| Bulb | 0 |
| Endosphere | 2.95 |
| Nodule | 0.66 |
| Rhizoplane | 3.5 |
| Rhizosphere | 84.46 |
| Stem | 0.11 |
| Stem Tuber | 0.33 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207707_10018316 | 3300025912 | Bacteria | 6104 |
| 2 | JGI24739J22299_10000036 | 3300001989 | Bacteria | 37579 |
| 3 | JGI25162J39368_1002447 | 3300002737 | Bacteria | 7205 |
| 4 | JGI25162J39368_1002514 | 3300002737 | Bacteria | 7013 |
| 5 | JGI25162J39368_1002516 | 3300002737 | Bacteria | 7010 |
| 6 | JGI25152J39213_1000187 | 3300002773 | Bacteria | 41763 |
| 7 | rootH2_10023964 | 3300003320 | Bacteria | 15066 |
| 8 | Ga0058692_1001649 | 3300003856 | Bacteria | 8011 |
| 9 | Ga0058692_1001730 | 3300003856 | Bacteria | 7778 |
| 10 | Ga0058692_1006192 | 3300003856 | Bacteria | 3313 |
| 11 | Ga0065715_10223441 | 3300005293 | Bacteria | 1262 |
| 12 | Ga0070690_100007666 | 3300005330 | Bacteria | 6187 |
| 13 | Ga0070690_100011534 | 3300005330 | Bacteria | 5172 |
| 14 | Ga0070670_100059524 | 3300005331 | Bacteria | 3279 |
| 15 | Ga0070670_100178451 | 3300005331 | Bacteria | 1843 |
| 16 | Ga0070677_10003986 | 3300005333 | Bacteria | 4800 |
| 17 | Ga0068869_100000179 | 3300005334 | Bacteria | 32307 |
| 18 | Ga0068869_100102967 | 3300005334 | Bacteria | 2162 |
| 19 | Ga0068869_100213838 | 3300005334 | Bacteria | 1525 |
| 20 | Ga0070666_10004842 | 3300005335 | Bacteria | 8227 |
| 21 | Ga0070666_10009494 | 3300005335 | Bacteria | 6067 |
| 22 | Ga0070666_10013205 | 3300005335 | Bacteria | 5235 |
| 23 | Ga0070666_10066444 | 3300005335 | Bacteria | 2447 |
| 24 | Ga0070666_10077658 | 3300005335 | Bacteria | 2266 |
| 25 | Ga0070680_100002041 | 3300005336 | Bacteria | 14890 |
| 26 | Ga0070680_100047098 | 3300005336 | Bacteria | 3510 |
| 27 | Ga0070680_100054104 | 3300005336 | Bacteria | 3276 |
| 28 | Ga0070682_100026425 | 3300005337 | Bacteria | 3474 |
| 29 | Ga0068868_100226032 | 3300005338 | Bacteria | 1568 |
| 30 | Ga0070691_10000201 | 3300005341 | Bacteria | 20122 |
| 31 | Ga0070691_10025383 | 3300005341 | Bacteria | 2759 |
| 32 | Ga0070687_100004423 | 3300005343 | Bacteria | 5602 |
| 33 | Ga0070687_100158552 | 3300005343 | Bacteria | 1335 |
| 34 | Ga0070668_100021905 | 3300005347 | Bacteria | 4828 |
| 35 | Ga0070668_100165739 | 3300005347 | Bacteria | 1795 |
| 36 | Ga0070675_100035869 | 3300005354 | Bacteria | 4032 |
| 37 | Ga0070675_100351868 | 3300005354 | Bacteria | 1306 |
| 38 | Ga0070671_100002044 | 3300005355 | Bacteria | 15550 |
| 39 | Ga0070671_100018662 | 3300005355 | Bacteria | 5635 |
| 40 | Ga0070671_100034652 | 3300005355 | Bacteria | 4179 |
| 41 | Ga0070671_100073677 | 3300005355 | Bacteria | 2852 |
| 42 | Ga0070674_100034839 | 3300005356 | Bacteria | 3366 |
| 43 | Ga0070674_100092380 | 3300005356 | Bacteria | 2187 |
| 44 | Ga0070674_100109440 | 3300005356 | Bacteria | 2026 |
| 45 | Ga0070673_100059240 | 3300005364 | Bacteria | 3031 |
| 46 | Ga0070673_100066144 | 3300005364 | Bacteria | 2886 |
| 47 | Ga0070673_100136437 | 3300005364 | Bacteria | 2065 |
| 48 | Ga0070667_100000184 | 3300005367 | Bacteria | 75408 |
| 49 | Ga0070667_100013808 | 3300005367 | Bacteria | 6677 |
| 50 | Ga0070667_100024865 | 3300005367 | Bacteria | 4975 |
| 51 | Ga0070667_100065708 | 3300005367 | Bacteria | 3080 |
| 52 | Ga0070709_10000132 | 3300005434 | Bacteria | 49598 |
| 53 | Ga0070709_10006539 | 3300005434 | Bacteria | 6356 |
| 54 | Ga0070709_10011218 | 3300005434 | Bacteria | 4985 |
| 55 | Ga0070714_100001047 | 3300005435 | Bacteria | 19734 |
| 56 | Ga0070714_100024629 | 3300005435 | Bacteria | 4959 |
| 57 | Ga0070714_100085145 | 3300005435 | Bacteria | 2760 |
| 58 | Ga0070713_100000696 | 3300005436 | Bacteria | 21617 |
| 59 | Ga0070713_100003974 | 3300005436 | Bacteria | 9835 |
| 60 | Ga0070713_100121978 | 3300005436 | Bacteria | 2287 |
| 61 | Ga0070710_10001105 | 3300005437 | Bacteria | 12767 |
| 62 | Ga0070710_10034787 | 3300005437 | Bacteria | 2743 |
| 63 | Ga0070701_10000441 | 3300005438 | Bacteria | 14159 |
| 64 | Ga0070701_10070603 | 3300005438 | Bacteria | 1866 |
| 65 | Ga0070711_100055982 | 3300005439 | Bacteria | 2726 |
| 66 | Ga0070711_100288281 | 3300005439 | Bacteria | 1301 |
| 67 | Ga0070705_100000428 | 3300005440 | Bacteria | 24201 |
| 68 | Ga0070705_100237544 | 3300005440 | Bacteria | 1271 |
| 69 | Ga0070700_100002394 | 3300005441 | Bacteria | 9557 |
| 70 | Ga0070700_100113612 | 3300005441 | Bacteria | 1804 |
| 71 | Ga0070700_100198944 | 3300005441 | Bacteria | 1406 |
| 72 | Ga0070694_100000620 | 3300005444 | Bacteria | 19535 |
| 73 | Ga0070694_100341638 | 3300005444 | Bacteria | 1157 |
| 74 | Ga0070708_100105955 | 3300005445 | Bacteria | 2580 |
| 75 | Ga0070663_100037888 | 3300005455 | Bacteria | 3359 |
| 76 | Ga0070663_100231036 | 3300005455 | Bacteria | 1456 |
| 77 | Ga0070678_100007333 | 3300005456 | Bacteria | 6533 |
| 78 | Ga0070662_100116940 | 3300005457 | Bacteria | 2039 |
| 79 | Ga0070681_10000131 | 3300005458 | Bacteria | 56441 |
| 80 | Ga0070681_10000231 | 3300005458 | Bacteria | 43967 |
| 81 | Ga0070681_10004886 | 3300005458 | Bacteria | 12856 |
| 82 | Ga0070681_10009857 | 3300005458 | Bacteria | 9412 |
| 83 | Ga0070681_10010910 | 3300005458 | Bacteria | 8984 |
| 84 | Ga0070681_10029157 | 3300005458 | Bacteria | 5540 |
| 85 | Ga0070681_10070970 | 3300005458 | Bacteria | 3448 |
| 86 | Ga0070681_10089146 | 3300005458 | Bacteria | 3036 |
| 87 | Ga0070681_10112367 | 3300005458 | Bacteria | 2664 |
| 88 | Ga0068867_100001899 | 3300005459 | Bacteria | 14533 |
| 89 | Ga0068867_100042614 | 3300005459 | Bacteria | 3321 |
| 90 | Ga0068867_100085315 | 3300005459 | Bacteria | 2387 |
| 91 | Ga0070685_10111860 | 3300005466 | Bacteria | 1683 |
| 92 | Ga0070685_10264085 | 3300005466 | Bacteria | 1146 |
| 93 | Ga0070706_100003733 | 3300005467 | Bacteria | 14884 |
| 94 | Ga0070706_100041096 | 3300005467 | Bacteria | 4269 |
| 95 | Ga0070707_100077507 | 3300005468 | Bacteria | 3207 |
| 96 | Ga0070707_100241824 | 3300005468 | Bacteria | 1757 |
| 97 | Ga0070698_100000354 | 3300005471 | Bacteria | 47476 |
| 98 | Ga0070698_100005850 | 3300005471 | Bacteria | 13439 |
| 99 | Ga0070698_100020872 | 3300005471 | Bacteria | 6864 |
| 100 | Ga0070698_100051215 | 3300005471 | Bacteria | 4207 |
| 101 | Ga0070699_100063452 | 3300005518 | Bacteria | 3203 |
| 102 | Ga0070699_100144625 | 3300005518 | Bacteria | 2101 |
| 103 | Ga0070699_100187509 | 3300005518 | Bacteria | 1837 |
| 104 | Ga0070679_100019019 | 3300005530 | Bacteria | 6672 |
| 105 | Ga0070679_100079717 | 3300005530 | Bacteria | 3264 |
| 106 | Ga0070679_100147308 | 3300005530 | Bacteria | 2332 |
| 107 | Ga0070679_100190653 | 3300005530 | Bacteria | 2019 |
| 108 | Ga0070684_100138929 | 3300005535 | Bacteria | 2196 |
| 109 | Ga0070684_100144282 | 3300005535 | Bacteria | 2154 |
| 110 | Ga0070684_100340440 | 3300005535 | Bacteria | 1379 |
| 111 | Ga0070697_100074834 | 3300005536 | Bacteria | 2783 |
| 112 | Ga0070697_100176041 | 3300005536 | Bacteria | 1812 |
| 113 | Ga0068853_100074893 | 3300005539 | Bacteria | 2954 |
| 114 | Ga0070672_100021356 | 3300005543 | Bacteria | 4735 |
| 115 | Ga0070686_100013640 | 3300005544 | Bacteria | 4660 |
| 116 | Ga0070686_100022906 | 3300005544 | Bacteria | 3726 |
| 117 | Ga0070686_100093129 | 3300005544 | Bacteria | 2020 |
| 118 | Ga0070695_100005505 | 3300005545 | Bacteria | 7461 |
| 119 | Ga0070695_100011219 | 3300005545 | Bacteria | 5358 |
| 120 | Ga0070696_100000037 | 3300005546 | Bacteria | 62186 |
| 121 | Ga0070696_100026580 | 3300005546 | Bacteria | 3937 |
| 122 | Ga0070693_100000225 | 3300005547 | Bacteria | 26343 |
| 123 | Ga0070665_100003573 | 3300005548 | Bacteria | 16475 |
| 124 | Ga0070665_100005905 | 3300005548 | Bacteria | 12540 |
| 125 | Ga0070665_100008678 | 3300005548 | Bacteria | 10288 |
| 126 | Ga0070665_100012130 | 3300005548 | Bacteria | 8694 |
| 127 | Ga0070665_100026498 | 3300005548 | Bacteria | 5837 |
| 128 | Ga0070665_100037380 | 3300005548 | Bacteria | 4883 |
| 129 | Ga0070665_100090572 | 3300005548 | Bacteria | 3064 |
| 130 | Ga0070665_100227305 | 3300005548 | Bacteria | 1866 |
| 131 | Ga0070704_100006185 | 3300005549 | Bacteria | 7031 |
| 132 | Ga0068855_100008724 | 3300005563 | Bacteria | 12255 |
| 133 | Ga0068855_100018159 | 3300005563 | Bacteria | 8450 |
| 134 | Ga0068855_100020453 | 3300005563 | Bacteria | 7937 |
| 135 | Ga0068855_100036225 | 3300005563 | Bacteria | 5874 |
| 136 | Ga0068855_100079790 | 3300005563 | Bacteria | 3795 |
| 137 | Ga0068855_100258503 | 3300005563 | Bacteria | 1941 |
| 138 | Ga0070664_100010321 | 3300005564 | Bacteria | 7579 |
| 139 | Ga0068857_100258121 | 3300005577 | Unclassified | 1599 |
| 140 | Ga0068854_100014490 | 3300005578 | Bacteria | 5198 |
| 141 | Ga0068856_100023424 | 3300005614 | Bacteria | 6003 |
| 142 | Ga0068856_100041447 | 3300005614 | Bacteria | 4524 |
| 143 | Ga0068856_100143811 | 3300005614 | Bacteria | 2393 |
| 144 | Ga0068856_100263674 | 3300005614 | Bacteria | 1739 |
| 145 | Ga0068852_100072254 | 3300005616 | Bacteria | 3032 |
| 146 | Ga0068859_100004269 | 3300005617 | Bacteria | 14594 |
| 147 | Ga0068859_100007815 | 3300005617 | Bacteria | 10857 |
| 148 | Ga0068859_100048836 | 3300005617 | Bacteria | 4251 |
| 149 | Ga0068859_100099223 | 3300005617 | Bacteria | 2967 |
| 150 | Ga0068859_100204778 | 3300005617 | Bacteria | 2058 |
| 151 | Ga0068859_100428480 | 3300005617 | Bacteria | 1419 |
| 152 | Ga0068864_100018240 | 3300005618 | Bacteria | 5858 |
| 153 | Ga0068864_100064649 | 3300005618 | Bacteria | 3173 |
| 154 | Ga0068864_100181691 | 3300005618 | Bacteria | 1923 |
| 155 | Ga0068864_100428436 | 3300005618 | Bacteria | 1262 |
| 156 | Ga0068864_100457037 | 3300005618 | Bacteria | 1222 |
| 157 | Ga0068866_10007417 | 3300005718 | Bacteria | 4589 |
| 158 | Ga0068866_10009466 | 3300005718 | Bacteria | 4136 |
| 159 | Ga0068861_100000538 | 3300005719 | Bacteria | 22249 |
| 160 | Ga0068861_100040357 | 3300005719 | Bacteria | 3490 |
| 161 | Ga0068861_100051338 | 3300005719 | Bacteria | 3130 |
| 162 | Ga0068861_100157116 | 3300005719 | Bacteria | 1872 |
| 163 | Ga0068861_100222452 | 3300005719 | Bacteria | 1596 |
| 164 | Ga0068851_10065242 | 3300005834 | Bacteria | 1873 |
| 165 | Ga0068863_100005874 | 3300005841 | Bacteria | 12025 |
| 166 | Ga0068863_100009793 | 3300005841 | Bacteria | 9343 |
| 167 | Ga0068863_100095074 | 3300005841 | Bacteria | 2828 |
| 168 | Ga0068863_100168201 | 3300005841 | Bacteria | 2102 |
| 169 | Ga0068858_100004263 | 3300005842 | Bacteria | 14060 |
| 170 | Ga0068858_100007132 | 3300005842 | Bacteria | 10855 |
| 171 | Ga0068858_100026808 | 3300005842 | Bacteria | 5353 |
| 172 | Ga0068860_100002783 | 3300005843 | Bacteria | 18194 |
| 173 | Ga0068860_100024367 | 3300005843 | Bacteria | 5847 |
| 174 | Ga0068860_100028398 | 3300005843 | Bacteria | 5384 |
| 175 | Ga0068860_100029624 | 3300005843 | Bacteria | 5267 |
| 176 | Ga0068862_100011319 | 3300005844 | Bacteria | 7366 |
| 177 | Ga0068862_100026123 | 3300005844 | Bacteria | 4909 |
| 178 | Ga0068862_100041886 | 3300005844 | Bacteria | 3898 |
| 179 | Ga0068862_100107325 | 3300005844 | Bacteria | 2448 |
| 180 | Ga0068862_100199098 | 3300005844 | Bacteria | 1805 |
| 181 | Ga0068862_100310143 | 3300005844 | Bacteria | 1454 |
| 182 | Ga0068862_100345359 | 3300005844 | Bacteria | 1379 |
| 183 | Ga0081455_10000679 | 3300005937 | Bacteria | 44123 |
| 184 | Ga0081455_10004105 | 3300005937 | Bacteria | 16479 |
| 185 | Ga0081539_10000006 | 3300005985 | Bacteria | 534555 |
| 186 | Ga0070717_10003728 | 3300006028 | Bacteria | 10945 |
| 187 | Ga0070717_10010793 | 3300006028 | Bacteria | 6911 |
| 188 | Ga0070717_10074698 | 3300006028 | Bacteria | 2834 |
| 189 | Ga0070715_10021861 | 3300006163 | Bacteria | 2486 |
| 190 | Ga0070715_10026537 | 3300006163 | Bacteria | 2306 |
| 191 | Ga0070715_10031022 | 3300006163 | Bacteria | 2166 |
| 192 | Ga0070716_100000088 | 3300006173 | Bacteria | 36109 |
| 193 | Ga0070716_100002763 | 3300006173 | Bacteria | 8149 |
| 194 | Ga0070716_100006147 | 3300006173 | Bacteria | 5860 |
| 195 | Ga0070716_100084949 | 3300006173 | Bacteria | 1899 |
| 196 | Ga0070716_100230181 | 3300006173 | Bacteria | 1251 |
| 197 | Ga0070712_100043363 | 3300006175 | Bacteria | 3097 |
| 198 | Ga0070712_100055963 | 3300006175 | Bacteria | 2765 |
| 199 | Ga0097621_100004518 | 3300006237 | Bacteria | 9696 |
| 200 | Ga0097621_100149636 | 3300006237 | Bacteria | 2001 |
| 201 | Ga0068871_100000772 | 3300006358 | Bacteria | 21551 |
| 202 | Ga0068871_100180168 | 3300006358 | Bacteria | 1815 |
| 203 | Ga0075428_100004730 | 3300006844 | Bacteria | 15076 |
| 204 | Ga0075428_100162789 | 3300006844 | Bacteria | 2421 |
| 205 | Ga0075430_100064425 | 3300006846 | Bacteria | 3079 |
| 206 | Ga0075430_100219712 | 3300006846 | Bacteria | 1577 |
| 207 | Ga0075431_100039561 | 3300006847 | Bacteria | 4858 |
| 208 | Ga0075431_100073118 | 3300006847 | Bacteria | 3537 |
| 209 | Ga0075433_10006653 | 3300006852 | Bacteria | 9153 |
| 210 | Ga0075433_10022836 | 3300006852 | Bacteria | 5256 |
| 211 | Ga0075433_10065305 | 3300006852 | Bacteria | 3192 |
| 212 | Ga0075434_100013542 | 3300006871 | Bacteria | 7767 |
| 213 | Ga0075434_100358853 | 3300006871 | Bacteria | 1478 |
| 214 | Ga0075429_100002677 | 3300006880 | Bacteria | 14995 |
| 215 | Ga0075429_100326419 | 3300006880 | Bacteria | 1343 |
| 216 | Ga0068865_100000628 | 3300006881 | Bacteria | 19880 |
| 217 | Ga0068865_100018665 | 3300006881 | Bacteria | 4479 |
| 218 | Ga0068865_100074213 | 3300006881 | Bacteria | 2421 |
| 219 | Ga0068865_100097540 | 3300006881 | Bacteria | 2145 |
| 220 | Ga0075436_100006378 | 3300006914 | Bacteria | 8083 |
| 221 | Ga0075436_100090533 | 3300006914 | Bacteria | 2127 |
| 222 | Ga0075436_100108320 | 3300006914 | Bacteria | 1938 |
| 223 | Ga0097620_100004269 | 3300006931 | Bacteria | 14594 |
| 224 | Ga0097620_100007814 | 3300006931 | Bacteria | 10857 |
| 225 | Ga0097620_100048836 | 3300006931 | Bacteria | 4251 |
| 226 | Ga0097620_100099227 | 3300006931 | Bacteria | 2967 |
| 227 | Ga0097620_100204784 | 3300006931 | Bacteria | 2058 |
| 228 | Ga0097620_100428449 | 3300006931 | Bacteria | 1419 |
| 229 | Ga0079104_1000308 | 3300006946 | Bacteria | 61968 |
| 230 | Ga0079104_1001380 | 3300006946 | Bacteria | 16519 |
| 231 | Ga0079104_1003875 | 3300006946 | Bacteria | 6697 |
| 232 | Ga0075435_100007394 | 3300007076 | Bacteria | 7823 |
| 233 | Ga0075435_100387134 | 3300007076 | Bacteria | 1201 |
| 234 | Ga0099794_10008883 | 3300007265 | Bacteria | 4189 |
| 235 | Ga0099795_10008084 | 3300007788 | Bacteria | 2979 |
| 236 | Ga0105251_10002158 | 3300009011 | Bacteria | 15783 |
| 237 | Ga0105251_10015033 | 3300009011 | Bacteria | 4246 |
| 238 | Ga0105244_10000293 | 3300009036 | Bacteria | 49039 |
| 239 | Ga0105240_10008075 | 3300009093 | Bacteria | 15126 |
| 240 | Ga0105240_10085320 | 3300009093 | Bacteria | 3869 |
| 241 | Ga0105240_10088147 | 3300009093 | Bacteria | 3798 |
| 242 | Ga0105240_10517562 | 3300009093 | Bacteria | 1324 |
| 243 | Ga0111539_10455538 | 3300009094 | Unclassified | 1490 |
| 244 | Ga0105245_10000951 | 3300009098 | Bacteria | 26343 |
| 245 | Ga0105247_10002396 | 3300009101 | Bacteria | 12742 |
| 246 | Ga0105247_10061333 | 3300009101 | Bacteria | 2331 |
| 247 | Ga0114129_10000841 | 3300009147 | Bacteria | 39754 |
| 248 | Ga0114129_10007905 | 3300009147 | Bacteria | 15138 |
| 249 | Ga0105243_10002746 | 3300009148 | Bacteria | 14634 |
| 250 | Ga0105241_10095262 | 3300009174 | Bacteria | 2356 |
| 251 | Ga0105242_10000779 | 3300009176 | Bacteria | 24760 |
| 252 | Ga0105242_10021808 | 3300009176 | Bacteria | 5034 |
| 253 | Ga0105248_10006682 | 3300009177 | Bacteria | 12658 |
| 254 | Ga0105248_10057294 | 3300009177 | Bacteria | 4373 |
| 255 | Ga0105248_10197860 | 3300009177 | Bacteria | 2264 |
| 256 | Ga0105237_10140737 | 3300009545 | Bacteria | 2407 |
| 257 | Ga0105237_10258577 | 3300009545 | Bacteria | 1744 |
| 258 | Ga0105237_10278974 | 3300009545 | Bacteria | 1674 |
| 259 | Ga0105237_10302991 | 3300009545 | Bacteria | 1601 |
| 260 | Ga0105237_10433665 | 3300009545 | Bacteria | 1320 |
| 261 | Ga0105237_10495323 | 3300009545 | Bacteria | 1228 |
| 262 | Ga0105249_10000995 | 3300009553 | Bacteria | 25125 |
| 263 | Ga0105249_10017575 | 3300009553 | Bacteria | 6349 |
| 264 | Ga0105249_10043968 | 3300009553 | Bacteria | 4062 |
| 265 | Ga0105249_10180346 | 3300009553 | Bacteria | 2054 |
| 266 | Ga0105239_10010533 | 3300010375 | Bacteria | 10337 |
| 267 | Ga0105239_10037988 | 3300010375 | Bacteria | 5276 |
| 268 | Ga0105239_10052409 | 3300010375 | Bacteria | 4474 |
| 269 | Ga0105239_10233331 | 3300010375 | Bacteria | 2065 |
| 270 | Ga0105239_10491273 | 3300010375 | Bacteria | 1395 |
| 271 | Ga0105246_10027556 | 3300011119 | Bacteria | 3724 |
| 272 | Ga0105246_10118887 | 3300011119 | Bacteria | 1955 |
| 273 | Ga0105246_10129408 | 3300011119 | Bacteria | 1883 |
| 274 | Ga0157373_10009701 | 3300013100 | Bacteria | 7105 |
| 275 | Ga0157371_10014930 | 3300013102 | Bacteria | 5844 |
| 276 | Ga0157371_10016478 | 3300013102 | Bacteria | 5513 |
| 277 | Ga0157371_10035692 | 3300013102 | Bacteria | 3562 |
| 278 | Ga0157370_10000452 | 3300013104 | Bacteria | 51362 |
| 279 | Ga0157370_10118437 | 3300013104 | Bacteria | 2473 |
| 280 | Ga0157369_10001732 | 3300013105 | Bacteria | 26524 |
| 281 | Ga0157369_10035219 | 3300013105 | Bacteria | 5490 |
| 282 | Ga0157369_10140326 | 3300013105 | Bacteria | 2557 |
| 283 | Ga0157369_10620257 | 3300013105 | Bacteria | 1116 |
| 284 | Ga0157374_10023374 | 3300013296 | Bacteria | 5530 |
| 285 | Ga0157374_10238651 | 3300013296 | Bacteria | 1787 |
| 286 | Ga0157374_10304336 | 3300013296 | Bacteria | 1577 |
| 287 | Ga0157378_10000590 | 3300013297 | Bacteria | 34084 |
| 288 | Ga0157378_10054853 | 3300013297 | Bacteria | 3549 |
| 289 | Ga0163162_10072025 | 3300013306 | Bacteria | 3510 |
| 290 | Ga0163162_10288648 | 3300013306 | Bacteria | 1772 |
| 291 | Ga0163162_10376876 | 3300013306 | Bacteria | 1552 |
| 292 | Ga0157372_10001062 | 3300013307 | Bacteria | 30024 |
| 293 | Ga0157372_10341051 | 3300013307 | Bacteria | 1745 |
| 294 | Ga0157375_10061997 | 3300013308 | Bacteria | 3714 |
| 295 | Ga0157375_10288654 | 3300013308 | Bacteria | 1803 |
| 296 | Ga0163163_10018471 | 3300014325 | Bacteria | 6528 |
| 297 | Ga0163163_10029120 | 3300014325 | Bacteria | 5310 |
| 298 | Ga0163163_10146475 | 3300014325 | Bacteria | 2405 |
| 299 | Ga0163163_10202981 | 3300014325 | Bacteria | 2031 |
| 300 | Ga0157379_10036534 | 3300014968 | Bacteria | 4380 |
| 301 | Ga0157379_10225498 | 3300014968 | Bacteria | 1698 |
| 302 | Ga0157376_10005783 | 3300014969 | Bacteria | 8664 |
| 303 | Ga0157376_10007674 | 3300014969 | Bacteria | 7727 |
| 304 | Ga0157376_10184983 | 3300014969 | Bacteria | 1907 |
| 305 | Ga0182006_1007687 | 3300015261 | Bacteria | 4923 |
| 306 | Ga0163161_10120572 | 3300017792 | Bacteria | 1970 |
| 307 | Ga0206353_11229857 | 3300020082 | Bacteria | 1166 |
| 308 | Ga0213874_10012646 | 3300021377 | Bacteria | 2169 |
| 309 | Ga0213875_10017205 | 3300021388 | Bacteria | 3498 |
| 310 | Ga0213875_10074012 | 3300021388 | Bacteria | 1589 |
| 311 | Ga0224712_10021090 | 3300022467 | Bacteria | 2224 |
| 312 | Ga0224572_1000869 | 3300024225 | Bacteria | 4061 |
| 313 | Ga0207425_1006279 | 3300025245 | Bacteria | 3268 |
| 314 | Ga0209759_1008745 | 3300025256 | Bacteria | 3129 |
| 315 | Ga0209129_1000008 | 3300025258 | Bacteria | 640959 |
| 316 | Ga0209256_1020720 | 3300025299 | Unclassified | 2042 |
| 317 | Ga0207655_1000026 | 3300025728 | Bacteria | 445528 |
| 318 | Ga0207655_1001273 | 3300025728 | Bacteria | 24068 |
| 319 | Ga0207655_1003937 | 3300025728 | Bacteria | 10769 |
| 320 | Ga0207655_1031276 | 3300025728 | Bacteria | 2456 |
| 321 | Ga0207692_10000891 | 3300025898 | Bacteria | 10795 |
| 322 | Ga0207692_10035485 | 3300025898 | Bacteria | 2423 |
| 323 | Ga0207692_10202050 | 3300025898 | Bacteria | 1169 |
| 324 | Ga0207642_10055381 | 3300025899 | Bacteria | 1814 |
| 325 | Ga0207642_10273093 | 3300025899 | Bacteria | 969 |
| 326 | Ga0207710_10001639 | 3300025900 | Bacteria | 10932 |
| 327 | Ga0207680_10006851 | 3300025903 | Bacteria | 5530 |
| 328 | Ga0207680_10134934 | 3300025903 | Bacteria | 1630 |
| 329 | Ga0207680_10141296 | 3300025903 | Bacteria | 1596 |
| 330 | Ga0207685_10002959 | 3300025905 | Bacteria | 4025 |
| 331 | Ga0207685_10017353 | 3300025905 | Bacteria | 2325 |
| 332 | Ga0207685_10047295 | 3300025905 | Bacteria | 1641 |
| 333 | Ga0207699_10000165 | 3300025906 | Bacteria | 40682 |
| 334 | Ga0207699_10002296 | 3300025906 | Bacteria | 9033 |
| 335 | Ga0207699_10123006 | 3300025906 | Bacteria | 1681 |
| 336 | Ga0207699_10298086 | 3300025906 | Bacteria | 1125 |
| 337 | Ga0207643_10058094 | 3300025908 | Bacteria | 2203 |
| 338 | Ga0207643_10071466 | 3300025908 | Bacteria | 1998 |
| 339 | Ga0207684_10132377 | 3300025910 | Bacteria | 2140 |
| 340 | Ga0207654_10049177 | 3300025911 | Bacteria | 2417 |
| 341 | Ga0207654_10253900 | 3300025911 | Bacteria | 1180 |
| 342 | Ga0207707_10000075 | 3300025912 | Bacteria | 101459 |
| 343 | Ga0207707_10000115 | 3300025912 | Bacteria | 81416 |
| 344 | Ga0207707_10000140 | 3300025912 | Bacteria | 74787 |
| 345 | Ga0207707_10000148 | 3300025912 | Bacteria | 73167 |
| 346 | Ga0207707_10001203 | 3300025912 | Bacteria | 24355 |
| 347 | Ga0207707_10002174 | 3300025912 | Bacteria | 17735 |
| 348 | Ga0207707_10064108 | 3300025912 | Bacteria | 3198 |
| 349 | Ga0207707_10086326 | 3300025912 | Bacteria | 2742 |
| 350 | Ga0207707_10192374 | 3300025912 | Bacteria | 1780 |
| 351 | Ga0207695_10012932 | 3300025913 | Bacteria | 9985 |
| 352 | Ga0207695_10020357 | 3300025913 | Bacteria | 7603 |
| 353 | Ga0207695_10021988 | 3300025913 | Bacteria | 7259 |
| 354 | Ga0207695_10052459 | 3300025913 | Bacteria | 4273 |
| 355 | Ga0207695_10129619 | 3300025913 | Bacteria | 2481 |
| 356 | Ga0207693_10000711 | 3300025915 | Bacteria | 29948 |
| 357 | Ga0207693_10000836 | 3300025915 | Bacteria | 27414 |
| 358 | Ga0207693_10012599 | 3300025915 | Bacteria | 6831 |
| 359 | Ga0207693_10167930 | 3300025915 | Bacteria | 1728 |
| 360 | Ga0207663_10044739 | 3300025916 | Bacteria | 2719 |
| 361 | Ga0207663_10082137 | 3300025916 | Bacteria | 2113 |
| 362 | Ga0207663_10147814 | 3300025916 | Bacteria | 1645 |
| 363 | Ga0207660_10010953 | 3300025917 | Bacteria | 5894 |
| 364 | Ga0207660_10045704 | 3300025917 | Bacteria | 3085 |
| 365 | Ga0207660_10068410 | 3300025917 | Bacteria | 2575 |
| 366 | Ga0207660_10218379 | 3300025917 | Unclassified | 1495 |
| 367 | Ga0207662_10000144 | 3300025918 | Bacteria | 34347 |
| 368 | Ga0207649_10248195 | 3300025920 | Bacteria | 1281 |
| 369 | Ga0207652_10019843 | 3300025921 | Bacteria | 5533 |
| 370 | Ga0207652_10024846 | 3300025921 | Bacteria | 4973 |
| 371 | Ga0207652_10042962 | 3300025921 | Bacteria | 3848 |
| 372 | Ga0207652_10066650 | 3300025921 | Bacteria | 3121 |
| 373 | Ga0207652_10069283 | 3300025921 | Bacteria | 3062 |
| 374 | Ga0207652_10162625 | 3300025921 | Bacteria | 2001 |
| 375 | Ga0207646_10039379 | 3300025922 | Bacteria | 4255 |
| 376 | Ga0207646_10354989 | 3300025922 | Bacteria | 1325 |
| 377 | Ga0207694_10046411 | 3300025924 | Bacteria | 3358 |
| 378 | Ga0207694_10056274 | 3300025924 | Unclassified | 3054 |
| 379 | Ga0207650_10113946 | 3300025925 | Bacteria | 2097 |
| 380 | Ga0207650_10119403 | 3300025925 | Bacteria | 2050 |
| 381 | Ga0207659_10055705 | 3300025926 | Bacteria | 2829 |
| 382 | Ga0207687_10000617 | 3300025927 | Bacteria | 23998 |
| 383 | Ga0207687_10126406 | 3300025927 | Bacteria | 1920 |
| 384 | Ga0207700_10000297 | 3300025928 | Bacteria | 29514 |
| 385 | Ga0207700_10043034 | 3300025928 | Bacteria | 3315 |
| 386 | Ga0207700_10095243 | 3300025928 | Bacteria | 2361 |
| 387 | Ga0207700_10220300 | 3300025928 | Bacteria | 1608 |
| 388 | Ga0207664_10000224 | 3300025929 | Bacteria | 42785 |
| 389 | Ga0207644_10000718 | 3300025931 | Bacteria | 20967 |
| 390 | Ga0207644_10027518 | 3300025931 | Bacteria | 3928 |
| 391 | Ga0207690_10155587 | 3300025932 | Bacteria | 1699 |
| 392 | Ga0207686_10000533 | 3300025934 | Bacteria | 24601 |
| 393 | Ga0207686_10068527 | 3300025934 | Bacteria | 2273 |
| 394 | Ga0207709_10000671 | 3300025935 | Bacteria | 27699 |
| 395 | Ga0207670_10002758 | 3300025936 | Bacteria | 9248 |
| 396 | Ga0207669_10009150 | 3300025937 | Bacteria | 4701 |
| 397 | Ga0207704_10071469 | 3300025938 | Bacteria | 2202 |
| 398 | Ga0207704_10392890 | 3300025938 | Bacteria | 1092 |
| 399 | Ga0207665_10000698 | 3300025939 | Bacteria | 22766 |
| 400 | Ga0207665_10013863 | 3300025939 | Bacteria | 5301 |
| 401 | Ga0207665_10014003 | 3300025939 | Bacteria | 5275 |
| 402 | Ga0207665_10019995 | 3300025939 | Bacteria | 4400 |
| 403 | Ga0207665_10049980 | 3300025939 | Bacteria | 2811 |
| 404 | Ga0207665_10335800 | 3300025939 | Bacteria | 1137 |
| 405 | Ga0207691_10361689 | 3300025940 | Bacteria | 1241 |
| 406 | Ga0207711_10037440 | 3300025941 | Bacteria | 4120 |
| 407 | Ga0207711_10317464 | 3300025941 | Bacteria | 1439 |
| 408 | Ga0207689_10014975 | 3300025942 | Bacteria | 6579 |
| 409 | Ga0207661_10077971 | 3300025944 | Bacteria | 2726 |
| 410 | Ga0207661_10089530 | 3300025944 | Bacteria | 2561 |
| 411 | Ga0207679_10009229 | 3300025945 | Bacteria | 6306 |
| 412 | Ga0207679_10012674 | 3300025945 | Bacteria | 5503 |
| 413 | Ga0207667_10006818 | 3300025949 | Bacteria | 13802 |
| 414 | Ga0207667_10017408 | 3300025949 | Bacteria | 8089 |
| 415 | Ga0207667_10067590 | 3300025949 | Bacteria | 3722 |
| 416 | Ga0207651_10121974 | 3300025960 | Bacteria | 1978 |
| 417 | Ga0207651_10167307 | 3300025960 | Bacteria | 1730 |
| 418 | Ga0207712_10009011 | 3300025961 | Bacteria | 6312 |
| 419 | Ga0207712_10025418 | 3300025961 | Bacteria | 3934 |
| 420 | Ga0207712_10026592 | 3300025961 | Bacteria | 3857 |
| 421 | Ga0207712_10396989 | 3300025961 | Bacteria | 1158 |
| 422 | Ga0207640_10003394 | 3300025981 | Bacteria | 8581 |
| 423 | Ga0207658_10001013 | 3300025986 | Bacteria | 22929 |
| 424 | Ga0207658_10009144 | 3300025986 | Bacteria | 6722 |
| 425 | Ga0207677_10073331 | 3300026023 | Bacteria | 2424 |
| 426 | Ga0207677_10108147 | 3300026023 | Bacteria | 2064 |
| 427 | Ga0207703_10001997 | 3300026035 | Bacteria | 17998 |
| 428 | Ga0207703_10027866 | 3300026035 | Bacteria | 4449 |
| 429 | Ga0207639_10183137 | 3300026041 | Bacteria | 1783 |
| 430 | Ga0207639_10215465 | 3300026041 | Bacteria | 1655 |
| 431 | Ga0207678_10015060 | 3300026067 | Bacteria | 6803 |
| 432 | Ga0207678_10116209 | 3300026067 | Bacteria | 2282 |
| 433 | Ga0207708_10000427 | 3300026075 | Bacteria | 32845 |
| 434 | Ga0207708_10249449 | 3300026075 | Bacteria | 1430 |
| 435 | Ga0207702_10187012 | 3300026078 | Bacteria | 1911 |
| 436 | Ga0207702_10327155 | 3300026078 | Bacteria | 1461 |
| 437 | Ga0207641_10001033 | 3300026088 | Bacteria | 28219 |
| 438 | Ga0207641_10094596 | 3300026088 | Unclassified | 2621 |
| 439 | Ga0207641_10134247 | 3300026088 | Bacteria | 2226 |
| 440 | Ga0207648_10000018 | 3300026089 | Bacteria | 148157 |
| 441 | Ga0207648_10055430 | 3300026089 | Bacteria | 3460 |
| 442 | Ga0207648_10168017 | 3300026089 | Bacteria | 1938 |
| 443 | Ga0207648_10200052 | 3300026089 | Bacteria | 1772 |
| 444 | Ga0207648_10455939 | 3300026089 | Bacteria | 1165 |
| 445 | Ga0207676_10010945 | 3300026095 | Bacteria | 6475 |
| 446 | Ga0207676_10462659 | 3300026095 | Bacteria | 1198 |
| 447 | Ga0207675_100000050 | 3300026118 | Bacteria | 83832 |
| 448 | Ga0207675_100102318 | 3300026118 | Bacteria | 2700 |
| 449 | Ga0207675_100195591 | 3300026118 | Bacteria | 1941 |
| 450 | Ga0207683_10017307 | 3300026121 | Bacteria | 6141 |
| 451 | Ga0207683_10019930 | 3300026121 | Bacteria | 5731 |
| 452 | Ga0207683_10098090 | 3300026121 | Bacteria | 2614 |
| 453 | Ga0207698_10012742 | 3300026142 | Bacteria | 5518 |
| 454 | Ga0207698_10529242 | 3300026142 | Bacteria | 1152 |
| 455 | Ga0209281_1000058 | 3300027111 | Bacteria | 300244 |
| 456 | Ga0209281_1001193 | 3300027111 | Bacteria | 17757 |
| 457 | Ga0209371_1000014 | 3300027312 | Bacteria | 661118 |
| 458 | Ga0209371_1000054 | 3300027312 | Bacteria | 259676 |
| 459 | Ga0209984_1002678 | 3300027424 | Bacteria | 2000 |
| 460 | Ga0209995_1000886 | 3300027471 | Bacteria | 4644 |
| 461 | Ga0209995_1014840 | 3300027471 | Bacteria | 1277 |
| 462 | Ga0209179_1001321 | 3300027512 | Bacteria | 2996 |
| 463 | Ga0209970_1005815 | 3300027614 | Bacteria | 2027 |
| 464 | Ga0209983_1003351 | 3300027665 | Bacteria | 3433 |
| 465 | Ga0209588_1014068 | 3300027671 | Bacteria | 2447 |
| 466 | Ga0209588_1016014 | 3300027671 | Bacteria | 2310 |
| 467 | Ga0209971_1001514 | 3300027682 | Bacteria | 5753 |
| 468 | Ga0209974_10008018 | 3300027876 | Bacteria | 3620 |
| 469 | Ga0207428_10001317 | 3300027907 | Bacteria | 26410 |
| 470 | Ga0268266_10002891 | 3300028379 | Bacteria | 17806 |
| 471 | Ga0268266_10007953 | 3300028379 | Bacteria | 9481 |
| 472 | Ga0268266_10022791 | 3300028379 | Bacteria | 5331 |
| 473 | Ga0268266_10049644 | 3300028379 | Bacteria | 3598 |
| 474 | Ga0268266_10062739 | 3300028379 | Bacteria | 3208 |
| 475 | Ga0268266_10108480 | 3300028379 | Bacteria | 2456 |
| 476 | Ga0268266_10120601 | 3300028379 | Bacteria | 2333 |
| 477 | Ga0268266_10379280 | 3300028379 | Bacteria | 1333 |
| 478 | Ga0268265_10017012 | 3300028380 | Bacteria | 5007 |
| 479 | Ga0268265_10039433 | 3300028380 | Bacteria | 3482 |
| 480 | Ga0268265_10050324 | 3300028380 | Bacteria | 3139 |
| 481 | Ga0268265_10072968 | 3300028380 | Bacteria | 2679 |
| 482 | Ga0268265_10151055 | 3300028380 | Bacteria | 1959 |
| 483 | Ga0268265_10220746 | 3300028380 | Bacteria | 1658 |
| 484 | Ga0268264_10000198 | 3300028381 | Bacteria | 122906 |
| 485 | Ga0268264_10001294 | 3300028381 | Bacteria | 23624 |
| 486 | Ga0268264_10018094 | 3300028381 | Bacteria | 5763 |
| 487 | Ga0268264_10185648 | 3300028381 | Unclassified | 1892 |
| 488 | Ga0307515_10003416 | 3300028794 | Bacteria | 33442 |
| 489 | Ga0265338_10034673 | 3300028800 | Bacteria | 4873 |
| 490 | Ga0268256_1000012 | 3300030500 | Bacteria | 794553 |
| 491 | Ga0268256_1000021 | 3300030500 | Bacteria | 542735 |
| 492 | Ga0307511_10000048 | 3300030521 | Bacteria | 98665 |
| 493 | Ga0307511_10009582 | 3300030521 | Bacteria | 9647 |
| 494 | Ga0265328_10014425 | 3300031239 | Bacteria | 3112 |
| 495 | Ga0265340_10024043 | 3300031247 | Bacteria | 3098 |
| 496 | Ga0265340_10054871 | 3300031247 | Bacteria | 1921 |
| 497 | Ga0265339_10107866 | 3300031249 | Bacteria | 1444 |
| 498 | Ga0265331_10010845 | 3300031250 | Bacteria | 5012 |
| 499 | Ga0265327_10003233 | 3300031251 | Bacteria | 15840 |
| 500 | Ga0307513_10013985 | 3300031456 | Bacteria | 9831 |
| 501 | Ga0307513_10028805 | 3300031456 | Bacteria | 6343 |
| 502 | Ga0307513_10156325 | 3300031456 | Bacteria | 2179 |
| 503 | Ga0307509_10000017 | 3300031507 | Bacteria | 265012 |
| 504 | Ga0307509_10000803 | 3300031507 | Bacteria | 53898 |
| 505 | Ga0307509_10136691 | 3300031507 | Bacteria | 2395 |
| 506 | Ga0307408_100027435 | 3300031548 | Bacteria | 3924 |
| 507 | Ga0316575_10034701 | 3300031665 | Bacteria | 1982 |
| 508 | Ga0316579_10000158 | 3300031691 | Bacteria | 19318 |
| 509 | Ga0316579_10006029 | 3300031691 | Bacteria | 4922 |
| 510 | Ga0316576_10009427 | 3300031727 | Bacteria | 6299 |
| 511 | Ga0316576_10024964 | 3300031727 | Bacteria | 4180 |
| 512 | Ga0316576_10029895 | 3300031727 | Bacteria | 3854 |
| 513 | Ga0316576_10136287 | 3300031727 | Bacteria | 1847 |
| 514 | Ga0316578_10056886 | 3300031728 | Bacteria | 2297 |
| 515 | Ga0316578_10127593 | 3300031728 | Bacteria | 1530 |
| 516 | Ga0316577_10003059 | 3300031733 | Bacteria | 8392 |
| 517 | Ga0316577_10072152 | 3300031733 | Bacteria | 1927 |
| 518 | Ga0307413_10004776 | 3300031824 | Bacteria | 5950 |
| 519 | Ga0307410_10000500 | 3300031852 | Bacteria | 15951 |
| 520 | Ga0307407_10021514 | 3300031903 | Bacteria | 3328 |
| 521 | Ga0307412_10077641 | 3300031911 | Bacteria | 2285 |
| 522 | Ga0307409_100000732 | 3300031995 | Bacteria | 14712 |
| 523 | Ga0307409_100438604 | 3300031995 | Bacteria | 1257 |
| 524 | Ga0307416_100146625 | 3300032002 | Bacteria | 2156 |
| 525 | Ga0307416_100178547 | 3300032002 | Bacteria | 1987 |
| 526 | Ga0307414_10143163 | 3300032004 | Bacteria | 1875 |
| 527 | Ga0307414_10264018 | 3300032004 | Bacteria | 1438 |
| 528 | Ga0307411_10060016 | 3300032005 | Bacteria | 2523 |
| 529 | Ga0307411_10282903 | 3300032005 | Bacteria | 1321 |
| 530 | Ga0316583_10021096 | 3300032133 | Bacteria | 2336 |
| 531 | Ga0316585_10001855 | 3300032137 | Bacteria | 5648 |
| 532 | Ga0316593_10004339 | 3300032168 | Bacteria | 3632 |
| 533 | Ga0316593_10004729 | 3300032168 | Unclassified | 3523 |
| 534 | Ga0316593_10007343 | 3300032168 | Bacteria | 3023 |
| 535 | Ga0316593_10023661 | 3300032168 | Bacteria | 1941 |
| 536 | Ga0316593_10026155 | 3300032168 | Bacteria | 1863 |
| 537 | Ga0316593_10103175 | 3300032168 | Bacteria | 1013 |
| 538 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 539 | Ga0307510_10063197 | 3300033180 | Bacteria | 3773 |
| 540 | Ga0373938_0036310 | 3300034957 | Bacteria | 1078 |
| 541 | Ga0373926_0002919 | 3300035083 | Bacteria | 5481 |
| 542 | Ga0373926_0005260 | 3300035083 | Bacteria | 4259 |
| 543 | Ga0373926_0028007 | 3300035083 | Bacteria | 1976 |
| 544 | Ga0373934_0003089 | 3300035086 | Bacteria | 6079 |
| 545 | Ga0373944_0000876 | 3300035089 | Bacteria | 7419 |
| 546 | Ga0373949_0028016 | 3300035090 | Bacteria | 1328 |
| 547 | Ga0373923_0074354 | 3300035111 | Bacteria | 1464 |
| 548 | Ga0373923_0088128 | 3300035111 | Bacteria | 1354 |
| 549 | Ga0373932_0001979 | 3300035112 | Bacteria | 5406 |
| 550 | Ga0373936_0000488 | 3300035113 | Bacteria | 13427 |
| 551 | Ga0373936_0006850 | 3300035113 | Bacteria | 4288 |
| 552 | Ga0373936_0033970 | 3300035113 | Bacteria | 2024 |
| 553 | Ga0373945_0004013 | 3300035116 | Bacteria | 4654 |
| 554 | Ga0373945_0008747 | 3300035116 | Bacteria | 3304 |
| 555 | Ga0373954_0002373 | 3300035118 | Bacteria | 7874 |
| 556 | Ga0373954_0055222 | 3300035118 | Bacteria | 1868 |
| 557 | Ga0373956_0077750 | 3300035119 | Bacteria | 1519 |
| 558 | Ga0373943_0004831 | 3300035170 | Bacteria | 6092 |
| 559 | Ga0373943_0016313 | 3300035170 | Bacteria | 3385 |
| 560 | Ga0373943_0078886 | 3300035170 | Bacteria | 1684 |
| 561 | Ga0373946_0000439 | 3300035171 | Bacteria | 13619 |
| 562 | Ga0373946_0026733 | 3300035171 | Bacteria | 2278 |
| 563 | Ga0373946_0029774 | 3300035171 | Bacteria | 2176 |
| 564 | Ga0373946_0032111 | 3300035171 | Bacteria | 2107 |
| 565 | Ga0373955_0059225 | 3300035172 | Bacteria | 2109 |
| 566 | Ga0373955_0099325 | 3300035172 | Bacteria | 1668 |
| 567 | Ga0316574_0007609 | 3300035398 | Bacteria | 5950 |
| 568 | Ga0316574_0016469 | 3300035398 | Bacteria | 4309 |
| 569 | Ga0316574_0033450 | 3300035398 | Bacteria | 3129 |
| 570 | Ga0316574_0037376 | 3300035398 | Bacteria | 2978 |
| 571 | Ga0316574_0073569 | 3300035398 | Bacteria | 2161 |
| 572 | Ga0316574_0074137 | 3300035398 | Bacteria | 2153 |
| 573 | Ga0316574_0099000 | 3300035398 | Bacteria | 1865 |
| 574 | Ga0316574_0134428 | 3300035398 | Bacteria | 1592 |
| 575 | Ga0373931_0030542 | 3300035691 | Bacteria | 2774 |
| 576 | Ga0373931_0134062 | 3300035691 | Bacteria | 1428 |
| 577 | Ga0373935_0000618 | 3300035692 | Bacteria | 18647 |
| 578 | Ga0373935_0004234 | 3300035692 | Bacteria | 8414 |
| 579 | Ga0373927_0000383 | 3300035695 | Bacteria | 34290 |
| 580 | Ga0373927_0117777 | 3300035695 | Bacteria | 1732 |
| 581 | Ga0373933_0010727 | 3300035724 | Bacteria | 5026 |
| 582 | Ga0373947_0000002 | 3300035725 | Bacteria | 383924 |
| 583 | Ga0373947_0005590 | 3300035725 | Bacteria | 7330 |
| 584 | Ga0373947_0059036 | 3300035725 | Bacteria | 2325 |
| 585 | Ga0373947_0109028 | 3300035725 | Bacteria | 1747 |
| 586 | Ga0373937_0035130 | 3300036401 | Bacteria | 4560 |
| 587 | Ga0316582_0004967 | 3300036647 | Bacteria | 6795 |
| 588 | Ga0316582_0064613 | 3300036647 | Bacteria | 2354 |
| 589 | Ga0316582_0084293 | 3300036647 | Bacteria | 2080 |
| 590 | Ga0316584_0030898 | 3300036712 | Bacteria | 3959 |
| 591 | Ga0316584_0053695 | 3300036712 | Bacteria | 3016 |
| 592 | Ga0316584_0066260 | 3300036712 | Bacteria | 2706 |
| 593 | Ga0373925_0005223 | 3300037068 | Bacteria | 9707 |
| 594 | Ga0373925_0008937 | 3300037068 | Bacteria | 7300 |
| 595 | Ga0373925_0013418 | 3300037068 | Bacteria | 5928 |
| 596 | Ga0373925_0038319 | 3300037068 | Bacteria | 3543 |
| 597 | Ga0395900_0000060 | 3300037418 | Bacteria | 205509 |
| 598 | Ga0395900_0089295 | 3300037418 | Bacteria | 3168 |
| 599 | Ga0395900_0216386 | 3300037418 | Bacteria | 1933 |
| 600 | Ga0395898_0083235 | 3300037466 | Bacteria | 3084 |
| 601 | Ga0436364_0260906 | 3300037853 | Bacteria | 21582 |
| 602 | Ga0400484_23031 | 3300038725 | Bacteria | 6518 |
| 603 | Ga0400484_27744 | 3300038725 | Bacteria | 2344 |
| 604 | Ga0400490_45667 | 3300038726 | Bacteria | 1291 |
| 605 | Ga0400483_055564 | 3300039062 | Bacteria | 3939 |
| 606 | Ga0400483_086083 | 3300039062 | Bacteria | 1660 |
| 607 | Ga0400483_093671 | 3300039062 | Bacteria | 1758 |
| 608 | Ga0400483_201732 | 3300039062 | Bacteria | 4012 |
| 609 | Ga0400483_280570 | 3300039062 | Bacteria | 2951 |
| 610 | Ga0436365_0360171 | 3300039437 | Bacteria | 13869 |
| 611 | Ga0436365_1274404 | 3300039437 | Bacteria | 1696 |
| 612 | Ga0436365_1414349 | 3300039437 | Bacteria | 6345 |
| 613 | Ga0436360_1005797 | 3300039438 | Bacteria | 6145 |
| 614 | Ga0436361_0576483 | 3300039447 | Bacteria | 1996 |
| 615 | Ga0436363_0296494 | 3300039450 | Bacteria | 2831 |
| 616 | Ga0436363_0375975 | 3300039450 | Bacteria | 36949 |
| 617 | Ga0436363_1127370 | 3300039450 | Bacteria | 2313 |
| 618 | Ga0436363_1153079 | 3300039450 | Bacteria | 1351 |
| 619 | Ga0436363_1648012 | 3300039450 | Bacteria | 2447 |
| 620 | Ga0439436_0011487 | 3300041404 | Bacteria | 2689 |
| 621 | Ga0439447_003544 | 3300041407 | Bacteria | 5531 |
| 622 | Ga0451789_1314313 | 3300041443 | Bacteria | 3094 |
| 623 | Ga0451793_0368982 | 3300041452 | Bacteria | 1212 |
| 624 | Ga0451802_1342131 | 3300041460 | Bacteria | 1915 |
| 625 | Ga0451837_0466646 | 3300041494 | Bacteria | 1810 |
| 626 | Ga0451841_0078952 | 3300041498 | Bacteria | 1172 |
| 627 | Ga0439432_002736 | 3300042006 | Bacteria | 6589 |
| 628 | Ga0439432_004394 | 3300042006 | Bacteria | 5151 |
| 629 | Ga0439451_005425 | 3300042009 | Bacteria | 2599 |
| 630 | Ga0439451_007565 | 3300042009 | Bacteria | 2211 |
| 631 | Ga0439452_000004 | 3300042010 | Bacteria | 764268 |
| 632 | Ga0439452_000005 | 3300042010 | Bacteria | 646919 |
| 633 | Ga0439452_000428 | 3300042010 | Bacteria | 24279 |
| 634 | Ga0439452_008326 | 3300042010 | Bacteria | 3129 |
| 635 | Ga0439444_0001930 | 3300042437 | Bacteria | 2765 |
| 636 | Ga0439460_0000378 | 3300042461 | Bacteria | 9469 |
| 637 | Ga0451577_0016678 | 3300042876 | Bacteria | 6793 |
| 638 | Ga0451577_0057889 | 3300042876 | Bacteria | 3454 |
| 639 | Ga0466969_0000960 | 3300044656 | Bacteria | 15534 |
| 640 | Ga0466969_0005735 | 3300044656 | Bacteria | 6600 |
| 641 | Ga0466969_0118262 | 3300044656 | Bacteria | 1235 |
| 642 | Ga0466966_0009008 | 3300044684 | Bacteria | 6614 |
| 643 | Ga0466966_0053439 | 3300044684 | Bacteria | 2563 |
| 644 | Ga0466963_0112886 | 3300044694 | Bacteria | 1866 |
| 645 | Ga0453684_0045609 | 3300044712 | Bacteria | 5844 |
| 646 | Ga0466971_0001123 | 3300044719 | Bacteria | 11133 |
| 647 | Ga0466968_0027250 | 3300044735 | Bacteria | 2351 |
| 648 | Ga0466970_0046170 | 3300044765 | Bacteria | 2320 |
| 649 | Ga0466957_0024169 | 3300044842 | Bacteria | 3595 |
| 650 | Ga0466960_0013133 | 3300044901 | Bacteria | 3512 |
| 651 | Ga0466959_0014029 | 3300045049 | Bacteria | 5816 |
| 652 | Ga0466959_0034640 | 3300045049 | Bacteria | 3735 |
| 653 | Ga0466959_0053806 | 3300045049 | Bacteria | 2942 |
| 654 | Ga0451576_0000217 | 3300045051 | Bacteria | 142222 |
| 655 | Ga0451576_0067931 | 3300045051 | Bacteria | 3710 |
| 656 | Ga0451576_0091467 | 3300045051 | Bacteria | 3165 |
| 657 | Ga0466958_0036183 | 3300045836 | Bacteria | 2954 |
| 658 | Ga0466958_0072990 | 3300045836 | Bacteria | 2102 |
| 659 | Ga0466967_0042746 | 3300045976 | Bacteria | 3918 |
| 660 | Ga0466967_0161509 | 3300045976 | Bacteria | 2103 |
| 661 | Ga0495592_0010288 | 3300046454 | Bacteria | 7053 |
| 662 | Ga0495592_0120274 | 3300046454 | Bacteria | 1848 |
| 663 | Ga0495603_0010466 | 3300046455 | Bacteria | 5619 |
| 664 | Ga0495590_0002047 | 3300046457 | Bacteria | 8457 |
| 665 | Ga0495629_0347594 | 3300046459 | Bacteria | 1012 |
| 666 | Ga0495638_0076082 | 3300046460 | Bacteria | 2045 |
| 667 | Ga0495638_0160552 | 3300046460 | Bacteria | 1297 |
| 668 | Ga0495641_0042287 | 3300046461 | Bacteria | 2112 |
| 669 | Ga0495653_0006412 | 3300046463 | Bacteria | 9646 |
| 670 | Ga0495580_0001506 | 3300046472 | Bacteria | 20489 |
| 671 | Ga0495580_0015225 | 3300046472 | Bacteria | 5811 |
| 672 | Ga0495580_0043965 | 3300046472 | Bacteria | 3178 |
| 673 | Ga0495582_0037643 | 3300046473 | Bacteria | 2661 |
| 674 | Ga0495639_0002165 | 3300046475 | Bacteria | 8661 |
| 675 | Ga0495639_0032526 | 3300046475 | Bacteria | 2326 |
| 676 | Ga0495662_0013627 | 3300046476 | Bacteria | 3958 |
| 677 | Ga0495664_0004691 | 3300046477 | Bacteria | 7476 |
| 678 | Ga0495584_0023980 | 3300046491 | Bacteria | 3093 |
| 679 | Ga0495594_0082982 | 3300046499 | Bacteria | 1791 |
| 680 | Ga0495594_0151865 | 3300046499 | Bacteria | 1315 |
| 681 | Ga0495596_0027282 | 3300046500 | Bacteria | 2298 |
| 682 | Ga0495583_0021099 | 3300046506 | Bacteria | 3356 |
| 683 | Ga0495608_0144824 | 3300046511 | Bacteria | 1515 |
| 684 | Ga0495618_0093151 | 3300046514 | Bacteria | 1926 |
| 685 | Ga0495628_0056228 | 3300046516 | Bacteria | 3098 |
| 686 | Ga0495630_0028591 | 3300046517 | Bacteria | 4143 |
| 687 | Ga0495630_0039960 | 3300046517 | Bacteria | 3506 |
| 688 | Ga0495630_0293994 | 3300046517 | Bacteria | 1241 |
| 689 | Ga0495648_0013861 | 3300046524 | Bacteria | 5935 |
| 690 | Ga0495648_0117804 | 3300046524 | Bacteria | 1433 |
| 691 | Ga0495666_0046639 | 3300046526 | Bacteria | 2088 |
| 692 | Ga0495665_0051846 | 3300046531 | Bacteria | 2173 |
| 693 | Ga0495640_0053821 | 3300046533 | Bacteria | 2758 |
| 694 | Ga0495586_0004720 | 3300046535 | Bacteria | 7284 |
| 695 | Ga0495586_0004892 | 3300046535 | Bacteria | 7164 |
| 696 | Ga0495587_0097364 | 3300046536 | Bacteria | 1696 |
| 697 | Ga0495667_0036525 | 3300046559 | Bacteria | 3279 |
| 698 | Ga0495667_0068892 | 3300046559 | Bacteria | 2309 |
| 699 | Ga0495656_0004463 | 3300046615 | Bacteria | 4796 |
| 700 | Ga0495668_0148242 | 3300046616 | Bacteria | 1285 |
| 701 | Ga0495634_0041752 | 3300046642 | Bacteria | 3114 |
| 702 | Ga0495625_0029573 | 3300046660 | Bacteria | 4095 |
| 703 | Ga0495635_0000464 | 3300046663 | Bacteria | 25665 |
| 704 | Ga0495657_0088806 | 3300046675 | Bacteria | 1986 |
| 705 | Ga0495657_0166310 | 3300046675 | Bacteria | 1361 |
| 706 | Ga0495599_0046240 | 3300046678 | Bacteria | 2729 |
| 707 | Ga0495599_0065356 | 3300046678 | Bacteria | 2273 |
| 708 | Ga0495646_0129415 | 3300046680 | Bacteria | 1422 |
| 709 | Ga0495647_0001482 | 3300046681 | Bacteria | 7280 |
| 710 | Ga0495647_0003243 | 3300046681 | Bacteria | 5205 |
| 711 | Ga0495658_0006801 | 3300046683 | Bacteria | 5628 |
| 712 | Ga0495658_0085759 | 3300046683 | Bacteria | 1856 |
| 713 | Ga0495671_0024188 | 3300046692 | Bacteria | 3166 |
| 714 | Ga0495649_0003326 | 3300046694 | Bacteria | 10920 |
| 715 | Ga0495600_0003135 | 3300046809 | Bacteria | 9677 |
| 716 | Ga0495581_0064804 | 3300047315 | Bacteria | 2111 |
| 717 | Ga0495604_0155405 | 3300047317 | Bacteria | 1621 |
| 718 | Ga0495674_0094152 | 3300047319 | Bacteria | 2555 |
| 719 | Ga0495676_0038206 | 3300047321 | Bacteria | 3989 |
| 720 | Ga0495676_0116557 | 3300047321 | Bacteria | 1950 |
| 721 | Ga0495680_0035758 | 3300047322 | Bacteria | 3996 |
| 722 | Ga0495675_0036099 | 3300047444 | Bacteria | 3154 |
| 723 | Ga0495681_0133669 | 3300047470 | Bacteria | 1054 |
| 724 | Ga0495684_0024315 | 3300047471 | Bacteria | 4663 |
| 725 | Ga0495602_0083747 | 3300048088 | Bacteria | 2671 |
| 726 | Ga0495602_0238165 | 3300048088 | Bacteria | 1363 |
| 727 | Ga0495615_0025199 | 3300048090 | Bacteria | 1379 |
| 728 | Ga0495626_0097765 | 3300048091 | Bacteria | 1283 |
| 729 | Ga0496100_0077976 | 3300048903 | Bacteria | 2229 |
| 730 | Ga0496100_0117923 | 3300048903 | Bacteria | 1853 |
| 731 | Ga0496102_0024944 | 3300048905 | Bacteria | 5318 |
| 732 | Ga0496102_0032576 | 3300048905 | Bacteria | 4682 |
| 733 | Ga0496103_0078166 | 3300048906 | Bacteria | 2078 |
| 734 | Ga0496104_0448094 | 3300048907 | Bacteria | 1203 |
| 735 | Ga0496105_0121352 | 3300048908 | Bacteria | 2155 |
| 736 | Ga0496107_0099375 | 3300048910 | Bacteria | 2132 |
| 737 | Ga0496108_0021701 | 3300048911 | Bacteria | 5279 |
| 738 | Ga0496108_0446951 | 3300048911 | Bacteria | 1129 |
| 739 | Ga0496109_0028132 | 3300048912 | Bacteria | 5026 |
| 740 | Ga0496109_0200936 | 3300048912 | Bacteria | 1874 |
| 741 | Ga0496110_0038938 | 3300048913 | Bacteria | 4138 |
| 742 | Ga0496111_0003521 | 3300048914 | Bacteria | 9689 |
| 743 | Ga0496112_0113896 | 3300048915 | Bacteria | 2675 |
| 744 | Ga0496112_0175623 | 3300048915 | Bacteria | 2107 |
| 745 | Ga0496112_0290370 | 3300048915 | Bacteria | 1581 |
| 746 | Ga0496113_0086931 | 3300048916 | Bacteria | 2403 |
| 747 | Ga0496114_0034713 | 3300048917 | Bacteria | 4162 |
| 748 | Ga0496115_0021506 | 3300048918 | Bacteria | 4985 |
| 749 | Ga0496115_0127037 | 3300048918 | Bacteria | 2101 |
| 750 | Ga0496115_0194916 | 3300048918 | Bacteria | 1674 |
| 751 | Ga0496116_0000217 | 3300048919 | Bacteria | 108128 |
| 752 | Ga0496116_0032636 | 3300048919 | Bacteria | 3707 |
| 753 | Ga0496116_0089752 | 3300048919 | Bacteria | 1873 |
| 754 | Ga0496117_0000135 | 3300048920 | Bacteria | 160708 |
| 755 | Ga0496117_0001101 | 3300048920 | Bacteria | 40741 |
| 756 | Ga0496117_0005290 | 3300048920 | Bacteria | 13669 |
| 757 | Ga0496118_0000098 | 3300048921 | Bacteria | 160610 |
| 758 | Ga0496118_0002338 | 3300048921 | Bacteria | 25715 |
| 759 | Ga0496118_0085298 | 3300048921 | Bacteria | 2199 |
| 760 | Ga0496119_0000026 | 3300048922 | Bacteria | 254759 |
| 761 | Ga0496119_0081790 | 3300048922 | Bacteria | 1859 |
| 762 | Ga0496120_0000543 | 3300048923 | Bacteria | 57596 |
| 763 | Ga0496120_0031913 | 3300048923 | Bacteria | 3182 |
| 764 | Ga0496120_0071899 | 3300048923 | Bacteria | 1897 |
| 765 | Ga0496121_0023475 | 3300048924 | Bacteria | 5938 |
| 766 | Ga0496121_0166063 | 3300048924 | Bacteria | 1608 |
| 767 | Ga0496124_0000142 | 3300048927 | Bacteria | 147311 |
| 768 | Ga0496124_0007498 | 3300048927 | Bacteria | 11584 |
| 769 | Ga0496124_0078346 | 3300048927 | Bacteria | 2724 |
| 770 | Ga0496125_0002765 | 3300048928 | Bacteria | 22202 |
| 771 | Ga0496125_0014965 | 3300048928 | Bacteria | 7531 |
| 772 | Ga0496125_0028906 | 3300048928 | Bacteria | 4993 |
| 773 | Ga0496126_0026574 | 3300048929 | Bacteria | 5547 |
| 774 | Ga0496126_0035411 | 3300048929 | Bacteria | 4679 |
| 775 | Ga0496126_0085718 | 3300048929 | Bacteria | 2776 |
| 776 | Ga0496126_0248437 | 3300048929 | Bacteria | 1483 |
| 777 | Ga0501033_0191500 | 3300049570 | Bacteria | 1463 |
| 778 | Ga0501034_0070053 | 3300049571 | Bacteria | 3518 |
| 779 | Ga0501034_0390282 | 3300049571 | Bacteria | 1316 |
| 780 | Ga0501036_0026800 | 3300049572 | Bacteria | 4869 |
| 781 | Ga0501036_0206502 | 3300049572 | Bacteria | 1651 |
| 782 | Ga0501037_0109540 | 3300049573 | Bacteria | 1990 |
| 783 | Ga0501037_0113504 | 3300049573 | Bacteria | 1951 |
| 784 | Ga0501038_0054535 | 3300049574 | Bacteria | 3438 |
| 785 | Ga0501038_0193941 | 3300049574 | Bacteria | 1633 |
| 786 | Ga0501039_0014722 | 3300049575 | Bacteria | 5984 |
| 787 | Ga0501040_0014832 | 3300049576 | Bacteria | 5143 |
| 788 | Ga0501040_0070544 | 3300049576 | Bacteria | 2411 |
| 789 | Ga0501041_0022500 | 3300049577 | Bacteria | 3774 |
| 790 | Ga0501042_0004832 | 3300049578 | Bacteria | 8614 |
| 791 | Ga0501046_0024641 | 3300049580 | Bacteria | 4932 |
| 792 | Ga0501047_0045918 | 3300049581 | Bacteria | 4223 |
| 793 | Ga0501048_0017183 | 3300049582 | Bacteria | 5331 |
| 794 | Ga0501048_0043811 | 3300049582 | Bacteria | 3202 |
| 795 | Ga0501067_0016549 | 3300049583 | Bacteria | 4075 |
| 796 | Ga0501067_0021788 | 3300049583 | Bacteria | 3546 |
| 797 | Ga0501068_0000804 | 3300049584 | Bacteria | 16286 |
| 798 | Ga0501070_0011456 | 3300049586 | Bacteria | 7491 |
| 799 | Ga0501071_0002075 | 3300049587 | Bacteria | 12010 |
| 800 | Ga0501071_0013048 | 3300049587 | Bacteria | 5654 |
| 801 | Ga0501071_0295976 | 3300049587 | Bacteria | 1226 |
| 802 | Ga0501072_0006963 | 3300049588 | Bacteria | 8581 |
| 803 | Ga0501072_0019946 | 3300049588 | Bacteria | 5189 |
| 804 | Ga0501072_0020139 | 3300049588 | Bacteria | 5166 |
| 805 | Ga0501073_0006025 | 3300049589 | Bacteria | 9045 |
| 806 | Ga0501074_0005572 | 3300049590 | Bacteria | 9057 |
| 807 | Ga0501074_0033465 | 3300049590 | Bacteria | 3725 |
| 808 | Ga0501074_0046875 | 3300049590 | Bacteria | 3125 |
| 809 | Ga0501074_0105954 | 3300049590 | Bacteria | 2013 |
| 810 | Ga0501075_0018337 | 3300049591 | Bacteria | 5065 |
| 811 | Ga0501075_0134707 | 3300049591 | Bacteria | 1882 |
| 812 | Ga0501076_0000300 | 3300049592 | Bacteria | 30853 |
| 813 | Ga0501076_0010795 | 3300049592 | Bacteria | 6791 |
| 814 | Ga0501076_0048350 | 3300049592 | Bacteria | 3363 |
| 815 | Ga0501076_0179238 | 3300049592 | Bacteria | 1727 |
| 816 | Ga0501076_0224221 | 3300049592 | Bacteria | 1536 |
| 817 | Ga0501077_0004667 | 3300049593 | Bacteria | 8327 |
| 818 | Ga0501079_0001458 | 3300049741 | Bacteria | 16725 |
| 819 | Ga0501079_0024720 | 3300049741 | Bacteria | 4609 |
| 820 | Ga0501079_0142134 | 3300049741 | Bacteria | 1869 |
| 821 | Ga0501079_0302674 | 3300049741 | Bacteria | 1251 |
| 822 | Ga0501080_0017301 | 3300049742 | Bacteria | 6663 |
| 823 | Ga0501080_0032012 | 3300049742 | Bacteria | 4902 |
| 824 | Ga0501080_0269684 | 3300049742 | Bacteria | 1549 |
| 825 | Ga0501081_0035049 | 3300049743 | Bacteria | 3416 |
| 826 | Ga0501081_0234111 | 3300049743 | Bacteria | 1338 |
| 827 | Ga0501083_0009175 | 3300049744 | Bacteria | 6989 |
| 828 | Ga0501083_0246352 | 3300049744 | Bacteria | 1163 |
| 829 | Ga0501045_0002979 | 3300049824 | Bacteria | 11587 |
| 830 | Ga0501045_0017362 | 3300049824 | Bacteria | 5108 |
| 831 | Ga0501045_0116759 | 3300049824 | Bacteria | 1980 |
| 832 | nmdc:mga05p37_13712_c1 | 3300050507 | Bacteria | 9714 |
| 833 | nmdc:mga05p37_2253_c1 | 3300050507 | Bacteria | 22457 |
| 834 | nmdc:mga09592_997_c1 | 3300050508 | Bacteria | 22431 |
| 835 | nmdc:mga06r32_55832_c1 | 3300050510 | Bacteria | 3789 |
| 836 | nmdc:mga08y16_6690_c1 | 3300050511 | Bacteria | 12097 |
| 837 | nmdc:mga0n895_1033_c1 | 3300050512 | Bacteria | 20242 |
| 838 | nmdc:mga0n895_250449_c1 | 3300050512 | Bacteria | 1798 |
| 839 | nmdc:mga0n895_266530_c1 | 3300050512 | Bacteria | 1738 |
| 840 | nmdc:mga0rr50_10423_c1 | 3300050513 | Bacteria | 5896 |
| 841 | nmdc:mga0rr50_1805_c1 | 3300050513 | Bacteria | 11829 |
| 842 | nmdc:mga0rr50_202081_c1 | 3300050513 | Bacteria | 1633 |
| 843 | nmdc:mga08x19_100134_c1 | 3300050514 | Bacteria | 1922 |
| 844 | nmdc:mga08x19_4186_c1 | 3300050514 | Bacteria | 8549 |
| 845 | nmdc:mga08x19_5920_c1 | 3300050514 | Bacteria | 7233 |
| 846 | nmdc:mga0a205_24706_c1 | 3300050515 | Bacteria | 5716 |
| 847 | nmdc:mga0a205_25504_c1 | 3300050515 | Bacteria | 5632 |
| 848 | nmdc:mga0a205_38742_c1 | 3300050515 | Bacteria | 4587 |
| 849 | Ga0495601_0001851 | 3300053077 | Bacteria | 11771 |
| 850 | Ga0495595_0025927 | 3300053084 | Bacteria | 2600 |
| 851 | Ga0495619_0032252 | 3300053085 | Bacteria | 3398 |
| 852 | Ga0500583_0014665 | 3300053092 | Bacteria | 3076 |
| 853 | Ga0500583_0042636 | 3300053092 | Bacteria | 2068 |
| 854 | Ga0500651_0135718 | 3300053093 | Bacteria | 1485 |
| 855 | Ga0500641_0063851 | 3300053096 | Bacteria | 1537 |
| 856 | Ga0500556_0000589 | 3300053104 | Bacteria | 23953 |
| 857 | Ga0500562_043559 | 3300053108 | Bacteria | 1195 |
| 858 | Ga0500594_0010636 | 3300053118 | Bacteria | 2140 |
| 859 | Ga0500614_006711 | 3300053123 | Bacteria | 2422 |
| 860 | Ga0500617_019162 | 3300053124 | Bacteria | 2988 |
| 861 | Ga0500642_0128512 | 3300053130 | Bacteria | 1187 |
| 862 | Ga0500652_074859 | 3300053131 | Bacteria | 1406 |
| 863 | Ga0500658_0015386 | 3300053134 | Bacteria | 2840 |
| 864 | Ga0500568_0010327 | 3300053139 | Bacteria | 4379 |
| 865 | Ga0500568_0044626 | 3300053139 | Bacteria | 1767 |
| 866 | Ga0500588_0004664 | 3300053146 | Bacteria | 2983 |
| 867 | Ga0500616_0000018 | 3300053153 | Bacteria | 610976 |
| 868 | Ga0500616_0040981 | 3300053153 | Unclassified | 2487 |
| 869 | Ga0500622_0018631 | 3300053156 | Bacteria | 3689 |
| 870 | Ga0500622_0115656 | 3300053156 | Bacteria | 1306 |
| 871 | Ga0500633_0007765 | 3300053160 | Bacteria | 2724 |
| 872 | Ga0501084_0011370 | 3300054114 | Bacteria | 7372 |
| 873 | Ga0501084_0014474 | 3300054114 | Bacteria | 6539 |
| 874 | Ga0501084_0037220 | 3300054114 | Bacteria | 4065 |
| 875 | Ga0590077_017742 | 3300059426 | Bacteria | 1499 |
| 876 | Ga0501082_0015602 | 3300060353 | Bacteria | 6539 |
| 877 | Ga0501082_0140118 | 3300060353 | Bacteria | 2099 |
| 878 | Ga0501082_0250136 | 3300060353 | Bacteria | 1542 |
| 879 | Ga0530510_0003481 | 3300061734 | Bacteria | 10822 |
| 880 | Ga0530510_0010479 | 3300061734 | Bacteria | 6501 |
| 881 | Ga0530510_0010649 | 3300061734 | Bacteria | 6450 |
| 882 | 2510283929 | 2510065053 | Bacteria | 5005518 |
| 883 | 2510312890 | 2510065058 | Bacteria | 5005894 |
| 884 | 2547696612 | 2547132181 | Bacteria | 4945084 |
| 885 | 2562465973 | 2561511199 | Bacteria | 5155034 |
| 886 | 2599928202 | 2599185299 | Bacteria | 4854625 |
| 887 | 2601534023 | 2600255256 | Bacteria | 5597742 |
| 888 | 2601540191 | 2600255257 | Bacteria | 5597196 |
| 889 | 2601758826 | 2600255310 | Bacteria | 5600903 |
| 890 | 2601762823 | 2600255311 | Bacteria | 5598766 |
| 891 | 2603640676 | 2602042046 | Bacteria | 5483348 |
| 892 | 2650900141 | 2648501693 | Bacteria | 5069560 |
| 893 | 2686354381 | 2684622997 | Bacteria | 4624240 |
| 894 | 2729146261 | 2728369097 | Bacteria | 4333476 |
| 895 | 2735816575 | 2734482258 | Unclassified | 2930739 |
| 896 | 2792313387 | 2791355010 | Bacteria | 4864581 |
| 897 | 2813730563 | 2811995292 | Bacteria | 5303342 |
| 898 | 2814698170 | 2814123068 | Bacteria | 5687681 |
| 899 | 2847801232 | 2847797336 | Bacteria | 5176640 |
| 900 | 2854602939 | 2854601825 | Bacteria | 4797592 |
| 901 | 2858469617 | 2858466076 | Bacteria | 4722413 |
| 902 | 2871273612 | 2871272651 | Bacteria | 5042015 |
| 903 | 2919128136 | 2919125081 | Bacteria | 5385106 |
| 904 | 2935627975 | 2935625433 | Bacteria | 5042964 |
| 905 | 2974437004 | 2974435778 | Bacteria | 4876478 |
| 906 | 2984498059 | 2984494565 | Bacteria | 5000175 |
| 907 | 2984503776 | 2984499530 | Bacteria | 5020881 |
| 908 | 2984507642 | 2984504281 | Bacteria | 5262371 |
| 909 | 2990264427 | 2990261002 | Bacteria | 4919493 |
| 910 | 3000380481 | 3000376612 | Bacteria | 4705565 |
| 911 | 640487032 | 640427133 | Bacteria | 4567418 |
| 912 | 651174904 | 651053060 | Bacteria | 4689946 |
| 913 | 8001525637 | 8001522603 | Bacteria | 4726425 |
| 914 | 8016730218 | 8016728285 | Bacteria | 5263933 |
| 915 | Ga0207707_10018316 | |||
| 916 | JGI24739J22299_10000036 | |||
| 917 | JGI25162J39368_1002447 | |||
| 918 | JGI25162J39368_1002514 | |||
| 919 | JGI25162J39368_1002516 | |||
| 920 | JGI25152J39213_1000187 | |||
| 921 | rootH2_10023964 | |||
| 922 | Ga0058692_1001649 | |||
| 923 | Ga0058692_1001730 | |||
| 924 | Ga0058692_1006192 | |||
| 925 | Ga0065715_10223441 | |||
| 926 | Ga0070690_100007666 | |||
| 927 | Ga0070690_100011534 | |||
| 928 | Ga0070670_100059524 | |||
| 929 | Ga0070670_100178451 | |||
| 930 | Ga0070677_10003986 | |||
| 931 | Ga0068869_100000179 | |||
| 932 | Ga0068869_100102967 | |||
| 933 | Ga0068869_100213838 | |||
| 934 | Ga0070666_10004842 | |||
| 935 | Ga0070666_10009494 | |||
| 936 | Ga0070666_10013205 | |||
| 937 | Ga0070666_10066444 | |||
| 938 | Ga0070666_10077658 | |||
| 939 | Ga0070680_100002041 | |||
| 940 | Ga0070680_100047098 | |||
| 941 | Ga0070680_100054104 | |||
| 942 | Ga0070682_100026425 | |||
| 943 | Ga0068868_100226032 | |||
| 944 | Ga0070691_10000201 | |||
| 945 | Ga0070691_10025383 | |||
| 946 | Ga0070687_100004423 | |||
| 947 | Ga0070687_100158552 | |||
| 948 | Ga0070668_100021905 | |||
| 949 | Ga0070668_100165739 | |||
| 950 | Ga0070675_100035869 | |||
| 951 | Ga0070675_100351868 | |||
| 952 | Ga0070671_100002044 | |||
| 953 | Ga0070671_100018662 | |||
| 954 | Ga0070671_100034652 | |||
| 955 | Ga0070671_100073677 | |||
| 956 | Ga0070674_100034839 | |||
| 957 | Ga0070674_100092380 | |||
| 958 | Ga0070674_100109440 | |||
| 959 | Ga0070673_100059240 | |||
| 960 | Ga0070673_100066144 | |||
| 961 | Ga0070673_100136437 | |||
| 962 | Ga0070667_100000184 | |||
| 963 | Ga0070667_100013808 | |||
| 964 | Ga0070667_100024865 | |||
| 965 | Ga0070667_100065708 | |||
| 966 | Ga0070709_10000132 | |||
| 967 | Ga0070709_10006539 | |||
| 968 | Ga0070709_10011218 | |||
| 969 | Ga0070714_100001047 | |||
| 970 | Ga0070714_100024629 | |||
| 971 | Ga0070714_100085145 | |||
| 972 | Ga0070713_100000696 | |||
| 973 | Ga0070713_100003974 | |||
| 974 | Ga0070713_100121978 | |||
| 975 | Ga0070710_10001105 | |||
| 976 | Ga0070710_10034787 | |||
| 977 | Ga0070701_10000441 | |||
| 978 | Ga0070701_10070603 | |||
| 979 | Ga0070711_100055982 | |||
| 980 | Ga0070711_100288281 | |||
| 981 | Ga0070705_100000428 | |||
| 982 | Ga0070705_100237544 | |||
| 983 | Ga0070700_100002394 | |||
| 984 | Ga0070700_100113612 | |||
| 985 | Ga0070700_100198944 | |||
| 986 | Ga0070694_100000620 | |||
| 987 | Ga0070694_100341638 | |||
| 988 | Ga0070708_100105955 | |||
| 989 | Ga0070663_100037888 | |||
| 990 | Ga0070663_100231036 | |||
| 991 | Ga0070678_100007333 | |||
| 992 | Ga0070662_100116940 | |||
| 993 | Ga0070681_10000131 | |||
| 994 | Ga0070681_10000231 | |||
| 995 | Ga0070681_10004886 | |||
| 996 | Ga0070681_10009857 | |||
| 997 | Ga0070681_10010910 | |||
| 998 | Ga0070681_10029157 | |||
| 999 | Ga0070681_10070970 | |||
| 1000 | Ga0070681_10089146 | |||
| 1001 | Ga0070681_10112367 | |||
| 1002 | Ga0068867_100001899 | |||
| 1003 | Ga0068867_100042614 | |||
| 1004 | Ga0068867_100085315 | |||
| 1005 | Ga0070685_10111860 | |||
| 1006 | Ga0070685_10264085 | |||
| 1007 | Ga0070706_100003733 | |||
| 1008 | Ga0070706_100041096 | |||
| 1009 | Ga0070707_100077507 | |||
| 1010 | Ga0070707_100241824 | |||
| 1011 | Ga0070698_100000354 | |||
| 1012 | Ga0070698_100005850 | |||
| 1013 | Ga0070698_100020872 | |||
| 1014 | Ga0070698_100051215 | |||
| 1015 | Ga0070699_100063452 | |||
| 1016 | Ga0070699_100144625 | |||
| 1017 | Ga0070699_100187509 | |||
| 1018 | Ga0070679_100019019 | |||
| 1019 | Ga0070679_100079717 | |||
| 1020 | Ga0070679_100147308 | |||
| 1021 | Ga0070679_100190653 | |||
| 1022 | Ga0070684_100138929 | |||
| 1023 | Ga0070684_100144282 | |||
| 1024 | Ga0070684_100340440 | |||
| 1025 | Ga0070697_100074834 | |||
| 1026 | Ga0070697_100176041 | |||
| 1027 | Ga0068853_100074893 | |||
| 1028 | Ga0070672_100021356 | |||
| 1029 | Ga0070686_100013640 | |||
| 1030 | Ga0070686_100022906 | |||
| 1031 | Ga0070686_100093129 | |||
| 1032 | Ga0070695_100005505 | |||
| 1033 | Ga0070695_100011219 | |||
| 1034 | Ga0070696_100000037 | |||
| 1035 | Ga0070696_100026580 | |||
| 1036 | Ga0070693_100000225 | |||
| 1037 | Ga0070665_100003573 | |||
| 1038 | Ga0070665_100005905 | |||
| 1039 | Ga0070665_100008678 | |||
| 1040 | Ga0070665_100012130 | |||
| 1041 | Ga0070665_100026498 | |||
| 1042 | Ga0070665_100037380 | |||
| 1043 | Ga0070665_100090572 | |||
| 1044 | Ga0070665_100227305 | |||
| 1045 | Ga0070704_100006185 | |||
| 1046 | Ga0068855_100008724 | |||
| 1047 | Ga0068855_100018159 | |||
| 1048 | Ga0068855_100020453 | |||
| 1049 | Ga0068855_100036225 | |||
| 1050 | Ga0068855_100079790 | |||
| 1051 | Ga0068855_100258503 | |||
| 1052 | Ga0070664_100010321 | |||
| 1053 | Ga0068857_100258121 | |||
| 1054 | Ga0068854_100014490 | |||
| 1055 | Ga0068856_100023424 | |||
| 1056 | Ga0068856_100041447 | |||
| 1057 | Ga0068856_100143811 | |||
| 1058 | Ga0068856_100263674 | |||
| 1059 | Ga0068852_100072254 | |||
| 1060 | Ga0068859_100004269 | |||
| 1061 | Ga0068859_100007815 | |||
| 1062 | Ga0068859_100048836 | |||
| 1063 | Ga0068859_100099223 | |||
| 1064 | Ga0068859_100204778 | |||
| 1065 | Ga0068859_100428480 | |||
| 1066 | Ga0068864_100018240 | |||
| 1067 | Ga0068864_100064649 | |||
| 1068 | Ga0068864_100181691 | |||
| 1069 | Ga0068864_100428436 | |||
| 1070 | Ga0068864_100457037 | |||
| 1071 | Ga0068866_10007417 | |||
| 1072 | Ga0068866_10009466 | |||
| 1073 | Ga0068861_100000538 | |||
| 1074 | Ga0068861_100040357 | |||
| 1075 | Ga0068861_100051338 | |||
| 1076 | Ga0068861_100157116 | |||
| 1077 | Ga0068861_100222452 | |||
| 1078 | Ga0068851_10065242 | |||
| 1079 | Ga0068863_100005874 | |||
| 1080 | Ga0068863_100009793 | |||
| 1081 | Ga0068863_100095074 | |||
| 1082 | Ga0068863_100168201 | |||
| 1083 | Ga0068858_100004263 | |||
| 1084 | Ga0068858_100007132 | |||
| 1085 | Ga0068858_100026808 | |||
| 1086 | Ga0068860_100002783 | |||
| 1087 | Ga0068860_100024367 | |||
| 1088 | Ga0068860_100028398 | |||
| 1089 | Ga0068860_100029624 | |||
| 1090 | Ga0068862_100011319 | |||
| 1091 | Ga0068862_100026123 | |||
| 1092 | Ga0068862_100041886 | |||
| 1093 | Ga0068862_100107325 | |||
| 1094 | Ga0068862_100199098 | |||
| 1095 | Ga0068862_100310143 | |||
| 1096 | Ga0068862_100345359 | |||
| 1097 | Ga0081455_10000679 | |||
| 1098 | Ga0081455_10004105 | |||
| 1099 | Ga0081539_10000006 | |||
| 1100 | Ga0070717_10003728 | |||
| 1101 | Ga0070717_10010793 | |||
| 1102 | Ga0070717_10074698 | |||
| 1103 | Ga0070715_10021861 | |||
| 1104 | Ga0070715_10026537 | |||
| 1105 | Ga0070715_10031022 | |||
| 1106 | Ga0070716_100000088 | |||
| 1107 | Ga0070716_100002763 | |||
| 1108 | Ga0070716_100006147 | |||
| 1109 | Ga0070716_100084949 | |||
| 1110 | Ga0070716_100230181 | |||
| 1111 | Ga0070712_100043363 | |||
| 1112 | Ga0070712_100055963 | |||
| 1113 | Ga0097621_100004518 | |||
| 1114 | Ga0097621_100149636 | |||
| 1115 | Ga0068871_100000772 | |||
| 1116 | Ga0068871_100180168 | |||
| 1117 | Ga0075428_100004730 | |||
| 1118 | Ga0075428_100162789 | |||
| 1119 | Ga0075430_100064425 | |||
| 1120 | Ga0075430_100219712 | |||
| 1121 | Ga0075431_100039561 | |||
| 1122 | Ga0075431_100073118 | |||
| 1123 | Ga0075433_10006653 | |||
| 1124 | Ga0075433_10022836 | |||
| 1125 | Ga0075433_10065305 | |||
| 1126 | Ga0075434_100013542 | |||
| 1127 | Ga0075434_100358853 | |||
| 1128 | Ga0075429_100002677 | |||
| 1129 | Ga0075429_100326419 | |||
| 1130 | Ga0068865_100000628 | |||
| 1131 | Ga0068865_100018665 | |||
| 1132 | Ga0068865_100074213 | |||
| 1133 | Ga0068865_100097540 | |||
| 1134 | Ga0075436_100006378 | |||
| 1135 | Ga0075436_100090533 | |||
| 1136 | Ga0075436_100108320 | |||
| 1137 | Ga0097620_100004269 | |||
| 1138 | Ga0097620_100007814 | |||
| 1139 | Ga0097620_100048836 | |||
| 1140 | Ga0097620_100099227 | |||
| 1141 | Ga0097620_100204784 | |||
| 1142 | Ga0097620_100428449 | |||
| 1143 | Ga0079104_1000308 | |||
| 1144 | Ga0079104_1001380 | |||
| 1145 | Ga0079104_1003875 | |||
| 1146 | Ga0075435_100007394 | |||
| 1147 | Ga0075435_100387134 | |||
| 1148 | Ga0099794_10008883 | |||
| 1149 | Ga0099795_10008084 | |||
| 1150 | Ga0105251_10002158 | |||
| 1151 | Ga0105251_10015033 | |||
| 1152 | Ga0105244_10000293 | |||
| 1153 | Ga0105240_10008075 | |||
| 1154 | Ga0105240_10085320 | |||
| 1155 | Ga0105240_10088147 | |||
| 1156 | Ga0105240_10517562 | |||
| 1157 | Ga0111539_10455538 | |||
| 1158 | Ga0105245_10000951 | |||
| 1159 | Ga0105247_10002396 | |||
| 1160 | Ga0105247_10061333 | |||
| 1161 | Ga0114129_10000841 | |||
| 1162 | Ga0114129_10007905 | |||
| 1163 | Ga0105243_10002746 | |||
| 1164 | Ga0105241_10095262 | |||
| 1165 | Ga0105242_10000779 | |||
| 1166 | Ga0105242_10021808 | |||
| 1167 | Ga0105248_10006682 | |||
| 1168 | Ga0105248_10057294 | |||
| 1169 | Ga0105248_10197860 | |||
| 1170 | Ga0105237_10140737 | |||
| 1171 | Ga0105237_10258577 | |||
| 1172 | Ga0105237_10278974 | |||
| 1173 | Ga0105237_10302991 | |||
| 1174 | Ga0105237_10433665 | |||
| 1175 | Ga0105237_10495323 | |||
| 1176 | Ga0105249_10000995 | |||
| 1177 | Ga0105249_10017575 | |||
| 1178 | Ga0105249_10043968 | |||
| 1179 | Ga0105249_10180346 | |||
| 1180 | Ga0105239_10010533 | |||
| 1181 | Ga0105239_10037988 | |||
| 1182 | Ga0105239_10052409 | |||
| 1183 | Ga0105239_10233331 | |||
| 1184 | Ga0105239_10491273 | |||
| 1185 | Ga0105246_10027556 | |||
| 1186 | Ga0105246_10118887 | |||
| 1187 | Ga0105246_10129408 | |||
| 1188 | Ga0157373_10009701 | |||
| 1189 | Ga0157371_10014930 | |||
| 1190 | Ga0157371_10016478 | |||
| 1191 | Ga0157371_10035692 | |||
| 1192 | Ga0157370_10000452 | |||
| 1193 | Ga0157370_10118437 | |||
| 1194 | Ga0157369_10001732 | |||
| 1195 | Ga0157369_10035219 | |||
| 1196 | Ga0157369_10140326 | |||
| 1197 | Ga0157369_10620257 | |||
| 1198 | Ga0157374_10023374 | |||
| 1199 | Ga0157374_10238651 | |||
| 1200 | Ga0157374_10304336 | |||
| 1201 | Ga0157378_10000590 | |||
| 1202 | Ga0157378_10054853 | |||
| 1203 | Ga0163162_10072025 | |||
| 1204 | Ga0163162_10288648 | |||
| 1205 | Ga0163162_10376876 | |||
| 1206 | Ga0157372_10001062 | |||
| 1207 | Ga0157372_10341051 | |||
| 1208 | Ga0157375_10061997 | |||
| 1209 | Ga0157375_10288654 | |||
| 1210 | Ga0163163_10018471 | |||
| 1211 | Ga0163163_10029120 | |||
| 1212 | Ga0163163_10146475 | |||
| 1213 | Ga0163163_10202981 | |||
| 1214 | Ga0157379_10036534 | |||
| 1215 | Ga0157379_10225498 | |||
| 1216 | Ga0157376_10005783 | |||
| 1217 | Ga0157376_10007674 | |||
| 1218 | Ga0157376_10184983 | |||
| 1219 | Ga0182006_1007687 | |||
| 1220 | Ga0163161_10120572 | |||
| 1221 | Ga0206353_11229857 | |||
| 1222 | Ga0213874_10012646 | |||
| 1223 | Ga0213875_10017205 | |||
| 1224 | Ga0213875_10074012 | |||
| 1225 | Ga0224712_10021090 | |||
| 1226 | Ga0224572_1000869 | |||
| 1227 | Ga0207425_1006279 | |||
| 1228 | Ga0209759_1008745 | |||
| 1229 | Ga0209129_1000008 | |||
| 1230 | Ga0209256_1020720 | |||
| 1231 | Ga0207655_1000026 | |||
| 1232 | Ga0207655_1001273 | |||
| 1233 | Ga0207655_1003937 | |||
| 1234 | Ga0207655_1031276 | |||
| 1235 | Ga0207692_10000891 | |||
| 1236 | Ga0207692_10035485 | |||
| 1237 | Ga0207692_10202050 | |||
| 1238 | Ga0207642_10055381 | |||
| 1239 | Ga0207642_10273093 | |||
| 1240 | Ga0207710_10001639 | |||
| 1241 | Ga0207680_10006851 | |||
| 1242 | Ga0207680_10134934 | |||
| 1243 | Ga0207680_10141296 | |||
| 1244 | Ga0207685_10002959 | |||
| 1245 | Ga0207685_10017353 | |||
| 1246 | Ga0207685_10047295 | |||
| 1247 | Ga0207699_10000165 | |||
| 1248 | Ga0207699_10002296 | |||
| 1249 | Ga0207699_10123006 | |||
| 1250 | Ga0207699_10298086 | |||
| 1251 | Ga0207643_10058094 | |||
| 1252 | Ga0207643_10071466 | |||
| 1253 | Ga0207684_10132377 | |||
| 1254 | Ga0207654_10049177 | |||
| 1255 | Ga0207654_10253900 | |||
| 1256 | Ga0207707_10000075 | |||
| 1257 | Ga0207707_10000115 | |||
| 1258 | Ga0207707_10000140 | |||
| 1259 | Ga0207707_10000148 | |||
| 1260 | Ga0207707_10001203 | |||
| 1261 | Ga0207707_10002174 | |||
| 1262 | Ga0207707_10064108 | |||
| 1263 | Ga0207707_10086326 | |||
| 1264 | Ga0207707_10192374 | |||
| 1265 | Ga0207695_10012932 | |||
| 1266 | Ga0207695_10020357 | |||
| 1267 | Ga0207695_10021988 | |||
| 1268 | Ga0207695_10052459 | |||
| 1269 | Ga0207695_10129619 | |||
| 1270 | Ga0207693_10000711 | |||
| 1271 | Ga0207693_10000836 | |||
| 1272 | Ga0207693_10012599 | |||
| 1273 | Ga0207693_10167930 | |||
| 1274 | Ga0207663_10044739 | |||
| 1275 | Ga0207663_10082137 | |||
| 1276 | Ga0207663_10147814 | |||
| 1277 | Ga0207660_10010953 | |||
| 1278 | Ga0207660_10045704 | |||
| 1279 | Ga0207660_10068410 | |||
| 1280 | Ga0207660_10218379 | |||
| 1281 | Ga0207662_10000144 | |||
| 1282 | Ga0207649_10248195 | |||
| 1283 | Ga0207652_10019843 | |||
| 1284 | Ga0207652_10024846 | |||
| 1285 | Ga0207652_10042962 | |||
| 1286 | Ga0207652_10066650 | |||
| 1287 | Ga0207652_10069283 | |||
| 1288 | Ga0207652_10162625 | |||
| 1289 | Ga0207646_10039379 | |||
| 1290 | Ga0207646_10354989 | |||
| 1291 | Ga0207694_10046411 | |||
| 1292 | Ga0207694_10056274 | |||
| 1293 | Ga0207650_10113946 | |||
| 1294 | Ga0207650_10119403 | |||
| 1295 | Ga0207659_10055705 | |||
| 1296 | Ga0207687_10000617 | |||
| 1297 | Ga0207687_10126406 | |||
| 1298 | Ga0207700_10000297 | |||
| 1299 | Ga0207700_10043034 | |||
| 1300 | Ga0207700_10095243 | |||
| 1301 | Ga0207700_10220300 | |||
| 1302 | Ga0207664_10000224 | |||
| 1303 | Ga0207644_10000718 | |||
| 1304 | Ga0207644_10027518 | |||
| 1305 | Ga0207690_10155587 | |||
| 1306 | Ga0207686_10000533 | |||
| 1307 | Ga0207686_10068527 | |||
| 1308 | Ga0207709_10000671 | |||
| 1309 | Ga0207670_10002758 | |||
| 1310 | Ga0207669_10009150 | |||
| 1311 | Ga0207704_10071469 | |||
| 1312 | Ga0207704_10392890 | |||
| 1313 | Ga0207665_10000698 | |||
| 1314 | Ga0207665_10013863 | |||
| 1315 | Ga0207665_10014003 | |||
| 1316 | Ga0207665_10019995 | |||
| 1317 | Ga0207665_10049980 | |||
| 1318 | Ga0207665_10335800 | |||
| 1319 | Ga0207691_10361689 | |||
| 1320 | Ga0207711_10037440 | |||
| 1321 | Ga0207711_10317464 | |||
| 1322 | Ga0207689_10014975 | |||
| 1323 | Ga0207661_10077971 | |||
| 1324 | Ga0207661_10089530 | |||
| 1325 | Ga0207679_10009229 | |||
| 1326 | Ga0207679_10012674 | |||
| 1327 | Ga0207667_10006818 | |||
| 1328 | Ga0207667_10017408 | |||
| 1329 | Ga0207667_10067590 | |||
| 1330 | Ga0207651_10121974 | |||
| 1331 | Ga0207651_10167307 | |||
| 1332 | Ga0207712_10009011 | |||
| 1333 | Ga0207712_10025418 | |||
| 1334 | Ga0207712_10026592 | |||
| 1335 | Ga0207712_10396989 | |||
| 1336 | Ga0207640_10003394 | |||
| 1337 | Ga0207658_10001013 | |||
| 1338 | Ga0207658_10009144 | |||
| 1339 | Ga0207677_10073331 | |||
| 1340 | Ga0207677_10108147 | |||
| 1341 | Ga0207703_10001997 | |||
| 1342 | Ga0207703_10027866 | |||
| 1343 | Ga0207639_10183137 | |||
| 1344 | Ga0207639_10215465 | |||
| 1345 | Ga0207678_10015060 | |||
| 1346 | Ga0207678_10116209 | |||
| 1347 | Ga0207708_10000427 | |||
| 1348 | Ga0207708_10249449 | |||
| 1349 | Ga0207702_10187012 | |||
| 1350 | Ga0207702_10327155 | |||
| 1351 | Ga0207641_10001033 | |||
| 1352 | Ga0207641_10094596 | |||
| 1353 | Ga0207641_10134247 | |||
| 1354 | Ga0207648_10000018 | |||
| 1355 | Ga0207648_10055430 | |||
| 1356 | Ga0207648_10168017 | |||
| 1357 | Ga0207648_10200052 | |||
| 1358 | Ga0207648_10455939 | |||
| 1359 | Ga0207676_10010945 | |||
| 1360 | Ga0207676_10462659 | |||
| 1361 | Ga0207675_100000050 | |||
| 1362 | Ga0207675_100102318 | |||
| 1363 | Ga0207675_100195591 | |||
| 1364 | Ga0207683_10017307 | |||
| 1365 | Ga0207683_10019930 | |||
| 1366 | Ga0207683_10098090 | |||
| 1367 | Ga0207698_10012742 | |||
| 1368 | Ga0207698_10529242 | |||
| 1369 | Ga0209281_1000058 | |||
| 1370 | Ga0209281_1001193 | |||
| 1371 | Ga0209371_1000014 | |||
| 1372 | Ga0209371_1000054 | |||
| 1373 | Ga0209984_1002678 | |||
| 1374 | Ga0209995_1000886 | |||
| 1375 | Ga0209995_1014840 | |||
| 1376 | Ga0209179_1001321 | |||
| 1377 | Ga0209970_1005815 | |||
| 1378 | Ga0209983_1003351 | |||
| 1379 | Ga0209588_1014068 | |||
| 1380 | Ga0209588_1016014 | |||
| 1381 | Ga0209971_1001514 | |||
| 1382 | Ga0209974_10008018 | |||
| 1383 | Ga0207428_10001317 | |||
| 1384 | Ga0268266_10002891 | |||
| 1385 | Ga0268266_10007953 | |||
| 1386 | Ga0268266_10022791 | |||
| 1387 | Ga0268266_10049644 | |||
| 1388 | Ga0268266_10062739 | |||
| 1389 | Ga0268266_10108480 | |||
| 1390 | Ga0268266_10120601 | |||
| 1391 | Ga0268266_10379280 | |||
| 1392 | Ga0268265_10017012 | |||
| 1393 | Ga0268265_10039433 | |||
| 1394 | Ga0268265_10050324 | |||
| 1395 | Ga0268265_10072968 | |||
| 1396 | Ga0268265_10151055 | |||
| 1397 | Ga0268265_10220746 | |||
| 1398 | Ga0268264_10000198 | |||
| 1399 | Ga0268264_10001294 | |||
| 1400 | Ga0268264_10018094 | |||
| 1401 | Ga0268264_10185648 | |||
| 1402 | Ga0307515_10003416 | |||
| 1403 | Ga0265338_10034673 | |||
| 1404 | Ga0268256_1000012 | |||
| 1405 | Ga0268256_1000021 | |||
| 1406 | Ga0307511_10000048 | |||
| 1407 | Ga0307511_10009582 | |||
| 1408 | Ga0265328_10014425 | |||
| 1409 | Ga0265340_10024043 | |||
| 1410 | Ga0265340_10054871 | |||
| 1411 | Ga0265339_10107866 | |||
| 1412 | Ga0265331_10010845 | |||
| 1413 | Ga0265327_10003233 | |||
| 1414 | Ga0307513_10013985 | |||
| 1415 | Ga0307513_10028805 | |||
| 1416 | Ga0307513_10156325 | |||
| 1417 | Ga0307509_10000017 | |||
| 1418 | Ga0307509_10000803 | |||
| 1419 | Ga0307509_10136691 | |||
| 1420 | Ga0307408_100027435 | |||
| 1421 | Ga0316575_10034701 | |||
| 1422 | Ga0316579_10000158 | |||
| 1423 | Ga0316579_10006029 | |||
| 1424 | Ga0316576_10009427 | |||
| 1425 | Ga0316576_10024964 | |||
| 1426 | Ga0316576_10029895 | |||
| 1427 | Ga0316576_10136287 | |||
| 1428 | Ga0316578_10056886 | |||
| 1429 | Ga0316578_10127593 | |||
| 1430 | Ga0316577_10003059 | |||
| 1431 | Ga0316577_10072152 | |||
| 1432 | Ga0307413_10004776 | |||
| 1433 | Ga0307410_10000500 | |||
| 1434 | Ga0307407_10021514 | |||
| 1435 | Ga0307412_10077641 | |||
| 1436 | Ga0307409_100000732 | |||
| 1437 | Ga0307409_100438604 | |||
| 1438 | Ga0307416_100146625 | |||
| 1439 | Ga0307416_100178547 | |||
| 1440 | Ga0307414_10143163 | |||
| 1441 | Ga0307414_10264018 | |||
| 1442 | Ga0307411_10060016 | |||
| 1443 | Ga0307411_10282903 | |||
| 1444 | Ga0316583_10021096 | |||
| 1445 | Ga0316585_10001855 | |||
| 1446 | Ga0316593_10004339 | |||
| 1447 | Ga0316593_10004729 | |||
| 1448 | Ga0316593_10007343 | |||
| 1449 | Ga0316593_10023661 | |||
| 1450 | Ga0316593_10026155 | |||
| 1451 | Ga0316593_10103175 | |||
| 1452 | Ga0307510_10000002 | |||
| 1453 | Ga0307510_10063197 | |||
| 1454 | Ga0373938_0036310 | |||
| 1455 | Ga0373926_0002919 | |||
| 1456 | Ga0373926_0005260 | |||
| 1457 | Ga0373926_0028007 | |||
| 1458 | Ga0373934_0003089 | |||
| 1459 | Ga0373944_0000876 | |||
| 1460 | Ga0373949_0028016 | |||
| 1461 | Ga0373923_0074354 | |||
| 1462 | Ga0373923_0088128 | |||
| 1463 | Ga0373932_0001979 | |||
| 1464 | Ga0373936_0000488 | |||
| 1465 | Ga0373936_0006850 | |||
| 1466 | Ga0373936_0033970 | |||
| 1467 | Ga0373945_0004013 | |||
| 1468 | Ga0373945_0008747 | |||
| 1469 | Ga0373954_0002373 | |||
| 1470 | Ga0373954_0055222 | |||
| 1471 | Ga0373956_0077750 | |||
| 1472 | Ga0373943_0004831 | |||
| 1473 | Ga0373943_0016313 | |||
| 1474 | Ga0373943_0078886 | |||
| 1475 | Ga0373946_0000439 | |||
| 1476 | Ga0373946_0026733 | |||
| 1477 | Ga0373946_0029774 | |||
| 1478 | Ga0373946_0032111 | |||
| 1479 | Ga0373955_0059225 | |||
| 1480 | Ga0373955_0099325 | |||
| 1481 | Ga0316574_0007609 | |||
| 1482 | Ga0316574_0016469 | |||
| 1483 | Ga0316574_0033450 | |||
| 1484 | Ga0316574_0037376 | |||
| 1485 | Ga0316574_0073569 | |||
| 1486 | Ga0316574_0074137 | |||
| 1487 | Ga0316574_0099000 | |||
| 1488 | Ga0316574_0134428 | |||
| 1489 | Ga0373931_0030542 | |||
| 1490 | Ga0373931_0134062 | |||
| 1491 | Ga0373935_0000618 | |||
| 1492 | Ga0373935_0004234 | |||
| 1493 | Ga0373927_0000383 | |||
| 1494 | Ga0373927_0117777 | |||
| 1495 | Ga0373933_0010727 | |||
| 1496 | Ga0373947_0000002 | |||
| 1497 | Ga0373947_0005590 | |||
| 1498 | Ga0373947_0059036 | |||
| 1499 | Ga0373947_0109028 | |||
| 1500 | Ga0373937_0035130 | |||
| 1501 | Ga0316582_0004967 | |||
| 1502 | Ga0316582_0064613 | |||
| 1503 | Ga0316582_0084293 | |||
| 1504 | Ga0316584_0030898 | |||
| 1505 | Ga0316584_0053695 | |||
| 1506 | Ga0316584_0066260 | |||
| 1507 | Ga0373925_0005223 | |||
| 1508 | Ga0373925_0008937 | |||
| 1509 | Ga0373925_0013418 | |||
| 1510 | Ga0373925_0038319 | |||
| 1511 | Ga0395900_0000060 | |||
| 1512 | Ga0395900_0089295 | |||
| 1513 | Ga0395900_0216386 | |||
| 1514 | Ga0395898_0083235 | |||
| 1515 | Ga0436364_0260906 | |||
| 1516 | Ga0400484_23031 | |||
| 1517 | Ga0400484_27744 | |||
| 1518 | Ga0400490_45667 | |||
| 1519 | Ga0400483_055564 | |||
| 1520 | Ga0400483_086083 | |||
| 1521 | Ga0400483_093671 | |||
| 1522 | Ga0400483_201732 | |||
| 1523 | Ga0400483_280570 | |||
| 1524 | Ga0436365_0360171 | |||
| 1525 | Ga0436365_1274404 | |||
| 1526 | Ga0436365_1414349 | |||
| 1527 | Ga0436360_1005797 | |||
| 1528 | Ga0436361_0576483 | |||
| 1529 | Ga0436363_0296494 | |||
| 1530 | Ga0436363_0375975 | |||
| 1531 | Ga0436363_1127370 | |||
| 1532 | Ga0436363_1153079 | |||
| 1533 | Ga0436363_1648012 | |||
| 1534 | Ga0439436_0011487 | |||
| 1535 | Ga0439447_003544 | |||
| 1536 | Ga0451789_1314313 | |||
| 1537 | Ga0451793_0368982 | |||
| 1538 | Ga0451802_1342131 | |||
| 1539 | Ga0451837_0466646 | |||
| 1540 | Ga0451841_0078952 | |||
| 1541 | Ga0439432_002736 | |||
| 1542 | Ga0439432_004394 | |||
| 1543 | Ga0439451_005425 | |||
| 1544 | Ga0439451_007565 | |||
| 1545 | Ga0439452_000004 | |||
| 1546 | Ga0439452_000005 | |||
| 1547 | Ga0439452_000428 | |||
| 1548 | Ga0439452_008326 | |||
| 1549 | Ga0439444_0001930 | |||
| 1550 | Ga0439460_0000378 | |||
| 1551 | Ga0451577_0016678 | |||
| 1552 | Ga0451577_0057889 | |||
| 1553 | Ga0466969_0000960 | |||
| 1554 | Ga0466969_0005735 | |||
| 1555 | Ga0466969_0118262 | |||
| 1556 | Ga0466966_0009008 | |||
| 1557 | Ga0466966_0053439 | |||
| 1558 | Ga0466963_0112886 | |||
| 1559 | Ga0453684_0045609 | |||
| 1560 | Ga0466971_0001123 | |||
| 1561 | Ga0466968_0027250 | |||
| 1562 | Ga0466970_0046170 | |||
| 1563 | Ga0466957_0024169 | |||
| 1564 | Ga0466960_0013133 | |||
| 1565 | Ga0466959_0014029 | |||
| 1566 | Ga0466959_0034640 | |||
| 1567 | Ga0466959_0053806 | |||
| 1568 | Ga0451576_0000217 | |||
| 1569 | Ga0451576_0067931 | |||
| 1570 | Ga0451576_0091467 | |||
| 1571 | Ga0466958_0036183 | |||
| 1572 | Ga0466958_0072990 | |||
| 1573 | Ga0466967_0042746 | |||
| 1574 | Ga0466967_0161509 | |||
| 1575 | Ga0495592_0010288 | |||
| 1576 | Ga0495592_0120274 | |||
| 1577 | Ga0495603_0010466 | |||
| 1578 | Ga0495590_0002047 | |||
| 1579 | Ga0495629_0347594 | |||
| 1580 | Ga0495638_0076082 | |||
| 1581 | Ga0495638_0160552 | |||
| 1582 | Ga0495641_0042287 | |||
| 1583 | Ga0495653_0006412 | |||
| 1584 | Ga0495580_0001506 | |||
| 1585 | Ga0495580_0015225 | |||
| 1586 | Ga0495580_0043965 | |||
| 1587 | Ga0495582_0037643 | |||
| 1588 | Ga0495639_0002165 | |||
| 1589 | Ga0495639_0032526 | |||
| 1590 | Ga0495662_0013627 | |||
| 1591 | Ga0495664_0004691 | |||
| 1592 | Ga0495584_0023980 | |||
| 1593 | Ga0495594_0082982 | |||
| 1594 | Ga0495594_0151865 | |||
| 1595 | Ga0495596_0027282 | |||
| 1596 | Ga0495583_0021099 | |||
| 1597 | Ga0495608_0144824 | |||
| 1598 | Ga0495618_0093151 | |||
| 1599 | Ga0495628_0056228 | |||
| 1600 | Ga0495630_0028591 | |||
| 1601 | Ga0495630_0039960 | |||
| 1602 | Ga0495630_0293994 | |||
| 1603 | Ga0495648_0013861 | |||
| 1604 | Ga0495648_0117804 | |||
| 1605 | Ga0495666_0046639 | |||
| 1606 | Ga0495665_0051846 | |||
| 1607 | Ga0495640_0053821 | |||
| 1608 | Ga0495586_0004720 | |||
| 1609 | Ga0495586_0004892 | |||
| 1610 | Ga0495587_0097364 | |||
| 1611 | Ga0495667_0036525 | |||
| 1612 | Ga0495667_0068892 | |||
| 1613 | Ga0495656_0004463 | |||
| 1614 | Ga0495668_0148242 | |||
| 1615 | Ga0495634_0041752 | |||
| 1616 | Ga0495625_0029573 | |||
| 1617 | Ga0495635_0000464 | |||
| 1618 | Ga0495657_0088806 | |||
| 1619 | Ga0495657_0166310 | |||
| 1620 | Ga0495599_0046240 | |||
| 1621 | Ga0495599_0065356 | |||
| 1622 | Ga0495646_0129415 | |||
| 1623 | Ga0495647_0001482 | |||
| 1624 | Ga0495647_0003243 | |||
| 1625 | Ga0495658_0006801 | |||
| 1626 | Ga0495658_0085759 | |||
| 1627 | Ga0495671_0024188 | |||
| 1628 | Ga0495649_0003326 | |||
| 1629 | Ga0495600_0003135 | |||
| 1630 | Ga0495581_0064804 | |||
| 1631 | Ga0495604_0155405 | |||
| 1632 | Ga0495674_0094152 | |||
| 1633 | Ga0495676_0038206 | |||
| 1634 | Ga0495676_0116557 | |||
| 1635 | Ga0495680_0035758 | |||
| 1636 | Ga0495675_0036099 | |||
| 1637 | Ga0495681_0133669 | |||
| 1638 | Ga0495684_0024315 | |||
| 1639 | Ga0495602_0083747 | |||
| 1640 | Ga0495602_0238165 | |||
| 1641 | Ga0495615_0025199 | |||
| 1642 | Ga0495626_0097765 | |||
| 1643 | Ga0496100_0077976 | |||
| 1644 | Ga0496100_0117923 | |||
| 1645 | Ga0496102_0024944 | |||
| 1646 | Ga0496102_0032576 | |||
| 1647 | Ga0496103_0078166 | |||
| 1648 | Ga0496104_0448094 | |||
| 1649 | Ga0496105_0121352 | |||
| 1650 | Ga0496107_0099375 | |||
| 1651 | Ga0496108_0021701 | |||
| 1652 | Ga0496108_0446951 | |||
| 1653 | Ga0496109_0028132 | |||
| 1654 | Ga0496109_0200936 | |||
| 1655 | Ga0496110_0038938 | |||
| 1656 | Ga0496111_0003521 | |||
| 1657 | Ga0496112_0113896 | |||
| 1658 | Ga0496112_0175623 | |||
| 1659 | Ga0496112_0290370 | |||
| 1660 | Ga0496113_0086931 | |||
| 1661 | Ga0496114_0034713 | |||
| 1662 | Ga0496115_0021506 | |||
| 1663 | Ga0496115_0127037 | |||
| 1664 | Ga0496115_0194916 | |||
| 1665 | Ga0496116_0000217 | |||
| 1666 | Ga0496116_0032636 | |||
| 1667 | Ga0496116_0089752 | |||
| 1668 | Ga0496117_0000135 | |||
| 1669 | Ga0496117_0001101 | |||
| 1670 | Ga0496117_0005290 | |||
| 1671 | Ga0496118_0000098 | |||
| 1672 | Ga0496118_0002338 | |||
| 1673 | Ga0496118_0085298 | |||
| 1674 | Ga0496119_0000026 | |||
| 1675 | Ga0496119_0081790 | |||
| 1676 | Ga0496120_0000543 | |||
| 1677 | Ga0496120_0031913 | |||
| 1678 | Ga0496120_0071899 | |||
| 1679 | Ga0496121_0023475 | |||
| 1680 | Ga0496121_0166063 | |||
| 1681 | Ga0496124_0000142 | |||
| 1682 | Ga0496124_0007498 | |||
| 1683 | Ga0496124_0078346 | |||
| 1684 | Ga0496125_0002765 | |||
| 1685 | Ga0496125_0014965 | |||
| 1686 | Ga0496125_0028906 | |||
| 1687 | Ga0496126_0026574 | |||
| 1688 | Ga0496126_0035411 | |||
| 1689 | Ga0496126_0085718 | |||
| 1690 | Ga0496126_0248437 | |||
| 1691 | Ga0501033_0191500 | |||
| 1692 | Ga0501034_0070053 | |||
| 1693 | Ga0501034_0390282 | |||
| 1694 | Ga0501036_0026800 | |||
| 1695 | Ga0501036_0206502 | |||
| 1696 | Ga0501037_0109540 | |||
| 1697 | Ga0501037_0113504 | |||
| 1698 | Ga0501038_0054535 | |||
| 1699 | Ga0501038_0193941 | |||
| 1700 | Ga0501039_0014722 | |||
| 1701 | Ga0501040_0014832 | |||
| 1702 | Ga0501040_0070544 | |||
| 1703 | Ga0501041_0022500 | |||
| 1704 | Ga0501042_0004832 | |||
| 1705 | Ga0501046_0024641 | |||
| 1706 | Ga0501047_0045918 | |||
| 1707 | Ga0501048_0017183 | |||
| 1708 | Ga0501048_0043811 | |||
| 1709 | Ga0501067_0016549 | |||
| 1710 | Ga0501067_0021788 | |||
| 1711 | Ga0501068_0000804 | |||
| 1712 | Ga0501070_0011456 | |||
| 1713 | Ga0501071_0002075 | |||
| 1714 | Ga0501071_0013048 | |||
| 1715 | Ga0501071_0295976 | |||
| 1716 | Ga0501072_0006963 | |||
| 1717 | Ga0501072_0019946 | |||
| 1718 | Ga0501072_0020139 | |||
| 1719 | Ga0501073_0006025 | |||
| 1720 | Ga0501074_0005572 | |||
| 1721 | Ga0501074_0033465 | |||
| 1722 | Ga0501074_0046875 | |||
| 1723 | Ga0501074_0105954 | |||
| 1724 | Ga0501075_0018337 | |||
| 1725 | Ga0501075_0134707 | |||
| 1726 | Ga0501076_0000300 | |||
| 1727 | Ga0501076_0010795 | |||
| 1728 | Ga0501076_0048350 | |||
| 1729 | Ga0501076_0179238 | |||
| 1730 | Ga0501076_0224221 | |||
| 1731 | Ga0501077_0004667 | |||
| 1732 | Ga0501079_0001458 | |||
| 1733 | Ga0501079_0024720 | |||
| 1734 | Ga0501079_0142134 | |||
| 1735 | Ga0501079_0302674 | |||
| 1736 | Ga0501080_0017301 | |||
| 1737 | Ga0501080_0032012 | |||
| 1738 | Ga0501080_0269684 | |||
| 1739 | Ga0501081_0035049 | |||
| 1740 | Ga0501081_0234111 | |||
| 1741 | Ga0501083_0009175 | |||
| 1742 | Ga0501083_0246352 | |||
| 1743 | Ga0501045_0002979 | |||
| 1744 | Ga0501045_0017362 | |||
| 1745 | Ga0501045_0116759 | |||
| 1746 | nmdc:mga05p37_13712_c1 | |||
| 1747 | nmdc:mga05p37_2253_c1 | |||
| 1748 | nmdc:mga09592_997_c1 | |||
| 1749 | nmdc:mga06r32_55832_c1 | |||
| 1750 | nmdc:mga08y16_6690_c1 | |||
| 1751 | nmdc:mga0n895_1033_c1 | |||
| 1752 | nmdc:mga0n895_250449_c1 | |||
| 1753 | nmdc:mga0n895_266530_c1 | |||
| 1754 | nmdc:mga0rr50_10423_c1 | |||
| 1755 | nmdc:mga0rr50_1805_c1 | |||
| 1756 | nmdc:mga0rr50_202081_c1 | |||
| 1757 | nmdc:mga08x19_100134_c1 | |||
| 1758 | nmdc:mga08x19_4186_c1 | |||
| 1759 | nmdc:mga08x19_5920_c1 | |||
| 1760 | nmdc:mga0a205_24706_c1 | |||
| 1761 | nmdc:mga0a205_25504_c1 | |||
| 1762 | nmdc:mga0a205_38742_c1 | |||
| 1763 | Ga0495601_0001851 | |||
| 1764 | Ga0495595_0025927 | |||
| 1765 | Ga0495619_0032252 | |||
| 1766 | Ga0500583_0014665 | |||
| 1767 | Ga0500583_0042636 | |||
| 1768 | Ga0500651_0135718 | |||
| 1769 | Ga0500641_0063851 | |||
| 1770 | Ga0500556_0000589 | |||
| 1771 | Ga0500562_043559 | |||
| 1772 | Ga0500594_0010636 | |||
| 1773 | Ga0500614_006711 | |||
| 1774 | Ga0500617_019162 | |||
| 1775 | Ga0500642_0128512 | |||
| 1776 | Ga0500652_074859 | |||
| 1777 | Ga0500658_0015386 | |||
| 1778 | Ga0500568_0010327 | |||
| 1779 | Ga0500568_0044626 | |||
| 1780 | Ga0500588_0004664 | |||
| 1781 | Ga0500616_0000018 | |||
| 1782 | Ga0500616_0040981 | |||
| 1783 | Ga0500622_0018631 | |||
| 1784 | Ga0500622_0115656 | |||
| 1785 | Ga0500633_0007765 | |||
| 1786 | Ga0501084_0011370 | |||
| 1787 | Ga0501084_0014474 | |||
| 1788 | Ga0501084_0037220 | |||
| 1789 | Ga0590077_017742 | |||
| 1790 | Ga0501082_0015602 | |||
| 1791 | Ga0501082_0140118 | |||
| 1792 | Ga0501082_0250136 | |||
| 1793 | Ga0530510_0003481 | |||
| 1794 | Ga0530510_0010479 | |||
| 1795 | Ga0530510_0010649 | |||
| 1796 | 2510283929 | |||
| 1797 | 2510312890 | |||
| 1798 | 2547696612 | |||
| 1799 | 2562465973 | |||
| 1800 | 2599928202 | |||
| 1801 | 2601534023 | |||
| 1802 | 2601540191 | |||
| 1803 | 2601758826 | |||
| 1804 | 2601762823 | |||
| 1805 | 2603640676 | |||
| 1806 | 2650900141 | |||
| 1807 | 2686354381 | |||
| 1808 | 2729146261 | |||
| 1809 | 2735816575 | |||
| 1810 | 2792313387 | |||
| 1811 | 2813730563 | |||
| 1812 | 2814698170 | |||
| 1813 | 2847801232 | |||
| 1814 | 2854602939 | |||
| 1815 | 2858469617 | |||
| 1816 | 2871273612 | |||
| 1817 | 2919128136 | |||
| 1818 | 2935627975 | |||
| 1819 | 2974437004 | |||
| 1820 | 2984498059 | |||
| 1821 | 2984503776 | |||
| 1822 | 2984507642 | |||
| 1823 | 2990264427 | |||
| 1824 | 3000380481 | |||
| 1825 | 640487032 | |||
| 1826 | 651174904 | |||
| 1827 | 8001525637 | |||
| 1828 | 8016730218 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.9838 | 8 | 313 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.9804 | 8 | 313 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9576 | 6 | 311 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9509 | 6 | 311 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9114 | 7 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9982 | 113 | 213 | 1.10.150.170 |
| af_P60390_9_313_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9906 | 9 | 313 | 3.40.50.150 |
| af_P60390_9_313_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9874 | 9 | 313 | 3.40.50.150 |
| 3tkaA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9727 | 8 | 313 | 3.40.50.150 |
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9682 | 113 | 213 | 1.10.150.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2X1N3B5-F1-model_v4 | S-adenosyl-methyltransferase MraW (EC 2.1.1.199) | 0.9995 | 52 | 252 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A656GR36-F1-model_v4 | deleted | 0.9905 | 75 | 259 |
|
| AF-A0A2X2BFM0-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9857 | 64 | 313 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A2S5LTZ9-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase | 0.9855 | 7 | 150 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A257X594-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase | 0.9852 | 7 | 250 |
GO:0005737
GO:0070475 GO:0071424 |