F485592
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 915 | 360 | 889 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10001316|Ga0105237_1000131613 |
| Length | 307 |
| Sequence | LSLSINFITGDAGEKVIATFAALNSTVPPMSVIIFTVVILFGSYFAGLLGSLTGLGGGFIIIPLLTLVLHVNLQYAIGASLVSVIATSSGSAAAYVREGITNIRLGMFLEIATTAGAFTGAVVAIYISTQLIAVLFGFILLFSAIMSLRNKAEHIVKEKTFLARKLKLDGNYPVNDELVEYGVSNIAGGFFMMVFAGIISGLLGIGSGALKVVAMDGIMRIPFKVSTTTSNFMIGVTAAASAVVYLQRGYIHPGLAMPVMIGVLLGAATGSKILVHTTSSQRLRWVFAIVITVIAIQMIYNGIQGKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 4 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 5 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 6 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 7 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 8 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 9 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 10 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 11 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 12 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 13 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 14 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 15 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 16 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 17 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 18 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 19 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 20 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 21 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 22 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 23 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 24 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 25 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 26 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 27 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 28 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 29 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 30 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 31 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 32 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 33 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 34 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 37 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 38 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 39 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 225 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 246 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 253 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 313 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 314 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 315 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 316 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 345 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 346 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 348 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 351 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 355 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 357 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 358 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.16 |
| Metatranscriptomes | 0 |
| Isolates | 2.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.26 |
| Nodule | 0 |
| Rhizoplane | 1.09 |
| Rhizosphere | 88.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3008445 | 2162886007 | Bacteria | 4503 |
| 2 | JGI24737J22298_10000840 | 3300001990 | Bacteria | 10935 |
| 3 | JGI24735J21928_10021300 | 3300002067 | Bacteria | 1980 |
| 4 | JGI24744J21845_10008150 | 3300002077 | Bacteria | 2163 |
| 5 | JGI25152J39213_1000006 | 3300002773 | Bacteria | 158516 |
| 6 | JGI25150J39212_1000005 | 3300002774 | Bacteria | 311800 |
| 7 | JGI25151J46595_10000004 | 3300003187 | Bacteria | 494006 |
| 8 | JGI25165J46597_1001383 | 3300003214 | Bacteria | 13315 |
| 9 | JGI25165J46597_1010880 | 3300003214 | Bacteria | 1315 |
| 10 | JGI25153J46596_10000004 | 3300003215 | Bacteria | 494006 |
| 11 | rootH1_10139411 | 3300003316 | Bacteria | 5392 |
| 12 | rootH2_10002321 | 3300003320 | Bacteria | 110257 |
| 13 | rootH2_10022605 | 3300003320 | Bacteria | 6328 |
| 14 | rootH2_10258336 | 3300003320 | Bacteria | 3929 |
| 15 | rootH1_10039624 | 3300003323 | Bacteria | 15166 |
| 16 | rootH1_10068371 | 3300003323 | Bacteria | 2372 |
| 17 | rootH1_10083328 | 3300003323 | Bacteria | 4598 |
| 18 | rootH1_10086794 | 3300003323 | Bacteria | 3600 |
| 19 | rootH1_10235905 | 3300003323 | Bacteria | 3306 |
| 20 | Ga0055536_1000004 | 3300003781 | Bacteria | 411108 |
| 21 | Ga0055530_10000817 | 3300003791 | Bacteria | 25836 |
| 22 | Ga0065714_10004209 | 3300005288 | Bacteria | 5260 |
| 23 | Ga0065714_10005173 | 3300005288 | Bacteria | 5531 |
| 24 | Ga0065714_10007399 | 3300005288 | Bacteria | 5260 |
| 25 | Ga0065714_10009634 | 3300005288 | Bacteria | 2983 |
| 26 | Ga0065714_10065250 | 3300005288 | Bacteria | 11440 |
| 27 | Ga0065714_10108862 | 3300005288 | Bacteria | 1494 |
| 28 | Ga0065714_10110142 | 3300005288 | Bacteria | 1485 |
| 29 | Ga0065704_10001893 | 3300005289 | Bacteria | 6314 |
| 30 | Ga0065704_10098950 | 3300005289 | Bacteria | 2324 |
| 31 | Ga0070658_10000200 | 3300005327 | Bacteria | 52651 |
| 32 | Ga0070658_10063529 | 3300005327 | Bacteria | 3010 |
| 33 | Ga0070658_10074142 | 3300005327 | Bacteria | 2791 |
| 34 | Ga0070658_10193955 | 3300005327 | Bacteria | 1713 |
| 35 | Ga0070658_10466577 | 3300005327 | Bacteria | 1089 |
| 36 | Ga0070676_10002382 | 3300005328 | Bacteria | 9622 |
| 37 | Ga0070683_100019588 | 3300005329 | Bacteria | 6011 |
| 38 | Ga0070683_100022500 | 3300005329 | Bacteria | 5633 |
| 39 | Ga0070683_100028155 | 3300005329 | Bacteria | 5076 |
| 40 | Ga0070683_100040343 | 3300005329 | Bacteria | 4292 |
| 41 | Ga0070683_100168911 | 3300005329 | Bacteria | 2076 |
| 42 | Ga0070683_100336686 | 3300005329 | Bacteria | 1437 |
| 43 | Ga0070670_100000465 | 3300005331 | Bacteria | 32818 |
| 44 | Ga0068869_100026879 | 3300005334 | Bacteria | 4007 |
| 45 | Ga0070680_100002217 | 3300005336 | Bacteria | 14323 |
| 46 | Ga0070680_100053695 | 3300005336 | Bacteria | 3289 |
| 47 | Ga0070680_100060347 | 3300005336 | Bacteria | 3104 |
| 48 | Ga0070682_100379000 | 3300005337 | Bacteria | 1063 |
| 49 | Ga0068868_100005678 | 3300005338 | Bacteria | 8784 |
| 50 | Ga0068868_100018805 | 3300005338 | Bacteria | 5169 |
| 51 | Ga0068868_100029959 | 3300005338 | Bacteria | 4171 |
| 52 | Ga0068868_100087456 | 3300005338 | Bacteria | 2506 |
| 53 | Ga0070660_100000172 | 3300005339 | Bacteria | 42371 |
| 54 | Ga0070660_100019016 | 3300005339 | Bacteria | 5029 |
| 55 | Ga0070660_100052135 | 3300005339 | Unclassified | 3153 |
| 56 | Ga0070660_100062739 | 3300005339 | Bacteria | 2888 |
| 57 | Ga0070691_10009132 | 3300005341 | Bacteria | 4533 |
| 58 | Ga0070691_10157308 | 3300005341 | Bacteria | 1169 |
| 59 | Ga0070687_100014799 | 3300005343 | Unclassified | 3513 |
| 60 | Ga0070675_100102479 | 3300005354 | Bacteria | 2412 |
| 61 | Ga0070675_100547737 | 3300005354 | Unclassified | 1046 |
| 62 | Ga0070671_100006664 | 3300005355 | Bacteria | 9235 |
| 63 | Ga0070671_100109826 | 3300005355 | Unclassified | 2316 |
| 64 | Ga0070673_100015777 | 3300005364 | Bacteria | 5319 |
| 65 | Ga0070673_100023233 | 3300005364 | Bacteria | 4529 |
| 66 | Ga0070673_100531917 | 3300005364 | Bacteria | 1066 |
| 67 | Ga0070688_100204885 | 3300005365 | Bacteria | 1382 |
| 68 | Ga0070659_100000242 | 3300005366 | Bacteria | 42847 |
| 69 | Ga0070659_100005922 | 3300005366 | Bacteria | 8813 |
| 70 | Ga0070659_100053736 | 3300005366 | Bacteria | 3171 |
| 71 | Ga0070667_100086003 | 3300005367 | Bacteria | 2697 |
| 72 | Ga0070709_10030139 | 3300005434 | Bacteria | 3253 |
| 73 | Ga0070709_10037304 | 3300005434 | Bacteria | 2967 |
| 74 | Ga0070709_10136544 | 3300005434 | Bacteria | 1680 |
| 75 | Ga0070714_100001995 | 3300005435 | Bacteria | 14916 |
| 76 | Ga0070714_100029083 | 3300005435 | Bacteria | 4591 |
| 77 | Ga0070714_100074413 | 3300005435 | Bacteria | 2945 |
| 78 | Ga0070714_100150627 | 3300005435 | Bacteria | 2096 |
| 79 | Ga0070714_100214080 | 3300005435 | Bacteria | 1767 |
| 80 | Ga0070714_100267949 | 3300005435 | Bacteria | 1583 |
| 81 | Ga0070713_100000575 | 3300005436 | Bacteria | 23317 |
| 82 | Ga0070713_100005330 | 3300005436 | Bacteria | 8774 |
| 83 | Ga0070713_100024471 | 3300005436 | Bacteria | 4703 |
| 84 | Ga0070713_100029003 | 3300005436 | Bacteria | 4376 |
| 85 | Ga0070713_100056196 | 3300005436 | Unclassified | 3274 |
| 86 | Ga0070713_100277175 | 3300005436 | Unclassified | 1537 |
| 87 | Ga0070713_100371473 | 3300005436 | Bacteria | 1331 |
| 88 | Ga0070710_10007071 | 3300005437 | Bacteria | 5418 |
| 89 | Ga0070711_100025932 | 3300005439 | Unclassified | 3838 |
| 90 | Ga0070711_100026344 | 3300005439 | Bacteria | 3809 |
| 91 | Ga0070711_100059361 | 3300005439 | Bacteria | 2655 |
| 92 | Ga0070711_100197309 | 3300005439 | Bacteria | 1551 |
| 93 | Ga0070705_100065277 | 3300005440 | Bacteria | 2178 |
| 94 | Ga0070708_100000030 | 3300005445 | Bacteria | 96247 |
| 95 | Ga0070708_100001090 | 3300005445 | Bacteria | 20733 |
| 96 | Ga0070708_100005564 | 3300005445 | Bacteria | 9983 |
| 97 | Ga0070708_100085950 | 3300005445 | Unclassified | 2856 |
| 98 | Ga0070708_100493438 | 3300005445 | Bacteria | 1155 |
| 99 | Ga0070678_100013519 | 3300005456 | Bacteria | 5122 |
| 100 | Ga0070662_100000877 | 3300005457 | Bacteria | 18384 |
| 101 | Ga0070662_100083699 | 3300005457 | Bacteria | 2382 |
| 102 | Ga0070681_10000026 | 3300005458 | Bacteria | 107615 |
| 103 | Ga0070681_10004904 | 3300005458 | Bacteria | 12846 |
| 104 | Ga0070681_10007353 | 3300005458 | Bacteria | 10764 |
| 105 | Ga0070681_10165503 | 3300005458 | Bacteria | 2134 |
| 106 | Ga0070681_10418966 | 3300005458 | Unclassified | 1251 |
| 107 | Ga0070681_10501598 | 3300005458 | Bacteria | 1127 |
| 108 | Ga0068867_100000040 | 3300005459 | Bacteria | 78509 |
| 109 | Ga0068867_100008021 | 3300005459 | Bacteria | 7463 |
| 110 | Ga0070706_100001928 | 3300005467 | Bacteria | 21387 |
| 111 | Ga0070706_100008523 | 3300005467 | Bacteria | 9557 |
| 112 | Ga0070706_100312357 | 3300005467 | Unclassified | 1466 |
| 113 | Ga0070706_100445040 | 3300005467 | Bacteria | 1206 |
| 114 | Ga0070707_100000176 | 3300005468 | Bacteria | 62533 |
| 115 | Ga0070698_100037908 | 3300005471 | Bacteria | 4969 |
| 116 | Ga0070699_100248493 | 3300005518 | Bacteria | 1589 |
| 117 | Ga0070699_100438424 | 3300005518 | Archaea | 1184 |
| 118 | Ga0070679_100002685 | 3300005530 | Bacteria | 16206 |
| 119 | Ga0070679_100007648 | 3300005530 | Bacteria | 10114 |
| 120 | Ga0070679_100034515 | 3300005530 | Bacteria | 5014 |
| 121 | Ga0070679_100193934 | 3300005530 | Bacteria | 1999 |
| 122 | Ga0070679_100221366 | 3300005530 | Bacteria | 1853 |
| 123 | Ga0070679_100225608 | 3300005530 | Bacteria | 1834 |
| 124 | Ga0070679_100261166 | 3300005530 | Unclassified | 1687 |
| 125 | Ga0070684_100110088 | 3300005535 | Bacteria | 2469 |
| 126 | Ga0070684_100197397 | 3300005535 | Bacteria | 1832 |
| 127 | Ga0070684_100201531 | 3300005535 | Unclassified | 1813 |
| 128 | Ga0070684_100274124 | 3300005535 | Bacteria | 1545 |
| 129 | Ga0070697_100005597 | 3300005536 | Archaea | 9684 |
| 130 | Ga0070697_100269584 | 3300005536 | Bacteria | 1459 |
| 131 | Ga0068853_100005706 | 3300005539 | Bacteria | 9792 |
| 132 | Ga0068853_100007080 | 3300005539 | Bacteria | 8971 |
| 133 | Ga0068853_100062754 | 3300005539 | Bacteria | 3217 |
| 134 | Ga0068853_100090731 | 3300005539 | Bacteria | 2686 |
| 135 | Ga0068853_100280145 | 3300005539 | Bacteria | 1537 |
| 136 | Ga0070686_100107443 | 3300005544 | Bacteria | 1895 |
| 137 | Ga0070696_100075778 | 3300005546 | Unclassified | 2374 |
| 138 | Ga0070665_100000010 | 3300005548 | Bacteria | 529545 |
| 139 | Ga0070665_100207748 | 3300005548 | Bacteria | 1959 |
| 140 | Ga0070665_100325771 | 3300005548 | Bacteria | 1540 |
| 141 | Ga0068855_100000054 | 3300005563 | Bacteria | 139322 |
| 142 | Ga0068855_100000295 | 3300005563 | Bacteria | 61909 |
| 143 | Ga0068855_100000856 | 3300005563 | Bacteria | 37762 |
| 144 | Ga0068855_100001626 | 3300005563 | Bacteria | 28175 |
| 145 | Ga0068855_100009839 | 3300005563 | Bacteria | 11535 |
| 146 | Ga0068855_100012882 | 3300005563 | Bacteria | 10090 |
| 147 | Ga0068855_100033711 | 3300005563 | Bacteria | 6109 |
| 148 | Ga0068855_100077266 | 3300005563 | Bacteria | 3862 |
| 149 | Ga0068855_100084338 | 3300005563 | Unclassified | 3679 |
| 150 | Ga0068855_100110740 | 3300005563 | Bacteria | 3151 |
| 151 | Ga0068855_100188833 | 3300005563 | Unclassified | 2325 |
| 152 | Ga0068855_100211524 | 3300005563 | Bacteria | 2179 |
| 153 | Ga0070664_100008525 | 3300005564 | Bacteria | 8289 |
| 154 | Ga0070664_100052380 | 3300005564 | Unclassified | 3457 |
| 155 | Ga0070664_100179556 | 3300005564 | Unclassified | 1881 |
| 156 | Ga0068857_100000036 | 3300005577 | Bacteria | 72327 |
| 157 | Ga0068857_100002465 | 3300005577 | Bacteria | 15129 |
| 158 | Ga0068857_100036079 | 3300005577 | Bacteria | 4381 |
| 159 | Ga0068857_100182735 | 3300005577 | Bacteria | 1908 |
| 160 | Ga0068857_100318782 | 3300005577 | Bacteria | 1435 |
| 161 | Ga0068854_100003663 | 3300005578 | Bacteria | 9611 |
| 162 | Ga0068854_100080200 | 3300005578 | Bacteria | 2408 |
| 163 | Ga0068854_100403486 | 3300005578 | Bacteria | 1132 |
| 164 | Ga0068856_100000023 | 3300005614 | Bacteria | 141671 |
| 165 | Ga0068856_100000407 | 3300005614 | Bacteria | 47326 |
| 166 | Ga0068856_100001013 | 3300005614 | Bacteria | 29894 |
| 167 | Ga0068856_100002064 | 3300005614 | Bacteria | 20820 |
| 168 | Ga0068856_100005806 | 3300005614 | Bacteria | 12161 |
| 169 | Ga0068856_100014557 | 3300005614 | Bacteria | 7600 |
| 170 | Ga0068856_100022934 | 3300005614 | Bacteria | 6070 |
| 171 | Ga0068856_100028518 | 3300005614 | Bacteria | 5451 |
| 172 | Ga0068856_100042307 | 3300005614 | Bacteria | 4481 |
| 173 | Ga0068856_100074931 | 3300005614 | Bacteria | 3351 |
| 174 | Ga0068856_100163191 | 3300005614 | Bacteria | 2239 |
| 175 | Ga0068856_100178323 | 3300005614 | Bacteria | 2137 |
| 176 | Ga0068856_100190440 | 3300005614 | Bacteria | 2065 |
| 177 | Ga0068856_100226671 | 3300005614 | Unclassified | 1884 |
| 178 | Ga0068856_100266109 | 3300005614 | Bacteria | 1730 |
| 179 | Ga0068856_100406242 | 3300005614 | Unclassified | 1381 |
| 180 | Ga0068852_100033904 | 3300005616 | Bacteria | 4244 |
| 181 | Ga0068852_100093087 | 3300005616 | Bacteria | 2700 |
| 182 | Ga0068852_100339780 | 3300005616 | Bacteria | 1463 |
| 183 | Ga0068852_100559249 | 3300005616 | Bacteria | 1145 |
| 184 | Ga0068859_100001163 | 3300005617 | Bacteria | 26891 |
| 185 | Ga0068864_100000684 | 3300005618 | Bacteria | 28437 |
| 186 | Ga0068864_100055045 | 3300005618 | Bacteria | 3434 |
| 187 | Ga0068866_10011030 | 3300005718 | Bacteria | 3894 |
| 188 | Ga0068870_10144267 | 3300005840 | Bacteria | 1396 |
| 189 | Ga0068863_100024417 | 3300005841 | Bacteria | 5765 |
| 190 | Ga0068863_100102141 | 3300005841 | Bacteria | 2726 |
| 191 | Ga0068858_100014126 | 3300005842 | Bacteria | 7531 |
| 192 | Ga0068858_100020900 | 3300005842 | Bacteria | 6117 |
| 193 | Ga0068858_100088342 | 3300005842 | Bacteria | 2884 |
| 194 | Ga0068860_100048369 | 3300005843 | Bacteria | 4053 |
| 195 | Ga0068860_100391785 | 3300005843 | Bacteria | 1373 |
| 196 | Ga0081455_10013928 | 3300005937 | Bacteria | 7904 |
| 197 | Ga0081455_10056904 | 3300005937 | Bacteria | 3318 |
| 198 | Ga0070717_10001574 | 3300006028 | Bacteria | 15793 |
| 199 | Ga0070717_10001844 | 3300006028 | Bacteria | 14794 |
| 200 | Ga0070717_10007845 | 3300006028 | Bacteria | 7946 |
| 201 | Ga0070717_10007951 | 3300006028 | Bacteria | 7898 |
| 202 | Ga0070717_10020023 | 3300006028 | Bacteria | 5256 |
| 203 | Ga0070717_10049436 | 3300006028 | Unclassified | 3452 |
| 204 | Ga0070717_10057142 | 3300006028 | Bacteria | 3225 |
| 205 | Ga0070717_10129472 | 3300006028 | Bacteria | 2169 |
| 206 | Ga0070717_10402465 | 3300006028 | Unclassified | 1230 |
| 207 | Ga0070717_10655569 | 3300006028 | Bacteria | 953 |
| 208 | Ga0070716_100010634 | 3300006173 | Bacteria | 4618 |
| 209 | Ga0070716_100106153 | 3300006173 | Bacteria | 1732 |
| 210 | Ga0070712_100009888 | 3300006175 | Bacteria | 6014 |
| 211 | Ga0097621_100000011 | 3300006237 | Bacteria | 111116 |
| 212 | Ga0097621_100000237 | 3300006237 | Bacteria | 37036 |
| 213 | Ga0097621_100014508 | 3300006237 | Bacteria | 5898 |
| 214 | Ga0097621_100060336 | 3300006237 | Bacteria | 3109 |
| 215 | Ga0068871_100001088 | 3300006358 | Bacteria | 18235 |
| 216 | Ga0068871_100002121 | 3300006358 | Bacteria | 13435 |
| 217 | Ga0068871_100003357 | 3300006358 | Bacteria | 10999 |
| 218 | Ga0068865_100001113 | 3300006881 | Bacteria | 15548 |
| 219 | Ga0068865_100040696 | 3300006881 | Bacteria | 3160 |
| 220 | Ga0075436_100039498 | 3300006914 | Bacteria | 3257 |
| 221 | Ga0097620_100001163 | 3300006931 | Bacteria | 26891 |
| 222 | Ga0099794_10000923 | 3300007265 | Archaea | 9921 |
| 223 | Ga0099794_10131581 | 3300007265 | Unclassified | 1263 |
| 224 | Ga0105240_10000558 | 3300009093 | Bacteria | 69072 |
| 225 | Ga0105240_10002861 | 3300009093 | Bacteria | 27285 |
| 226 | Ga0105240_10003887 | 3300009093 | Bacteria | 23076 |
| 227 | Ga0105240_10004872 | 3300009093 | Bacteria | 20190 |
| 228 | Ga0105240_10012765 | 3300009093 | Bacteria | 11577 |
| 229 | Ga0105240_10031483 | 3300009093 | Bacteria | 6880 |
| 230 | Ga0105240_10046934 | 3300009093 | Bacteria | 5469 |
| 231 | Ga0105240_10062993 | 3300009093 | Bacteria | 4615 |
| 232 | Ga0105240_10085284 | 3300009093 | Bacteria | 3870 |
| 233 | Ga0105240_10085736 | 3300009093 | Bacteria | 3858 |
| 234 | Ga0105240_10109624 | 3300009093 | Bacteria | 3343 |
| 235 | Ga0105240_10133272 | 3300009093 | Bacteria | 2978 |
| 236 | Ga0105240_10180658 | 3300009093 | Bacteria | 2490 |
| 237 | Ga0105240_10282272 | 3300009093 | Bacteria | 1907 |
| 238 | Ga0105240_10314348 | 3300009093 | Bacteria | 1787 |
| 239 | Ga0105240_10386510 | 3300009093 | Bacteria | 1579 |
| 240 | Ga0105240_10447387 | 3300009093 | Bacteria | 1446 |
| 241 | Ga0105240_10694057 | 3300009093 | Bacteria | 1112 |
| 242 | Ga0105241_10003934 | 3300009174 | Bacteria | 10993 |
| 243 | Ga0105241_10006678 | 3300009174 | Bacteria | 8490 |
| 244 | Ga0105241_10074887 | 3300009174 | Bacteria | 2637 |
| 245 | Ga0105241_10092839 | 3300009174 | Bacteria | 2384 |
| 246 | Ga0105241_10335181 | 3300009174 | Bacteria | 1309 |
| 247 | Ga0105241_10710459 | 3300009174 | Bacteria | 918 |
| 248 | Ga0105242_10011984 | 3300009176 | Bacteria | 6675 |
| 249 | Ga0105242_10075022 | 3300009176 | Unclassified | 2815 |
| 250 | Ga0105248_10003155 | 3300009177 | Bacteria | 18246 |
| 251 | Ga0105248_10046585 | 3300009177 | Bacteria | 4860 |
| 252 | Ga0105248_10217286 | 3300009177 | Bacteria | 2153 |
| 253 | Ga0105237_10000381 | 3300009545 | Bacteria | 63311 |
| 254 | Ga0105237_10001316 | 3300009545 | Bacteria | 32951 |
| 255 | Ga0105237_10002553 | 3300009545 | Bacteria | 22488 |
| 256 | Ga0105237_10004319 | 3300009545 | Bacteria | 16482 |
| 257 | Ga0105237_10004940 | 3300009545 | Bacteria | 15232 |
| 258 | Ga0105237_10006655 | 3300009545 | Bacteria | 12769 |
| 259 | Ga0105237_10011977 | 3300009545 | Bacteria | 9166 |
| 260 | Ga0105237_10013652 | 3300009545 | Bacteria | 8505 |
| 261 | Ga0105237_10056078 | 3300009545 | Unclassified | 3945 |
| 262 | Ga0105237_10060642 | 3300009545 | Bacteria | 3784 |
| 263 | Ga0105237_10086070 | 3300009545 | Bacteria | 3133 |
| 264 | Ga0105237_10150727 | 3300009545 | Bacteria | 2322 |
| 265 | Ga0105237_10219924 | 3300009545 | Bacteria | 1899 |
| 266 | Ga0105237_10242362 | 3300009545 | Unclassified | 1804 |
| 267 | Ga0105237_10848719 | 3300009545 | Bacteria | 920 |
| 268 | Ga0105238_10000848 | 3300009551 | Bacteria | 31448 |
| 269 | Ga0105238_10003247 | 3300009551 | Bacteria | 16233 |
| 270 | Ga0105238_10031206 | 3300009551 | Bacteria | 5424 |
| 271 | Ga0105238_10055666 | 3300009551 | Bacteria | 3970 |
| 272 | Ga0105238_10113584 | 3300009551 | Bacteria | 2688 |
| 273 | Ga0105239_10000011 | 3300010375 | Bacteria | 337500 |
| 274 | Ga0105239_10001982 | 3300010375 | Bacteria | 26624 |
| 275 | Ga0105239_10004282 | 3300010375 | Bacteria | 17118 |
| 276 | Ga0105239_10006110 | 3300010375 | Bacteria | 14024 |
| 277 | Ga0105239_10007356 | 3300010375 | Bacteria | 12647 |
| 278 | Ga0105239_10008277 | 3300010375 | Bacteria | 11858 |
| 279 | Ga0105239_10026773 | 3300010375 | Bacteria | 6346 |
| 280 | Ga0105239_10037880 | 3300010375 | Bacteria | 5283 |
| 281 | Ga0105239_10084130 | 3300010375 | Bacteria | 3504 |
| 282 | Ga0105239_10137966 | 3300010375 | Unclassified | 2716 |
| 283 | Ga0105239_10150101 | 3300010375 | Bacteria | 2601 |
| 284 | Ga0105239_10214113 | 3300010375 | Bacteria | 2160 |
| 285 | Ga0105239_10728387 | 3300010375 | Bacteria | 1135 |
| 286 | Ga0105246_10002620 | 3300011119 | Bacteria | 10886 |
| 287 | Ga0105246_10033519 | 3300011119 | Bacteria | 3415 |
| 288 | Ga0157373_10008448 | 3300013100 | Bacteria | 7646 |
| 289 | Ga0157373_10012250 | 3300013100 | Bacteria | 6305 |
| 290 | Ga0157373_10016721 | 3300013100 | Bacteria | 5346 |
| 291 | Ga0157373_10018974 | 3300013100 | Bacteria | 5006 |
| 292 | Ga0157373_10040777 | 3300013100 | Bacteria | 3322 |
| 293 | Ga0157373_10049369 | 3300013100 | Bacteria | 2999 |
| 294 | Ga0157373_10065552 | 3300013100 | Bacteria | 2570 |
| 295 | Ga0157373_10222128 | 3300013100 | Bacteria | 1333 |
| 296 | Ga0157371_10001686 | 3300013102 | Bacteria | 22505 |
| 297 | Ga0157371_10005650 | 3300013102 | Bacteria | 10499 |
| 298 | Ga0157371_10009615 | 3300013102 | Bacteria | 7601 |
| 299 | Ga0157371_10010104 | 3300013102 | Bacteria | 7378 |
| 300 | Ga0157371_10050715 | 3300013102 | Bacteria | 2949 |
| 301 | Ga0157371_10054888 | 3300013102 | Bacteria | 2828 |
| 302 | Ga0157371_10066523 | 3300013102 | Bacteria | 2552 |
| 303 | Ga0157371_10078959 | 3300013102 | Bacteria | 2331 |
| 304 | Ga0157371_10140751 | 3300013102 | Bacteria | 1718 |
| 305 | Ga0157371_10306216 | 3300013102 | Bacteria | 1151 |
| 306 | Ga0157370_10000084 | 3300013104 | Bacteria | 104159 |
| 307 | Ga0157370_10000173 | 3300013104 | Bacteria | 80263 |
| 308 | Ga0157370_10001193 | 3300013104 | Bacteria | 32395 |
| 309 | Ga0157370_10010467 | 3300013104 | Bacteria | 9769 |
| 310 | Ga0157370_10010945 | 3300013104 | Bacteria | 9522 |
| 311 | Ga0157370_10027543 | 3300013104 | Bacteria | 5603 |
| 312 | Ga0157370_10066433 | 3300013104 | Bacteria | 3411 |
| 313 | Ga0157370_10083652 | 3300013104 | Bacteria | 3000 |
| 314 | Ga0157370_10083711 | 3300013104 | Bacteria | 2999 |
| 315 | Ga0157370_10101904 | 3300013104 | Bacteria | 2689 |
| 316 | Ga0157370_10146649 | 3300013104 | Bacteria | 2197 |
| 317 | Ga0157370_10253898 | 3300013104 | Unclassified | 1626 |
| 318 | Ga0157370_10280241 | 3300013104 | Bacteria | 1540 |
| 319 | Ga0157370_10297377 | 3300013104 | Bacteria | 1490 |
| 320 | Ga0157370_10425220 | 3300013104 | Bacteria | 1222 |
| 321 | Ga0157369_10000023 | 3300013105 | Bacteria | 226955 |
| 322 | Ga0157369_10000124 | 3300013105 | Bacteria | 110693 |
| 323 | Ga0157369_10008828 | 3300013105 | Bacteria | 11547 |
| 324 | Ga0157369_10021963 | 3300013105 | Bacteria | 7132 |
| 325 | Ga0157369_10022924 | 3300013105 | Bacteria | 6962 |
| 326 | Ga0157369_10028633 | 3300013105 | Bacteria | 6164 |
| 327 | Ga0157369_10031489 | 3300013105 | Bacteria | 5839 |
| 328 | Ga0157369_10047163 | 3300013105 | Unclassified | 4680 |
| 329 | Ga0157369_10051510 | 3300013105 | Bacteria | 4455 |
| 330 | Ga0157369_10069306 | 3300013105 | Bacteria | 3789 |
| 331 | Ga0157369_10098242 | 3300013105 | Unclassified | 3123 |
| 332 | Ga0157369_10143317 | 3300013105 | Bacteria | 2527 |
| 333 | Ga0157369_10159442 | 3300013105 | Bacteria | 2382 |
| 334 | Ga0157369_10283249 | 3300013105 | Bacteria | 1726 |
| 335 | Ga0157369_10367376 | 3300013105 | Bacteria | 1494 |
| 336 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 337 | Ga0157374_10000162 | 3300013296 | Bacteria | 61913 |
| 338 | Ga0157374_10000391 | 3300013296 | Bacteria | 40035 |
| 339 | Ga0157374_10000667 | 3300013296 | Bacteria | 30210 |
| 340 | Ga0157374_10001058 | 3300013296 | Bacteria | 23891 |
| 341 | Ga0157374_10001625 | 3300013296 | Bacteria | 18840 |
| 342 | Ga0157374_10005516 | 3300013296 | Bacteria | 10634 |
| 343 | Ga0157374_10021199 | 3300013296 | Bacteria | 5777 |
| 344 | Ga0157374_10056135 | 3300013296 | Bacteria | 3676 |
| 345 | Ga0157374_10137383 | 3300013296 | Unclassified | 2371 |
| 346 | Ga0157374_10430488 | 3300013296 | Unclassified | 1319 |
| 347 | Ga0157378_10000020 | 3300013297 | Bacteria | 131245 |
| 348 | Ga0157378_10000320 | 3300013297 | Bacteria | 47177 |
| 349 | Ga0157378_10012884 | 3300013297 | Bacteria | 7322 |
| 350 | Ga0157378_10028561 | 3300013297 | Bacteria | 4923 |
| 351 | Ga0157378_10083027 | 3300013297 | Bacteria | 2898 |
| 352 | Ga0157378_10119822 | 3300013297 | Bacteria | 2424 |
| 353 | Ga0157378_10644725 | 3300013297 | Bacteria | 1074 |
| 354 | Ga0163162_10000013 | 3300013306 | Bacteria | 275366 |
| 355 | Ga0163162_10000082 | 3300013306 | Bacteria | 86888 |
| 356 | Ga0163162_10002182 | 3300013306 | Bacteria | 18354 |
| 357 | Ga0163162_10005591 | 3300013306 | Bacteria | 12161 |
| 358 | Ga0157372_10000084 | 3300013307 | Bacteria | 98431 |
| 359 | Ga0157372_10001112 | 3300013307 | Bacteria | 29221 |
| 360 | Ga0157372_10001395 | 3300013307 | Bacteria | 26028 |
| 361 | Ga0157372_10005137 | 3300013307 | Bacteria | 13912 |
| 362 | Ga0157372_10009649 | 3300013307 | Bacteria | 10259 |
| 363 | Ga0157372_10018191 | 3300013307 | Bacteria | 7554 |
| 364 | Ga0157372_10028068 | 3300013307 | Bacteria | 6139 |
| 365 | Ga0157372_10054272 | 3300013307 | Bacteria | 4469 |
| 366 | Ga0157372_10067480 | 3300013307 | Bacteria | 4019 |
| 367 | Ga0157372_10109261 | 3300013307 | Bacteria | 3167 |
| 368 | Ga0157372_10112776 | 3300013307 | Bacteria | 3116 |
| 369 | Ga0157372_10257431 | 3300013307 | Bacteria | 2026 |
| 370 | Ga0157372_10324072 | 3300013307 | Unclassified | 1794 |
| 371 | Ga0157372_10541205 | 3300013307 | Bacteria | 1358 |
| 372 | Ga0157372_10606185 | 3300013307 | Bacteria | 1276 |
| 373 | Ga0157372_10817697 | 3300013307 | Bacteria | 1082 |
| 374 | Ga0157375_10009398 | 3300013308 | Bacteria | 8584 |
| 375 | Ga0157375_10034701 | 3300013308 | Bacteria | 4808 |
| 376 | Ga0163163_10059148 | 3300014325 | Bacteria | 3790 |
| 377 | Ga0163163_10202252 | 3300014325 | Bacteria | 2035 |
| 378 | Ga0182008_10000002 | 3300014497 | Bacteria | 480216 |
| 379 | Ga0182008_10000600 | 3300014497 | Bacteria | 26471 |
| 380 | Ga0182008_10005586 | 3300014497 | Bacteria | 7133 |
| 381 | Ga0157379_10026657 | 3300014968 | Bacteria | 5144 |
| 382 | Ga0157376_10016338 | 3300014969 | Bacteria | 5632 |
| 383 | Ga0157376_10020473 | 3300014969 | Bacteria | 5117 |
| 384 | Ga0157376_10040319 | 3300014969 | Bacteria | 3816 |
| 385 | Ga0157376_10271248 | 3300014969 | Bacteria | 1594 |
| 386 | Ga0182006_1000806 | 3300015261 | Bacteria | 21001 |
| 387 | Ga0182006_1000849 | 3300015261 | Bacteria | 20567 |
| 388 | Ga0182006_1002239 | 3300015261 | Bacteria | 10695 |
| 389 | Ga0182006_1010004 | 3300015261 | Bacteria | 4231 |
| 390 | Ga0182006_1088462 | 3300015261 | Bacteria | 1118 |
| 391 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 392 | Ga0182007_10042238 | 3300015262 | Bacteria | 1518 |
| 393 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 394 | Ga0163161_10002163 | 3300017792 | Bacteria | 14176 |
| 395 | Ga0163161_10002409 | 3300017792 | Bacteria | 13411 |
| 396 | Ga0163161_10003140 | 3300017792 | Bacteria | 11646 |
| 397 | Ga0163161_10135846 | 3300017792 | Bacteria | 1859 |
| 398 | Ga0163161_10195333 | 3300017792 | Bacteria | 1557 |
| 399 | Ga0163161_10225768 | 3300017792 | Bacteria | 1452 |
| 400 | Ga0213873_10020392 | 3300021358 | Bacteria | 1548 |
| 401 | Ga0213872_10002892 | 3300021361 | Bacteria | 9779 |
| 402 | Ga0213872_10051840 | 3300021361 | Bacteria | 1862 |
| 403 | Ga0213874_10019751 | 3300021377 | Bacteria | 1838 |
| 404 | Ga0213876_10067790 | 3300021384 | Bacteria | 1885 |
| 405 | Ga0213876_10143007 | 3300021384 | Bacteria | 1272 |
| 406 | Ga0213875_10000013 | 3300021388 | Bacteria | 305595 |
| 407 | Ga0207427_100137 | 3300025231 | Bacteria | 88182 |
| 408 | Ga0209437_100112 | 3300025233 | Bacteria | 214292 |
| 409 | Ga0209437_100119 | 3300025233 | Bacteria | 206549 |
| 410 | Ga0207425_1000008 | 3300025245 | Bacteria | 618024 |
| 411 | Ga0209026_1004556 | 3300025250 | Bacteria | 4075 |
| 412 | Ga0209129_1000040 | 3300025258 | Bacteria | 313043 |
| 413 | Ga0209233_1000126 | 3300025261 | Bacteria | 214298 |
| 414 | Ga0209233_1001504 | 3300025261 | Bacteria | 9164 |
| 415 | Ga0209233_1008644 | 3300025261 | Bacteria | 3133 |
| 416 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 417 | Ga0209025_1000020 | 3300025294 | Bacteria | 618024 |
| 418 | Ga0209758_1000022 | 3300025297 | Bacteria | 618024 |
| 419 | Ga0209050_1000048 | 3300025298 | Bacteria | 371553 |
| 420 | Ga0207692_10004695 | 3300025898 | Bacteria | 5421 |
| 421 | Ga0207692_10147538 | 3300025898 | Bacteria | 1344 |
| 422 | Ga0207647_10000046 | 3300025904 | Bacteria | 90148 |
| 423 | Ga0207647_10000171 | 3300025904 | Bacteria | 51875 |
| 424 | Ga0207647_10057239 | 3300025904 | Bacteria | 2390 |
| 425 | Ga0207699_10010688 | 3300025906 | Unclassified | 4616 |
| 426 | Ga0207645_10001612 | 3300025907 | Bacteria | 18396 |
| 427 | Ga0207643_10085460 | 3300025908 | Bacteria | 1832 |
| 428 | Ga0207705_10000257 | 3300025909 | Bacteria | 51549 |
| 429 | Ga0207705_10115602 | 3300025909 | Unclassified | 1985 |
| 430 | Ga0207684_10000812 | 3300025910 | Bacteria | 36095 |
| 431 | Ga0207684_10082298 | 3300025910 | Bacteria | 2741 |
| 432 | Ga0207684_10376805 | 3300025910 | Bacteria | 1221 |
| 433 | Ga0207654_10001865 | 3300025911 | Bacteria | 10912 |
| 434 | Ga0207654_10013745 | 3300025911 | Bacteria | 4170 |
| 435 | Ga0207707_10000800 | 3300025912 | Bacteria | 30836 |
| 436 | Ga0207707_10005146 | 3300025912 | Bacteria | 11464 |
| 437 | Ga0207707_10071101 | 3300025912 | Bacteria | 3032 |
| 438 | Ga0207707_10265941 | 3300025912 | Bacteria | 1487 |
| 439 | Ga0207707_10446698 | 3300025912 | Bacteria | 1107 |
| 440 | Ga0207695_10000351 | 3300025913 | Bacteria | 105891 |
| 441 | Ga0207695_10000658 | 3300025913 | Bacteria | 68310 |
| 442 | Ga0207695_10021867 | 3300025913 | Bacteria | 7282 |
| 443 | Ga0207695_10029736 | 3300025913 | Bacteria | 6028 |
| 444 | Ga0207695_10031138 | 3300025913 | Bacteria | 5857 |
| 445 | Ga0207695_10036490 | 3300025913 | Bacteria | 5314 |
| 446 | Ga0207695_10043027 | 3300025913 | Bacteria | 4817 |
| 447 | Ga0207695_10052703 | 3300025913 | Bacteria | 4260 |
| 448 | Ga0207695_10065573 | 3300025913 | Bacteria | 3733 |
| 449 | Ga0207695_10077828 | 3300025913 | Bacteria | 3367 |
| 450 | Ga0207695_10098617 | 3300025913 | Bacteria | 2921 |
| 451 | Ga0207695_10223355 | 3300025913 | Bacteria | 1790 |
| 452 | Ga0207695_10298667 | 3300025913 | Bacteria | 1502 |
| 453 | Ga0207695_10349272 | 3300025913 | Bacteria | 1366 |
| 454 | Ga0207695_10411137 | 3300025913 | Bacteria | 1237 |
| 455 | Ga0207671_10000006 | 3300025914 | Bacteria | 836809 |
| 456 | Ga0207671_10002980 | 3300025914 | Bacteria | 17367 |
| 457 | Ga0207671_10003029 | 3300025914 | Bacteria | 17218 |
| 458 | Ga0207671_10005707 | 3300025914 | Bacteria | 11360 |
| 459 | Ga0207671_10008730 | 3300025914 | Bacteria | 8540 |
| 460 | Ga0207671_10010521 | 3300025914 | Bacteria | 7625 |
| 461 | Ga0207671_10011192 | 3300025914 | Bacteria | 7322 |
| 462 | Ga0207671_10019385 | 3300025914 | Bacteria | 5201 |
| 463 | Ga0207671_10029864 | 3300025914 | Bacteria | 4068 |
| 464 | Ga0207671_10129435 | 3300025914 | Bacteria | 1936 |
| 465 | Ga0207671_10160916 | 3300025914 | Bacteria | 1738 |
| 466 | Ga0207671_10191671 | 3300025914 | Bacteria | 1594 |
| 467 | Ga0207693_10003255 | 3300025915 | Bacteria | 13927 |
| 468 | Ga0207693_10015937 | 3300025915 | Bacteria | 6018 |
| 469 | Ga0207693_10203524 | 3300025915 | Bacteria | 1557 |
| 470 | Ga0207663_10018868 | 3300025916 | Unclassified | 3874 |
| 471 | Ga0207663_10025308 | 3300025916 | Bacteria | 3429 |
| 472 | Ga0207663_10314646 | 3300025916 | Bacteria | 1174 |
| 473 | Ga0207660_10000011 | 3300025917 | Bacteria | 89179 |
| 474 | Ga0207660_10002156 | 3300025917 | Bacteria | 13062 |
| 475 | Ga0207660_10027486 | 3300025917 | Bacteria | 3883 |
| 476 | Ga0207660_10047295 | 3300025917 | Bacteria | 3041 |
| 477 | Ga0207662_10032738 | 3300025918 | Bacteria | 3027 |
| 478 | Ga0207657_10010910 | 3300025919 | Bacteria | 9042 |
| 479 | Ga0207657_10034733 | 3300025919 | Bacteria | 4530 |
| 480 | Ga0207657_10048579 | 3300025919 | Bacteria | 3704 |
| 481 | Ga0207649_10115458 | 3300025920 | Bacteria | 1801 |
| 482 | Ga0207652_10004418 | 3300025921 | Bacteria | 11456 |
| 483 | Ga0207652_10040702 | 3300025921 | Bacteria | 3947 |
| 484 | Ga0207652_10043526 | 3300025921 | Bacteria | 3823 |
| 485 | Ga0207652_10192895 | 3300025921 | Bacteria | 1832 |
| 486 | Ga0207652_10264368 | 3300025921 | Bacteria | 1552 |
| 487 | Ga0207652_10299426 | 3300025921 | Bacteria | 1452 |
| 488 | Ga0207652_10514051 | 3300025921 | Bacteria | 1078 |
| 489 | Ga0207646_10000811 | 3300025922 | Bacteria | 40685 |
| 490 | Ga0207694_10000434 | 3300025924 | Bacteria | 38832 |
| 491 | Ga0207694_10016698 | 3300025924 | Bacteria | 5548 |
| 492 | Ga0207694_10033670 | 3300025924 | Bacteria | 3925 |
| 493 | Ga0207694_10072774 | 3300025924 | Bacteria | 2688 |
| 494 | Ga0207694_10114827 | 3300025924 | Bacteria | 2145 |
| 495 | Ga0207650_10000976 | 3300025925 | Bacteria | 21527 |
| 496 | Ga0207659_10235727 | 3300025926 | Bacteria | 1478 |
| 497 | Ga0207659_10467900 | 3300025926 | Unclassified | 1064 |
| 498 | Ga0207700_10000907 | 3300025928 | Bacteria | 16997 |
| 499 | Ga0207700_10001252 | 3300025928 | Bacteria | 14454 |
| 500 | Ga0207700_10102797 | 3300025928 | Bacteria | 2283 |
| 501 | Ga0207700_10105783 | 3300025928 | Unclassified | 2254 |
| 502 | Ga0207700_10117371 | 3300025928 | Bacteria | 2152 |
| 503 | Ga0207664_10023773 | 3300025929 | Bacteria | 4597 |
| 504 | Ga0207664_10035319 | 3300025929 | Bacteria | 3856 |
| 505 | Ga0207664_10065613 | 3300025929 | Unclassified | 2907 |
| 506 | Ga0207664_10107542 | 3300025929 | Bacteria | 2314 |
| 507 | Ga0207664_10124260 | 3300025929 | Bacteria | 2164 |
| 508 | Ga0207664_10209267 | 3300025929 | Bacteria | 1687 |
| 509 | Ga0207664_10503296 | 3300025929 | Bacteria | 1085 |
| 510 | Ga0207664_10585085 | 3300025929 | Bacteria | 1002 |
| 511 | Ga0207644_10024997 | 3300025931 | Bacteria | 4103 |
| 512 | Ga0207644_10105521 | 3300025931 | Unclassified | 2123 |
| 513 | Ga0207690_10001885 | 3300025932 | Bacteria | 12869 |
| 514 | Ga0207690_10006251 | 3300025932 | Bacteria | 7053 |
| 515 | Ga0207706_10001858 | 3300025933 | Bacteria | 20682 |
| 516 | Ga0207704_10000169 | 3300025938 | Bacteria | 34738 |
| 517 | Ga0207704_10013811 | 3300025938 | Bacteria | 4057 |
| 518 | Ga0207665_10003917 | 3300025939 | Bacteria | 9965 |
| 519 | Ga0207665_10085746 | 3300025939 | Unclassified | 2175 |
| 520 | Ga0207665_10096809 | 3300025939 | Bacteria | 2053 |
| 521 | Ga0207665_10148690 | 3300025939 | Bacteria | 1676 |
| 522 | Ga0207711_10273095 | 3300025941 | Bacteria | 1556 |
| 523 | Ga0207689_10066546 | 3300025942 | Bacteria | 2962 |
| 524 | Ga0207661_10044284 | 3300025944 | Bacteria | 3517 |
| 525 | Ga0207661_10244393 | 3300025944 | Bacteria | 1593 |
| 526 | Ga0207679_10005041 | 3300025945 | Bacteria | 8255 |
| 527 | Ga0207667_10000023 | 3300025949 | Bacteria | 362527 |
| 528 | Ga0207667_10000591 | 3300025949 | Bacteria | 47010 |
| 529 | Ga0207667_10003075 | 3300025949 | Bacteria | 20688 |
| 530 | Ga0207667_10006360 | 3300025949 | Bacteria | 14316 |
| 531 | Ga0207667_10020179 | 3300025949 | Bacteria | 7418 |
| 532 | Ga0207667_10037903 | 3300025949 | Bacteria | 5151 |
| 533 | Ga0207667_10067382 | 3300025949 | Bacteria | 3729 |
| 534 | Ga0207667_10085121 | 3300025949 | Bacteria | 3273 |
| 535 | Ga0207667_10087393 | 3300025949 | Bacteria | 3225 |
| 536 | Ga0207667_10329862 | 3300025949 | Bacteria | 1558 |
| 537 | Ga0207651_10011591 | 3300025960 | Unclassified | 4943 |
| 538 | Ga0207651_10034259 | 3300025960 | Bacteria | 3286 |
| 539 | Ga0207640_10010314 | 3300025981 | Bacteria | 5259 |
| 540 | Ga0207640_10030346 | 3300025981 | Bacteria | 3328 |
| 541 | Ga0207677_10005304 | 3300026023 | Bacteria | 6987 |
| 542 | Ga0207677_10009929 | 3300026023 | Bacteria | 5367 |
| 543 | Ga0207677_10127799 | 3300026023 | Bacteria | 1924 |
| 544 | Ga0207703_10014595 | 3300026035 | Bacteria | 6129 |
| 545 | Ga0207703_10070450 | 3300026035 | Bacteria | 2886 |
| 546 | Ga0207639_10003935 | 3300026041 | Bacteria | 10028 |
| 547 | Ga0207639_10022983 | 3300026041 | Bacteria | 4496 |
| 548 | Ga0207639_10023165 | 3300026041 | Bacteria | 4481 |
| 549 | Ga0207639_10045199 | 3300026041 | Bacteria | 3316 |
| 550 | Ga0207639_10156581 | 3300026041 | Unclassified | 1914 |
| 551 | Ga0207702_10000114 | 3300026078 | Bacteria | 93951 |
| 552 | Ga0207702_10000314 | 3300026078 | Bacteria | 55437 |
| 553 | Ga0207702_10001495 | 3300026078 | Bacteria | 23103 |
| 554 | Ga0207702_10005292 | 3300026078 | Bacteria | 11321 |
| 555 | Ga0207702_10012932 | 3300026078 | Bacteria | 6944 |
| 556 | Ga0207702_10016448 | 3300026078 | Bacteria | 6123 |
| 557 | Ga0207702_10016626 | 3300026078 | Bacteria | 6087 |
| 558 | Ga0207702_10024484 | 3300026078 | Bacteria | 5010 |
| 559 | Ga0207702_10025937 | 3300026078 | Unclassified | 4866 |
| 560 | Ga0207702_10061438 | 3300026078 | Bacteria | 3205 |
| 561 | Ga0207702_10165243 | 3300026078 | Bacteria | 2024 |
| 562 | Ga0207702_10224419 | 3300026078 | Bacteria | 1752 |
| 563 | Ga0207702_10328041 | 3300026078 | Unclassified | 1459 |
| 564 | Ga0207702_10502683 | 3300026078 | Bacteria | 1182 |
| 565 | Ga0207641_10006671 | 3300026088 | Bacteria | 9691 |
| 566 | Ga0207648_10000220 | 3300026089 | Bacteria | 61703 |
| 567 | Ga0207676_10004134 | 3300026095 | Bacteria | 10249 |
| 568 | Ga0207676_10043265 | 3300026095 | Bacteria | 3467 |
| 569 | Ga0207674_10000860 | 3300026116 | Bacteria | 39670 |
| 570 | Ga0207674_10001389 | 3300026116 | Bacteria | 31181 |
| 571 | Ga0207674_10038061 | 3300026116 | Bacteria | 4998 |
| 572 | Ga0207683_10154701 | 3300026121 | Bacteria | 2071 |
| 573 | Ga0207683_10319826 | 3300026121 | Bacteria | 1421 |
| 574 | Ga0207698_10015037 | 3300026142 | Bacteria | 5169 |
| 575 | Ga0207698_10390424 | 3300026142 | Bacteria | 1327 |
| 576 | Ga0207698_10617627 | 3300026142 | Bacteria | 1070 |
| 577 | Ga0209588_1000819 | 3300027671 | Archaea | 7911 |
| 578 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 579 | Ga0268266_10000080 | 3300028379 | Bacteria | 210179 |
| 580 | Ga0268266_10009865 | 3300028379 | Bacteria | 8392 |
| 581 | Ga0268266_10013247 | 3300028379 | Bacteria | 7108 |
| 582 | Ga0268266_10351917 | 3300028379 | Bacteria | 1384 |
| 583 | Ga0268264_10013176 | 3300028381 | Bacteria | 6802 |
| 584 | Ga0268264_10550300 | 3300028381 | Bacteria | 1132 |
| 585 | Ga0265323_10010027 | 3300028653 | Bacteria | 3850 |
| 586 | Ga0265322_10027480 | 3300028654 | Bacteria | 1626 |
| 587 | Ga0265336_10014006 | 3300028666 | Bacteria | 2664 |
| 588 | Ga0307517_10000429 | 3300028786 | Bacteria | 72171 |
| 589 | Ga0307515_10007084 | 3300028794 | Bacteria | 22272 |
| 590 | Ga0265338_10001594 | 3300028800 | Bacteria | 36404 |
| 591 | Ga0265338_10012507 | 3300028800 | Bacteria | 9671 |
| 592 | Ga0265338_10020888 | 3300028800 | Bacteria | 6858 |
| 593 | Ga0265338_10080732 | 3300028800 | Bacteria | 2731 |
| 594 | Ga0316181_1278947 | 3300030744 | Bacteria | 3255 |
| 595 | Ga0265330_10000211 | 3300031235 | Bacteria | 45210 |
| 596 | Ga0265330_10002022 | 3300031235 | Bacteria | 11253 |
| 597 | Ga0265330_10004610 | 3300031235 | Bacteria | 6968 |
| 598 | Ga0265332_10013606 | 3300031238 | Bacteria | 3604 |
| 599 | Ga0265332_10020645 | 3300031238 | Bacteria | 2908 |
| 600 | Ga0265328_10001124 | 3300031239 | Bacteria | 12350 |
| 601 | Ga0265320_10030709 | 3300031240 | Bacteria | 2767 |
| 602 | Ga0265325_10000434 | 3300031241 | Bacteria | 30035 |
| 603 | Ga0265325_10175223 | 3300031241 | Bacteria | 1002 |
| 604 | Ga0265340_10003970 | 3300031247 | Bacteria | 8320 |
| 605 | Ga0265339_10000332 | 3300031249 | Bacteria | 38100 |
| 606 | Ga0265339_10002485 | 3300031249 | Bacteria | 13174 |
| 607 | Ga0265331_10024057 | 3300031250 | Bacteria | 3087 |
| 608 | Ga0265331_10029604 | 3300031250 | Unclassified | 2731 |
| 609 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 610 | Ga0265327_10006320 | 3300031251 | Bacteria | 9517 |
| 611 | Ga0265316_10001755 | 3300031344 | Bacteria | 22947 |
| 612 | Ga0265316_10003740 | 3300031344 | Bacteria | 15289 |
| 613 | Ga0265316_10023161 | 3300031344 | Bacteria | 5221 |
| 614 | Ga0265316_10048954 | 3300031344 | Bacteria | 3332 |
| 615 | Ga0307408_100168601 | 3300031548 | Bacteria | 1746 |
| 616 | Ga0265313_10002928 | 3300031595 | Bacteria | 14255 |
| 617 | Ga0316575_10006715 | 3300031665 | Bacteria | 4154 |
| 618 | Ga0265314_10000033 | 3300031711 | Bacteria | 254594 |
| 619 | Ga0265314_10018302 | 3300031711 | Bacteria | 5465 |
| 620 | Ga0265342_10000652 | 3300031712 | Bacteria | 36426 |
| 621 | Ga0265342_10001277 | 3300031712 | Bacteria | 23694 |
| 622 | Ga0265342_10145761 | 3300031712 | Bacteria | 1318 |
| 623 | Ga0316578_10261077 | 3300031728 | Bacteria | 1038 |
| 624 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 625 | Ga0307405_10160332 | 3300031731 | Bacteria | 1592 |
| 626 | Ga0307407_10000003 | 3300031903 | Bacteria | 271723 |
| 627 | Ga0307412_10000085 | 3300031911 | Bacteria | 88692 |
| 628 | Ga0307409_100110604 | 3300031995 | Bacteria | 2303 |
| 629 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 630 | Ga0307414_10003085 | 3300032004 | Bacteria | 8845 |
| 631 | Ga0307414_10019434 | 3300032004 | Bacteria | 4210 |
| 632 | Ga0307414_10113594 | 3300032004 | Bacteria | 2067 |
| 633 | Ga0307414_10114369 | 3300032004 | Bacteria | 2061 |
| 634 | Ga0307411_10196946 | 3300032005 | Bacteria | 1544 |
| 635 | Ga0307411_10203152 | 3300032005 | Bacteria | 1524 |
| 636 | Ga0307510_10010589 | 3300033180 | Bacteria | 10959 |
| 637 | Ga0373926_0002982 | 3300035083 | Bacteria | 5413 |
| 638 | Ga0373944_0126136 | 3300035089 | Bacteria | 886 |
| 639 | Ga0373936_0013931 | 3300035113 | Unclassified | 3071 |
| 640 | Ga0373931_0064983 | 3300035691 | Bacteria | 1976 |
| 641 | Ga0373935_0088494 | 3300035692 | Bacteria | 2023 |
| 642 | Ga0373935_0297461 | 3300035692 | Bacteria | 1140 |
| 643 | Ga0373927_0019991 | 3300035695 | Bacteria | 4392 |
| 644 | Ga0373927_0026827 | 3300035695 | Unclassified | 3764 |
| 645 | Ga0373927_0170953 | 3300035695 | Unclassified | 1425 |
| 646 | Ga0373933_0009618 | 3300035724 | Bacteria | 5280 |
| 647 | Ga0373937_0000015 | 3300036401 | Bacteria | 148228 |
| 648 | Ga0373937_0007694 | 3300036401 | Bacteria | 9341 |
| 649 | Ga0373937_0023028 | 3300036401 | Bacteria | 5603 |
| 650 | Ga0373937_0051436 | 3300036401 | Unclassified | 3776 |
| 651 | Ga0373937_0143389 | 3300036401 | Bacteria | 2235 |
| 652 | Ga0373937_0767420 | 3300036401 | Bacteria | 912 |
| 653 | Ga0316582_0054575 | 3300036647 | Bacteria | 2544 |
| 654 | Ga0373925_0036081 | 3300037068 | Bacteria | 3650 |
| 655 | Ga0373925_0049103 | 3300037068 | Unclassified | 3145 |
| 656 | Ga0373925_0143266 | 3300037068 | Bacteria | 1872 |
| 657 | Ga0373925_0145680 | 3300037068 | Unclassified | 1857 |
| 658 | Ga0395899_0087037 | 3300037312 | Bacteria | 2268 |
| 659 | Ga0395899_0165520 | 3300037312 | Bacteria | 1560 |
| 660 | Ga0395900_0000194 | 3300037418 | Bacteria | 97768 |
| 661 | Ga0395900_0045441 | 3300037418 | Bacteria | 4524 |
| 662 | Ga0395900_0166981 | 3300037418 | Bacteria | 2242 |
| 663 | Ga0395898_0043670 | 3300037466 | Bacteria | 4416 |
| 664 | Ga0395898_0190280 | 3300037466 | Bacteria | 1961 |
| 665 | Ga0395905_0000355 | 3300037471 | Bacteria | 65176 |
| 666 | Ga0395905_0011403 | 3300037471 | Bacteria | 8590 |
| 667 | Ga0436364_0758800 | 3300037853 | Unclassified | 3645 |
| 668 | Ga0436364_0794765 | 3300037853 | Bacteria | 162685 |
| 669 | Ga0436364_1004357 | 3300037853 | Bacteria | 2375 |
| 670 | Ga0436364_1359397 | 3300037853 | Bacteria | 1374 |
| 671 | Ga0436364_1378358 | 3300037853 | Bacteria | 3166 |
| 672 | Ga0395901_0026672 | 3300038443 | Bacteria | 5933 |
| 673 | Ga0395901_0041615 | 3300038443 | Bacteria | 4763 |
| 674 | Ga0395901_0072785 | 3300038443 | Bacteria | 3583 |
| 675 | Ga0436365_0329451 | 3300039437 | Bacteria | 1532 |
| 676 | Ga0436365_0361465 | 3300039437 | Bacteria | 3987 |
| 677 | Ga0436365_0575734 | 3300039437 | Bacteria | 2433 |
| 678 | Ga0436365_1082274 | 3300039437 | Bacteria | 9710 |
| 679 | Ga0436360_0295097 | 3300039438 | Unclassified | 4074 |
| 680 | Ga0436360_0418629 | 3300039438 | Bacteria | 1300 |
| 681 | Ga0436361_0972882 | 3300039447 | Bacteria | 108107 |
| 682 | Ga0436361_1206081 | 3300039447 | Bacteria | 5519 |
| 683 | Ga0436363_0008358 | 3300039450 | Unclassified | 2048 |
| 684 | Ga0436363_0179094 | 3300039450 | Unclassified | 1922 |
| 685 | Ga0436363_0640237 | 3300039450 | Bacteria | 3368 |
| 686 | Ga0436362_0347231 | 3300039453 | Bacteria | 7679 |
| 687 | Ga0436362_0815299 | 3300039453 | Bacteria | 1916 |
| 688 | Ga0439448_0085186 | 3300042005 | Bacteria | 1064 |
| 689 | Ga0451577_0640125 | 3300042876 | Bacteria | 964 |
| 690 | Ga0466972_0000014 | 3300044658 | Bacteria | 216776 |
| 691 | Ga0466972_0000046 | 3300044658 | Bacteria | 127926 |
| 692 | Ga0466972_0000161 | 3300044658 | Bacteria | 53994 |
| 693 | Ga0466966_0230552 | 3300044684 | Unclassified | 1117 |
| 694 | Ga0466963_0047410 | 3300044694 | Bacteria | 2836 |
| 695 | Ga0453684_0011973 | 3300044712 | Bacteria | 14427 |
| 696 | Ga0453684_0123537 | 3300044712 | Bacteria | 3121 |
| 697 | Ga0466968_0079527 | 3300044735 | Unclassified | 1438 |
| 698 | Ga0466970_0000352 | 3300044765 | Bacteria | 22307 |
| 699 | Ga0466957_0008786 | 3300044842 | Bacteria | 5751 |
| 700 | Ga0466957_0060811 | 3300044842 | Bacteria | 2317 |
| 701 | Ga0466959_0055372 | 3300045049 | Bacteria | 2896 |
| 702 | Ga0466959_0205939 | 3300045049 | Bacteria | 1368 |
| 703 | Ga0466959_0353321 | 3300045049 | Bacteria | 1002 |
| 704 | Ga0466958_0188315 | 3300045836 | Unclassified | 1311 |
| 705 | Ga0466967_0020964 | 3300045976 | Bacteria | 5294 |
| 706 | Ga0466967_0031129 | 3300045976 | Bacteria | 4488 |
| 707 | Ga0466967_0120329 | 3300045976 | Bacteria | 2425 |
| 708 | Ga0466967_0381303 | 3300045976 | Bacteria | 1369 |
| 709 | Ga0466967_0571572 | 3300045976 | Bacteria | 1114 |
| 710 | Ga0495592_0057917 | 3300046454 | Bacteria | 2859 |
| 711 | Ga0495592_0144847 | 3300046454 | Bacteria | 1648 |
| 712 | Ga0495651_0003054 | 3300046462 | Bacteria | 12917 |
| 713 | Ga0495651_0005817 | 3300046462 | Bacteria | 9410 |
| 714 | Ga0495651_0202069 | 3300046462 | Bacteria | 1390 |
| 715 | Ga0495653_0084625 | 3300046463 | Bacteria | 2335 |
| 716 | Ga0495653_0147935 | 3300046463 | Bacteria | 1644 |
| 717 | Ga0495650_0008037 | 3300046471 | Bacteria | 6229 |
| 718 | Ga0495580_0000448 | 3300046472 | Bacteria | 34094 |
| 719 | Ga0495580_0004308 | 3300046472 | Bacteria | 11967 |
| 720 | Ga0495580_0005048 | 3300046472 | Bacteria | 10999 |
| 721 | Ga0495580_0027876 | 3300046472 | Bacteria | 4108 |
| 722 | Ga0495580_0033221 | 3300046472 | Bacteria | 3718 |
| 723 | Ga0495582_0011265 | 3300046473 | Bacteria | 4927 |
| 724 | Ga0495582_0064851 | 3300046473 | Bacteria | 2017 |
| 725 | Ga0495639_0047864 | 3300046475 | Bacteria | 1938 |
| 726 | Ga0495662_0024394 | 3300046476 | Bacteria | 2918 |
| 727 | Ga0495662_0051091 | 3300046476 | Bacteria | 1996 |
| 728 | Ga0495662_0107767 | 3300046476 | Bacteria | 1364 |
| 729 | Ga0495662_0134869 | 3300046476 | Bacteria | 1214 |
| 730 | Ga0495664_0001480 | 3300046477 | Bacteria | 12431 |
| 731 | Ga0495664_0009264 | 3300046477 | Bacteria | 5505 |
| 732 | Ga0495664_0020526 | 3300046477 | Bacteria | 3810 |
| 733 | Ga0495594_0029926 | 3300046499 | Bacteria | 2944 |
| 734 | Ga0495594_0032837 | 3300046499 | Bacteria | 2819 |
| 735 | Ga0495596_0015176 | 3300046500 | Bacteria | 3233 |
| 736 | Ga0495606_0009521 | 3300046507 | Bacteria | 8207 |
| 737 | Ga0495606_0105165 | 3300046507 | Bacteria | 1711 |
| 738 | Ga0495610_0000148 | 3300046512 | Bacteria | 77303 |
| 739 | Ga0495610_0002626 | 3300046512 | Bacteria | 14866 |
| 740 | Ga0495610_0010777 | 3300046512 | Bacteria | 5650 |
| 741 | Ga0495618_0019647 | 3300046514 | Bacteria | 4157 |
| 742 | Ga0495628_0020615 | 3300046516 | Bacteria | 5434 |
| 743 | Ga0495630_0006608 | 3300046517 | Bacteria | 8264 |
| 744 | Ga0495630_0025857 | 3300046517 | Bacteria | 4343 |
| 745 | Ga0495630_0264441 | 3300046517 | Bacteria | 1314 |
| 746 | Ga0495666_0002651 | 3300046526 | Bacteria | 8915 |
| 747 | Ga0495652_0189312 | 3300046529 | Bacteria | 1572 |
| 748 | Ga0495652_0224141 | 3300046529 | Bacteria | 1411 |
| 749 | Ga0495652_0268578 | 3300046529 | Unclassified | 1255 |
| 750 | Ga0495665_0000411 | 3300046531 | Bacteria | 21896 |
| 751 | Ga0495665_0146046 | 3300046531 | Bacteria | 1235 |
| 752 | Ga0495640_0123142 | 3300046533 | Bacteria | 1683 |
| 753 | Ga0495586_0004070 | 3300046535 | Bacteria | 7833 |
| 754 | Ga0495586_0052124 | 3300046535 | Unclassified | 2215 |
| 755 | Ga0495587_0000219 | 3300046536 | Bacteria | 42459 |
| 756 | Ga0495587_0091428 | 3300046536 | Bacteria | 1758 |
| 757 | Ga0495587_0134044 | 3300046536 | Bacteria | 1415 |
| 758 | Ga0495645_0003642 | 3300046543 | Bacteria | 10463 |
| 759 | Ga0495645_0024026 | 3300046543 | Unclassified | 4418 |
| 760 | Ga0495645_0027986 | 3300046543 | Bacteria | 4094 |
| 761 | Ga0495633_0000450 | 3300046558 | Bacteria | 42356 |
| 762 | Ga0495667_0110978 | 3300046559 | Bacteria | 1772 |
| 763 | Ga0495634_0001890 | 3300046642 | Bacteria | 17969 |
| 764 | Ga0495634_0304783 | 3300046642 | Unclassified | 962 |
| 765 | Ga0495625_0000422 | 3300046660 | Bacteria | 63660 |
| 766 | Ga0495625_0253441 | 3300046660 | Bacteria | 1142 |
| 767 | Ga0495661_0001078 | 3300046665 | Bacteria | 24017 |
| 768 | Ga0495661_0139149 | 3300046665 | Bacteria | 1322 |
| 769 | Ga0495599_0002460 | 3300046678 | Bacteria | 10791 |
| 770 | Ga0495599_0008956 | 3300046678 | Bacteria | 6096 |
| 771 | Ga0495623_0172534 | 3300046679 | Bacteria | 1262 |
| 772 | Ga0495646_0118958 | 3300046680 | Bacteria | 1496 |
| 773 | Ga0495647_0003772 | 3300046681 | Bacteria | 4874 |
| 774 | Ga0495658_0056164 | 3300046683 | Bacteria | 2244 |
| 775 | Ga0495613_0129033 | 3300046689 | Bacteria | 1811 |
| 776 | Ga0495624_0078000 | 3300046690 | Bacteria | 2055 |
| 777 | Ga0495600_0040352 | 3300046809 | Bacteria | 3039 |
| 778 | Ga0495600_0071975 | 3300046809 | Bacteria | 2259 |
| 779 | Ga0495581_0139149 | 3300047315 | Bacteria | 1416 |
| 780 | Ga0495604_0069067 | 3300047317 | Bacteria | 2679 |
| 781 | Ga0495604_0144436 | 3300047317 | Bacteria | 1697 |
| 782 | Ga0495636_0005843 | 3300047318 | Bacteria | 4826 |
| 783 | Ga0495674_0011132 | 3300047319 | Bacteria | 8493 |
| 784 | Ga0495674_0042378 | 3300047319 | Bacteria | 4060 |
| 785 | Ga0495674_0121542 | 3300047319 | Unclassified | 2206 |
| 786 | Ga0495672_0001992 | 3300047320 | Bacteria | 19304 |
| 787 | Ga0495680_0031119 | 3300047322 | Unclassified | 4348 |
| 788 | Ga0495680_0035849 | 3300047322 | Bacteria | 3989 |
| 789 | Ga0495687_005321 | 3300047443 | Bacteria | 8250 |
| 790 | Ga0495675_0196993 | 3300047444 | Unclassified | 1227 |
| 791 | Ga0495684_0107340 | 3300047471 | Bacteria | 2109 |
| 792 | Ga0495684_0260943 | 3300047471 | Bacteria | 1257 |
| 793 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 794 | Ga0495686_0002322 | 3300047472 | Bacteria | 18183 |
| 795 | Ga0495602_0000206 | 3300048088 | Bacteria | 54913 |
| 796 | Ga0495614_0083190 | 3300048089 | Bacteria | 1388 |
| 797 | Ga0496104_0202029 | 3300048907 | Bacteria | 1899 |
| 798 | Ga0496104_0357896 | 3300048907 | Unclassified | 1372 |
| 799 | Ga0496109_0148287 | 3300048912 | Bacteria | 2196 |
| 800 | Ga0496111_0092078 | 3300048914 | Bacteria | 2222 |
| 801 | Ga0496112_0052403 | 3300048915 | Bacteria | 4004 |
| 802 | Ga0496112_0177991 | 3300048915 | Bacteria | 2091 |
| 803 | Ga0496112_0313270 | 3300048915 | Unclassified | 1514 |
| 804 | Ga0496115_0006011 | 3300048918 | Bacteria | 8860 |
| 805 | Ga0496115_0230613 | 3300048918 | Unclassified | 1527 |
| 806 | Ga0496115_0319038 | 3300048918 | Bacteria | 1271 |
| 807 | Ga0496116_0137698 | 3300048919 | Unclassified | 1379 |
| 808 | Ga0496119_0132154 | 3300048922 | Bacteria | 1359 |
| 809 | Ga0496120_0008902 | 3300048923 | Bacteria | 7191 |
| 810 | Ga0496122_0000862 | 3300048925 | Bacteria | 57049 |
| 811 | Ga0496123_0108966 | 3300048926 | Bacteria | 1588 |
| 812 | Ga0496126_0000010 | 3300048929 | Bacteria | 744888 |
| 813 | Ga0496126_0000095 | 3300048929 | Bacteria | 207654 |
| 814 | Ga0496126_0007453 | 3300048929 | Bacteria | 11995 |
| 815 | Ga0496126_0089293 | 3300048929 | Bacteria | 2713 |
| 816 | Ga0501034_0006905 | 3300049571 | Bacteria | 12134 |
| 817 | Ga0501034_0067604 | 3300049571 | Bacteria | 3585 |
| 818 | Ga0501034_0105743 | 3300049571 | Bacteria | 2807 |
| 819 | Ga0501034_0201625 | 3300049571 | Bacteria | 1947 |
| 820 | Ga0501036_0074592 | 3300049572 | Bacteria | 2869 |
| 821 | Ga0501036_0236528 | 3300049572 | Bacteria | 1532 |
| 822 | Ga0501036_0245675 | 3300049572 | Bacteria | 1500 |
| 823 | Ga0501038_0011540 | 3300049574 | Bacteria | 8061 |
| 824 | Ga0501038_0305870 | 3300049574 | Bacteria | 1247 |
| 825 | Ga0501043_0033647 | 3300049579 | Bacteria | 4033 |
| 826 | Ga0501046_0004542 | 3300049580 | Bacteria | 12576 |
| 827 | Ga0501046_0121675 | 3300049580 | Bacteria | 1985 |
| 828 | Ga0501047_0028521 | 3300049581 | Bacteria | 5383 |
| 829 | Ga0501047_0106013 | 3300049581 | Bacteria | 2691 |
| 830 | Ga0501047_0129888 | 3300049581 | Bacteria | 2400 |
| 831 | Ga0501047_0225042 | 3300049581 | Bacteria | 1731 |
| 832 | Ga0501047_0250826 | 3300049581 | Bacteria | 1618 |
| 833 | Ga0501048_0108718 | 3300049582 | Unclassified | 1958 |
| 834 | Ga0501048_0199826 | 3300049582 | Bacteria | 1417 |
| 835 | Ga0501067_0007388 | 3300049583 | Bacteria | 6104 |
| 836 | Ga0501067_0007917 | 3300049583 | Bacteria | 5902 |
| 837 | Ga0501069_0008779 | 3300049585 | Bacteria | 5323 |
| 838 | Ga0501069_0065956 | 3300049585 | Bacteria | 2024 |
| 839 | Ga0501070_0026759 | 3300049586 | Bacteria | 4838 |
| 840 | Ga0501070_0122095 | 3300049586 | Bacteria | 2153 |
| 841 | Ga0501071_0052002 | 3300049587 | Bacteria | 2953 |
| 842 | Ga0501073_0152849 | 3300049589 | Bacteria | 1599 |
| 843 | Ga0501073_0221250 | 3300049589 | Bacteria | 1308 |
| 844 | Ga0501074_0030373 | 3300049590 | Bacteria | 3915 |
| 845 | Ga0501074_0044544 | 3300049590 | Bacteria | 3212 |
| 846 | Ga0501076_0027756 | 3300049592 | Bacteria | 4390 |
| 847 | Ga0501076_0502669 | 3300049592 | Bacteria | 999 |
| 848 | Ga0501077_0008963 | 3300049593 | Bacteria | 6206 |
| 849 | Ga0501077_0380387 | 3300049593 | Bacteria | 902 |
| 850 | Ga0501249_015647 | 3300049679 | Bacteria | 1623 |
| 851 | Ga0501079_0523946 | 3300049741 | Archaea | 932 |
| 852 | Ga0501080_0006180 | 3300049742 | Bacteria | 10747 |
| 853 | Ga0501080_0021446 | 3300049742 | Bacteria | 5979 |
| 854 | Ga0501080_0145472 | 3300049742 | Bacteria | 2191 |
| 855 | Ga0501080_0363007 | 3300049742 | Bacteria | 1307 |
| 856 | Ga0501083_0122687 | 3300049744 | Bacteria | 1704 |
| 857 | Ga0501241_005281 | 3300049758 | Bacteria | 2412 |
| 858 | Ga0501241_006434 | 3300049758 | Bacteria | 2160 |
| 859 | Ga0501035_0027380 | 3300049822 | Bacteria | 5211 |
| 860 | Ga0501044_0011305 | 3300049823 | Bacteria | 9675 |
| 861 | Ga0501044_0121840 | 3300049823 | Bacteria | 2608 |
| 862 | Ga0501044_0245214 | 3300049823 | Bacteria | 1734 |
| 863 | Ga0501044_0328319 | 3300049823 | Bacteria | 1453 |
| 864 | nmdc:mga07m45_34980_c1 | 3300050496 | Bacteria | 2793 |
| 865 | nmdc:mga0n895_354744_c1 | 3300050512 | Unclassified | 1485 |
| 866 | nmdc:mga0rr50_1647_c1 | 3300050513 | Bacteria | 12304 |
| 867 | nmdc:mga08x19_630492_c1 | 3300050514 | Bacteria | 760 |
| 868 | Ga0495601_0075942 | 3300053077 | Bacteria | 2151 |
| 869 | Ga0500635_0004193 | 3300053080 | Bacteria | 3693 |
| 870 | Ga0500635_0005378 | 3300053080 | Bacteria | 3356 |
| 871 | Ga0500651_0000078 | 3300053093 | Bacteria | 62741 |
| 872 | Ga0500651_0140347 | 3300053093 | Unclassified | 1457 |
| 873 | Ga0500555_000116 | 3300053103 | Bacteria | 37945 |
| 874 | Ga0500562_000095 | 3300053108 | Bacteria | 35281 |
| 875 | Ga0500572_032379 | 3300053111 | Unclassified | 1467 |
| 876 | Ga0500618_000036 | 3300053125 | Bacteria | 118803 |
| 877 | Ga0500642_0011622 | 3300053130 | Bacteria | 3157 |
| 878 | Ga0500564_127236 | 3300053138 | Bacteria | 1105 |
| 879 | Ga0500590_086703 | 3300053148 | Unclassified | 1527 |
| 880 | Ga0500616_0002603 | 3300053153 | Bacteria | 14769 |
| 881 | Ga0500622_0001257 | 3300053156 | Bacteria | 20711 |
| 882 | Ga0500636_0081639 | 3300053177 | Bacteria | 1862 |
| 883 | Ga0500637_0090303 | 3300053178 | Bacteria | 1774 |
| 884 | Ga0500645_000103 | 3300053730 | Bacteria | 67414 |
| 885 | Ga0500645_004861 | 3300053730 | Bacteria | 5062 |
| 886 | Ga0500661_001496 | 3300055283 | Bacteria | 4386 |
| 887 | Ga0501082_0182300 | 3300060353 | Bacteria | 1826 |
| 888 | Ga0501082_0671366 | 3300060353 | Bacteria | 907 |
| 889 | Ga0466962_0148317 | 3300061719 | Bacteria | 1138 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031250 | Ga0265331_10024057 | Ga0265331_100240573 | 210 |
| 2 | 3300050514 | nmdc:mga08x19_630492_c1 | nmdc:mga08x19_630492_c1_52_732 | 224 |
| 3 | 3300028800 | Ga0265338_10012507 | Ga0265338_100125075 | 232 |
| 4 | 3300031235 | Ga0265330_10000211 | Ga0265330_100002116 | 232 |
| 5 | 3300031239 | Ga0265328_10001124 | Ga0265328_100011244 | 232 |
| 6 | 3300031241 | Ga0265325_10000434 | Ga0265325_100004344 | 232 |
| 7 | 3300031249 | Ga0265339_10000332 | Ga0265339_100003324 | 232 |
| 8 | 3300031344 | Ga0265316_10001755 | Ga0265316_100017556 | 232 |
| 9 | 3300031595 | Ga0265313_10002928 | Ga0265313_100029288 | 232 |
| 10 | 3300031712 | Ga0265342_10000652 | Ga0265342_100006529 | 232 |
| 11 | 3300028666 | Ga0265336_10014006 | Ga0265336_100140063 | 234 |
| 12 | 3300031238 | Ga0265332_10013606 | Ga0265332_100136065 | 234 |
| 13 | 3300031240 | Ga0265320_10030709 | Ga0265320_100307092 | 234 |
| 14 | 3300031247 | Ga0265340_10003970 | Ga0265340_100039705 | 234 |
| 15 | 3300025915 | Ga0207693_10203524 | Ga0207693_102035241 | 237 |
| 16 | 3300025928 | Ga0207700_10117371 | Ga0207700_101173713 | 239 |
| 17 | 3300005530 | Ga0070679_100261166 | Ga0070679_1002611661 | 242 |
| 18 | 3300005564 | Ga0070664_100179556 | Ga0070664_1001795562 | 242 |
| 19 | 3300005614 | Ga0068856_100226671 | Ga0068856_1002266712 | 242 |
| 20 | 3300007265 | Ga0099794_10131581 | Ga0099794_101315812 | 242 |
| 21 | 3300009174 | Ga0105241_10074887 | Ga0105241_100748873 | 242 |
| 22 | 3300013100 | Ga0157373_10040777 | Ga0157373_100407772 | 242 |
| 23 | 3300013104 | Ga0157370_10253898 | Ga0157370_102538981 | 242 |
| 24 | 3300013296 | Ga0157374_10430488 | Ga0157374_104304882 | 242 |
| 25 | 3300013307 | Ga0157372_10324072 | Ga0157372_103240722 | 242 |
| 26 | 3300025914 | Ga0207671_10191671 | Ga0207671_101916712 | 242 |
| 27 | 3300025960 | Ga0207651_10011591 | Ga0207651_100115914 | 242 |
| 28 | 3300026078 | Ga0207702_10016448 | Ga0207702_100164486 | 242 |
| 29 | 3300037068 | Ga0373925_0143266 | Ga0373925_0143266_926_1762 | 242 |
| 30 | 3300042005 | Ga0439448_0085186 | Ga0439448_0085186_162_998 | 242 |
| 31 | 3300048907 | Ga0496104_0357896 | Ga0496104_0357896_69_905 | 242 |
| 32 | 3300048915 | Ga0496112_0313270 | Ga0496112_0313270_529_1365 | 242 |
| 33 | 3300053148 | Ga0500590_086703 | Ga0500590_086703_19_753 | 242 |
| 34 | 3300005614 | Ga0068856_100074931 | Ga0068856_1000749313 | 243 |
| 35 | 3300005842 | Ga0068858_100014126 | Ga0068858_1000141265 | 244 |
| 36 | 3300005518 | Ga0070699_100438424 | Ga0070699_1004384241 | 245 |
| 37 | 3300005536 | Ga0070697_100005597 | Ga0070697_1000055977 | 245 |
| 38 | 3300028800 | Ga0265338_10080732 | Ga0265338_100807323 | 245 |
| 39 | 3300031711 | Ga0265314_10000033 | Ga0265314_1000003388 | 245 |
| 40 | 3300005445 | Ga0070708_100085950 | Ga0070708_1000859503 | 246 |
| 41 | 3300010375 | Ga0105239_10006110 | Ga0105239_1000611017 | 246 |
| 42 | 3300013104 | Ga0157370_10000173 | Ga0157370_1000017340 | 246 |
| 43 | 3300013297 | Ga0157378_10644725 | Ga0157378_106447251 | 246 |
| 44 | 3300032005 | Ga0307411_10196946 | Ga0307411_101969462 | 247 |
| 45 | 3300031728 | Ga0316578_10261077 | Ga0316578_102610771 | 248 |
| 46 | 3300047444 | Ga0495675_0196993 | Ga0495675_0196993_426_1217 | 248 |
| 47 | 3300037853 | Ga0436364_1004357 | Ga0436364_1004357_729_1565 | 249 |
| 48 | 3300046472 | Ga0495580_0000448 | Ga0495580_0000448_4351_5187 | 249 |
| 49 | 3300005366 | Ga0070659_100053736 | Ga0070659_1000537362 | 250 |
| 50 | 3300005439 | Ga0070711_100059361 | Ga0070711_1000593612 | 250 |
| 51 | 3300005563 | Ga0068855_100084338 | Ga0068855_1000843382 | 250 |
| 52 | 3300005564 | Ga0070664_100052380 | Ga0070664_1000523804 | 250 |
| 53 | 3300005614 | Ga0068856_100014557 | Ga0068856_1000145574 | 250 |
| 54 | 3300006028 | Ga0070717_10049436 | Ga0070717_100494363 | 250 |
| 55 | 3300007265 | Ga0099794_10000923 | Ga0099794_1000092312 | 250 |
| 56 | 3300009174 | Ga0105241_10335181 | Ga0105241_103351812 | 250 |
| 57 | 3300013100 | Ga0157373_10222128 | Ga0157373_102221282 | 250 |
| 58 | 3300013105 | Ga0157369_10022924 | Ga0157369_100229246 | 250 |
| 59 | 3300013307 | Ga0157372_10257431 | Ga0157372_102574311 | 250 |
| 60 | 3300014325 | Ga0163163_10059148 | Ga0163163_100591482 | 250 |
| 61 | 3300025916 | Ga0207663_10314646 | Ga0207663_103146462 | 250 |
| 62 | 3300025929 | Ga0207664_10585085 | Ga0207664_105850851 | 250 |
| 63 | 3300026078 | Ga0207702_10025937 | Ga0207702_100259374 | 250 |
| 64 | 3300027671 | Ga0209588_1000819 | Ga0209588_10008193 | 250 |
| 65 | 3300048918 | Ga0496115_0006011 | Ga0496115_0006011_7463_8293 | 250 |
| 66 | 3300025250 | Ga0209026_1004556 | Ga0209026_10045564 | 251 |
| 67 | 3300039437 | Ga0436365_0329451 | Ga0436365_0329451_233_1069 | 251 |
| 68 | 3300046689 | Ga0495613_0129033 | Ga0495613_0129033_14_775 | 251 |
| 69 | 3300047319 | Ga0495674_0121542 | Ga0495674_0121542_525_1361 | 251 |
| 70 | 3300005435 | Ga0070714_100267949 | Ga0070714_1002679492 | 253 |
| 71 | 3300010375 | Ga0105239_10004282 | Ga0105239_1000428211 | 253 |
| 72 | 3300025929 | Ga0207664_10503296 | Ga0207664_105032962 | 253 |
| 73 | 3300036401 | Ga0373937_0143389 | Ga0373937_0143389_1347_2186 | 253 |
| 74 | 3300037853 | Ga0436364_1378358 | Ga0436364_1378358_2160_3026 | 253 |
| 75 | 3300046529 | Ga0495652_0224141 | Ga0495652_0224141_315_1151 | 253 |
| 76 | 3300049580 | Ga0501046_0121675 | Ga0501046_0121675_261_1100 | 253 |
| 77 | 3300049590 | Ga0501074_0044544 | Ga0501074_0044544_1310_2149 | 253 |
| 78 | 3300049592 | Ga0501076_0502669 | Ga0501076_0502669_107_940 | 253 |
| 79 | 3300049742 | Ga0501080_0006180 | Ga0501080_0006180_9458_10297 | 253 |
| 80 | 3300060353 | Ga0501082_0182300 | Ga0501082_0182300_390_1223 | 253 |
| 81 | 3300009093 | Ga0105240_10062993 | Ga0105240_100629932 | 254 |
| 82 | 3300025913 | Ga0207695_10065573 | Ga0207695_100655732 | 254 |
| 83 | 3300044842 | Ga0466957_0008786 | Ga0466957_0008786_219_1055 | 254 |
| 84 | 3300049572 | Ga0501036_0245675 | Ga0501036_0245675_193_1026 | 254 |
| 85 | 3300049581 | Ga0501047_0129888 | Ga0501047_0129888_269_1102 | 254 |
| 86 | 3300049583 | Ga0501067_0007917 | Ga0501067_0007917_840_1673 | 254 |
| 87 | 3300049585 | Ga0501069_0008779 | Ga0501069_0008779_1554_2387 | 254 |
| 88 | 3300049585 | Ga0501069_0065956 | Ga0501069_0065956_870_1703 | 254 |
| 89 | 3300049586 | Ga0501070_0026759 | Ga0501070_0026759_2418_3251 | 254 |
| 90 | 3300049587 | Ga0501071_0052002 | Ga0501071_0052002_1927_2760 | 254 |
| 91 | 3300049589 | Ga0501073_0152849 | Ga0501073_0152849_389_1222 | 254 |
| 92 | 3300049590 | Ga0501074_0030373 | Ga0501074_0030373_274_1107 | 254 |
| 93 | 3300049592 | Ga0501076_0027756 | Ga0501076_0027756_2781_3614 | 254 |
| 94 | 3300049742 | Ga0501080_0021446 | Ga0501080_0021446_4149_4982 | 254 |
| 95 | 3300005354 | Ga0070675_100102479 | Ga0070675_1001024792 | 255 |
| 96 | 3300005437 | Ga0070710_10007071 | Ga0070710_100070712 | 255 |
| 97 | 3300005614 | Ga0068856_100406242 | Ga0068856_1004062422 | 255 |
| 98 | 3300005937 | Ga0081455_10013928 | Ga0081455_100139289 | 255 |
| 99 | 3300010375 | Ga0105239_10728387 | Ga0105239_107283872 | 255 |
| 100 | 3300013296 | Ga0157374_10021199 | Ga0157374_100211996 | 255 |
| 101 | 3300021358 | Ga0213873_10020392 | Ga0213873_100203921 | 255 |
| 102 | 3300025898 | Ga0207692_10004695 | Ga0207692_100046955 | 255 |
| 103 | 3300025926 | Ga0207659_10235727 | Ga0207659_102357271 | 255 |
| 104 | 3300026078 | Ga0207702_10328041 | Ga0207702_103280411 | 255 |
| 105 | 3300039453 | Ga0436362_0815299 | Ga0436362_0815299_485_1321 | 255 |
| 106 | 3300044735 | Ga0466968_0079527 | Ga0466968_0079527_35_871 | 255 |
| 107 | 3300048915 | Ga0496112_0177991 | Ga0496112_0177991_993_1823 | 255 |
| 108 | 3300005327 | Ga0070658_10466577 | Ga0070658_104665771 | 256 |
| 109 | 3300005329 | Ga0070683_100336686 | Ga0070683_1003366862 | 256 |
| 110 | 3300005338 | Ga0068868_100029959 | Ga0068868_1000299593 | 256 |
| 111 | 3300005440 | Ga0070705_100065277 | Ga0070705_1000652772 | 256 |
| 112 | 3300005458 | Ga0070681_10501598 | Ga0070681_105015981 | 256 |
| 113 | 3300005530 | Ga0070679_100034515 | Ga0070679_1000345155 | 256 |
| 114 | 3300005530 | Ga0070679_100225608 | Ga0070679_1002256082 | 256 |
| 115 | 3300005563 | Ga0068855_100001626 | Ga0068855_1000016269 | 256 |
| 116 | 3300005578 | Ga0068854_100403486 | Ga0068854_1004034861 | 256 |
| 117 | 3300005614 | Ga0068856_100000407 | Ga0068856_10000040729 | 256 |
| 118 | 3300005618 | Ga0068864_100055045 | Ga0068864_1000550454 | 256 |
| 119 | 3300005841 | Ga0068863_100024417 | Ga0068863_1000244174 | 256 |
| 120 | 3300005843 | Ga0068860_100391785 | Ga0068860_1003917852 | 256 |
| 121 | 3300006028 | Ga0070717_10129472 | Ga0070717_101294722 | 256 |
| 122 | 3300006237 | Ga0097621_100000237 | Ga0097621_10000023730 | 256 |
| 123 | 3300006358 | Ga0068871_100002121 | Ga0068871_1000021216 | 256 |
| 124 | 3300006881 | Ga0068865_100040696 | Ga0068865_1000406963 | 256 |
| 125 | 3300009093 | Ga0105240_10000558 | Ga0105240_1000055816 | 256 |
| 126 | 3300009177 | Ga0105248_10003155 | Ga0105248_1000315516 | 256 |
| 127 | 3300010375 | Ga0105239_10026773 | Ga0105239_100267733 | 256 |
| 128 | 3300013104 | Ga0157370_10027543 | Ga0157370_100275438 | 256 |
| 129 | 3300013296 | Ga0157374_10000667 | Ga0157374_1000066714 | 256 |
| 130 | 3300013297 | Ga0157378_10000320 | Ga0157378_1000032029 | 256 |
| 131 | 3300013307 | Ga0157372_10001112 | Ga0157372_1000111217 | 256 |
| 132 | 3300013307 | Ga0157372_10028068 | Ga0157372_100280684 | 256 |
| 133 | 3300014969 | Ga0157376_10020473 | Ga0157376_100204734 | 256 |
| 134 | 3300025912 | Ga0207707_10446698 | Ga0207707_104466981 | 256 |
| 135 | 3300025913 | Ga0207695_10000351 | Ga0207695_1000035150 | 256 |
| 136 | 3300025921 | Ga0207652_10043526 | Ga0207652_100435265 | 256 |
| 137 | 3300025938 | Ga0207704_10013811 | Ga0207704_100138113 | 256 |
| 138 | 3300025944 | Ga0207661_10244393 | Ga0207661_102443932 | 256 |
| 139 | 3300025949 | Ga0207667_10003075 | Ga0207667_1000307516 | 256 |
| 140 | 3300026078 | Ga0207702_10001495 | Ga0207702_1000149517 | 256 |
| 141 | 3300026088 | Ga0207641_10006671 | Ga0207641_100066713 | 256 |
| 142 | 3300026095 | Ga0207676_10043265 | Ga0207676_100432652 | 256 |
| 143 | 3300026121 | Ga0207683_10319826 | Ga0207683_103198262 | 256 |
| 144 | 3300031548 | Ga0307408_100168601 | Ga0307408_1001686012 | 256 |
| 145 | 3300031731 | Ga0307405_10160332 | Ga0307405_101603322 | 256 |
| 146 | 3300035691 | Ga0373931_0064983 | Ga0373931_0064983_165_1001 | 256 |
| 147 | 3300046507 | Ga0495606_0105165 | Ga0495606_0105165_228_1064 | 256 |
| 148 | 3300048929 | Ga0496126_0089293 | Ga0496126_0089293_1796_2629 | 256 |
| 149 | 3300049571 | Ga0501034_0201625 | Ga0501034_0201625_177_1013 | 256 |
| 150 | 3300049572 | Ga0501036_0074592 | Ga0501036_0074592_1985_2821 | 256 |
| 151 | 3300049574 | Ga0501038_0011540 | Ga0501038_0011540_4982_5818 | 256 |
| 152 | 3300049579 | Ga0501043_0033647 | Ga0501043_0033647_2185_3021 | 256 |
| 153 | 3300049581 | Ga0501047_0106013 | Ga0501047_0106013_392_1231 | 256 |
| 154 | 3300049581 | Ga0501047_0225042 | Ga0501047_0225042_660_1496 | 256 |
| 155 | 3300049582 | Ga0501048_0199826 | Ga0501048_0199826_88_924 | 256 |
| 156 | 3300049589 | Ga0501073_0221250 | Ga0501073_0221250_94_930 | 256 |
| 157 | 3300049742 | Ga0501080_0145472 | Ga0501080_0145472_173_1009 | 256 |
| 158 | 3300049744 | Ga0501083_0122687 | Ga0501083_0122687_773_1609 | 256 |
| 159 | 3300049822 | Ga0501035_0027380 | Ga0501035_0027380_4263_5099 | 256 |
| 160 | 3300049823 | Ga0501044_0011305 | Ga0501044_0011305_2617_3453 | 256 |
| 161 | 3300005329 | Ga0070683_100019588 | Ga0070683_1000195884 | 257 |
| 162 | 3300005563 | Ga0068855_100188833 | Ga0068855_1001888331 | 257 |
| 163 | 3300013102 | Ga0157371_10306216 | Ga0157371_103062162 | 257 |
| 164 | 3300013105 | Ga0157369_10143317 | Ga0157369_101433172 | 257 |
| 165 | 3300014968 | Ga0157379_10026657 | Ga0157379_100266572 | 257 |
| 166 | 3300049742 | Ga0501080_0363007 | Ga0501080_0363007_357_1193 | 257 |
| 167 | 3300003320 | rootH2_10258336 | rootH2_102583364 | 258 |
| 168 | 3300035695 | Ga0373927_0026827 | Ga0373927_0026827_2348_3202 | 258 |
| 169 | 3300037068 | Ga0373925_0145680 | Ga0373925_0145680_125_967 | 258 |
| 170 | 3300053111 | Ga0500572_032379 | Ga0500572_032379_264_1100 | 258 |
| 171 | 3300053177 | Ga0500636_0081639 | Ga0500636_0081639_192_1028 | 258 |
| 172 | 3300009093 | Ga0105240_10002861 | Ga0105240_1000286116 | 259 |
| 173 | 3300013104 | Ga0157370_10425220 | Ga0157370_104252201 | 259 |
| 174 | 3300013105 | Ga0157369_10051510 | Ga0157369_100515102 | 259 |
| 175 | 3300013307 | Ga0157372_10112776 | Ga0157372_101127763 | 259 |
| 176 | 3300025913 | Ga0207695_10000658 | Ga0207695_1000065816 | 259 |
| 177 | 3300045976 | Ga0466967_0031129 | Ga0466967_0031129_3058_3894 | 259 |
| 178 | 3300048923 | Ga0496120_0008902 | Ga0496120_0008902_568_1401 | 259 |
| 179 | 3300005445 | Ga0070708_100001090 | Ga0070708_1000010903 | 260 |
| 180 | 3300005467 | Ga0070706_100008523 | Ga0070706_1000085237 | 260 |
| 181 | 3300005468 | Ga0070707_100000176 | Ga0070707_1000001769 | 260 |
| 182 | 3300005471 | Ga0070698_100037908 | Ga0070698_1000379082 | 260 |
| 183 | 3300005536 | Ga0070697_100269584 | Ga0070697_1002695841 | 260 |
| 184 | 3300006028 | Ga0070717_10007951 | Ga0070717_100079512 | 260 |
| 185 | 3300013105 | Ga0157369_10283249 | Ga0157369_102832491 | 260 |
| 186 | 3300025910 | Ga0207684_10082298 | Ga0207684_100822984 | 260 |
| 187 | 3300025921 | Ga0207652_10192895 | Ga0207652_101928953 | 260 |
| 188 | 3300025922 | Ga0207646_10000811 | Ga0207646_1000081125 | 260 |
| 189 | 3300026078 | Ga0207702_10165243 | Ga0207702_101652432 | 260 |
| 190 | 3300031241 | Ga0265325_10175223 | Ga0265325_101752231 | 260 |
| 191 | 3300039438 | Ga0436360_0418629 | Ga0436360_0418629_235_1071 | 260 |
| 192 | 3300044712 | Ga0453684_0123537 | Ga0453684_0123537_1233_2078 | 260 |
| 193 | 3300047315 | Ga0495581_0139149 | Ga0495581_0139149_503_1402 | 260 |
| 194 | 3300053103 | Ga0500555_000116 | Ga0500555_000116_7781_8617 | 260 |
| 195 | 3300053730 | Ga0500645_000103 | Ga0500645_000103_30150_30986 | 260 |
| 196 | 3300005436 | Ga0070713_100371473 | Ga0070713_1003714732 | 261 |
| 197 | 3300005445 | Ga0070708_100493438 | Ga0070708_1004934382 | 261 |
| 198 | 3300053153 | Ga0500616_0002603 | Ga0500616_0002603_13825_14673 | 261 |
| 199 | 3300005434 | Ga0070709_10037304 | Ga0070709_100373042 | 262 |
| 200 | 3300005436 | Ga0070713_100029003 | Ga0070713_1000290035 | 262 |
| 201 | 3300005439 | Ga0070711_100026344 | Ga0070711_1000263443 | 262 |
| 202 | 3300006028 | Ga0070717_10655569 | Ga0070717_106555691 | 262 |
| 203 | 3300006173 | Ga0070716_100106153 | Ga0070716_1001061532 | 262 |
| 204 | 3300025898 | Ga0207692_10147538 | Ga0207692_101475381 | 262 |
| 205 | 3300025916 | Ga0207663_10025308 | Ga0207663_100253084 | 262 |
| 206 | 3300025928 | Ga0207700_10102797 | Ga0207700_101027972 | 262 |
| 207 | 3300025939 | Ga0207665_10096809 | Ga0207665_100968093 | 262 |
| 208 | 3300035113 | Ga0373936_0013931 | Ga0373936_0013931_1069_1905 | 262 |
| 209 | 3300037068 | Ga0373925_0049103 | Ga0373925_0049103_1360_2196 | 262 |
| 210 | 3300005288 | Ga0065714_10005173 | Ga0065714_100051732 | 263 |
| 211 | 3300013102 | Ga0157371_10066523 | Ga0157371_100665233 | 263 |
| 212 | 3300028379 | Ga0268266_10351917 | Ga0268266_103519172 | 263 |
| 213 | 3300030744 | Ga0316181_1278947 | Ga0316181_12789475 | 263 |
| 214 | 3300032004 | Ga0307414_10003085 | Ga0307414_100030859 | 263 |
| 215 | 3300036647 | Ga0316582_0054575 | Ga0316582_0054575_1001_1837 | 263 |
| 216 | 3300046476 | Ga0495662_0134869 | Ga0495662_0134869_35_871 | 263 |
| 217 | 3300049583 | Ga0501067_0007388 | Ga0501067_0007388_4561_5394 | 263 |
| 218 | 3300060353 | Ga0501082_0671366 | Ga0501082_0671366_55_888 | 263 |
| 219 | 3300005288 | Ga0065714_10108862 | Ga0065714_101088622 | 264 |
| 220 | 3300005435 | Ga0070714_100214080 | Ga0070714_1002140803 | 264 |
| 221 | 3300005458 | Ga0070681_10418966 | Ga0070681_104189662 | 264 |
| 222 | 3300005467 | Ga0070706_100445040 | Ga0070706_1004450402 | 264 |
| 223 | 3300009551 | Ga0105238_10055666 | Ga0105238_100556662 | 264 |
| 224 | 3300025904 | Ga0207647_10057239 | Ga0207647_100572391 | 264 |
| 225 | 3300025910 | Ga0207684_10376805 | Ga0207684_103768052 | 264 |
| 226 | 3300025924 | Ga0207694_10114827 | Ga0207694_101148273 | 264 |
| 227 | 3300025929 | Ga0207664_10209267 | Ga0207664_102092673 | 264 |
| 228 | 3300035724 | Ga0373933_0009618 | Ga0373933_0009618_3198_4037 | 264 |
| 229 | 3300036401 | Ga0373937_0000015 | Ga0373937_0000015_23646_24485 | 264 |
| 230 | 3300036401 | Ga0373937_0767420 | Ga0373937_0767420_11_883 | 264 |
| 231 | 3300046462 | Ga0495651_0005817 | Ga0495651_0005817_290_1129 | 264 |
| 232 | 3300046463 | Ga0495653_0084625 | Ga0495653_0084625_671_1510 | 264 |
| 233 | 3300046472 | Ga0495580_0027876 | Ga0495580_0027876_3062_3898 | 264 |
| 234 | 3300046536 | Ga0495587_0000219 | Ga0495587_0000219_11475_12314 | 264 |
| 235 | 3300047317 | Ga0495604_0069067 | Ga0495604_0069067_927_1766 | 264 |
| 236 | 3300048088 | Ga0495602_0000206 | Ga0495602_0000206_24376_25215 | 264 |
| 237 | 3300046499 | Ga0495594_0029926 | Ga0495594_0029926_1616_2452 | 265 |
| 238 | 3300048919 | Ga0496116_0137698 | Ga0496116_0137698_16_846 | 265 |
| 239 | 3300005435 | Ga0070714_100029083 | Ga0070714_1000290836 | 266 |
| 240 | 3300009093 | Ga0105240_10085284 | Ga0105240_100852844 | 266 |
| 241 | 3300025913 | Ga0207695_10029736 | Ga0207695_100297364 | 266 |
| 242 | 3300025929 | Ga0207664_10124260 | Ga0207664_101242602 | 266 |
| 243 | 3300039450 | Ga0436363_0179094 | Ga0436363_0179094_287_1123 | 266 |
| 244 | 3300047318 | Ga0495636_0005843 | Ga0495636_0005843_777_1595 | 266 |
| 245 | 3300049586 | Ga0501070_0122095 | Ga0501070_0122095_630_1466 | 266 |
| 246 | 3300005329 | Ga0070683_100028155 | Ga0070683_1000281555 | 267 |
| 247 | 3300005331 | Ga0070670_100000465 | Ga0070670_1000004659 | 267 |
| 248 | 3300005334 | Ga0068869_100026879 | Ga0068869_1000268795 | 267 |
| 249 | 3300005338 | Ga0068868_100018805 | Ga0068868_1000188056 | 267 |
| 250 | 3300005343 | Ga0070687_100014799 | Ga0070687_1000147992 | 267 |
| 251 | 3300005434 | Ga0070709_10136544 | Ga0070709_101365442 | 267 |
| 252 | 3300005435 | Ga0070714_100074413 | Ga0070714_1000744132 | 267 |
| 253 | 3300005436 | Ga0070713_100005330 | Ga0070713_1000053308 | 267 |
| 254 | 3300005436 | Ga0070713_100056196 | Ga0070713_1000561964 | 267 |
| 255 | 3300005458 | Ga0070681_10007353 | Ga0070681_100073537 | 267 |
| 256 | 3300005459 | Ga0068867_100008021 | Ga0068867_1000080215 | 267 |
| 257 | 3300005535 | Ga0070684_100110088 | Ga0070684_1001100883 | 267 |
| 258 | 3300005539 | Ga0068853_100280145 | Ga0068853_1002801452 | 267 |
| 259 | 3300005544 | Ga0070686_100107443 | Ga0070686_1001074432 | 267 |
| 260 | 3300005563 | Ga0068855_100009839 | Ga0068855_10000983910 | 267 |
| 261 | 3300005564 | Ga0070664_100008525 | Ga0070664_1000085258 | 267 |
| 262 | 3300005577 | Ga0068857_100000036 | Ga0068857_1000000369 | 267 |
| 263 | 3300005578 | Ga0068854_100003663 | Ga0068854_1000036638 | 267 |
| 264 | 3300005614 | Ga0068856_100002064 | Ga0068856_10000206417 | 267 |
| 265 | 3300005616 | Ga0068852_100339780 | Ga0068852_1003397802 | 267 |
| 266 | 3300005617 | Ga0068859_100001163 | Ga0068859_10000116311 | 267 |
| 267 | 3300005618 | Ga0068864_100000684 | Ga0068864_10000068413 | 267 |
| 268 | 3300005840 | Ga0068870_10144267 | Ga0068870_101442672 | 267 |
| 269 | 3300005841 | Ga0068863_100102141 | Ga0068863_1001021414 | 267 |
| 270 | 3300005842 | Ga0068858_100020900 | Ga0068858_1000209007 | 267 |
| 271 | 3300005843 | Ga0068860_100048369 | Ga0068860_1000483696 | 267 |
| 272 | 3300006028 | Ga0070717_10001574 | Ga0070717_100015746 | 267 |
| 273 | 3300006028 | Ga0070717_10057142 | Ga0070717_100571423 | 267 |
| 274 | 3300006237 | Ga0097621_100060336 | Ga0097621_1000603361 | 267 |
| 275 | 3300006931 | Ga0097620_100001163 | Ga0097620_10000116319 | 267 |
| 276 | 3300010375 | Ga0105239_10150101 | Ga0105239_101501012 | 267 |
| 277 | 3300013105 | Ga0157369_10047163 | Ga0157369_100471636 | 267 |
| 278 | 3300013296 | Ga0157374_10000162 | Ga0157374_1000016234 | 267 |
| 279 | 3300013297 | Ga0157378_10000020 | Ga0157378_1000002040 | 267 |
| 280 | 3300013307 | Ga0157372_10005137 | Ga0157372_1000513713 | 267 |
| 281 | 3300013307 | Ga0157372_10018191 | Ga0157372_100181914 | 267 |
| 282 | 3300014325 | Ga0163163_10202252 | Ga0163163_102022522 | 267 |
| 283 | 3300025908 | Ga0207643_10085460 | Ga0207643_100854602 | 267 |
| 284 | 3300025912 | Ga0207707_10005146 | Ga0207707_100051462 | 267 |
| 285 | 3300025917 | Ga0207660_10027486 | Ga0207660_100274863 | 267 |
| 286 | 3300025918 | Ga0207662_10032738 | Ga0207662_100327383 | 267 |
| 287 | 3300025920 | Ga0207649_10115458 | Ga0207649_101154582 | 267 |
| 288 | 3300025925 | Ga0207650_10000976 | Ga0207650_100009769 | 267 |
| 289 | 3300025928 | Ga0207700_10000907 | Ga0207700_1000090710 | 267 |
| 290 | 3300025928 | Ga0207700_10105783 | Ga0207700_101057832 | 267 |
| 291 | 3300025929 | Ga0207664_10107542 | Ga0207664_101075423 | 267 |
| 292 | 3300025942 | Ga0207689_10066546 | Ga0207689_100665464 | 267 |
| 293 | 3300025944 | Ga0207661_10044284 | Ga0207661_100442843 | 267 |
| 294 | 3300025945 | Ga0207679_10005041 | Ga0207679_100050417 | 267 |
| 295 | 3300025949 | Ga0207667_10087393 | Ga0207667_100873933 | 267 |
| 296 | 3300025981 | Ga0207640_10010314 | Ga0207640_100103142 | 267 |
| 297 | 3300026023 | Ga0207677_10009929 | Ga0207677_100099294 | 267 |
| 298 | 3300026035 | Ga0207703_10014595 | Ga0207703_100145957 | 267 |
| 299 | 3300026041 | Ga0207639_10045199 | Ga0207639_100451992 | 267 |
| 300 | 3300026078 | Ga0207702_10005292 | Ga0207702_100052926 | 267 |
| 301 | 3300026095 | Ga0207676_10004134 | Ga0207676_100041348 | 267 |
| 302 | 3300026116 | Ga0207674_10000860 | Ga0207674_1000086019 | 267 |
| 303 | 3300028381 | Ga0268264_10013176 | Ga0268264_100131766 | 267 |
| 304 | 3300035692 | Ga0373935_0297461 | Ga0373935_0297461_259_1095 | 267 |
| 305 | 3300036401 | Ga0373937_0051436 | Ga0373937_0051436_70_906 | 267 |
| 306 | 3300045049 | Ga0466959_0205939 | Ga0466959_0205939_380_1216 | 267 |
| 307 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_269580_270416 | 267 |
| 308 | 3300005336 | Ga0070680_100053695 | Ga0070680_1000536953 | 268 |
| 309 | 3300005337 | Ga0070682_100379000 | Ga0070682_1003790001 | 268 |
| 310 | 3300005341 | Ga0070691_10157308 | Ga0070691_101573081 | 268 |
| 311 | 3300005439 | Ga0070711_100025932 | Ga0070711_1000259323 | 268 |
| 312 | 3300005458 | Ga0070681_10000026 | Ga0070681_1000002683 | 268 |
| 313 | 3300005530 | Ga0070679_100002685 | Ga0070679_1000026857 | 268 |
| 314 | 3300005535 | Ga0070684_100274124 | Ga0070684_1002741242 | 268 |
| 315 | 3300005539 | Ga0068853_100007080 | Ga0068853_1000070802 | 268 |
| 316 | 3300005539 | Ga0068853_100090731 | Ga0068853_1000907312 | 268 |
| 317 | 3300005563 | Ga0068855_100000295 | Ga0068855_10000029512 | 268 |
| 318 | 3300005577 | Ga0068857_100002465 | Ga0068857_1000024652 | 268 |
| 319 | 3300005614 | Ga0068856_100001013 | Ga0068856_10000101313 | 268 |
| 320 | 3300005614 | Ga0068856_100022934 | Ga0068856_1000229343 | 268 |
| 321 | 3300005616 | Ga0068852_100559249 | Ga0068852_1005592491 | 268 |
| 322 | 3300005842 | Ga0068858_100088342 | Ga0068858_1000883422 | 268 |
| 323 | 3300006175 | Ga0070712_100009888 | Ga0070712_1000098888 | 268 |
| 324 | 3300006237 | Ga0097621_100014508 | Ga0097621_1000145086 | 268 |
| 325 | 3300006358 | Ga0068871_100001088 | Ga0068871_10000108812 | 268 |
| 326 | 3300009545 | Ga0105237_10219924 | Ga0105237_102199242 | 268 |
| 327 | 3300009551 | Ga0105238_10000848 | Ga0105238_1000084822 | 268 |
| 328 | 3300010375 | Ga0105239_10084130 | Ga0105239_100841302 | 268 |
| 329 | 3300013104 | Ga0157370_10010945 | Ga0157370_1001094512 | 268 |
| 330 | 3300013105 | Ga0157369_10000124 | Ga0157369_1000012489 | 268 |
| 331 | 3300013105 | Ga0157369_10028633 | Ga0157369_100286337 | 268 |
| 332 | 3300013296 | Ga0157374_10001625 | Ga0157374_1000162520 | 268 |
| 333 | 3300013297 | Ga0157378_10028561 | Ga0157378_100285614 | 268 |
| 334 | 3300013307 | Ga0157372_10000084 | Ga0157372_1000008474 | 268 |
| 335 | 3300013307 | Ga0157372_10009649 | Ga0157372_100096499 | 268 |
| 336 | 3300025912 | Ga0207707_10000800 | Ga0207707_1000080028 | 268 |
| 337 | 3300025913 | Ga0207695_10031138 | Ga0207695_100311384 | 268 |
| 338 | 3300025914 | Ga0207671_10160916 | Ga0207671_101609162 | 268 |
| 339 | 3300025915 | Ga0207693_10015937 | Ga0207693_100159373 | 268 |
| 340 | 3300025916 | Ga0207663_10018868 | Ga0207663_100188685 | 268 |
| 341 | 3300025917 | Ga0207660_10047295 | Ga0207660_100472952 | 268 |
| 342 | 3300025921 | Ga0207652_10004418 | Ga0207652_100044183 | 268 |
| 343 | 3300025924 | Ga0207694_10000434 | Ga0207694_1000043422 | 268 |
| 344 | 3300025924 | Ga0207694_10033670 | Ga0207694_100336703 | 268 |
| 345 | 3300025949 | Ga0207667_10000591 | Ga0207667_100005912 | 268 |
| 346 | 3300026023 | Ga0207677_10127799 | Ga0207677_101277992 | 268 |
| 347 | 3300026035 | Ga0207703_10070450 | Ga0207703_100704503 | 268 |
| 348 | 3300026041 | Ga0207639_10023165 | Ga0207639_100231653 | 268 |
| 349 | 3300026078 | Ga0207702_10000114 | Ga0207702_1000011411 | 268 |
| 350 | 3300026078 | Ga0207702_10016626 | Ga0207702_100166266 | 268 |
| 351 | 3300026116 | Ga0207674_10001389 | Ga0207674_1000138915 | 268 |
| 352 | 3300026142 | Ga0207698_10617627 | Ga0207698_106176272 | 268 |
| 353 | 3300028653 | Ga0265323_10010027 | Ga0265323_100100272 | 268 |
| 354 | 3300044694 | Ga0466963_0047410 | Ga0466963_0047410_110_946 | 268 |
| 355 | 3300045976 | Ga0466967_0020964 | Ga0466967_0020964_2406_3242 | 268 |
| 356 | 3300048912 | Ga0496109_0148287 | Ga0496109_0148287_726_1562 | 268 |
| 357 | 3300048918 | Ga0496115_0319038 | Ga0496115_0319038_85_921 | 268 |
| 358 | 3300005336 | Ga0070680_100002217 | Ga0070680_1000022176 | 269 |
| 359 | 3300005436 | Ga0070713_100277175 | Ga0070713_1002771752 | 269 |
| 360 | 3300005445 | Ga0070708_100005564 | Ga0070708_1000055649 | 269 |
| 361 | 3300005467 | Ga0070706_100312357 | Ga0070706_1003123573 | 269 |
| 362 | 3300005530 | Ga0070679_100193934 | Ga0070679_1001939342 | 269 |
| 363 | 3300005563 | Ga0068855_100077266 | Ga0068855_1000772663 | 269 |
| 364 | 3300005614 | Ga0068856_100190440 | Ga0068856_1001904403 | 269 |
| 365 | 3300006028 | Ga0070717_10001844 | Ga0070717_100018446 | 269 |
| 366 | 3300006028 | Ga0070717_10007845 | Ga0070717_100078457 | 269 |
| 367 | 3300006028 | Ga0070717_10402465 | Ga0070717_104024652 | 269 |
| 368 | 3300013307 | Ga0157372_10541205 | Ga0157372_105412052 | 269 |
| 369 | 3300025917 | Ga0207660_10000011 | Ga0207660_1000001111 | 269 |
| 370 | 3300025921 | Ga0207652_10299426 | Ga0207652_102994262 | 269 |
| 371 | 3300025939 | Ga0207665_10085746 | Ga0207665_100857462 | 269 |
| 372 | 3300031238 | Ga0265332_10020645 | Ga0265332_100206452 | 269 |
| 373 | 3300031344 | Ga0265316_10003740 | Ga0265316_100037403 | 269 |
| 374 | 3300031712 | Ga0265342_10001277 | Ga0265342_1000127718 | 269 |
| 375 | 3300035083 | Ga0373926_0002982 | Ga0373926_0002982_2454_3290 | 269 |
| 376 | 3300044842 | Ga0466957_0060811 | Ga0466957_0060811_189_1025 | 269 |
| 377 | 3300046462 | Ga0495651_0202069 | Ga0495651_0202069_186_1037 | 269 |
| 378 | 3300046472 | Ga0495580_0004308 | Ga0495580_0004308_4316_5152 | 269 |
| 379 | 3300046473 | Ga0495582_0011265 | Ga0495582_0011265_1494_2330 | 269 |
| 380 | 3300046531 | Ga0495665_0000411 | Ga0495665_0000411_770_1606 | 269 |
| 381 | 3300049581 | Ga0501047_0250826 | Ga0501047_0250826_621_1457 | 269 |
| 382 | 3300049823 | Ga0501044_0245214 | Ga0501044_0245214_143_979 | 269 |
| 383 | 3300050512 | nmdc:mga0n895_354744_c1 | nmdc:mga0n895_354744_c1_351_1187 | 269 |
| 384 | 3300050513 | nmdc:mga0rr50_1647_c1 | nmdc:mga0rr50_1647_c1_6625_7461 | 269 |
| 385 | 3300061719 | Ga0466962_0148317 | Ga0466962_0148317_16_852 | 269 |
| 386 | 3300005327 | Ga0070658_10193955 | Ga0070658_101939552 | 270 |
| 387 | 3300009177 | Ga0105248_10217286 | Ga0105248_102172862 | 270 |
| 388 | 3300013105 | Ga0157369_10021963 | Ga0157369_100219634 | 270 |
| 389 | 3300013296 | Ga0157374_10056135 | Ga0157374_100561354 | 270 |
| 390 | 3300014969 | Ga0157376_10016338 | Ga0157376_100163384 | 270 |
| 391 | 3300046543 | Ga0495645_0027986 | Ga0495645_0027986_1301_2149 | 270 |
| 392 | 3300048907 | Ga0496104_0202029 | Ga0496104_0202029_797_1630 | 270 |
| 393 | 3300048914 | Ga0496111_0092078 | Ga0496111_0092078_245_1078 | 270 |
| 394 | 3300048915 | Ga0496112_0052403 | Ga0496112_0052403_2003_2836 | 270 |
| 395 | 3300048918 | Ga0496115_0230613 | Ga0496115_0230613_376_1212 | 270 |
| 396 | 3300048922 | Ga0496119_0132154 | Ga0496119_0132154_22_855 | 270 |
| 397 | 3300005355 | Ga0070671_100109826 | Ga0070671_1001098261 | 271 |
| 398 | 3300005364 | Ga0070673_100015777 | Ga0070673_10001577711 | 271 |
| 399 | 3300005434 | Ga0070709_10030139 | Ga0070709_100301393 | 271 |
| 400 | 3300005436 | Ga0070713_100024471 | Ga0070713_1000244713 | 271 |
| 401 | 3300005530 | Ga0070679_100221366 | Ga0070679_1002213662 | 271 |
| 402 | 3300005616 | Ga0068852_100093087 | Ga0068852_1000930873 | 271 |
| 403 | 3300006173 | Ga0070716_100010634 | Ga0070716_1000106343 | 271 |
| 404 | 3300006914 | Ga0075436_100039498 | Ga0075436_1000394982 | 271 |
| 405 | 3300025906 | Ga0207699_10010688 | Ga0207699_100106886 | 271 |
| 406 | 3300025912 | Ga0207707_10265941 | Ga0207707_102659412 | 271 |
| 407 | 3300025915 | Ga0207693_10003255 | Ga0207693_1000325513 | 271 |
| 408 | 3300025921 | Ga0207652_10514051 | Ga0207652_105140511 | 271 |
| 409 | 3300025929 | Ga0207664_10065613 | Ga0207664_100656134 | 271 |
| 410 | 3300025931 | Ga0207644_10105521 | Ga0207644_101055212 | 271 |
| 411 | 3300025939 | Ga0207665_10003917 | Ga0207665_100039176 | 271 |
| 412 | 3300047320 | Ga0495672_0001992 | Ga0495672_0001992_4360_5196 | 271 |
| 413 | 3300053125 | Ga0500618_000036 | Ga0500618_000036_40648_41481 | 271 |
| 414 | 3300009093 | Ga0105240_10386510 | Ga0105240_103865102 | 272 |
| 415 | 3300032004 | Ga0307414_10019434 | Ga0307414_100194344 | 272 |
| 416 | 3300049758 | Ga0501241_005281 | Ga0501241_005281_689_1525 | 272 |
| 417 | iso_pu_bacteria | 2977232053 | 2977233915 | 272 |
| 418 | 3300025914 | Ga0207671_10008730 | Ga0207671_100087302 | 273 |
| 419 | 3300049581 | Ga0501047_0028521 | Ga0501047_0028521_2820_3656 | 273 |
| 420 | iso_pu_bacteria | 2585427687 | 2586210014 | 273 |
| 421 | iso_pu_bacteria | 2738541302 | 2738854387 | 273 |
| 422 | iso_pu_bacteria | 2739367651 | 2739587938 | 273 |
| 423 | iso_pu_bacteria | 2739367656 | 2739614410 | 273 |
| 424 | iso_pu_bacteria | 2739367663 | 2739646658 | 273 |
| 425 | iso_pu_bacteria | 2818991437 | 2819545814 | 273 |
| 426 | iso_pu_bacteria | 2842722452 | 2842724292 | 273 |
| 427 | iso_pu_bacteria | 2842909656 | 2842913573 | 273 |
| 428 | iso_pu_bacteria | 2849281842 | 2849282614 | 273 |
| 429 | iso_pu_bacteria | 2852623160 | 2852625164 | 273 |
| 430 | iso_pu_bacteria | 2857627736 | 2857631637 | 273 |
| 431 | iso_pu_bacteria | 2884791551 | 2884792172 | 273 |
| 432 | iso_pu_bacteria | 2884933994 | 2884934180 | 273 |
| 433 | iso_pu_bacteria | 2904445276 | 2904449055 | 273 |
| 434 | iso_pu_bacteria | 2945997725 | 2945998884 | 273 |
| 435 | iso_pu_bacteria | 2954016120 | 2954021328 | 273 |
| 436 | 3300005467 | Ga0070706_100001928 | Ga0070706_1000019283 | 274 |
| 437 | 3300025910 | Ga0207684_10000812 | Ga0207684_1000081228 | 274 |
| 438 | 3300028654 | Ga0265322_10027480 | Ga0265322_100274802 | 274 |
| 439 | 3300045976 | Ga0466967_0381303 | Ga0466967_0381303_300_1130 | 274 |
| 440 | 3300046543 | Ga0495645_0003642 | Ga0495645_0003642_3283_4113 | 274 |
| 441 | iso_pu_bacteria | 2738541283 | 2738755691 | 274 |
| 442 | iso_pu_bacteria | 2852627209 | 2852629099 | 274 |
| 443 | iso_pu_bacteria | 2902048731 | 2902051202 | 274 |
| 444 | iso_pu_bacteria | 2919186247 | 2919189057 | 274 |
| 445 | iso_pu_bacteria | 2929154850 | 2929156035 | 274 |
| 446 | iso_pu_bacteria | 2939664404 | 2939666788 | 274 |
| 447 | 3300005329 | Ga0070683_100040343 | Ga0070683_1000403433 | 275 |
| 448 | 3300005435 | Ga0070714_100001995 | Ga0070714_10000199513 | 275 |
| 449 | 3300005436 | Ga0070713_100000575 | Ga0070713_10000057519 | 275 |
| 450 | 3300005439 | Ga0070711_100197309 | Ga0070711_1001973092 | 275 |
| 451 | 3300005614 | Ga0068856_100042307 | Ga0068856_1000423076 | 275 |
| 452 | 3300009093 | Ga0105240_10004872 | Ga0105240_100048728 | 275 |
| 453 | 3300009093 | Ga0105240_10031483 | Ga0105240_100314833 | 275 |
| 454 | 3300009177 | Ga0105248_10046585 | Ga0105248_100465854 | 275 |
| 455 | 3300009545 | Ga0105237_10006655 | Ga0105237_100066556 | 275 |
| 456 | 3300009545 | Ga0105237_10086070 | Ga0105237_100860702 | 275 |
| 457 | 3300009545 | Ga0105237_10848719 | Ga0105237_108487191 | 275 |
| 458 | 3300009551 | Ga0105238_10113584 | Ga0105238_101135842 | 275 |
| 459 | 3300010375 | Ga0105239_10137966 | Ga0105239_101379664 | 275 |
| 460 | 3300013105 | Ga0157369_10098242 | Ga0157369_100982422 | 275 |
| 461 | 3300013105 | Ga0157369_10159442 | Ga0157369_101594423 | 275 |
| 462 | 3300021384 | Ga0213876_10143007 | Ga0213876_101430071 | 275 |
| 463 | 3300025913 | Ga0207695_10021867 | Ga0207695_100218676 | 275 |
| 464 | 3300025913 | Ga0207695_10077828 | Ga0207695_100778283 | 275 |
| 465 | 3300025914 | Ga0207671_10029864 | Ga0207671_100298644 | 275 |
| 466 | 3300025924 | Ga0207694_10072774 | Ga0207694_100727742 | 275 |
| 467 | 3300025928 | Ga0207700_10001252 | Ga0207700_100012525 | 275 |
| 468 | 3300025929 | Ga0207664_10023773 | Ga0207664_100237734 | 275 |
| 469 | 3300025939 | Ga0207665_10148690 | Ga0207665_101486903 | 275 |
| 470 | 3300025941 | Ga0207711_10273095 | Ga0207711_102730952 | 275 |
| 471 | 3300031235 | Ga0265330_10002022 | Ga0265330_100020226 | 275 |
| 472 | 3300031250 | Ga0265331_10029604 | Ga0265331_100296044 | 275 |
| 473 | 3300031344 | Ga0265316_10023161 | Ga0265316_100231612 | 275 |
| 474 | 3300031711 | Ga0265314_10018302 | Ga0265314_100183024 | 275 |
| 475 | 3300031712 | Ga0265342_10145761 | Ga0265342_101457611 | 275 |
| 476 | 3300032004 | Ga0307414_10113594 | Ga0307414_101135943 | 275 |
| 477 | 3300032005 | Ga0307411_10203152 | Ga0307411_102031521 | 275 |
| 478 | 3300035089 | Ga0373944_0126136 | Ga0373944_0126136_39_872 | 275 |
| 479 | 3300035692 | Ga0373935_0088494 | Ga0373935_0088494_871_1704 | 275 |
| 480 | 3300035695 | Ga0373927_0019991 | Ga0373927_0019991_3249_4082 | 275 |
| 481 | 3300036401 | Ga0373937_0007694 | Ga0373937_0007694_6624_7457 | 275 |
| 482 | 3300036401 | Ga0373937_0023028 | Ga0373937_0023028_3211_4044 | 275 |
| 483 | 3300037853 | Ga0436364_0758800 | Ga0436364_0758800_1589_2422 | 275 |
| 484 | 3300039437 | Ga0436365_0575734 | Ga0436365_0575734_374_1207 | 275 |
| 485 | 3300045976 | Ga0466967_0571572 | Ga0466967_0571572_109_942 | 275 |
| 486 | 3300046454 | Ga0495592_0144847 | Ga0495592_0144847_21_851 | 275 |
| 487 | 3300046472 | Ga0495580_0005048 | Ga0495580_0005048_486_1319 | 275 |
| 488 | 3300046472 | Ga0495580_0033221 | Ga0495580_0033221_532_1368 | 275 |
| 489 | 3300046473 | Ga0495582_0064851 | Ga0495582_0064851_985_1818 | 275 |
| 490 | 3300046475 | Ga0495639_0047864 | Ga0495639_0047864_357_1190 | 275 |
| 491 | 3300046476 | Ga0495662_0051091 | Ga0495662_0051091_480_1313 | 275 |
| 492 | 3300046477 | Ga0495664_0020526 | Ga0495664_0020526_2134_2967 | 275 |
| 493 | 3300046499 | Ga0495594_0032837 | Ga0495594_0032837_323_1156 | 275 |
| 494 | 3300046514 | Ga0495618_0019647 | Ga0495618_0019647_1044_1877 | 275 |
| 495 | 3300046517 | Ga0495630_0006608 | Ga0495630_0006608_886_1719 | 275 |
| 496 | 3300046526 | Ga0495666_0002651 | Ga0495666_0002651_2001_2834 | 275 |
| 497 | 3300046533 | Ga0495640_0123142 | Ga0495640_0123142_67_900 | 275 |
| 498 | 3300046535 | Ga0495586_0004070 | Ga0495586_0004070_1165_1998 | 275 |
| 499 | 3300046559 | Ga0495667_0110978 | Ga0495667_0110978_757_1590 | 275 |
| 500 | 3300046642 | Ga0495634_0001890 | Ga0495634_0001890_15004_15837 | 275 |
| 501 | 3300046681 | Ga0495647_0003772 | Ga0495647_0003772_721_1554 | 275 |
| 502 | 3300046683 | Ga0495658_0056164 | Ga0495658_0056164_935_1768 | 275 |
| 503 | 3300046690 | Ga0495624_0078000 | Ga0495624_0078000_1202_2035 | 275 |
| 504 | 3300046809 | Ga0495600_0071975 | Ga0495600_0071975_480_1313 | 275 |
| 505 | 3300047319 | Ga0495674_0042378 | Ga0495674_0042378_2767_3600 | 275 |
| 506 | 3300047322 | Ga0495680_0035849 | Ga0495680_0035849_2848_3681 | 275 |
| 507 | 3300047471 | Ga0495684_0107340 | Ga0495684_0107340_717_1550 | 275 |
| 508 | 3300048089 | Ga0495614_0083190 | Ga0495614_0083190_251_1084 | 275 |
| 509 | 3300001990 | JGI24737J22298_10000840 | JGI24737J22298_100008402 | 276 |
| 510 | 3300002067 | JGI24735J21928_10021300 | JGI24735J21928_100213001 | 276 |
| 511 | 3300002077 | JGI24744J21845_10008150 | JGI24744J21845_100081502 | 276 |
| 512 | 3300003214 | JGI25165J46597_1001383 | JGI25165J46597_10013833 | 276 |
| 513 | 3300003214 | JGI25165J46597_1010880 | JGI25165J46597_10108802 | 276 |
| 514 | 3300003316 | rootH1_10139411 | rootH1_101394113 | 276 |
| 515 | 3300003320 | rootH2_10002321 | rootH2_1000232186 | 276 |
| 516 | 3300003320 | rootH2_10022605 | rootH2_100226053 | 276 |
| 517 | 3300003323 | rootH1_10039624 | rootH1_1003962410 | 276 |
| 518 | 3300003323 | rootH1_10068371 | rootH1_100683713 | 276 |
| 519 | 3300003323 | rootH1_10235905 | rootH1_102359051 | 276 |
| 520 | 3300005327 | Ga0070658_10000200 | Ga0070658_1000020039 | 276 |
| 521 | 3300005327 | Ga0070658_10074142 | Ga0070658_100741424 | 276 |
| 522 | 3300005328 | Ga0070676_10002382 | Ga0070676_100023825 | 276 |
| 523 | 3300005329 | Ga0070683_100022500 | Ga0070683_1000225003 | 276 |
| 524 | 3300005329 | Ga0070683_100168911 | Ga0070683_1001689113 | 276 |
| 525 | 3300005336 | Ga0070680_100060347 | Ga0070680_1000603472 | 276 |
| 526 | 3300005338 | Ga0068868_100005678 | Ga0068868_1000056784 | 276 |
| 527 | 3300005338 | Ga0068868_100087456 | Ga0068868_1000874561 | 276 |
| 528 | 3300005339 | Ga0070660_100052135 | Ga0070660_1000521351 | 276 |
| 529 | 3300005339 | Ga0070660_100062739 | Ga0070660_1000627392 | 276 |
| 530 | 3300005354 | Ga0070675_100547737 | Ga0070675_1005477371 | 276 |
| 531 | 3300005355 | Ga0070671_100006664 | Ga0070671_1000066644 | 276 |
| 532 | 3300005364 | Ga0070673_100023233 | Ga0070673_1000232333 | 276 |
| 533 | 3300005364 | Ga0070673_100531917 | Ga0070673_1005319172 | 276 |
| 534 | 3300005365 | Ga0070688_100204885 | Ga0070688_1002048851 | 276 |
| 535 | 3300005366 | Ga0070659_100000242 | Ga0070659_10000024230 | 276 |
| 536 | 3300005366 | Ga0070659_100005922 | Ga0070659_1000059224 | 276 |
| 537 | 3300005367 | Ga0070667_100086003 | Ga0070667_1000860033 | 276 |
| 538 | 3300005435 | Ga0070714_100150627 | Ga0070714_1001506271 | 276 |
| 539 | 3300005456 | Ga0070678_100013519 | Ga0070678_1000135192 | 276 |
| 540 | 3300005457 | Ga0070662_100000877 | Ga0070662_1000008774 | 276 |
| 541 | 3300005457 | Ga0070662_100083699 | Ga0070662_1000836992 | 276 |
| 542 | 3300005458 | Ga0070681_10004904 | Ga0070681_1000490410 | 276 |
| 543 | 3300005458 | Ga0070681_10165503 | Ga0070681_101655034 | 276 |
| 544 | 3300005459 | Ga0068867_100000040 | Ga0068867_1000000403 | 276 |
| 545 | 3300005518 | Ga0070699_100248493 | Ga0070699_1002484932 | 276 |
| 546 | 3300005530 | Ga0070679_100007648 | Ga0070679_1000076487 | 276 |
| 547 | 3300005535 | Ga0070684_100197397 | Ga0070684_1001973973 | 276 |
| 548 | 3300005535 | Ga0070684_100201531 | Ga0070684_1002015311 | 276 |
| 549 | 3300005539 | Ga0068853_100005706 | Ga0068853_1000057066 | 276 |
| 550 | 3300005548 | Ga0070665_100000010 | Ga0070665_100000010306 | 276 |
| 551 | 3300005548 | Ga0070665_100207748 | Ga0070665_1002077482 | 276 |
| 552 | 3300005548 | Ga0070665_100325771 | Ga0070665_1003257712 | 276 |
| 553 | 3300005563 | Ga0068855_100000054 | Ga0068855_10000005467 | 276 |
| 554 | 3300005563 | Ga0068855_100012882 | Ga0068855_1000128823 | 276 |
| 555 | 3300005563 | Ga0068855_100110740 | Ga0068855_1001107404 | 276 |
| 556 | 3300005563 | Ga0068855_100211524 | Ga0068855_1002115242 | 276 |
| 557 | 3300005577 | Ga0068857_100036079 | Ga0068857_1000360794 | 276 |
| 558 | 3300005578 | Ga0068854_100080200 | Ga0068854_1000802003 | 276 |
| 559 | 3300005614 | Ga0068856_100000023 | Ga0068856_10000002393 | 276 |
| 560 | 3300005614 | Ga0068856_100005806 | Ga0068856_1000058066 | 276 |
| 561 | 3300005614 | Ga0068856_100028518 | Ga0068856_1000285182 | 276 |
| 562 | 3300005614 | Ga0068856_100163191 | Ga0068856_1001631913 | 276 |
| 563 | 3300005614 | Ga0068856_100178323 | Ga0068856_1001783232 | 276 |
| 564 | 3300005614 | Ga0068856_100266109 | Ga0068856_1002661093 | 276 |
| 565 | 3300005616 | Ga0068852_100033904 | Ga0068852_1000339043 | 276 |
| 566 | 3300005718 | Ga0068866_10011030 | Ga0068866_100110303 | 276 |
| 567 | 3300006028 | Ga0070717_10020023 | Ga0070717_100200234 | 276 |
| 568 | 3300006237 | Ga0097621_100000011 | Ga0097621_10000001115 | 276 |
| 569 | 3300006358 | Ga0068871_100003357 | Ga0068871_1000033575 | 276 |
| 570 | 3300006881 | Ga0068865_100001113 | Ga0068865_1000011139 | 276 |
| 571 | 3300009093 | Ga0105240_10003887 | Ga0105240_1000388717 | 276 |
| 572 | 3300009093 | Ga0105240_10012765 | Ga0105240_100127657 | 276 |
| 573 | 3300009093 | Ga0105240_10046934 | Ga0105240_100469341 | 276 |
| 574 | 3300009093 | Ga0105240_10085736 | Ga0105240_100857363 | 276 |
| 575 | 3300009093 | Ga0105240_10109624 | Ga0105240_101096242 | 276 |
| 576 | 3300009093 | Ga0105240_10133272 | Ga0105240_101332724 | 276 |
| 577 | 3300009093 | Ga0105240_10180658 | Ga0105240_101806582 | 276 |
| 578 | 3300009093 | Ga0105240_10282272 | Ga0105240_102822723 | 276 |
| 579 | 3300009093 | Ga0105240_10314348 | Ga0105240_103143482 | 276 |
| 580 | 3300009093 | Ga0105240_10447387 | Ga0105240_104473872 | 276 |
| 581 | 3300009093 | Ga0105240_10694057 | Ga0105240_106940571 | 276 |
| 582 | 3300009174 | Ga0105241_10003934 | Ga0105241_100039349 | 276 |
| 583 | 3300009174 | Ga0105241_10006678 | Ga0105241_100066786 | 276 |
| 584 | 3300009174 | Ga0105241_10710459 | Ga0105241_107104591 | 276 |
| 585 | 3300009176 | Ga0105242_10011984 | Ga0105242_100119844 | 276 |
| 586 | 3300009176 | Ga0105242_10075022 | Ga0105242_100750223 | 276 |
| 587 | 3300009545 | Ga0105237_10004319 | Ga0105237_1000431910 | 276 |
| 588 | 3300009545 | Ga0105237_10004940 | Ga0105237_1000494014 | 276 |
| 589 | 3300009545 | Ga0105237_10011977 | Ga0105237_100119775 | 276 |
| 590 | 3300009545 | Ga0105237_10056078 | Ga0105237_100560783 | 276 |
| 591 | 3300009545 | Ga0105237_10150727 | Ga0105237_101507272 | 276 |
| 592 | 3300009545 | Ga0105237_10242362 | Ga0105237_102423623 | 276 |
| 593 | 3300009551 | Ga0105238_10003247 | Ga0105238_100032475 | 276 |
| 594 | 3300009551 | Ga0105238_10031206 | Ga0105238_100312067 | 276 |
| 595 | 3300010375 | Ga0105239_10000011 | Ga0105239_1000001183 | 276 |
| 596 | 3300010375 | Ga0105239_10008277 | Ga0105239_100082773 | 276 |
| 597 | 3300010375 | Ga0105239_10037880 | Ga0105239_100378801 | 276 |
| 598 | 3300010375 | Ga0105239_10214113 | Ga0105239_102141132 | 276 |
| 599 | 3300011119 | Ga0105246_10002620 | Ga0105246_100026205 | 276 |
| 600 | 3300011119 | Ga0105246_10033519 | Ga0105246_100335193 | 276 |
| 601 | 3300013100 | Ga0157373_10012250 | Ga0157373_100122503 | 276 |
| 602 | 3300013100 | Ga0157373_10016721 | Ga0157373_100167213 | 276 |
| 603 | 3300013102 | Ga0157371_10050715 | Ga0157371_100507152 | 276 |
| 604 | 3300013104 | Ga0157370_10010467 | Ga0157370_100104674 | 276 |
| 605 | 3300013104 | Ga0157370_10101904 | Ga0157370_101019042 | 276 |
| 606 | 3300013104 | Ga0157370_10280241 | Ga0157370_102802412 | 276 |
| 607 | 3300013104 | Ga0157370_10297377 | Ga0157370_102973772 | 276 |
| 608 | 3300013105 | Ga0157369_10031489 | Ga0157369_100314893 | 276 |
| 609 | 3300013105 | Ga0157369_10069306 | Ga0157369_100693064 | 276 |
| 610 | 3300013105 | Ga0157369_10367376 | Ga0157369_103673762 | 276 |
| 611 | 3300013296 | Ga0157374_10000391 | Ga0157374_1000039121 | 276 |
| 612 | 3300013296 | Ga0157374_10001058 | Ga0157374_1000105813 | 276 |
| 613 | 3300013296 | Ga0157374_10137383 | Ga0157374_101373832 | 276 |
| 614 | 3300013297 | Ga0157378_10012884 | Ga0157378_100128841 | 276 |
| 615 | 3300013297 | Ga0157378_10083027 | Ga0157378_100830274 | 276 |
| 616 | 3300013297 | Ga0157378_10119822 | Ga0157378_101198223 | 276 |
| 617 | 3300013306 | Ga0163162_10000082 | Ga0163162_1000008233 | 276 |
| 618 | 3300013306 | Ga0163162_10005591 | Ga0163162_100055917 | 276 |
| 619 | 3300013307 | Ga0157372_10001395 | Ga0157372_1000139517 | 276 |
| 620 | 3300013307 | Ga0157372_10054272 | Ga0157372_100542721 | 276 |
| 621 | 3300013307 | Ga0157372_10109261 | Ga0157372_101092613 | 276 |
| 622 | 3300013307 | Ga0157372_10817697 | Ga0157372_108176971 | 276 |
| 623 | 3300013308 | Ga0157375_10009398 | Ga0157375_100093983 | 276 |
| 624 | 3300014969 | Ga0157376_10040319 | Ga0157376_100403193 | 276 |
| 625 | 3300015261 | Ga0182006_1010004 | Ga0182006_10100044 | 276 |
| 626 | 3300021361 | Ga0213872_10002892 | Ga0213872_100028925 | 276 |
| 627 | 3300021361 | Ga0213872_10051840 | Ga0213872_100518402 | 276 |
| 628 | 3300021377 | Ga0213874_10019751 | Ga0213874_100197512 | 276 |
| 629 | 3300021384 | Ga0213876_10067790 | Ga0213876_100677903 | 276 |
| 630 | 3300021388 | Ga0213875_10000013 | Ga0213875_10000013142 | 276 |
| 631 | 3300025231 | Ga0207427_100137 | Ga0207427_10013734 | 276 |
| 632 | 3300025233 | Ga0209437_100112 | Ga0209437_10011292 | 276 |
| 633 | 3300025261 | Ga0209233_1000126 | Ga0209233_100012689 | 276 |
| 634 | 3300025261 | Ga0209233_1001504 | Ga0209233_10015044 | 276 |
| 635 | 3300025261 | Ga0209233_1008644 | Ga0209233_10086442 | 276 |
| 636 | 3300025904 | Ga0207647_10000046 | Ga0207647_1000004664 | 276 |
| 637 | 3300025904 | Ga0207647_10000171 | Ga0207647_1000017161 | 276 |
| 638 | 3300025907 | Ga0207645_10001612 | Ga0207645_1000161211 | 276 |
| 639 | 3300025909 | Ga0207705_10000257 | Ga0207705_1000025710 | 276 |
| 640 | 3300025911 | Ga0207654_10001865 | Ga0207654_100018659 | 276 |
| 641 | 3300025912 | Ga0207707_10071101 | Ga0207707_100711011 | 276 |
| 642 | 3300025913 | Ga0207695_10043027 | Ga0207695_100430274 | 276 |
| 643 | 3300025913 | Ga0207695_10052703 | Ga0207695_100527034 | 276 |
| 644 | 3300025913 | Ga0207695_10098617 | Ga0207695_100986173 | 276 |
| 645 | 3300025913 | Ga0207695_10223355 | Ga0207695_102233553 | 276 |
| 646 | 3300025913 | Ga0207695_10298667 | Ga0207695_102986672 | 276 |
| 647 | 3300025913 | Ga0207695_10349272 | Ga0207695_103492722 | 276 |
| 648 | 3300025913 | Ga0207695_10411137 | Ga0207695_104111372 | 276 |
| 649 | 3300025914 | Ga0207671_10003029 | Ga0207671_1000302913 | 276 |
| 650 | 3300025914 | Ga0207671_10010521 | Ga0207671_100105213 | 276 |
| 651 | 3300025914 | Ga0207671_10019385 | Ga0207671_100193853 | 276 |
| 652 | 3300025914 | Ga0207671_10129435 | Ga0207671_101294351 | 276 |
| 653 | 3300025917 | Ga0207660_10002156 | Ga0207660_100021568 | 276 |
| 654 | 3300025919 | Ga0207657_10034733 | Ga0207657_100347335 | 276 |
| 655 | 3300025921 | Ga0207652_10264368 | Ga0207652_102643681 | 276 |
| 656 | 3300025924 | Ga0207694_10016698 | Ga0207694_100166983 | 276 |
| 657 | 3300025926 | Ga0207659_10467900 | Ga0207659_104679001 | 276 |
| 658 | 3300025931 | Ga0207644_10024997 | Ga0207644_100249973 | 276 |
| 659 | 3300025932 | Ga0207690_10001885 | Ga0207690_100018858 | 276 |
| 660 | 3300025932 | Ga0207690_10006251 | Ga0207690_100062514 | 276 |
| 661 | 3300025933 | Ga0207706_10001858 | Ga0207706_1000185813 | 276 |
| 662 | 3300025938 | Ga0207704_10000169 | Ga0207704_100001699 | 276 |
| 663 | 3300025949 | Ga0207667_10000023 | Ga0207667_10000023244 | 276 |
| 664 | 3300025949 | Ga0207667_10020179 | Ga0207667_100201792 | 276 |
| 665 | 3300025949 | Ga0207667_10037903 | Ga0207667_100379033 | 276 |
| 666 | 3300025949 | Ga0207667_10067382 | Ga0207667_100673823 | 276 |
| 667 | 3300025949 | Ga0207667_10329862 | Ga0207667_103298621 | 276 |
| 668 | 3300025960 | Ga0207651_10034259 | Ga0207651_100342593 | 276 |
| 669 | 3300025981 | Ga0207640_10030346 | Ga0207640_100303464 | 276 |
| 670 | 3300026023 | Ga0207677_10005304 | Ga0207677_100053045 | 276 |
| 671 | 3300026041 | Ga0207639_10003935 | Ga0207639_100039354 | 276 |
| 672 | 3300026041 | Ga0207639_10156581 | Ga0207639_101565812 | 276 |
| 673 | 3300026078 | Ga0207702_10000314 | Ga0207702_1000031440 | 276 |
| 674 | 3300026078 | Ga0207702_10012932 | Ga0207702_100129322 | 276 |
| 675 | 3300026078 | Ga0207702_10061438 | Ga0207702_100614383 | 276 |
| 676 | 3300026078 | Ga0207702_10224419 | Ga0207702_102244192 | 276 |
| 677 | 3300026078 | Ga0207702_10502683 | Ga0207702_105026832 | 276 |
| 678 | 3300026089 | Ga0207648_10000220 | Ga0207648_1000022015 | 276 |
| 679 | 3300026121 | Ga0207683_10154701 | Ga0207683_101547012 | 276 |
| 680 | 3300026142 | Ga0207698_10015037 | Ga0207698_100150373 | 276 |
| 681 | 3300028379 | Ga0268266_10000032 | Ga0268266_10000032270 | 276 |
| 682 | 3300028379 | Ga0268266_10009865 | Ga0268266_100098657 | 276 |
| 683 | 3300028379 | Ga0268266_10013247 | Ga0268266_100132472 | 276 |
| 684 | 3300028786 | Ga0307517_10000429 | Ga0307517_1000042957 | 276 |
| 685 | 3300028800 | Ga0265338_10001594 | Ga0265338_1000159412 | 276 |
| 686 | 3300028800 | Ga0265338_10020888 | Ga0265338_100208884 | 276 |
| 687 | 3300031249 | Ga0265339_10002485 | Ga0265339_100024859 | 276 |
| 688 | 3300031251 | Ga0265327_10006320 | Ga0265327_1000632011 | 276 |
| 689 | 3300031665 | Ga0316575_10006715 | Ga0316575_100067153 | 276 |
| 690 | 3300033180 | Ga0307510_10010589 | Ga0307510_100105899 | 276 |
| 691 | 3300037068 | Ga0373925_0036081 | Ga0373925_0036081_1030_1866 | 276 |
| 692 | 3300037312 | Ga0395899_0087037 | Ga0395899_0087037_940_1776 | 276 |
| 693 | 3300037312 | Ga0395899_0165520 | Ga0395899_0165520_39_875 | 276 |
| 694 | 3300037418 | Ga0395900_0000194 | Ga0395900_0000194_37588_38424 | 276 |
| 695 | 3300037418 | Ga0395900_0045441 | Ga0395900_0045441_3031_3867 | 276 |
| 696 | 3300037418 | Ga0395900_0166981 | Ga0395900_0166981_948_1787 | 276 |
| 697 | 3300037466 | Ga0395898_0043670 | Ga0395898_0043670_565_1401 | 276 |
| 698 | 3300037466 | Ga0395898_0190280 | Ga0395898_0190280_323_1159 | 276 |
| 699 | 3300037471 | Ga0395905_0000355 | Ga0395905_0000355_20864_21700 | 276 |
| 700 | 3300037471 | Ga0395905_0011403 | Ga0395905_0011403_4956_5795 | 276 |
| 701 | 3300037853 | Ga0436364_0794765 | Ga0436364_0794765_153004_153840 | 276 |
| 702 | 3300037853 | Ga0436364_1359397 | Ga0436364_1359397_302_1138 | 276 |
| 703 | 3300038443 | Ga0395901_0026672 | Ga0395901_0026672_2834_3670 | 276 |
| 704 | 3300038443 | Ga0395901_0041615 | Ga0395901_0041615_3593_4429 | 276 |
| 705 | 3300038443 | Ga0395901_0072785 | Ga0395901_0072785_718_1557 | 276 |
| 706 | 3300039437 | Ga0436365_0361465 | Ga0436365_0361465_938_1774 | 276 |
| 707 | 3300039437 | Ga0436365_1082274 | Ga0436365_1082274_7994_8830 | 276 |
| 708 | 3300039438 | Ga0436360_0295097 | Ga0436360_0295097_1528_2364 | 276 |
| 709 | 3300039447 | Ga0436361_1206081 | Ga0436361_1206081_3713_4549 | 276 |
| 710 | 3300039450 | Ga0436363_0008358 | Ga0436363_0008358_510_1346 | 276 |
| 711 | 3300039450 | Ga0436363_0640237 | Ga0436363_0640237_312_1148 | 276 |
| 712 | 3300039453 | Ga0436362_0347231 | Ga0436362_0347231_3968_4804 | 276 |
| 713 | 3300042876 | Ga0451577_0640125 | Ga0451577_0640125_95_940 | 276 |
| 714 | 3300044712 | Ga0453684_0011973 | Ga0453684_0011973_10410_11255 | 276 |
| 715 | 3300045049 | Ga0466959_0353321 | Ga0466959_0353321_122_958 | 276 |
| 716 | 3300045976 | Ga0466967_0120329 | Ga0466967_0120329_1176_2012 | 276 |
| 717 | 3300046454 | Ga0495592_0057917 | Ga0495592_0057917_422_1297 | 276 |
| 718 | 3300046471 | Ga0495650_0008037 | Ga0495650_0008037_3840_4676 | 276 |
| 719 | 3300046476 | Ga0495662_0024394 | Ga0495662_0024394_365_1240 | 276 |
| 720 | 3300046477 | Ga0495664_0001480 | Ga0495664_0001480_11254_12129 | 276 |
| 721 | 3300046500 | Ga0495596_0015176 | Ga0495596_0015176_1664_2500 | 276 |
| 722 | 3300046516 | Ga0495628_0020615 | Ga0495628_0020615_4516_5391 | 276 |
| 723 | 3300046529 | Ga0495652_0268578 | Ga0495652_0268578_246_1121 | 276 |
| 724 | 3300046535 | Ga0495586_0052124 | Ga0495586_0052124_1292_2167 | 276 |
| 725 | 3300046536 | Ga0495587_0091428 | Ga0495587_0091428_466_1341 | 276 |
| 726 | 3300046543 | Ga0495645_0024026 | Ga0495645_0024026_1052_1927 | 276 |
| 727 | 3300046642 | Ga0495634_0304783 | Ga0495634_0304783_72_947 | 276 |
| 728 | 3300046660 | Ga0495625_0000422 | Ga0495625_0000422_32105_32941 | 276 |
| 729 | 3300046660 | Ga0495625_0253441 | Ga0495625_0253441_102_938 | 276 |
| 730 | 3300046678 | Ga0495599_0008956 | Ga0495599_0008956_3832_4707 | 276 |
| 731 | 3300047322 | Ga0495680_0031119 | Ga0495680_0031119_3358_4233 | 276 |
| 732 | 3300047443 | Ga0495687_005321 | Ga0495687_005321_6047_6883 | 276 |
| 733 | 3300047471 | Ga0495684_0260943 | Ga0495684_0260943_339_1175 | 276 |
| 734 | 3300047472 | Ga0495686_0002322 | Ga0495686_0002322_10270_11106 | 276 |
| 735 | 3300048929 | Ga0496126_0000010 | Ga0496126_0000010_629985_630821 | 276 |
| 736 | 3300048929 | Ga0496126_0000095 | Ga0496126_0000095_149467_150306 | 276 |
| 737 | 3300048929 | Ga0496126_0007453 | Ga0496126_0007453_2650_3486 | 276 |
| 738 | 3300049571 | Ga0501034_0006905 | Ga0501034_0006905_7976_8827 | 276 |
| 739 | 3300049593 | Ga0501077_0008963 | Ga0501077_0008963_2235_3071 | 276 |
| 740 | 3300049593 | Ga0501077_0380387 | Ga0501077_0380387_21_857 | 276 |
| 741 | 3300049741 | Ga0501079_0523946 | Ga0501079_0523946_57_893 | 276 |
| 742 | 3300050496 | nmdc:mga07m45_34980_c1 | nmdc:mga07m45_34980_c1_1885_2721 | 276 |
| 743 | 3300053077 | Ga0495601_0075942 | Ga0495601_0075942_515_1351 | 276 |
| 744 | 3300053080 | Ga0500635_0004193 | Ga0500635_0004193_349_1185 | 276 |
| 745 | 3300053080 | Ga0500635_0005378 | Ga0500635_0005378_776_1612 | 276 |
| 746 | 3300053130 | Ga0500642_0011622 | Ga0500642_0011622_595_1431 | 276 |
| 747 | 3300053156 | Ga0500622_0001257 | Ga0500622_0001257_4343_5179 | 276 |
| 748 | 3300003323 | rootH1_10083328 | rootH1_100833283 | 277 |
| 749 | 3300003781 | Ga0055536_1000004 | Ga0055536_100000495 | 277 |
| 750 | 3300003791 | Ga0055530_10000817 | Ga0055530_1000081733 | 277 |
| 751 | 3300005288 | Ga0065714_10065250 | Ga0065714_1006525010 | 277 |
| 752 | 3300005288 | Ga0065714_10110142 | Ga0065714_101101422 | 277 |
| 753 | 3300005445 | Ga0070708_100000030 | Ga0070708_10000003037 | 277 |
| 754 | 3300009545 | Ga0105237_10013652 | Ga0105237_100136523 | 277 |
| 755 | 3300009545 | Ga0105237_10060642 | Ga0105237_100606423 | 277 |
| 756 | 3300010375 | Ga0105239_10001982 | Ga0105239_1000198218 | 277 |
| 757 | 3300010375 | Ga0105239_10007356 | Ga0105239_100073564 | 277 |
| 758 | 3300013100 | Ga0157373_10008448 | Ga0157373_100084485 | 277 |
| 759 | 3300013102 | Ga0157371_10005650 | Ga0157371_100056504 | 277 |
| 760 | 3300013104 | Ga0157370_10001193 | Ga0157370_1000119331 | 277 |
| 761 | 3300013104 | Ga0157370_10146649 | Ga0157370_101466492 | 277 |
| 762 | 3300013105 | Ga0157369_10000023 | Ga0157369_1000002319 | 277 |
| 763 | 3300013306 | Ga0163162_10000013 | Ga0163162_100000139 | 277 |
| 764 | 3300013306 | Ga0163162_10002182 | Ga0163162_100021829 | 277 |
| 765 | 3300013307 | Ga0157372_10067480 | Ga0157372_100674802 | 277 |
| 766 | 3300014497 | Ga0182008_10000600 | Ga0182008_1000060014 | 277 |
| 767 | 3300015261 | Ga0182006_1000849 | Ga0182006_10008492 | 277 |
| 768 | 3300015261 | Ga0182006_1002239 | Ga0182006_10022393 | 277 |
| 769 | 3300015262 | Ga0182007_10000002 | Ga0182007_10000002447 | 277 |
| 770 | 3300015682 | Ga0183373_1004 | Ga0183373_100449 | 277 |
| 771 | 3300017792 | Ga0163161_10002409 | Ga0163161_100024092 | 277 |
| 772 | 3300017792 | Ga0163161_10003140 | Ga0163161_1000314012 | 277 |
| 773 | 3300025233 | Ga0209437_100119 | Ga0209437_10011975 | 277 |
| 774 | 3300025292 | Ga0209676_1000009 | Ga0209676_1000009458 | 277 |
| 775 | 3300025298 | Ga0209050_1000048 | Ga0209050_1000048254 | 277 |
| 776 | 3300025914 | Ga0207671_10002980 | Ga0207671_1000298016 | 277 |
| 777 | 3300025914 | Ga0207671_10011192 | Ga0207671_100111926 | 277 |
| 778 | 3300028379 | Ga0268266_10000080 | Ga0268266_1000008035 | 277 |
| 779 | 3300031731 | Ga0307405_10000006 | Ga0307405_1000000645 | 277 |
| 780 | 3300031903 | Ga0307407_10000003 | Ga0307407_10000003203 | 277 |
| 781 | 3300031995 | Ga0307409_100110604 | Ga0307409_1001106042 | 277 |
| 782 | 3300032002 | Ga0307416_100000002 | Ga0307416_100000002447 | 277 |
| 783 | 3300035695 | Ga0373927_0170953 | Ga0373927_0170953_229_1068 | 277 |
| 784 | 3300044658 | Ga0466972_0000014 | Ga0466972_0000014_22308_23144 | 277 |
| 785 | 3300044684 | Ga0466966_0230552 | Ga0466966_0230552_179_1018 | 277 |
| 786 | 3300044765 | Ga0466970_0000352 | Ga0466970_0000352_2912_3748 | 277 |
| 787 | 3300045049 | Ga0466959_0055372 | Ga0466959_0055372_501_1340 | 277 |
| 788 | 3300045836 | Ga0466958_0188315 | Ga0466958_0188315_327_1166 | 277 |
| 789 | 3300046462 | Ga0495651_0003054 | Ga0495651_0003054_6983_7822 | 277 |
| 790 | 3300046463 | Ga0495653_0147935 | Ga0495653_0147935_680_1519 | 277 |
| 791 | 3300046476 | Ga0495662_0107767 | Ga0495662_0107767_307_1146 | 277 |
| 792 | 3300046477 | Ga0495664_0009264 | Ga0495664_0009264_2141_2980 | 277 |
| 793 | 3300046507 | Ga0495606_0009521 | Ga0495606_0009521_4075_4914 | 277 |
| 794 | 3300046512 | Ga0495610_0000148 | Ga0495610_0000148_18295_19128 | 277 |
| 795 | 3300046512 | Ga0495610_0002626 | Ga0495610_0002626_13320_14153 | 277 |
| 796 | 3300046512 | Ga0495610_0010777 | Ga0495610_0010777_661_1494 | 277 |
| 797 | 3300046517 | Ga0495630_0025857 | Ga0495630_0025857_2477_3316 | 277 |
| 798 | 3300046517 | Ga0495630_0264441 | Ga0495630_0264441_225_1064 | 277 |
| 799 | 3300046529 | Ga0495652_0189312 | Ga0495652_0189312_220_1059 | 277 |
| 800 | 3300046531 | Ga0495665_0146046 | Ga0495665_0146046_35_874 | 277 |
| 801 | 3300046536 | Ga0495587_0134044 | Ga0495587_0134044_478_1317 | 277 |
| 802 | 3300046665 | Ga0495661_0001078 | Ga0495661_0001078_16676_17515 | 277 |
| 803 | 3300046665 | Ga0495661_0139149 | Ga0495661_0139149_360_1199 | 277 |
| 804 | 3300046678 | Ga0495599_0002460 | Ga0495599_0002460_7006_7845 | 277 |
| 805 | 3300046679 | Ga0495623_0172534 | Ga0495623_0172534_18_857 | 277 |
| 806 | 3300046680 | Ga0495646_0118958 | Ga0495646_0118958_434_1273 | 277 |
| 807 | 3300046809 | Ga0495600_0040352 | Ga0495600_0040352_926_1765 | 277 |
| 808 | 3300047317 | Ga0495604_0144436 | Ga0495604_0144436_769_1608 | 277 |
| 809 | 3300047319 | Ga0495674_0011132 | Ga0495674_0011132_6846_7685 | 277 |
| 810 | 3300049679 | Ga0501249_015647 | Ga0501249_015647_680_1513 | 277 |
| 811 | 3300053138 | Ga0500564_127236 | Ga0500564_127236_117_950 | 277 |
| 812 | 3300002773 | JGI25152J39213_1000006 | JGI25152J39213_100000647 | 278 |
| 813 | 3300002774 | JGI25150J39212_1000005 | JGI25150J39212_1000005186 | 278 |
| 814 | 3300003187 | JGI25151J46595_10000004 | JGI25151J46595_10000004354 | 278 |
| 815 | 3300003215 | JGI25153J46596_10000004 | JGI25153J46596_10000004354 | 278 |
| 816 | 3300005288 | Ga0065714_10007399 | Ga0065714_100073995 | 278 |
| 817 | 3300005339 | Ga0070660_100000172 | Ga0070660_10000017236 | 278 |
| 818 | 3300005339 | Ga0070660_100019016 | Ga0070660_1000190167 | 278 |
| 819 | 3300005341 | Ga0070691_10009132 | Ga0070691_100091323 | 278 |
| 820 | 3300005539 | Ga0068853_100062754 | Ga0068853_1000627544 | 278 |
| 821 | 3300005563 | Ga0068855_100033711 | Ga0068855_1000337113 | 278 |
| 822 | 3300005577 | Ga0068857_100182735 | Ga0068857_1001827352 | 278 |
| 823 | 3300005577 | Ga0068857_100318782 | Ga0068857_1003187822 | 278 |
| 824 | 3300005937 | Ga0081455_10056904 | Ga0081455_100569043 | 278 |
| 825 | 3300009174 | Ga0105241_10092839 | Ga0105241_100928392 | 278 |
| 826 | 3300009545 | Ga0105237_10000381 | Ga0105237_1000038127 | 278 |
| 827 | 3300009545 | Ga0105237_10002553 | Ga0105237_100025539 | 278 |
| 828 | 3300013100 | Ga0157373_10018974 | Ga0157373_100189746 | 278 |
| 829 | 3300013102 | Ga0157371_10001686 | Ga0157371_1000168611 | 278 |
| 830 | 3300013102 | Ga0157371_10009615 | Ga0157371_100096153 | 278 |
| 831 | 3300013102 | Ga0157371_10010104 | Ga0157371_100101044 | 278 |
| 832 | 3300013102 | Ga0157371_10078959 | Ga0157371_100789592 | 278 |
| 833 | 3300013104 | Ga0157370_10000084 | Ga0157370_100000846 | 278 |
| 834 | 3300013104 | Ga0157370_10066433 | Ga0157370_100664335 | 278 |
| 835 | 3300013105 | Ga0157369_10008828 | Ga0157369_100088286 | 278 |
| 836 | 3300013307 | Ga0157372_10606185 | Ga0157372_106061852 | 278 |
| 837 | 3300013308 | Ga0157375_10034701 | Ga0157375_100347014 | 278 |
| 838 | 3300014497 | Ga0182008_10005586 | Ga0182008_100055865 | 278 |
| 839 | 3300015261 | Ga0182006_1000806 | Ga0182006_10008068 | 278 |
| 840 | 3300015262 | Ga0182007_10042238 | Ga0182007_100422381 | 278 |
| 841 | 3300017792 | Ga0163161_10002163 | Ga0163161_100021636 | 278 |
| 842 | 3300017792 | Ga0163161_10195333 | Ga0163161_101953331 | 278 |
| 843 | 3300025245 | Ga0207425_1000008 | Ga0207425_100000884 | 278 |
| 844 | 3300025258 | Ga0209129_1000040 | Ga0209129_1000040181 | 278 |
| 845 | 3300025294 | Ga0209025_1000020 | Ga0209025_100002084 | 278 |
| 846 | 3300025297 | Ga0209758_1000022 | Ga0209758_100002284 | 278 |
| 847 | 3300025909 | Ga0207705_10115602 | Ga0207705_101156022 | 278 |
| 848 | 3300025911 | Ga0207654_10013745 | Ga0207654_100137455 | 278 |
| 849 | 3300025913 | Ga0207695_10036490 | Ga0207695_100364904 | 278 |
| 850 | 3300025914 | Ga0207671_10000006 | Ga0207671_10000006728 | 278 |
| 851 | 3300025914 | Ga0207671_10005707 | Ga0207671_100057079 | 278 |
| 852 | 3300025919 | Ga0207657_10010910 | Ga0207657_100109106 | 278 |
| 853 | 3300025919 | Ga0207657_10048579 | Ga0207657_100485795 | 278 |
| 854 | 3300025921 | Ga0207652_10040702 | Ga0207652_100407024 | 278 |
| 855 | 3300025929 | Ga0207664_10035319 | Ga0207664_100353193 | 278 |
| 856 | 3300025949 | Ga0207667_10085121 | Ga0207667_100851213 | 278 |
| 857 | 3300026041 | Ga0207639_10022983 | Ga0207639_100229832 | 278 |
| 858 | 3300026078 | Ga0207702_10024484 | Ga0207702_100244842 | 278 |
| 859 | 3300026116 | Ga0207674_10038061 | Ga0207674_100380617 | 278 |
| 860 | 3300026142 | Ga0207698_10390424 | Ga0207698_103904241 | 278 |
| 861 | 3300028381 | Ga0268264_10550300 | Ga0268264_105503001 | 278 |
| 862 | 3300028794 | Ga0307515_10007084 | Ga0307515_100070844 | 278 |
| 863 | 3300031235 | Ga0265330_10004610 | Ga0265330_100046105 | 278 |
| 864 | 3300031251 | Ga0265327_10000006 | Ga0265327_1000000699 | 278 |
| 865 | 3300031344 | Ga0265316_10048954 | Ga0265316_100489541 | 278 |
| 866 | 3300031911 | Ga0307412_10000085 | Ga0307412_100000857 | 278 |
| 867 | 3300039447 | Ga0436361_0972882 | Ga0436361_0972882_73290_74180 | 278 |
| 868 | 3300044658 | Ga0466972_0000161 | Ga0466972_0000161_31919_32755 | 278 |
| 869 | 3300046558 | Ga0495633_0000450 | Ga0495633_0000450_1620_2456 | 278 |
| 870 | 3300048925 | Ga0496122_0000862 | Ga0496122_0000862_39167_40003 | 278 |
| 871 | 3300048926 | Ga0496123_0108966 | Ga0496123_0108966_109_945 | 278 |
| 872 | 3300049571 | Ga0501034_0067604 | Ga0501034_0067604_1105_1971 | 278 |
| 873 | 3300049571 | Ga0501034_0105743 | Ga0501034_0105743_1593_2429 | 278 |
| 874 | 3300049572 | Ga0501036_0236528 | Ga0501036_0236528_46_912 | 278 |
| 875 | 3300049574 | Ga0501038_0305870 | Ga0501038_0305870_373_1209 | 278 |
| 876 | 3300049580 | Ga0501046_0004542 | Ga0501046_0004542_2844_3710 | 278 |
| 877 | 3300049582 | Ga0501048_0108718 | Ga0501048_0108718_274_1140 | 278 |
| 878 | 3300049758 | Ga0501241_006434 | Ga0501241_006434_1109_1945 | 278 |
| 879 | 3300049823 | Ga0501044_0121840 | Ga0501044_0121840_751_1617 | 278 |
| 880 | 3300049823 | Ga0501044_0328319 | Ga0501044_0328319_397_1233 | 278 |
| 881 | 3300053093 | Ga0500651_0140347 | Ga0500651_0140347_312_1148 | 278 |
| 882 | 3300053108 | Ga0500562_000095 | Ga0500562_000095_12459_13298 | 278 |
| 883 | 3300053178 | Ga0500637_0090303 | Ga0500637_0090303_726_1562 | 278 |
| 884 | 3300053730 | Ga0500645_004861 | Ga0500645_004861_1296_2135 | 278 |
| 885 | 3300055283 | Ga0500661_001496 | Ga0500661_001496_950_1789 | 278 |
| 886 | 3300044658 | Ga0466972_0000046 | Ga0466972_0000046_8747_9586 | 279 |
| 887 | 3300005563 | Ga0068855_100000856 | Ga0068855_10000085615 | 283 |
| 888 | 3300013296 | Ga0157374_10000011 | Ga0157374_1000001148 | 283 |
| 889 | 3300013296 | Ga0157374_10005516 | Ga0157374_100055164 | 283 |
| 890 | 3300025949 | Ga0207667_10006360 | Ga0207667_100063607 | 283 |
| 891 | iso_pu_bacteria | 2738541284 | 2738762092 | 283 |
| 892 | iso_pu_bacteria | 2738543023 | 2739301928 | 283 |
| 893 | iso_pu_bacteria | 2775506987 | 2776615282 | 283 |
| 894 | 3300009545 | Ga0105237_10001316 | Ga0105237_1000131613 | 284 |
| 895 | 3300014969 | Ga0157376_10271248 | Ga0157376_102712482 | 284 |
| 896 | 3300017792 | Ga0163161_10225768 | Ga0163161_102257682 | 284 |
| 897 | 3300005327 | Ga0070658_10063529 | Ga0070658_100635294 | 285 |
| 898 | 3300005546 | Ga0070696_100075778 | Ga0070696_1000757783 | 285 |
| 899 | 2162886007 | SwRhRL2b_contig_3008445 | SwRhRL2b_0052.00005830 | 287 |
| 900 | 3300003323 | rootH1_10086794 | rootH1_100867942 | 287 |
| 901 | 3300005288 | Ga0065714_10004209 | Ga0065714_100042095 | 287 |
| 902 | 3300005288 | Ga0065714_10009634 | Ga0065714_100096344 | 287 |
| 903 | 3300005289 | Ga0065704_10001893 | Ga0065704_100018933 | 287 |
| 904 | 3300005289 | Ga0065704_10098950 | Ga0065704_100989503 | 287 |
| 905 | 3300013100 | Ga0157373_10049369 | Ga0157373_100493693 | 287 |
| 906 | 3300013100 | Ga0157373_10065552 | Ga0157373_100655523 | 287 |
| 907 | 3300013102 | Ga0157371_10054888 | Ga0157371_100548883 | 287 |
| 908 | 3300013102 | Ga0157371_10140751 | Ga0157371_101407513 | 287 |
| 909 | 3300013104 | Ga0157370_10083652 | Ga0157370_100836523 | 287 |
| 910 | 3300013104 | Ga0157370_10083711 | Ga0157370_100837113 | 287 |
| 911 | 3300014497 | Ga0182008_10000002 | Ga0182008_10000002422 | 287 |
| 912 | 3300015261 | Ga0182006_1088462 | Ga0182006_10884622 | 287 |
| 913 | 3300017792 | Ga0163161_10135846 | Ga0163161_101358462 | 287 |
| 914 | 3300032004 | Ga0307414_10114369 | Ga0307414_101143693 | 287 |
| 915 | 3300053093 | Ga0500651_0000078 | Ga0500651_0000078_29160_30023 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5374 | 19 | 278 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5296 | 19 | 283 |
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5291 | 19 | 278 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5205 | 19 | 283 |
| 8c03-assembly1.cif.gz_A | structure of slc40/ferroportin in complex with vamifeport and synthetic nanobody sy12 in outward-facing conformation | 0.4174 | 53 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PRS0_66_261_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4707 | 55 | 281 | 1.20.1250.20 |
| af_O45678_17_211_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4652 | 54 | 286 | 1.20.1250.20 |
| af_O96156_55_269_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4612 | 54 | 278 | 1.20.1250.20 |
| af_Q2FZP8_207_396_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4478 | 13 | 286 | 1.20.1250.20 |
| af_P0AA76_9_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4474 | 43 | 280 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H7ZCC3-F1-model_v4 | Probable membrane transporter protein | 0.9928 | 10 | 287 |
GO:0005886
|
| AF-A0A7W8QX99-F1-model_v4 | Probable membrane transporter protein | 0.9902 | 10 | 287 |
GO:0005886
|
| AF-A0A4Q3TFN6-F1-model_v4 | deleted | 0.9878 | 10 | 232 |
|
| AF-A0A7W8QX99-F1-model_v4 | Probable membrane transporter protein | 0.9867 | 10 | 287 |
GO:0005886
|
| AF-A0A2V3PMI7-F1-model_v4 | Probable membrane transporter protein | 0.9852 | 9 | 287 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar