F485592

General Info

Members Datasets Scaffolds Average Seq Length
915 360 889 272

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10001316|Ga0105237_1000131613
Length 307
Sequence LSLSINFITGDAGEKVIATFAALNSTVPPMSVIIFTVVILFGSYFAGLLGSLTGLGGGFIIIPLLTLVLHVNLQYAIGASLVSVIATSSGSAAAYVREGITNIRLGMFLEIATTAGAFTGAVVAIYISTQLIAVLFGFILLFSAIMSLRNKAEHIVKEKTFLARKLKLDGNYPVNDELVEYGVSNIAGGFFMMVFAGIISGLLGIGSGALKVVAMDGIMRIPFKVSTTTSNFMIGVTAAASAVVYLQRGYIHPGLAMPVMIGVLLGAATGSKILVHTTSSQRLRWVFAIVITVIAIQMIYNGIQGKI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
16 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
17 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
18 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
19 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
20 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
21 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
22 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
23 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
24 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
25 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
26 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
27 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
31 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
195 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
316 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
345 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
346 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
347 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
348 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
349 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
350 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
351 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
352 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
355 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
356 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
357 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
358 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.26
Nodule 0
Rhizoplane 1.09
Rhizosphere 88.85
Stem 0
Stem Tuber 0
Unclassified 5.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3008445 2162886007 Bacteria 4503
2 JGI24737J22298_10000840 3300001990 Bacteria 10935
3 JGI24735J21928_10021300 3300002067 Bacteria 1980
4 JGI24744J21845_10008150 3300002077 Bacteria 2163
5 JGI25152J39213_1000006 3300002773 Bacteria 158516
6 JGI25150J39212_1000005 3300002774 Bacteria 311800
7 JGI25151J46595_10000004 3300003187 Bacteria 494006
8 JGI25165J46597_1001383 3300003214 Bacteria 13315
9 JGI25165J46597_1010880 3300003214 Bacteria 1315
10 JGI25153J46596_10000004 3300003215 Bacteria 494006
11 rootH1_10139411 3300003316 Bacteria 5392
12 rootH2_10002321 3300003320 Bacteria 110257
13 rootH2_10022605 3300003320 Bacteria 6328
14 rootH2_10258336 3300003320 Bacteria 3929
15 rootH1_10039624 3300003323 Bacteria 15166
16 rootH1_10068371 3300003323 Bacteria 2372
17 rootH1_10083328 3300003323 Bacteria 4598
18 rootH1_10086794 3300003323 Bacteria 3600
19 rootH1_10235905 3300003323 Bacteria 3306
20 Ga0055536_1000004 3300003781 Bacteria 411108
21 Ga0055530_10000817 3300003791 Bacteria 25836
22 Ga0065714_10004209 3300005288 Bacteria 5260
23 Ga0065714_10005173 3300005288 Bacteria 5531
24 Ga0065714_10007399 3300005288 Bacteria 5260
25 Ga0065714_10009634 3300005288 Bacteria 2983
26 Ga0065714_10065250 3300005288 Bacteria 11440
27 Ga0065714_10108862 3300005288 Bacteria 1494
28 Ga0065714_10110142 3300005288 Bacteria 1485
29 Ga0065704_10001893 3300005289 Bacteria 6314
30 Ga0065704_10098950 3300005289 Bacteria 2324
31 Ga0070658_10000200 3300005327 Bacteria 52651
32 Ga0070658_10063529 3300005327 Bacteria 3010
33 Ga0070658_10074142 3300005327 Bacteria 2791
34 Ga0070658_10193955 3300005327 Bacteria 1713
35 Ga0070658_10466577 3300005327 Bacteria 1089
36 Ga0070676_10002382 3300005328 Bacteria 9622
37 Ga0070683_100019588 3300005329 Bacteria 6011
38 Ga0070683_100022500 3300005329 Bacteria 5633
39 Ga0070683_100028155 3300005329 Bacteria 5076
40 Ga0070683_100040343 3300005329 Bacteria 4292
41 Ga0070683_100168911 3300005329 Bacteria 2076
42 Ga0070683_100336686 3300005329 Bacteria 1437
43 Ga0070670_100000465 3300005331 Bacteria 32818
44 Ga0068869_100026879 3300005334 Bacteria 4007
45 Ga0070680_100002217 3300005336 Bacteria 14323
46 Ga0070680_100053695 3300005336 Bacteria 3289
47 Ga0070680_100060347 3300005336 Bacteria 3104
48 Ga0070682_100379000 3300005337 Bacteria 1063
49 Ga0068868_100005678 3300005338 Bacteria 8784
50 Ga0068868_100018805 3300005338 Bacteria 5169
51 Ga0068868_100029959 3300005338 Bacteria 4171
52 Ga0068868_100087456 3300005338 Bacteria 2506
53 Ga0070660_100000172 3300005339 Bacteria 42371
54 Ga0070660_100019016 3300005339 Bacteria 5029
55 Ga0070660_100052135 3300005339 Unclassified 3153
56 Ga0070660_100062739 3300005339 Bacteria 2888
57 Ga0070691_10009132 3300005341 Bacteria 4533
58 Ga0070691_10157308 3300005341 Bacteria 1169
59 Ga0070687_100014799 3300005343 Unclassified 3513
60 Ga0070675_100102479 3300005354 Bacteria 2412
61 Ga0070675_100547737 3300005354 Unclassified 1046
62 Ga0070671_100006664 3300005355 Bacteria 9235
63 Ga0070671_100109826 3300005355 Unclassified 2316
64 Ga0070673_100015777 3300005364 Bacteria 5319
65 Ga0070673_100023233 3300005364 Bacteria 4529
66 Ga0070673_100531917 3300005364 Bacteria 1066
67 Ga0070688_100204885 3300005365 Bacteria 1382
68 Ga0070659_100000242 3300005366 Bacteria 42847
69 Ga0070659_100005922 3300005366 Bacteria 8813
70 Ga0070659_100053736 3300005366 Bacteria 3171
71 Ga0070667_100086003 3300005367 Bacteria 2697
72 Ga0070709_10030139 3300005434 Bacteria 3253
73 Ga0070709_10037304 3300005434 Bacteria 2967
74 Ga0070709_10136544 3300005434 Bacteria 1680
75 Ga0070714_100001995 3300005435 Bacteria 14916
76 Ga0070714_100029083 3300005435 Bacteria 4591
77 Ga0070714_100074413 3300005435 Bacteria 2945
78 Ga0070714_100150627 3300005435 Bacteria 2096
79 Ga0070714_100214080 3300005435 Bacteria 1767
80 Ga0070714_100267949 3300005435 Bacteria 1583
81 Ga0070713_100000575 3300005436 Bacteria 23317
82 Ga0070713_100005330 3300005436 Bacteria 8774
83 Ga0070713_100024471 3300005436 Bacteria 4703
84 Ga0070713_100029003 3300005436 Bacteria 4376
85 Ga0070713_100056196 3300005436 Unclassified 3274
86 Ga0070713_100277175 3300005436 Unclassified 1537
87 Ga0070713_100371473 3300005436 Bacteria 1331
88 Ga0070710_10007071 3300005437 Bacteria 5418
89 Ga0070711_100025932 3300005439 Unclassified 3838
90 Ga0070711_100026344 3300005439 Bacteria 3809
91 Ga0070711_100059361 3300005439 Bacteria 2655
92 Ga0070711_100197309 3300005439 Bacteria 1551
93 Ga0070705_100065277 3300005440 Bacteria 2178
94 Ga0070708_100000030 3300005445 Bacteria 96247
95 Ga0070708_100001090 3300005445 Bacteria 20733
96 Ga0070708_100005564 3300005445 Bacteria 9983
97 Ga0070708_100085950 3300005445 Unclassified 2856
98 Ga0070708_100493438 3300005445 Bacteria 1155
99 Ga0070678_100013519 3300005456 Bacteria 5122
100 Ga0070662_100000877 3300005457 Bacteria 18384
101 Ga0070662_100083699 3300005457 Bacteria 2382
102 Ga0070681_10000026 3300005458 Bacteria 107615
103 Ga0070681_10004904 3300005458 Bacteria 12846
104 Ga0070681_10007353 3300005458 Bacteria 10764
105 Ga0070681_10165503 3300005458 Bacteria 2134
106 Ga0070681_10418966 3300005458 Unclassified 1251
107 Ga0070681_10501598 3300005458 Bacteria 1127
108 Ga0068867_100000040 3300005459 Bacteria 78509
109 Ga0068867_100008021 3300005459 Bacteria 7463
110 Ga0070706_100001928 3300005467 Bacteria 21387
111 Ga0070706_100008523 3300005467 Bacteria 9557
112 Ga0070706_100312357 3300005467 Unclassified 1466
113 Ga0070706_100445040 3300005467 Bacteria 1206
114 Ga0070707_100000176 3300005468 Bacteria 62533
115 Ga0070698_100037908 3300005471 Bacteria 4969
116 Ga0070699_100248493 3300005518 Bacteria 1589
117 Ga0070699_100438424 3300005518 Archaea 1184
118 Ga0070679_100002685 3300005530 Bacteria 16206
119 Ga0070679_100007648 3300005530 Bacteria 10114
120 Ga0070679_100034515 3300005530 Bacteria 5014
121 Ga0070679_100193934 3300005530 Bacteria 1999
122 Ga0070679_100221366 3300005530 Bacteria 1853
123 Ga0070679_100225608 3300005530 Bacteria 1834
124 Ga0070679_100261166 3300005530 Unclassified 1687
125 Ga0070684_100110088 3300005535 Bacteria 2469
126 Ga0070684_100197397 3300005535 Bacteria 1832
127 Ga0070684_100201531 3300005535 Unclassified 1813
128 Ga0070684_100274124 3300005535 Bacteria 1545
129 Ga0070697_100005597 3300005536 Archaea 9684
130 Ga0070697_100269584 3300005536 Bacteria 1459
131 Ga0068853_100005706 3300005539 Bacteria 9792
132 Ga0068853_100007080 3300005539 Bacteria 8971
133 Ga0068853_100062754 3300005539 Bacteria 3217
134 Ga0068853_100090731 3300005539 Bacteria 2686
135 Ga0068853_100280145 3300005539 Bacteria 1537
136 Ga0070686_100107443 3300005544 Bacteria 1895
137 Ga0070696_100075778 3300005546 Unclassified 2374
138 Ga0070665_100000010 3300005548 Bacteria 529545
139 Ga0070665_100207748 3300005548 Bacteria 1959
140 Ga0070665_100325771 3300005548 Bacteria 1540
141 Ga0068855_100000054 3300005563 Bacteria 139322
142 Ga0068855_100000295 3300005563 Bacteria 61909
143 Ga0068855_100000856 3300005563 Bacteria 37762
144 Ga0068855_100001626 3300005563 Bacteria 28175
145 Ga0068855_100009839 3300005563 Bacteria 11535
146 Ga0068855_100012882 3300005563 Bacteria 10090
147 Ga0068855_100033711 3300005563 Bacteria 6109
148 Ga0068855_100077266 3300005563 Bacteria 3862
149 Ga0068855_100084338 3300005563 Unclassified 3679
150 Ga0068855_100110740 3300005563 Bacteria 3151
151 Ga0068855_100188833 3300005563 Unclassified 2325
152 Ga0068855_100211524 3300005563 Bacteria 2179
153 Ga0070664_100008525 3300005564 Bacteria 8289
154 Ga0070664_100052380 3300005564 Unclassified 3457
155 Ga0070664_100179556 3300005564 Unclassified 1881
156 Ga0068857_100000036 3300005577 Bacteria 72327
157 Ga0068857_100002465 3300005577 Bacteria 15129
158 Ga0068857_100036079 3300005577 Bacteria 4381
159 Ga0068857_100182735 3300005577 Bacteria 1908
160 Ga0068857_100318782 3300005577 Bacteria 1435
161 Ga0068854_100003663 3300005578 Bacteria 9611
162 Ga0068854_100080200 3300005578 Bacteria 2408
163 Ga0068854_100403486 3300005578 Bacteria 1132
164 Ga0068856_100000023 3300005614 Bacteria 141671
165 Ga0068856_100000407 3300005614 Bacteria 47326
166 Ga0068856_100001013 3300005614 Bacteria 29894
167 Ga0068856_100002064 3300005614 Bacteria 20820
168 Ga0068856_100005806 3300005614 Bacteria 12161
169 Ga0068856_100014557 3300005614 Bacteria 7600
170 Ga0068856_100022934 3300005614 Bacteria 6070
171 Ga0068856_100028518 3300005614 Bacteria 5451
172 Ga0068856_100042307 3300005614 Bacteria 4481
173 Ga0068856_100074931 3300005614 Bacteria 3351
174 Ga0068856_100163191 3300005614 Bacteria 2239
175 Ga0068856_100178323 3300005614 Bacteria 2137
176 Ga0068856_100190440 3300005614 Bacteria 2065
177 Ga0068856_100226671 3300005614 Unclassified 1884
178 Ga0068856_100266109 3300005614 Bacteria 1730
179 Ga0068856_100406242 3300005614 Unclassified 1381
180 Ga0068852_100033904 3300005616 Bacteria 4244
181 Ga0068852_100093087 3300005616 Bacteria 2700
182 Ga0068852_100339780 3300005616 Bacteria 1463
183 Ga0068852_100559249 3300005616 Bacteria 1145
184 Ga0068859_100001163 3300005617 Bacteria 26891
185 Ga0068864_100000684 3300005618 Bacteria 28437
186 Ga0068864_100055045 3300005618 Bacteria 3434
187 Ga0068866_10011030 3300005718 Bacteria 3894
188 Ga0068870_10144267 3300005840 Bacteria 1396
189 Ga0068863_100024417 3300005841 Bacteria 5765
190 Ga0068863_100102141 3300005841 Bacteria 2726
191 Ga0068858_100014126 3300005842 Bacteria 7531
192 Ga0068858_100020900 3300005842 Bacteria 6117
193 Ga0068858_100088342 3300005842 Bacteria 2884
194 Ga0068860_100048369 3300005843 Bacteria 4053
195 Ga0068860_100391785 3300005843 Bacteria 1373
196 Ga0081455_10013928 3300005937 Bacteria 7904
197 Ga0081455_10056904 3300005937 Bacteria 3318
198 Ga0070717_10001574 3300006028 Bacteria 15793
199 Ga0070717_10001844 3300006028 Bacteria 14794
200 Ga0070717_10007845 3300006028 Bacteria 7946
201 Ga0070717_10007951 3300006028 Bacteria 7898
202 Ga0070717_10020023 3300006028 Bacteria 5256
203 Ga0070717_10049436 3300006028 Unclassified 3452
204 Ga0070717_10057142 3300006028 Bacteria 3225
205 Ga0070717_10129472 3300006028 Bacteria 2169
206 Ga0070717_10402465 3300006028 Unclassified 1230
207 Ga0070717_10655569 3300006028 Bacteria 953
208 Ga0070716_100010634 3300006173 Bacteria 4618
209 Ga0070716_100106153 3300006173 Bacteria 1732
210 Ga0070712_100009888 3300006175 Bacteria 6014
211 Ga0097621_100000011 3300006237 Bacteria 111116
212 Ga0097621_100000237 3300006237 Bacteria 37036
213 Ga0097621_100014508 3300006237 Bacteria 5898
214 Ga0097621_100060336 3300006237 Bacteria 3109
215 Ga0068871_100001088 3300006358 Bacteria 18235
216 Ga0068871_100002121 3300006358 Bacteria 13435
217 Ga0068871_100003357 3300006358 Bacteria 10999
218 Ga0068865_100001113 3300006881 Bacteria 15548
219 Ga0068865_100040696 3300006881 Bacteria 3160
220 Ga0075436_100039498 3300006914 Bacteria 3257
221 Ga0097620_100001163 3300006931 Bacteria 26891
222 Ga0099794_10000923 3300007265 Archaea 9921
223 Ga0099794_10131581 3300007265 Unclassified 1263
224 Ga0105240_10000558 3300009093 Bacteria 69072
225 Ga0105240_10002861 3300009093 Bacteria 27285
226 Ga0105240_10003887 3300009093 Bacteria 23076
227 Ga0105240_10004872 3300009093 Bacteria 20190
228 Ga0105240_10012765 3300009093 Bacteria 11577
229 Ga0105240_10031483 3300009093 Bacteria 6880
230 Ga0105240_10046934 3300009093 Bacteria 5469
231 Ga0105240_10062993 3300009093 Bacteria 4615
232 Ga0105240_10085284 3300009093 Bacteria 3870
233 Ga0105240_10085736 3300009093 Bacteria 3858
234 Ga0105240_10109624 3300009093 Bacteria 3343
235 Ga0105240_10133272 3300009093 Bacteria 2978
236 Ga0105240_10180658 3300009093 Bacteria 2490
237 Ga0105240_10282272 3300009093 Bacteria 1907
238 Ga0105240_10314348 3300009093 Bacteria 1787
239 Ga0105240_10386510 3300009093 Bacteria 1579
240 Ga0105240_10447387 3300009093 Bacteria 1446
241 Ga0105240_10694057 3300009093 Bacteria 1112
242 Ga0105241_10003934 3300009174 Bacteria 10993
243 Ga0105241_10006678 3300009174 Bacteria 8490
244 Ga0105241_10074887 3300009174 Bacteria 2637
245 Ga0105241_10092839 3300009174 Bacteria 2384
246 Ga0105241_10335181 3300009174 Bacteria 1309
247 Ga0105241_10710459 3300009174 Bacteria 918
248 Ga0105242_10011984 3300009176 Bacteria 6675
249 Ga0105242_10075022 3300009176 Unclassified 2815
250 Ga0105248_10003155 3300009177 Bacteria 18246
251 Ga0105248_10046585 3300009177 Bacteria 4860
252 Ga0105248_10217286 3300009177 Bacteria 2153
253 Ga0105237_10000381 3300009545 Bacteria 63311
254 Ga0105237_10001316 3300009545 Bacteria 32951
255 Ga0105237_10002553 3300009545 Bacteria 22488
256 Ga0105237_10004319 3300009545 Bacteria 16482
257 Ga0105237_10004940 3300009545 Bacteria 15232
258 Ga0105237_10006655 3300009545 Bacteria 12769
259 Ga0105237_10011977 3300009545 Bacteria 9166
260 Ga0105237_10013652 3300009545 Bacteria 8505
261 Ga0105237_10056078 3300009545 Unclassified 3945
262 Ga0105237_10060642 3300009545 Bacteria 3784
263 Ga0105237_10086070 3300009545 Bacteria 3133
264 Ga0105237_10150727 3300009545 Bacteria 2322
265 Ga0105237_10219924 3300009545 Bacteria 1899
266 Ga0105237_10242362 3300009545 Unclassified 1804
267 Ga0105237_10848719 3300009545 Bacteria 920
268 Ga0105238_10000848 3300009551 Bacteria 31448
269 Ga0105238_10003247 3300009551 Bacteria 16233
270 Ga0105238_10031206 3300009551 Bacteria 5424
271 Ga0105238_10055666 3300009551 Bacteria 3970
272 Ga0105238_10113584 3300009551 Bacteria 2688
273 Ga0105239_10000011 3300010375 Bacteria 337500
274 Ga0105239_10001982 3300010375 Bacteria 26624
275 Ga0105239_10004282 3300010375 Bacteria 17118
276 Ga0105239_10006110 3300010375 Bacteria 14024
277 Ga0105239_10007356 3300010375 Bacteria 12647
278 Ga0105239_10008277 3300010375 Bacteria 11858
279 Ga0105239_10026773 3300010375 Bacteria 6346
280 Ga0105239_10037880 3300010375 Bacteria 5283
281 Ga0105239_10084130 3300010375 Bacteria 3504
282 Ga0105239_10137966 3300010375 Unclassified 2716
283 Ga0105239_10150101 3300010375 Bacteria 2601
284 Ga0105239_10214113 3300010375 Bacteria 2160
285 Ga0105239_10728387 3300010375 Bacteria 1135
286 Ga0105246_10002620 3300011119 Bacteria 10886
287 Ga0105246_10033519 3300011119 Bacteria 3415
288 Ga0157373_10008448 3300013100 Bacteria 7646
289 Ga0157373_10012250 3300013100 Bacteria 6305
290 Ga0157373_10016721 3300013100 Bacteria 5346
291 Ga0157373_10018974 3300013100 Bacteria 5006
292 Ga0157373_10040777 3300013100 Bacteria 3322
293 Ga0157373_10049369 3300013100 Bacteria 2999
294 Ga0157373_10065552 3300013100 Bacteria 2570
295 Ga0157373_10222128 3300013100 Bacteria 1333
296 Ga0157371_10001686 3300013102 Bacteria 22505
297 Ga0157371_10005650 3300013102 Bacteria 10499
298 Ga0157371_10009615 3300013102 Bacteria 7601
299 Ga0157371_10010104 3300013102 Bacteria 7378
300 Ga0157371_10050715 3300013102 Bacteria 2949
301 Ga0157371_10054888 3300013102 Bacteria 2828
302 Ga0157371_10066523 3300013102 Bacteria 2552
303 Ga0157371_10078959 3300013102 Bacteria 2331
304 Ga0157371_10140751 3300013102 Bacteria 1718
305 Ga0157371_10306216 3300013102 Bacteria 1151
306 Ga0157370_10000084 3300013104 Bacteria 104159
307 Ga0157370_10000173 3300013104 Bacteria 80263
308 Ga0157370_10001193 3300013104 Bacteria 32395
309 Ga0157370_10010467 3300013104 Bacteria 9769
310 Ga0157370_10010945 3300013104 Bacteria 9522
311 Ga0157370_10027543 3300013104 Bacteria 5603
312 Ga0157370_10066433 3300013104 Bacteria 3411
313 Ga0157370_10083652 3300013104 Bacteria 3000
314 Ga0157370_10083711 3300013104 Bacteria 2999
315 Ga0157370_10101904 3300013104 Bacteria 2689
316 Ga0157370_10146649 3300013104 Bacteria 2197
317 Ga0157370_10253898 3300013104 Unclassified 1626
318 Ga0157370_10280241 3300013104 Bacteria 1540
319 Ga0157370_10297377 3300013104 Bacteria 1490
320 Ga0157370_10425220 3300013104 Bacteria 1222
321 Ga0157369_10000023 3300013105 Bacteria 226955
322 Ga0157369_10000124 3300013105 Bacteria 110693
323 Ga0157369_10008828 3300013105 Bacteria 11547
324 Ga0157369_10021963 3300013105 Bacteria 7132
325 Ga0157369_10022924 3300013105 Bacteria 6962
326 Ga0157369_10028633 3300013105 Bacteria 6164
327 Ga0157369_10031489 3300013105 Bacteria 5839
328 Ga0157369_10047163 3300013105 Unclassified 4680
329 Ga0157369_10051510 3300013105 Bacteria 4455
330 Ga0157369_10069306 3300013105 Bacteria 3789
331 Ga0157369_10098242 3300013105 Unclassified 3123
332 Ga0157369_10143317 3300013105 Bacteria 2527
333 Ga0157369_10159442 3300013105 Bacteria 2382
334 Ga0157369_10283249 3300013105 Bacteria 1726
335 Ga0157369_10367376 3300013105 Bacteria 1494
336 Ga0157374_10000011 3300013296 Bacteria 466749
337 Ga0157374_10000162 3300013296 Bacteria 61913
338 Ga0157374_10000391 3300013296 Bacteria 40035
339 Ga0157374_10000667 3300013296 Bacteria 30210
340 Ga0157374_10001058 3300013296 Bacteria 23891
341 Ga0157374_10001625 3300013296 Bacteria 18840
342 Ga0157374_10005516 3300013296 Bacteria 10634
343 Ga0157374_10021199 3300013296 Bacteria 5777
344 Ga0157374_10056135 3300013296 Bacteria 3676
345 Ga0157374_10137383 3300013296 Unclassified 2371
346 Ga0157374_10430488 3300013296 Unclassified 1319
347 Ga0157378_10000020 3300013297 Bacteria 131245
348 Ga0157378_10000320 3300013297 Bacteria 47177
349 Ga0157378_10012884 3300013297 Bacteria 7322
350 Ga0157378_10028561 3300013297 Bacteria 4923
351 Ga0157378_10083027 3300013297 Bacteria 2898
352 Ga0157378_10119822 3300013297 Bacteria 2424
353 Ga0157378_10644725 3300013297 Bacteria 1074
354 Ga0163162_10000013 3300013306 Bacteria 275366
355 Ga0163162_10000082 3300013306 Bacteria 86888
356 Ga0163162_10002182 3300013306 Bacteria 18354
357 Ga0163162_10005591 3300013306 Bacteria 12161
358 Ga0157372_10000084 3300013307 Bacteria 98431
359 Ga0157372_10001112 3300013307 Bacteria 29221
360 Ga0157372_10001395 3300013307 Bacteria 26028
361 Ga0157372_10005137 3300013307 Bacteria 13912
362 Ga0157372_10009649 3300013307 Bacteria 10259
363 Ga0157372_10018191 3300013307 Bacteria 7554
364 Ga0157372_10028068 3300013307 Bacteria 6139
365 Ga0157372_10054272 3300013307 Bacteria 4469
366 Ga0157372_10067480 3300013307 Bacteria 4019
367 Ga0157372_10109261 3300013307 Bacteria 3167
368 Ga0157372_10112776 3300013307 Bacteria 3116
369 Ga0157372_10257431 3300013307 Bacteria 2026
370 Ga0157372_10324072 3300013307 Unclassified 1794
371 Ga0157372_10541205 3300013307 Bacteria 1358
372 Ga0157372_10606185 3300013307 Bacteria 1276
373 Ga0157372_10817697 3300013307 Bacteria 1082
374 Ga0157375_10009398 3300013308 Bacteria 8584
375 Ga0157375_10034701 3300013308 Bacteria 4808
376 Ga0163163_10059148 3300014325 Bacteria 3790
377 Ga0163163_10202252 3300014325 Bacteria 2035
378 Ga0182008_10000002 3300014497 Bacteria 480216
379 Ga0182008_10000600 3300014497 Bacteria 26471
380 Ga0182008_10005586 3300014497 Bacteria 7133
381 Ga0157379_10026657 3300014968 Bacteria 5144
382 Ga0157376_10016338 3300014969 Bacteria 5632
383 Ga0157376_10020473 3300014969 Bacteria 5117
384 Ga0157376_10040319 3300014969 Bacteria 3816
385 Ga0157376_10271248 3300014969 Bacteria 1594
386 Ga0182006_1000806 3300015261 Bacteria 21001
387 Ga0182006_1000849 3300015261 Bacteria 20567
388 Ga0182006_1002239 3300015261 Bacteria 10695
389 Ga0182006_1010004 3300015261 Bacteria 4231
390 Ga0182006_1088462 3300015261 Bacteria 1118
391 Ga0182007_10000002 3300015262 Bacteria 564661
392 Ga0182007_10042238 3300015262 Bacteria 1518
393 Ga0183373_1004 3300015682 Bacteria 537398
394 Ga0163161_10002163 3300017792 Bacteria 14176
395 Ga0163161_10002409 3300017792 Bacteria 13411
396 Ga0163161_10003140 3300017792 Bacteria 11646
397 Ga0163161_10135846 3300017792 Bacteria 1859
398 Ga0163161_10195333 3300017792 Bacteria 1557
399 Ga0163161_10225768 3300017792 Bacteria 1452
400 Ga0213873_10020392 3300021358 Bacteria 1548
401 Ga0213872_10002892 3300021361 Bacteria 9779
402 Ga0213872_10051840 3300021361 Bacteria 1862
403 Ga0213874_10019751 3300021377 Bacteria 1838
404 Ga0213876_10067790 3300021384 Bacteria 1885
405 Ga0213876_10143007 3300021384 Bacteria 1272
406 Ga0213875_10000013 3300021388 Bacteria 305595
407 Ga0207427_100137 3300025231 Bacteria 88182
408 Ga0209437_100112 3300025233 Bacteria 214292
409 Ga0209437_100119 3300025233 Bacteria 206549
410 Ga0207425_1000008 3300025245 Bacteria 618024
411 Ga0209026_1004556 3300025250 Bacteria 4075
412 Ga0209129_1000040 3300025258 Bacteria 313043
413 Ga0209233_1000126 3300025261 Bacteria 214298
414 Ga0209233_1001504 3300025261 Bacteria 9164
415 Ga0209233_1008644 3300025261 Bacteria 3133
416 Ga0209676_1000009 3300025292 Bacteria 981719
417 Ga0209025_1000020 3300025294 Bacteria 618024
418 Ga0209758_1000022 3300025297 Bacteria 618024
419 Ga0209050_1000048 3300025298 Bacteria 371553
420 Ga0207692_10004695 3300025898 Bacteria 5421
421 Ga0207692_10147538 3300025898 Bacteria 1344
422 Ga0207647_10000046 3300025904 Bacteria 90148
423 Ga0207647_10000171 3300025904 Bacteria 51875
424 Ga0207647_10057239 3300025904 Bacteria 2390
425 Ga0207699_10010688 3300025906 Unclassified 4616
426 Ga0207645_10001612 3300025907 Bacteria 18396
427 Ga0207643_10085460 3300025908 Bacteria 1832
428 Ga0207705_10000257 3300025909 Bacteria 51549
429 Ga0207705_10115602 3300025909 Unclassified 1985
430 Ga0207684_10000812 3300025910 Bacteria 36095
431 Ga0207684_10082298 3300025910 Bacteria 2741
432 Ga0207684_10376805 3300025910 Bacteria 1221
433 Ga0207654_10001865 3300025911 Bacteria 10912
434 Ga0207654_10013745 3300025911 Bacteria 4170
435 Ga0207707_10000800 3300025912 Bacteria 30836
436 Ga0207707_10005146 3300025912 Bacteria 11464
437 Ga0207707_10071101 3300025912 Bacteria 3032
438 Ga0207707_10265941 3300025912 Bacteria 1487
439 Ga0207707_10446698 3300025912 Bacteria 1107
440 Ga0207695_10000351 3300025913 Bacteria 105891
441 Ga0207695_10000658 3300025913 Bacteria 68310
442 Ga0207695_10021867 3300025913 Bacteria 7282
443 Ga0207695_10029736 3300025913 Bacteria 6028
444 Ga0207695_10031138 3300025913 Bacteria 5857
445 Ga0207695_10036490 3300025913 Bacteria 5314
446 Ga0207695_10043027 3300025913 Bacteria 4817
447 Ga0207695_10052703 3300025913 Bacteria 4260
448 Ga0207695_10065573 3300025913 Bacteria 3733
449 Ga0207695_10077828 3300025913 Bacteria 3367
450 Ga0207695_10098617 3300025913 Bacteria 2921
451 Ga0207695_10223355 3300025913 Bacteria 1790
452 Ga0207695_10298667 3300025913 Bacteria 1502
453 Ga0207695_10349272 3300025913 Bacteria 1366
454 Ga0207695_10411137 3300025913 Bacteria 1237
455 Ga0207671_10000006 3300025914 Bacteria 836809
456 Ga0207671_10002980 3300025914 Bacteria 17367
457 Ga0207671_10003029 3300025914 Bacteria 17218
458 Ga0207671_10005707 3300025914 Bacteria 11360
459 Ga0207671_10008730 3300025914 Bacteria 8540
460 Ga0207671_10010521 3300025914 Bacteria 7625
461 Ga0207671_10011192 3300025914 Bacteria 7322
462 Ga0207671_10019385 3300025914 Bacteria 5201
463 Ga0207671_10029864 3300025914 Bacteria 4068
464 Ga0207671_10129435 3300025914 Bacteria 1936
465 Ga0207671_10160916 3300025914 Bacteria 1738
466 Ga0207671_10191671 3300025914 Bacteria 1594
467 Ga0207693_10003255 3300025915 Bacteria 13927
468 Ga0207693_10015937 3300025915 Bacteria 6018
469 Ga0207693_10203524 3300025915 Bacteria 1557
470 Ga0207663_10018868 3300025916 Unclassified 3874
471 Ga0207663_10025308 3300025916 Bacteria 3429
472 Ga0207663_10314646 3300025916 Bacteria 1174
473 Ga0207660_10000011 3300025917 Bacteria 89179
474 Ga0207660_10002156 3300025917 Bacteria 13062
475 Ga0207660_10027486 3300025917 Bacteria 3883
476 Ga0207660_10047295 3300025917 Bacteria 3041
477 Ga0207662_10032738 3300025918 Bacteria 3027
478 Ga0207657_10010910 3300025919 Bacteria 9042
479 Ga0207657_10034733 3300025919 Bacteria 4530
480 Ga0207657_10048579 3300025919 Bacteria 3704
481 Ga0207649_10115458 3300025920 Bacteria 1801
482 Ga0207652_10004418 3300025921 Bacteria 11456
483 Ga0207652_10040702 3300025921 Bacteria 3947
484 Ga0207652_10043526 3300025921 Bacteria 3823
485 Ga0207652_10192895 3300025921 Bacteria 1832
486 Ga0207652_10264368 3300025921 Bacteria 1552
487 Ga0207652_10299426 3300025921 Bacteria 1452
488 Ga0207652_10514051 3300025921 Bacteria 1078
489 Ga0207646_10000811 3300025922 Bacteria 40685
490 Ga0207694_10000434 3300025924 Bacteria 38832
491 Ga0207694_10016698 3300025924 Bacteria 5548
492 Ga0207694_10033670 3300025924 Bacteria 3925
493 Ga0207694_10072774 3300025924 Bacteria 2688
494 Ga0207694_10114827 3300025924 Bacteria 2145
495 Ga0207650_10000976 3300025925 Bacteria 21527
496 Ga0207659_10235727 3300025926 Bacteria 1478
497 Ga0207659_10467900 3300025926 Unclassified 1064
498 Ga0207700_10000907 3300025928 Bacteria 16997
499 Ga0207700_10001252 3300025928 Bacteria 14454
500 Ga0207700_10102797 3300025928 Bacteria 2283
501 Ga0207700_10105783 3300025928 Unclassified 2254
502 Ga0207700_10117371 3300025928 Bacteria 2152
503 Ga0207664_10023773 3300025929 Bacteria 4597
504 Ga0207664_10035319 3300025929 Bacteria 3856
505 Ga0207664_10065613 3300025929 Unclassified 2907
506 Ga0207664_10107542 3300025929 Bacteria 2314
507 Ga0207664_10124260 3300025929 Bacteria 2164
508 Ga0207664_10209267 3300025929 Bacteria 1687
509 Ga0207664_10503296 3300025929 Bacteria 1085
510 Ga0207664_10585085 3300025929 Bacteria 1002
511 Ga0207644_10024997 3300025931 Bacteria 4103
512 Ga0207644_10105521 3300025931 Unclassified 2123
513 Ga0207690_10001885 3300025932 Bacteria 12869
514 Ga0207690_10006251 3300025932 Bacteria 7053
515 Ga0207706_10001858 3300025933 Bacteria 20682
516 Ga0207704_10000169 3300025938 Bacteria 34738
517 Ga0207704_10013811 3300025938 Bacteria 4057
518 Ga0207665_10003917 3300025939 Bacteria 9965
519 Ga0207665_10085746 3300025939 Unclassified 2175
520 Ga0207665_10096809 3300025939 Bacteria 2053
521 Ga0207665_10148690 3300025939 Bacteria 1676
522 Ga0207711_10273095 3300025941 Bacteria 1556
523 Ga0207689_10066546 3300025942 Bacteria 2962
524 Ga0207661_10044284 3300025944 Bacteria 3517
525 Ga0207661_10244393 3300025944 Bacteria 1593
526 Ga0207679_10005041 3300025945 Bacteria 8255
527 Ga0207667_10000023 3300025949 Bacteria 362527
528 Ga0207667_10000591 3300025949 Bacteria 47010
529 Ga0207667_10003075 3300025949 Bacteria 20688
530 Ga0207667_10006360 3300025949 Bacteria 14316
531 Ga0207667_10020179 3300025949 Bacteria 7418
532 Ga0207667_10037903 3300025949 Bacteria 5151
533 Ga0207667_10067382 3300025949 Bacteria 3729
534 Ga0207667_10085121 3300025949 Bacteria 3273
535 Ga0207667_10087393 3300025949 Bacteria 3225
536 Ga0207667_10329862 3300025949 Bacteria 1558
537 Ga0207651_10011591 3300025960 Unclassified 4943
538 Ga0207651_10034259 3300025960 Bacteria 3286
539 Ga0207640_10010314 3300025981 Bacteria 5259
540 Ga0207640_10030346 3300025981 Bacteria 3328
541 Ga0207677_10005304 3300026023 Bacteria 6987
542 Ga0207677_10009929 3300026023 Bacteria 5367
543 Ga0207677_10127799 3300026023 Bacteria 1924
544 Ga0207703_10014595 3300026035 Bacteria 6129
545 Ga0207703_10070450 3300026035 Bacteria 2886
546 Ga0207639_10003935 3300026041 Bacteria 10028
547 Ga0207639_10022983 3300026041 Bacteria 4496
548 Ga0207639_10023165 3300026041 Bacteria 4481
549 Ga0207639_10045199 3300026041 Bacteria 3316
550 Ga0207639_10156581 3300026041 Unclassified 1914
551 Ga0207702_10000114 3300026078 Bacteria 93951
552 Ga0207702_10000314 3300026078 Bacteria 55437
553 Ga0207702_10001495 3300026078 Bacteria 23103
554 Ga0207702_10005292 3300026078 Bacteria 11321
555 Ga0207702_10012932 3300026078 Bacteria 6944
556 Ga0207702_10016448 3300026078 Bacteria 6123
557 Ga0207702_10016626 3300026078 Bacteria 6087
558 Ga0207702_10024484 3300026078 Bacteria 5010
559 Ga0207702_10025937 3300026078 Unclassified 4866
560 Ga0207702_10061438 3300026078 Bacteria 3205
561 Ga0207702_10165243 3300026078 Bacteria 2024
562 Ga0207702_10224419 3300026078 Bacteria 1752
563 Ga0207702_10328041 3300026078 Unclassified 1459
564 Ga0207702_10502683 3300026078 Bacteria 1182
565 Ga0207641_10006671 3300026088 Bacteria 9691
566 Ga0207648_10000220 3300026089 Bacteria 61703
567 Ga0207676_10004134 3300026095 Bacteria 10249
568 Ga0207676_10043265 3300026095 Bacteria 3467
569 Ga0207674_10000860 3300026116 Bacteria 39670
570 Ga0207674_10001389 3300026116 Bacteria 31181
571 Ga0207674_10038061 3300026116 Bacteria 4998
572 Ga0207683_10154701 3300026121 Bacteria 2071
573 Ga0207683_10319826 3300026121 Bacteria 1421
574 Ga0207698_10015037 3300026142 Bacteria 5169
575 Ga0207698_10390424 3300026142 Bacteria 1327
576 Ga0207698_10617627 3300026142 Bacteria 1070
577 Ga0209588_1000819 3300027671 Archaea 7911
578 Ga0268266_10000032 3300028379 Bacteria 395079
579 Ga0268266_10000080 3300028379 Bacteria 210179
580 Ga0268266_10009865 3300028379 Bacteria 8392
581 Ga0268266_10013247 3300028379 Bacteria 7108
582 Ga0268266_10351917 3300028379 Bacteria 1384
583 Ga0268264_10013176 3300028381 Bacteria 6802
584 Ga0268264_10550300 3300028381 Bacteria 1132
585 Ga0265323_10010027 3300028653 Bacteria 3850
586 Ga0265322_10027480 3300028654 Bacteria 1626
587 Ga0265336_10014006 3300028666 Bacteria 2664
588 Ga0307517_10000429 3300028786 Bacteria 72171
589 Ga0307515_10007084 3300028794 Bacteria 22272
590 Ga0265338_10001594 3300028800 Bacteria 36404
591 Ga0265338_10012507 3300028800 Bacteria 9671
592 Ga0265338_10020888 3300028800 Bacteria 6858
593 Ga0265338_10080732 3300028800 Bacteria 2731
594 Ga0316181_1278947 3300030744 Bacteria 3255
595 Ga0265330_10000211 3300031235 Bacteria 45210
596 Ga0265330_10002022 3300031235 Bacteria 11253
597 Ga0265330_10004610 3300031235 Bacteria 6968
598 Ga0265332_10013606 3300031238 Bacteria 3604
599 Ga0265332_10020645 3300031238 Bacteria 2908
600 Ga0265328_10001124 3300031239 Bacteria 12350
601 Ga0265320_10030709 3300031240 Bacteria 2767
602 Ga0265325_10000434 3300031241 Bacteria 30035
603 Ga0265325_10175223 3300031241 Bacteria 1002
604 Ga0265340_10003970 3300031247 Bacteria 8320
605 Ga0265339_10000332 3300031249 Bacteria 38100
606 Ga0265339_10002485 3300031249 Bacteria 13174
607 Ga0265331_10024057 3300031250 Bacteria 3087
608 Ga0265331_10029604 3300031250 Unclassified 2731
609 Ga0265327_10000006 3300031251 Bacteria 693716
610 Ga0265327_10006320 3300031251 Bacteria 9517
611 Ga0265316_10001755 3300031344 Bacteria 22947
612 Ga0265316_10003740 3300031344 Bacteria 15289
613 Ga0265316_10023161 3300031344 Bacteria 5221
614 Ga0265316_10048954 3300031344 Bacteria 3332
615 Ga0307408_100168601 3300031548 Bacteria 1746
616 Ga0265313_10002928 3300031595 Bacteria 14255
617 Ga0316575_10006715 3300031665 Bacteria 4154
618 Ga0265314_10000033 3300031711 Bacteria 254594
619 Ga0265314_10018302 3300031711 Bacteria 5465
620 Ga0265342_10000652 3300031712 Bacteria 36426
621 Ga0265342_10001277 3300031712 Bacteria 23694
622 Ga0265342_10145761 3300031712 Bacteria 1318
623 Ga0316578_10261077 3300031728 Bacteria 1038
624 Ga0307405_10000006 3300031731 Bacteria 361477
625 Ga0307405_10160332 3300031731 Bacteria 1592
626 Ga0307407_10000003 3300031903 Bacteria 271723
627 Ga0307412_10000085 3300031911 Bacteria 88692
628 Ga0307409_100110604 3300031995 Bacteria 2303
629 Ga0307416_100000002 3300032002 Bacteria 509907
630 Ga0307414_10003085 3300032004 Bacteria 8845
631 Ga0307414_10019434 3300032004 Bacteria 4210
632 Ga0307414_10113594 3300032004 Bacteria 2067
633 Ga0307414_10114369 3300032004 Bacteria 2061
634 Ga0307411_10196946 3300032005 Bacteria 1544
635 Ga0307411_10203152 3300032005 Bacteria 1524
636 Ga0307510_10010589 3300033180 Bacteria 10959
637 Ga0373926_0002982 3300035083 Bacteria 5413
638 Ga0373944_0126136 3300035089 Bacteria 886
639 Ga0373936_0013931 3300035113 Unclassified 3071
640 Ga0373931_0064983 3300035691 Bacteria 1976
641 Ga0373935_0088494 3300035692 Bacteria 2023
642 Ga0373935_0297461 3300035692 Bacteria 1140
643 Ga0373927_0019991 3300035695 Bacteria 4392
644 Ga0373927_0026827 3300035695 Unclassified 3764
645 Ga0373927_0170953 3300035695 Unclassified 1425
646 Ga0373933_0009618 3300035724 Bacteria 5280
647 Ga0373937_0000015 3300036401 Bacteria 148228
648 Ga0373937_0007694 3300036401 Bacteria 9341
649 Ga0373937_0023028 3300036401 Bacteria 5603
650 Ga0373937_0051436 3300036401 Unclassified 3776
651 Ga0373937_0143389 3300036401 Bacteria 2235
652 Ga0373937_0767420 3300036401 Bacteria 912
653 Ga0316582_0054575 3300036647 Bacteria 2544
654 Ga0373925_0036081 3300037068 Bacteria 3650
655 Ga0373925_0049103 3300037068 Unclassified 3145
656 Ga0373925_0143266 3300037068 Bacteria 1872
657 Ga0373925_0145680 3300037068 Unclassified 1857
658 Ga0395899_0087037 3300037312 Bacteria 2268
659 Ga0395899_0165520 3300037312 Bacteria 1560
660 Ga0395900_0000194 3300037418 Bacteria 97768
661 Ga0395900_0045441 3300037418 Bacteria 4524
662 Ga0395900_0166981 3300037418 Bacteria 2242
663 Ga0395898_0043670 3300037466 Bacteria 4416
664 Ga0395898_0190280 3300037466 Bacteria 1961
665 Ga0395905_0000355 3300037471 Bacteria 65176
666 Ga0395905_0011403 3300037471 Bacteria 8590
667 Ga0436364_0758800 3300037853 Unclassified 3645
668 Ga0436364_0794765 3300037853 Bacteria 162685
669 Ga0436364_1004357 3300037853 Bacteria 2375
670 Ga0436364_1359397 3300037853 Bacteria 1374
671 Ga0436364_1378358 3300037853 Bacteria 3166
672 Ga0395901_0026672 3300038443 Bacteria 5933
673 Ga0395901_0041615 3300038443 Bacteria 4763
674 Ga0395901_0072785 3300038443 Bacteria 3583
675 Ga0436365_0329451 3300039437 Bacteria 1532
676 Ga0436365_0361465 3300039437 Bacteria 3987
677 Ga0436365_0575734 3300039437 Bacteria 2433
678 Ga0436365_1082274 3300039437 Bacteria 9710
679 Ga0436360_0295097 3300039438 Unclassified 4074
680 Ga0436360_0418629 3300039438 Bacteria 1300
681 Ga0436361_0972882 3300039447 Bacteria 108107
682 Ga0436361_1206081 3300039447 Bacteria 5519
683 Ga0436363_0008358 3300039450 Unclassified 2048
684 Ga0436363_0179094 3300039450 Unclassified 1922
685 Ga0436363_0640237 3300039450 Bacteria 3368
686 Ga0436362_0347231 3300039453 Bacteria 7679
687 Ga0436362_0815299 3300039453 Bacteria 1916
688 Ga0439448_0085186 3300042005 Bacteria 1064
689 Ga0451577_0640125 3300042876 Bacteria 964
690 Ga0466972_0000014 3300044658 Bacteria 216776
691 Ga0466972_0000046 3300044658 Bacteria 127926
692 Ga0466972_0000161 3300044658 Bacteria 53994
693 Ga0466966_0230552 3300044684 Unclassified 1117
694 Ga0466963_0047410 3300044694 Bacteria 2836
695 Ga0453684_0011973 3300044712 Bacteria 14427
696 Ga0453684_0123537 3300044712 Bacteria 3121
697 Ga0466968_0079527 3300044735 Unclassified 1438
698 Ga0466970_0000352 3300044765 Bacteria 22307
699 Ga0466957_0008786 3300044842 Bacteria 5751
700 Ga0466957_0060811 3300044842 Bacteria 2317
701 Ga0466959_0055372 3300045049 Bacteria 2896
702 Ga0466959_0205939 3300045049 Bacteria 1368
703 Ga0466959_0353321 3300045049 Bacteria 1002
704 Ga0466958_0188315 3300045836 Unclassified 1311
705 Ga0466967_0020964 3300045976 Bacteria 5294
706 Ga0466967_0031129 3300045976 Bacteria 4488
707 Ga0466967_0120329 3300045976 Bacteria 2425
708 Ga0466967_0381303 3300045976 Bacteria 1369
709 Ga0466967_0571572 3300045976 Bacteria 1114
710 Ga0495592_0057917 3300046454 Bacteria 2859
711 Ga0495592_0144847 3300046454 Bacteria 1648
712 Ga0495651_0003054 3300046462 Bacteria 12917
713 Ga0495651_0005817 3300046462 Bacteria 9410
714 Ga0495651_0202069 3300046462 Bacteria 1390
715 Ga0495653_0084625 3300046463 Bacteria 2335
716 Ga0495653_0147935 3300046463 Bacteria 1644
717 Ga0495650_0008037 3300046471 Bacteria 6229
718 Ga0495580_0000448 3300046472 Bacteria 34094
719 Ga0495580_0004308 3300046472 Bacteria 11967
720 Ga0495580_0005048 3300046472 Bacteria 10999
721 Ga0495580_0027876 3300046472 Bacteria 4108
722 Ga0495580_0033221 3300046472 Bacteria 3718
723 Ga0495582_0011265 3300046473 Bacteria 4927
724 Ga0495582_0064851 3300046473 Bacteria 2017
725 Ga0495639_0047864 3300046475 Bacteria 1938
726 Ga0495662_0024394 3300046476 Bacteria 2918
727 Ga0495662_0051091 3300046476 Bacteria 1996
728 Ga0495662_0107767 3300046476 Bacteria 1364
729 Ga0495662_0134869 3300046476 Bacteria 1214
730 Ga0495664_0001480 3300046477 Bacteria 12431
731 Ga0495664_0009264 3300046477 Bacteria 5505
732 Ga0495664_0020526 3300046477 Bacteria 3810
733 Ga0495594_0029926 3300046499 Bacteria 2944
734 Ga0495594_0032837 3300046499 Bacteria 2819
735 Ga0495596_0015176 3300046500 Bacteria 3233
736 Ga0495606_0009521 3300046507 Bacteria 8207
737 Ga0495606_0105165 3300046507 Bacteria 1711
738 Ga0495610_0000148 3300046512 Bacteria 77303
739 Ga0495610_0002626 3300046512 Bacteria 14866
740 Ga0495610_0010777 3300046512 Bacteria 5650
741 Ga0495618_0019647 3300046514 Bacteria 4157
742 Ga0495628_0020615 3300046516 Bacteria 5434
743 Ga0495630_0006608 3300046517 Bacteria 8264
744 Ga0495630_0025857 3300046517 Bacteria 4343
745 Ga0495630_0264441 3300046517 Bacteria 1314
746 Ga0495666_0002651 3300046526 Bacteria 8915
747 Ga0495652_0189312 3300046529 Bacteria 1572
748 Ga0495652_0224141 3300046529 Bacteria 1411
749 Ga0495652_0268578 3300046529 Unclassified 1255
750 Ga0495665_0000411 3300046531 Bacteria 21896
751 Ga0495665_0146046 3300046531 Bacteria 1235
752 Ga0495640_0123142 3300046533 Bacteria 1683
753 Ga0495586_0004070 3300046535 Bacteria 7833
754 Ga0495586_0052124 3300046535 Unclassified 2215
755 Ga0495587_0000219 3300046536 Bacteria 42459
756 Ga0495587_0091428 3300046536 Bacteria 1758
757 Ga0495587_0134044 3300046536 Bacteria 1415
758 Ga0495645_0003642 3300046543 Bacteria 10463
759 Ga0495645_0024026 3300046543 Unclassified 4418
760 Ga0495645_0027986 3300046543 Bacteria 4094
761 Ga0495633_0000450 3300046558 Bacteria 42356
762 Ga0495667_0110978 3300046559 Bacteria 1772
763 Ga0495634_0001890 3300046642 Bacteria 17969
764 Ga0495634_0304783 3300046642 Unclassified 962
765 Ga0495625_0000422 3300046660 Bacteria 63660
766 Ga0495625_0253441 3300046660 Bacteria 1142
767 Ga0495661_0001078 3300046665 Bacteria 24017
768 Ga0495661_0139149 3300046665 Bacteria 1322
769 Ga0495599_0002460 3300046678 Bacteria 10791
770 Ga0495599_0008956 3300046678 Bacteria 6096
771 Ga0495623_0172534 3300046679 Bacteria 1262
772 Ga0495646_0118958 3300046680 Bacteria 1496
773 Ga0495647_0003772 3300046681 Bacteria 4874
774 Ga0495658_0056164 3300046683 Bacteria 2244
775 Ga0495613_0129033 3300046689 Bacteria 1811
776 Ga0495624_0078000 3300046690 Bacteria 2055
777 Ga0495600_0040352 3300046809 Bacteria 3039
778 Ga0495600_0071975 3300046809 Bacteria 2259
779 Ga0495581_0139149 3300047315 Bacteria 1416
780 Ga0495604_0069067 3300047317 Bacteria 2679
781 Ga0495604_0144436 3300047317 Bacteria 1697
782 Ga0495636_0005843 3300047318 Bacteria 4826
783 Ga0495674_0011132 3300047319 Bacteria 8493
784 Ga0495674_0042378 3300047319 Bacteria 4060
785 Ga0495674_0121542 3300047319 Unclassified 2206
786 Ga0495672_0001992 3300047320 Bacteria 19304
787 Ga0495680_0031119 3300047322 Unclassified 4348
788 Ga0495680_0035849 3300047322 Bacteria 3989
789 Ga0495687_005321 3300047443 Bacteria 8250
790 Ga0495675_0196993 3300047444 Unclassified 1227
791 Ga0495684_0107340 3300047471 Bacteria 2109
792 Ga0495684_0260943 3300047471 Bacteria 1257
793 Ga0495686_0000005 3300047472 Bacteria 827143
794 Ga0495686_0002322 3300047472 Bacteria 18183
795 Ga0495602_0000206 3300048088 Bacteria 54913
796 Ga0495614_0083190 3300048089 Bacteria 1388
797 Ga0496104_0202029 3300048907 Bacteria 1899
798 Ga0496104_0357896 3300048907 Unclassified 1372
799 Ga0496109_0148287 3300048912 Bacteria 2196
800 Ga0496111_0092078 3300048914 Bacteria 2222
801 Ga0496112_0052403 3300048915 Bacteria 4004
802 Ga0496112_0177991 3300048915 Bacteria 2091
803 Ga0496112_0313270 3300048915 Unclassified 1514
804 Ga0496115_0006011 3300048918 Bacteria 8860
805 Ga0496115_0230613 3300048918 Unclassified 1527
806 Ga0496115_0319038 3300048918 Bacteria 1271
807 Ga0496116_0137698 3300048919 Unclassified 1379
808 Ga0496119_0132154 3300048922 Bacteria 1359
809 Ga0496120_0008902 3300048923 Bacteria 7191
810 Ga0496122_0000862 3300048925 Bacteria 57049
811 Ga0496123_0108966 3300048926 Bacteria 1588
812 Ga0496126_0000010 3300048929 Bacteria 744888
813 Ga0496126_0000095 3300048929 Bacteria 207654
814 Ga0496126_0007453 3300048929 Bacteria 11995
815 Ga0496126_0089293 3300048929 Bacteria 2713
816 Ga0501034_0006905 3300049571 Bacteria 12134
817 Ga0501034_0067604 3300049571 Bacteria 3585
818 Ga0501034_0105743 3300049571 Bacteria 2807
819 Ga0501034_0201625 3300049571 Bacteria 1947
820 Ga0501036_0074592 3300049572 Bacteria 2869
821 Ga0501036_0236528 3300049572 Bacteria 1532
822 Ga0501036_0245675 3300049572 Bacteria 1500
823 Ga0501038_0011540 3300049574 Bacteria 8061
824 Ga0501038_0305870 3300049574 Bacteria 1247
825 Ga0501043_0033647 3300049579 Bacteria 4033
826 Ga0501046_0004542 3300049580 Bacteria 12576
827 Ga0501046_0121675 3300049580 Bacteria 1985
828 Ga0501047_0028521 3300049581 Bacteria 5383
829 Ga0501047_0106013 3300049581 Bacteria 2691
830 Ga0501047_0129888 3300049581 Bacteria 2400
831 Ga0501047_0225042 3300049581 Bacteria 1731
832 Ga0501047_0250826 3300049581 Bacteria 1618
833 Ga0501048_0108718 3300049582 Unclassified 1958
834 Ga0501048_0199826 3300049582 Bacteria 1417
835 Ga0501067_0007388 3300049583 Bacteria 6104
836 Ga0501067_0007917 3300049583 Bacteria 5902
837 Ga0501069_0008779 3300049585 Bacteria 5323
838 Ga0501069_0065956 3300049585 Bacteria 2024
839 Ga0501070_0026759 3300049586 Bacteria 4838
840 Ga0501070_0122095 3300049586 Bacteria 2153
841 Ga0501071_0052002 3300049587 Bacteria 2953
842 Ga0501073_0152849 3300049589 Bacteria 1599
843 Ga0501073_0221250 3300049589 Bacteria 1308
844 Ga0501074_0030373 3300049590 Bacteria 3915
845 Ga0501074_0044544 3300049590 Bacteria 3212
846 Ga0501076_0027756 3300049592 Bacteria 4390
847 Ga0501076_0502669 3300049592 Bacteria 999
848 Ga0501077_0008963 3300049593 Bacteria 6206
849 Ga0501077_0380387 3300049593 Bacteria 902
850 Ga0501249_015647 3300049679 Bacteria 1623
851 Ga0501079_0523946 3300049741 Archaea 932
852 Ga0501080_0006180 3300049742 Bacteria 10747
853 Ga0501080_0021446 3300049742 Bacteria 5979
854 Ga0501080_0145472 3300049742 Bacteria 2191
855 Ga0501080_0363007 3300049742 Bacteria 1307
856 Ga0501083_0122687 3300049744 Bacteria 1704
857 Ga0501241_005281 3300049758 Bacteria 2412
858 Ga0501241_006434 3300049758 Bacteria 2160
859 Ga0501035_0027380 3300049822 Bacteria 5211
860 Ga0501044_0011305 3300049823 Bacteria 9675
861 Ga0501044_0121840 3300049823 Bacteria 2608
862 Ga0501044_0245214 3300049823 Bacteria 1734
863 Ga0501044_0328319 3300049823 Bacteria 1453
864 nmdc:mga07m45_34980_c1 3300050496 Bacteria 2793
865 nmdc:mga0n895_354744_c1 3300050512 Unclassified 1485
866 nmdc:mga0rr50_1647_c1 3300050513 Bacteria 12304
867 nmdc:mga08x19_630492_c1 3300050514 Bacteria 760
868 Ga0495601_0075942 3300053077 Bacteria 2151
869 Ga0500635_0004193 3300053080 Bacteria 3693
870 Ga0500635_0005378 3300053080 Bacteria 3356
871 Ga0500651_0000078 3300053093 Bacteria 62741
872 Ga0500651_0140347 3300053093 Unclassified 1457
873 Ga0500555_000116 3300053103 Bacteria 37945
874 Ga0500562_000095 3300053108 Bacteria 35281
875 Ga0500572_032379 3300053111 Unclassified 1467
876 Ga0500618_000036 3300053125 Bacteria 118803
877 Ga0500642_0011622 3300053130 Bacteria 3157
878 Ga0500564_127236 3300053138 Bacteria 1105
879 Ga0500590_086703 3300053148 Unclassified 1527
880 Ga0500616_0002603 3300053153 Bacteria 14769
881 Ga0500622_0001257 3300053156 Bacteria 20711
882 Ga0500636_0081639 3300053177 Bacteria 1862
883 Ga0500637_0090303 3300053178 Bacteria 1774
884 Ga0500645_000103 3300053730 Bacteria 67414
885 Ga0500645_004861 3300053730 Bacteria 5062
886 Ga0500661_001496 3300055283 Bacteria 4386
887 Ga0501082_0182300 3300060353 Bacteria 1826
888 Ga0501082_0671366 3300060353 Bacteria 907
889 Ga0466962_0148317 3300061719 Bacteria 1138

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031250 Ga0265331_10024057 Ga0265331_100240573 210
2 3300050514 nmdc:mga08x19_630492_c1 nmdc:mga08x19_630492_c1_52_732 224
3 3300028800 Ga0265338_10012507 Ga0265338_100125075 232
4 3300031235 Ga0265330_10000211 Ga0265330_100002116 232
5 3300031239 Ga0265328_10001124 Ga0265328_100011244 232
6 3300031241 Ga0265325_10000434 Ga0265325_100004344 232
7 3300031249 Ga0265339_10000332 Ga0265339_100003324 232
8 3300031344 Ga0265316_10001755 Ga0265316_100017556 232
9 3300031595 Ga0265313_10002928 Ga0265313_100029288 232
10 3300031712 Ga0265342_10000652 Ga0265342_100006529 232
11 3300028666 Ga0265336_10014006 Ga0265336_100140063 234
12 3300031238 Ga0265332_10013606 Ga0265332_100136065 234
13 3300031240 Ga0265320_10030709 Ga0265320_100307092 234
14 3300031247 Ga0265340_10003970 Ga0265340_100039705 234
15 3300025915 Ga0207693_10203524 Ga0207693_102035241 237
16 3300025928 Ga0207700_10117371 Ga0207700_101173713 239
17 3300005530 Ga0070679_100261166 Ga0070679_1002611661 242
18 3300005564 Ga0070664_100179556 Ga0070664_1001795562 242
19 3300005614 Ga0068856_100226671 Ga0068856_1002266712 242
20 3300007265 Ga0099794_10131581 Ga0099794_101315812 242
21 3300009174 Ga0105241_10074887 Ga0105241_100748873 242
22 3300013100 Ga0157373_10040777 Ga0157373_100407772 242
23 3300013104 Ga0157370_10253898 Ga0157370_102538981 242
24 3300013296 Ga0157374_10430488 Ga0157374_104304882 242
25 3300013307 Ga0157372_10324072 Ga0157372_103240722 242
26 3300025914 Ga0207671_10191671 Ga0207671_101916712 242
27 3300025960 Ga0207651_10011591 Ga0207651_100115914 242
28 3300026078 Ga0207702_10016448 Ga0207702_100164486 242
29 3300037068 Ga0373925_0143266 Ga0373925_0143266_926_1762 242
30 3300042005 Ga0439448_0085186 Ga0439448_0085186_162_998 242
31 3300048907 Ga0496104_0357896 Ga0496104_0357896_69_905 242
32 3300048915 Ga0496112_0313270 Ga0496112_0313270_529_1365 242
33 3300053148 Ga0500590_086703 Ga0500590_086703_19_753 242
34 3300005614 Ga0068856_100074931 Ga0068856_1000749313 243
35 3300005842 Ga0068858_100014126 Ga0068858_1000141265 244
36 3300005518 Ga0070699_100438424 Ga0070699_1004384241 245
37 3300005536 Ga0070697_100005597 Ga0070697_1000055977 245
38 3300028800 Ga0265338_10080732 Ga0265338_100807323 245
39 3300031711 Ga0265314_10000033 Ga0265314_1000003388 245
40 3300005445 Ga0070708_100085950 Ga0070708_1000859503 246
41 3300010375 Ga0105239_10006110 Ga0105239_1000611017 246
42 3300013104 Ga0157370_10000173 Ga0157370_1000017340 246
43 3300013297 Ga0157378_10644725 Ga0157378_106447251 246
44 3300032005 Ga0307411_10196946 Ga0307411_101969462 247
45 3300031728 Ga0316578_10261077 Ga0316578_102610771 248
46 3300047444 Ga0495675_0196993 Ga0495675_0196993_426_1217 248
47 3300037853 Ga0436364_1004357 Ga0436364_1004357_729_1565 249
48 3300046472 Ga0495580_0000448 Ga0495580_0000448_4351_5187 249
49 3300005366 Ga0070659_100053736 Ga0070659_1000537362 250
50 3300005439 Ga0070711_100059361 Ga0070711_1000593612 250
51 3300005563 Ga0068855_100084338 Ga0068855_1000843382 250
52 3300005564 Ga0070664_100052380 Ga0070664_1000523804 250
53 3300005614 Ga0068856_100014557 Ga0068856_1000145574 250
54 3300006028 Ga0070717_10049436 Ga0070717_100494363 250
55 3300007265 Ga0099794_10000923 Ga0099794_1000092312 250
56 3300009174 Ga0105241_10335181 Ga0105241_103351812 250
57 3300013100 Ga0157373_10222128 Ga0157373_102221282 250
58 3300013105 Ga0157369_10022924 Ga0157369_100229246 250
59 3300013307 Ga0157372_10257431 Ga0157372_102574311 250
60 3300014325 Ga0163163_10059148 Ga0163163_100591482 250
61 3300025916 Ga0207663_10314646 Ga0207663_103146462 250
62 3300025929 Ga0207664_10585085 Ga0207664_105850851 250
63 3300026078 Ga0207702_10025937 Ga0207702_100259374 250
64 3300027671 Ga0209588_1000819 Ga0209588_10008193 250
65 3300048918 Ga0496115_0006011 Ga0496115_0006011_7463_8293 250
66 3300025250 Ga0209026_1004556 Ga0209026_10045564 251
67 3300039437 Ga0436365_0329451 Ga0436365_0329451_233_1069 251
68 3300046689 Ga0495613_0129033 Ga0495613_0129033_14_775 251
69 3300047319 Ga0495674_0121542 Ga0495674_0121542_525_1361 251
70 3300005435 Ga0070714_100267949 Ga0070714_1002679492 253
71 3300010375 Ga0105239_10004282 Ga0105239_1000428211 253
72 3300025929 Ga0207664_10503296 Ga0207664_105032962 253
73 3300036401 Ga0373937_0143389 Ga0373937_0143389_1347_2186 253
74 3300037853 Ga0436364_1378358 Ga0436364_1378358_2160_3026 253
75 3300046529 Ga0495652_0224141 Ga0495652_0224141_315_1151 253
76 3300049580 Ga0501046_0121675 Ga0501046_0121675_261_1100 253
77 3300049590 Ga0501074_0044544 Ga0501074_0044544_1310_2149 253
78 3300049592 Ga0501076_0502669 Ga0501076_0502669_107_940 253
79 3300049742 Ga0501080_0006180 Ga0501080_0006180_9458_10297 253
80 3300060353 Ga0501082_0182300 Ga0501082_0182300_390_1223 253
81 3300009093 Ga0105240_10062993 Ga0105240_100629932 254
82 3300025913 Ga0207695_10065573 Ga0207695_100655732 254
83 3300044842 Ga0466957_0008786 Ga0466957_0008786_219_1055 254
84 3300049572 Ga0501036_0245675 Ga0501036_0245675_193_1026 254
85 3300049581 Ga0501047_0129888 Ga0501047_0129888_269_1102 254
86 3300049583 Ga0501067_0007917 Ga0501067_0007917_840_1673 254
87 3300049585 Ga0501069_0008779 Ga0501069_0008779_1554_2387 254
88 3300049585 Ga0501069_0065956 Ga0501069_0065956_870_1703 254
89 3300049586 Ga0501070_0026759 Ga0501070_0026759_2418_3251 254
90 3300049587 Ga0501071_0052002 Ga0501071_0052002_1927_2760 254
91 3300049589 Ga0501073_0152849 Ga0501073_0152849_389_1222 254
92 3300049590 Ga0501074_0030373 Ga0501074_0030373_274_1107 254
93 3300049592 Ga0501076_0027756 Ga0501076_0027756_2781_3614 254
94 3300049742 Ga0501080_0021446 Ga0501080_0021446_4149_4982 254
95 3300005354 Ga0070675_100102479 Ga0070675_1001024792 255
96 3300005437 Ga0070710_10007071 Ga0070710_100070712 255
97 3300005614 Ga0068856_100406242 Ga0068856_1004062422 255
98 3300005937 Ga0081455_10013928 Ga0081455_100139289 255
99 3300010375 Ga0105239_10728387 Ga0105239_107283872 255
100 3300013296 Ga0157374_10021199 Ga0157374_100211996 255
101 3300021358 Ga0213873_10020392 Ga0213873_100203921 255
102 3300025898 Ga0207692_10004695 Ga0207692_100046955 255
103 3300025926 Ga0207659_10235727 Ga0207659_102357271 255
104 3300026078 Ga0207702_10328041 Ga0207702_103280411 255
105 3300039453 Ga0436362_0815299 Ga0436362_0815299_485_1321 255
106 3300044735 Ga0466968_0079527 Ga0466968_0079527_35_871 255
107 3300048915 Ga0496112_0177991 Ga0496112_0177991_993_1823 255
108 3300005327 Ga0070658_10466577 Ga0070658_104665771 256
109 3300005329 Ga0070683_100336686 Ga0070683_1003366862 256
110 3300005338 Ga0068868_100029959 Ga0068868_1000299593 256
111 3300005440 Ga0070705_100065277 Ga0070705_1000652772 256
112 3300005458 Ga0070681_10501598 Ga0070681_105015981 256
113 3300005530 Ga0070679_100034515 Ga0070679_1000345155 256
114 3300005530 Ga0070679_100225608 Ga0070679_1002256082 256
115 3300005563 Ga0068855_100001626 Ga0068855_1000016269 256
116 3300005578 Ga0068854_100403486 Ga0068854_1004034861 256
117 3300005614 Ga0068856_100000407 Ga0068856_10000040729 256
118 3300005618 Ga0068864_100055045 Ga0068864_1000550454 256
119 3300005841 Ga0068863_100024417 Ga0068863_1000244174 256
120 3300005843 Ga0068860_100391785 Ga0068860_1003917852 256
121 3300006028 Ga0070717_10129472 Ga0070717_101294722 256
122 3300006237 Ga0097621_100000237 Ga0097621_10000023730 256
123 3300006358 Ga0068871_100002121 Ga0068871_1000021216 256
124 3300006881 Ga0068865_100040696 Ga0068865_1000406963 256
125 3300009093 Ga0105240_10000558 Ga0105240_1000055816 256
126 3300009177 Ga0105248_10003155 Ga0105248_1000315516 256
127 3300010375 Ga0105239_10026773 Ga0105239_100267733 256
128 3300013104 Ga0157370_10027543 Ga0157370_100275438 256
129 3300013296 Ga0157374_10000667 Ga0157374_1000066714 256
130 3300013297 Ga0157378_10000320 Ga0157378_1000032029 256
131 3300013307 Ga0157372_10001112 Ga0157372_1000111217 256
132 3300013307 Ga0157372_10028068 Ga0157372_100280684 256
133 3300014969 Ga0157376_10020473 Ga0157376_100204734 256
134 3300025912 Ga0207707_10446698 Ga0207707_104466981 256
135 3300025913 Ga0207695_10000351 Ga0207695_1000035150 256
136 3300025921 Ga0207652_10043526 Ga0207652_100435265 256
137 3300025938 Ga0207704_10013811 Ga0207704_100138113 256
138 3300025944 Ga0207661_10244393 Ga0207661_102443932 256
139 3300025949 Ga0207667_10003075 Ga0207667_1000307516 256
140 3300026078 Ga0207702_10001495 Ga0207702_1000149517 256
141 3300026088 Ga0207641_10006671 Ga0207641_100066713 256
142 3300026095 Ga0207676_10043265 Ga0207676_100432652 256
143 3300026121 Ga0207683_10319826 Ga0207683_103198262 256
144 3300031548 Ga0307408_100168601 Ga0307408_1001686012 256
145 3300031731 Ga0307405_10160332 Ga0307405_101603322 256
146 3300035691 Ga0373931_0064983 Ga0373931_0064983_165_1001 256
147 3300046507 Ga0495606_0105165 Ga0495606_0105165_228_1064 256
148 3300048929 Ga0496126_0089293 Ga0496126_0089293_1796_2629 256
149 3300049571 Ga0501034_0201625 Ga0501034_0201625_177_1013 256
150 3300049572 Ga0501036_0074592 Ga0501036_0074592_1985_2821 256
151 3300049574 Ga0501038_0011540 Ga0501038_0011540_4982_5818 256
152 3300049579 Ga0501043_0033647 Ga0501043_0033647_2185_3021 256
153 3300049581 Ga0501047_0106013 Ga0501047_0106013_392_1231 256
154 3300049581 Ga0501047_0225042 Ga0501047_0225042_660_1496 256
155 3300049582 Ga0501048_0199826 Ga0501048_0199826_88_924 256
156 3300049589 Ga0501073_0221250 Ga0501073_0221250_94_930 256
157 3300049742 Ga0501080_0145472 Ga0501080_0145472_173_1009 256
158 3300049744 Ga0501083_0122687 Ga0501083_0122687_773_1609 256
159 3300049822 Ga0501035_0027380 Ga0501035_0027380_4263_5099 256
160 3300049823 Ga0501044_0011305 Ga0501044_0011305_2617_3453 256
161 3300005329 Ga0070683_100019588 Ga0070683_1000195884 257
162 3300005563 Ga0068855_100188833 Ga0068855_1001888331 257
163 3300013102 Ga0157371_10306216 Ga0157371_103062162 257
164 3300013105 Ga0157369_10143317 Ga0157369_101433172 257
165 3300014968 Ga0157379_10026657 Ga0157379_100266572 257
166 3300049742 Ga0501080_0363007 Ga0501080_0363007_357_1193 257
167 3300003320 rootH2_10258336 rootH2_102583364 258
168 3300035695 Ga0373927_0026827 Ga0373927_0026827_2348_3202 258
169 3300037068 Ga0373925_0145680 Ga0373925_0145680_125_967 258
170 3300053111 Ga0500572_032379 Ga0500572_032379_264_1100 258
171 3300053177 Ga0500636_0081639 Ga0500636_0081639_192_1028 258
172 3300009093 Ga0105240_10002861 Ga0105240_1000286116 259
173 3300013104 Ga0157370_10425220 Ga0157370_104252201 259
174 3300013105 Ga0157369_10051510 Ga0157369_100515102 259
175 3300013307 Ga0157372_10112776 Ga0157372_101127763 259
176 3300025913 Ga0207695_10000658 Ga0207695_1000065816 259
177 3300045976 Ga0466967_0031129 Ga0466967_0031129_3058_3894 259
178 3300048923 Ga0496120_0008902 Ga0496120_0008902_568_1401 259
179 3300005445 Ga0070708_100001090 Ga0070708_1000010903 260
180 3300005467 Ga0070706_100008523 Ga0070706_1000085237 260
181 3300005468 Ga0070707_100000176 Ga0070707_1000001769 260
182 3300005471 Ga0070698_100037908 Ga0070698_1000379082 260
183 3300005536 Ga0070697_100269584 Ga0070697_1002695841 260
184 3300006028 Ga0070717_10007951 Ga0070717_100079512 260
185 3300013105 Ga0157369_10283249 Ga0157369_102832491 260
186 3300025910 Ga0207684_10082298 Ga0207684_100822984 260
187 3300025921 Ga0207652_10192895 Ga0207652_101928953 260
188 3300025922 Ga0207646_10000811 Ga0207646_1000081125 260
189 3300026078 Ga0207702_10165243 Ga0207702_101652432 260
190 3300031241 Ga0265325_10175223 Ga0265325_101752231 260
191 3300039438 Ga0436360_0418629 Ga0436360_0418629_235_1071 260
192 3300044712 Ga0453684_0123537 Ga0453684_0123537_1233_2078 260
193 3300047315 Ga0495581_0139149 Ga0495581_0139149_503_1402 260
194 3300053103 Ga0500555_000116 Ga0500555_000116_7781_8617 260
195 3300053730 Ga0500645_000103 Ga0500645_000103_30150_30986 260
196 3300005436 Ga0070713_100371473 Ga0070713_1003714732 261
197 3300005445 Ga0070708_100493438 Ga0070708_1004934382 261
198 3300053153 Ga0500616_0002603 Ga0500616_0002603_13825_14673 261
199 3300005434 Ga0070709_10037304 Ga0070709_100373042 262
200 3300005436 Ga0070713_100029003 Ga0070713_1000290035 262
201 3300005439 Ga0070711_100026344 Ga0070711_1000263443 262
202 3300006028 Ga0070717_10655569 Ga0070717_106555691 262
203 3300006173 Ga0070716_100106153 Ga0070716_1001061532 262
204 3300025898 Ga0207692_10147538 Ga0207692_101475381 262
205 3300025916 Ga0207663_10025308 Ga0207663_100253084 262
206 3300025928 Ga0207700_10102797 Ga0207700_101027972 262
207 3300025939 Ga0207665_10096809 Ga0207665_100968093 262
208 3300035113 Ga0373936_0013931 Ga0373936_0013931_1069_1905 262
209 3300037068 Ga0373925_0049103 Ga0373925_0049103_1360_2196 262
210 3300005288 Ga0065714_10005173 Ga0065714_100051732 263
211 3300013102 Ga0157371_10066523 Ga0157371_100665233 263
212 3300028379 Ga0268266_10351917 Ga0268266_103519172 263
213 3300030744 Ga0316181_1278947 Ga0316181_12789475 263
214 3300032004 Ga0307414_10003085 Ga0307414_100030859 263
215 3300036647 Ga0316582_0054575 Ga0316582_0054575_1001_1837 263
216 3300046476 Ga0495662_0134869 Ga0495662_0134869_35_871 263
217 3300049583 Ga0501067_0007388 Ga0501067_0007388_4561_5394 263
218 3300060353 Ga0501082_0671366 Ga0501082_0671366_55_888 263
219 3300005288 Ga0065714_10108862 Ga0065714_101088622 264
220 3300005435 Ga0070714_100214080 Ga0070714_1002140803 264
221 3300005458 Ga0070681_10418966 Ga0070681_104189662 264
222 3300005467 Ga0070706_100445040 Ga0070706_1004450402 264
223 3300009551 Ga0105238_10055666 Ga0105238_100556662 264
224 3300025904 Ga0207647_10057239 Ga0207647_100572391 264
225 3300025910 Ga0207684_10376805 Ga0207684_103768052 264
226 3300025924 Ga0207694_10114827 Ga0207694_101148273 264
227 3300025929 Ga0207664_10209267 Ga0207664_102092673 264
228 3300035724 Ga0373933_0009618 Ga0373933_0009618_3198_4037 264
229 3300036401 Ga0373937_0000015 Ga0373937_0000015_23646_24485 264
230 3300036401 Ga0373937_0767420 Ga0373937_0767420_11_883 264
231 3300046462 Ga0495651_0005817 Ga0495651_0005817_290_1129 264
232 3300046463 Ga0495653_0084625 Ga0495653_0084625_671_1510 264
233 3300046472 Ga0495580_0027876 Ga0495580_0027876_3062_3898 264
234 3300046536 Ga0495587_0000219 Ga0495587_0000219_11475_12314 264
235 3300047317 Ga0495604_0069067 Ga0495604_0069067_927_1766 264
236 3300048088 Ga0495602_0000206 Ga0495602_0000206_24376_25215 264
237 3300046499 Ga0495594_0029926 Ga0495594_0029926_1616_2452 265
238 3300048919 Ga0496116_0137698 Ga0496116_0137698_16_846 265
239 3300005435 Ga0070714_100029083 Ga0070714_1000290836 266
240 3300009093 Ga0105240_10085284 Ga0105240_100852844 266
241 3300025913 Ga0207695_10029736 Ga0207695_100297364 266
242 3300025929 Ga0207664_10124260 Ga0207664_101242602 266
243 3300039450 Ga0436363_0179094 Ga0436363_0179094_287_1123 266
244 3300047318 Ga0495636_0005843 Ga0495636_0005843_777_1595 266
245 3300049586 Ga0501070_0122095 Ga0501070_0122095_630_1466 266
246 3300005329 Ga0070683_100028155 Ga0070683_1000281555 267
247 3300005331 Ga0070670_100000465 Ga0070670_1000004659 267
248 3300005334 Ga0068869_100026879 Ga0068869_1000268795 267
249 3300005338 Ga0068868_100018805 Ga0068868_1000188056 267
250 3300005343 Ga0070687_100014799 Ga0070687_1000147992 267
251 3300005434 Ga0070709_10136544 Ga0070709_101365442 267
252 3300005435 Ga0070714_100074413 Ga0070714_1000744132 267
253 3300005436 Ga0070713_100005330 Ga0070713_1000053308 267
254 3300005436 Ga0070713_100056196 Ga0070713_1000561964 267
255 3300005458 Ga0070681_10007353 Ga0070681_100073537 267
256 3300005459 Ga0068867_100008021 Ga0068867_1000080215 267
257 3300005535 Ga0070684_100110088 Ga0070684_1001100883 267
258 3300005539 Ga0068853_100280145 Ga0068853_1002801452 267
259 3300005544 Ga0070686_100107443 Ga0070686_1001074432 267
260 3300005563 Ga0068855_100009839 Ga0068855_10000983910 267
261 3300005564 Ga0070664_100008525 Ga0070664_1000085258 267
262 3300005577 Ga0068857_100000036 Ga0068857_1000000369 267
263 3300005578 Ga0068854_100003663 Ga0068854_1000036638 267
264 3300005614 Ga0068856_100002064 Ga0068856_10000206417 267
265 3300005616 Ga0068852_100339780 Ga0068852_1003397802 267
266 3300005617 Ga0068859_100001163 Ga0068859_10000116311 267
267 3300005618 Ga0068864_100000684 Ga0068864_10000068413 267
268 3300005840 Ga0068870_10144267 Ga0068870_101442672 267
269 3300005841 Ga0068863_100102141 Ga0068863_1001021414 267
270 3300005842 Ga0068858_100020900 Ga0068858_1000209007 267
271 3300005843 Ga0068860_100048369 Ga0068860_1000483696 267
272 3300006028 Ga0070717_10001574 Ga0070717_100015746 267
273 3300006028 Ga0070717_10057142 Ga0070717_100571423 267
274 3300006237 Ga0097621_100060336 Ga0097621_1000603361 267
275 3300006931 Ga0097620_100001163 Ga0097620_10000116319 267
276 3300010375 Ga0105239_10150101 Ga0105239_101501012 267
277 3300013105 Ga0157369_10047163 Ga0157369_100471636 267
278 3300013296 Ga0157374_10000162 Ga0157374_1000016234 267
279 3300013297 Ga0157378_10000020 Ga0157378_1000002040 267
280 3300013307 Ga0157372_10005137 Ga0157372_1000513713 267
281 3300013307 Ga0157372_10018191 Ga0157372_100181914 267
282 3300014325 Ga0163163_10202252 Ga0163163_102022522 267
283 3300025908 Ga0207643_10085460 Ga0207643_100854602 267
284 3300025912 Ga0207707_10005146 Ga0207707_100051462 267
285 3300025917 Ga0207660_10027486 Ga0207660_100274863 267
286 3300025918 Ga0207662_10032738 Ga0207662_100327383 267
287 3300025920 Ga0207649_10115458 Ga0207649_101154582 267
288 3300025925 Ga0207650_10000976 Ga0207650_100009769 267
289 3300025928 Ga0207700_10000907 Ga0207700_1000090710 267
290 3300025928 Ga0207700_10105783 Ga0207700_101057832 267
291 3300025929 Ga0207664_10107542 Ga0207664_101075423 267
292 3300025942 Ga0207689_10066546 Ga0207689_100665464 267
293 3300025944 Ga0207661_10044284 Ga0207661_100442843 267
294 3300025945 Ga0207679_10005041 Ga0207679_100050417 267
295 3300025949 Ga0207667_10087393 Ga0207667_100873933 267
296 3300025981 Ga0207640_10010314 Ga0207640_100103142 267
297 3300026023 Ga0207677_10009929 Ga0207677_100099294 267
298 3300026035 Ga0207703_10014595 Ga0207703_100145957 267
299 3300026041 Ga0207639_10045199 Ga0207639_100451992 267
300 3300026078 Ga0207702_10005292 Ga0207702_100052926 267
301 3300026095 Ga0207676_10004134 Ga0207676_100041348 267
302 3300026116 Ga0207674_10000860 Ga0207674_1000086019 267
303 3300028381 Ga0268264_10013176 Ga0268264_100131766 267
304 3300035692 Ga0373935_0297461 Ga0373935_0297461_259_1095 267
305 3300036401 Ga0373937_0051436 Ga0373937_0051436_70_906 267
306 3300045049 Ga0466959_0205939 Ga0466959_0205939_380_1216 267
307 3300047472 Ga0495686_0000005 Ga0495686_0000005_269580_270416 267
308 3300005336 Ga0070680_100053695 Ga0070680_1000536953 268
309 3300005337 Ga0070682_100379000 Ga0070682_1003790001 268
310 3300005341 Ga0070691_10157308 Ga0070691_101573081 268
311 3300005439 Ga0070711_100025932 Ga0070711_1000259323 268
312 3300005458 Ga0070681_10000026 Ga0070681_1000002683 268
313 3300005530 Ga0070679_100002685 Ga0070679_1000026857 268
314 3300005535 Ga0070684_100274124 Ga0070684_1002741242 268
315 3300005539 Ga0068853_100007080 Ga0068853_1000070802 268
316 3300005539 Ga0068853_100090731 Ga0068853_1000907312 268
317 3300005563 Ga0068855_100000295 Ga0068855_10000029512 268
318 3300005577 Ga0068857_100002465 Ga0068857_1000024652 268
319 3300005614 Ga0068856_100001013 Ga0068856_10000101313 268
320 3300005614 Ga0068856_100022934 Ga0068856_1000229343 268
321 3300005616 Ga0068852_100559249 Ga0068852_1005592491 268
322 3300005842 Ga0068858_100088342 Ga0068858_1000883422 268
323 3300006175 Ga0070712_100009888 Ga0070712_1000098888 268
324 3300006237 Ga0097621_100014508 Ga0097621_1000145086 268
325 3300006358 Ga0068871_100001088 Ga0068871_10000108812 268
326 3300009545 Ga0105237_10219924 Ga0105237_102199242 268
327 3300009551 Ga0105238_10000848 Ga0105238_1000084822 268
328 3300010375 Ga0105239_10084130 Ga0105239_100841302 268
329 3300013104 Ga0157370_10010945 Ga0157370_1001094512 268
330 3300013105 Ga0157369_10000124 Ga0157369_1000012489 268
331 3300013105 Ga0157369_10028633 Ga0157369_100286337 268
332 3300013296 Ga0157374_10001625 Ga0157374_1000162520 268
333 3300013297 Ga0157378_10028561 Ga0157378_100285614 268
334 3300013307 Ga0157372_10000084 Ga0157372_1000008474 268
335 3300013307 Ga0157372_10009649 Ga0157372_100096499 268
336 3300025912 Ga0207707_10000800 Ga0207707_1000080028 268
337 3300025913 Ga0207695_10031138 Ga0207695_100311384 268
338 3300025914 Ga0207671_10160916 Ga0207671_101609162 268
339 3300025915 Ga0207693_10015937 Ga0207693_100159373 268
340 3300025916 Ga0207663_10018868 Ga0207663_100188685 268
341 3300025917 Ga0207660_10047295 Ga0207660_100472952 268
342 3300025921 Ga0207652_10004418 Ga0207652_100044183 268
343 3300025924 Ga0207694_10000434 Ga0207694_1000043422 268
344 3300025924 Ga0207694_10033670 Ga0207694_100336703 268
345 3300025949 Ga0207667_10000591 Ga0207667_100005912 268
346 3300026023 Ga0207677_10127799 Ga0207677_101277992 268
347 3300026035 Ga0207703_10070450 Ga0207703_100704503 268
348 3300026041 Ga0207639_10023165 Ga0207639_100231653 268
349 3300026078 Ga0207702_10000114 Ga0207702_1000011411 268
350 3300026078 Ga0207702_10016626 Ga0207702_100166266 268
351 3300026116 Ga0207674_10001389 Ga0207674_1000138915 268
352 3300026142 Ga0207698_10617627 Ga0207698_106176272 268
353 3300028653 Ga0265323_10010027 Ga0265323_100100272 268
354 3300044694 Ga0466963_0047410 Ga0466963_0047410_110_946 268
355 3300045976 Ga0466967_0020964 Ga0466967_0020964_2406_3242 268
356 3300048912 Ga0496109_0148287 Ga0496109_0148287_726_1562 268
357 3300048918 Ga0496115_0319038 Ga0496115_0319038_85_921 268
358 3300005336 Ga0070680_100002217 Ga0070680_1000022176 269
359 3300005436 Ga0070713_100277175 Ga0070713_1002771752 269
360 3300005445 Ga0070708_100005564 Ga0070708_1000055649 269
361 3300005467 Ga0070706_100312357 Ga0070706_1003123573 269
362 3300005530 Ga0070679_100193934 Ga0070679_1001939342 269
363 3300005563 Ga0068855_100077266 Ga0068855_1000772663 269
364 3300005614 Ga0068856_100190440 Ga0068856_1001904403 269
365 3300006028 Ga0070717_10001844 Ga0070717_100018446 269
366 3300006028 Ga0070717_10007845 Ga0070717_100078457 269
367 3300006028 Ga0070717_10402465 Ga0070717_104024652 269
368 3300013307 Ga0157372_10541205 Ga0157372_105412052 269
369 3300025917 Ga0207660_10000011 Ga0207660_1000001111 269
370 3300025921 Ga0207652_10299426 Ga0207652_102994262 269
371 3300025939 Ga0207665_10085746 Ga0207665_100857462 269
372 3300031238 Ga0265332_10020645 Ga0265332_100206452 269
373 3300031344 Ga0265316_10003740 Ga0265316_100037403 269
374 3300031712 Ga0265342_10001277 Ga0265342_1000127718 269
375 3300035083 Ga0373926_0002982 Ga0373926_0002982_2454_3290 269
376 3300044842 Ga0466957_0060811 Ga0466957_0060811_189_1025 269
377 3300046462 Ga0495651_0202069 Ga0495651_0202069_186_1037 269
378 3300046472 Ga0495580_0004308 Ga0495580_0004308_4316_5152 269
379 3300046473 Ga0495582_0011265 Ga0495582_0011265_1494_2330 269
380 3300046531 Ga0495665_0000411 Ga0495665_0000411_770_1606 269
381 3300049581 Ga0501047_0250826 Ga0501047_0250826_621_1457 269
382 3300049823 Ga0501044_0245214 Ga0501044_0245214_143_979 269
383 3300050512 nmdc:mga0n895_354744_c1 nmdc:mga0n895_354744_c1_351_1187 269
384 3300050513 nmdc:mga0rr50_1647_c1 nmdc:mga0rr50_1647_c1_6625_7461 269
385 3300061719 Ga0466962_0148317 Ga0466962_0148317_16_852 269
386 3300005327 Ga0070658_10193955 Ga0070658_101939552 270
387 3300009177 Ga0105248_10217286 Ga0105248_102172862 270
388 3300013105 Ga0157369_10021963 Ga0157369_100219634 270
389 3300013296 Ga0157374_10056135 Ga0157374_100561354 270
390 3300014969 Ga0157376_10016338 Ga0157376_100163384 270
391 3300046543 Ga0495645_0027986 Ga0495645_0027986_1301_2149 270
392 3300048907 Ga0496104_0202029 Ga0496104_0202029_797_1630 270
393 3300048914 Ga0496111_0092078 Ga0496111_0092078_245_1078 270
394 3300048915 Ga0496112_0052403 Ga0496112_0052403_2003_2836 270
395 3300048918 Ga0496115_0230613 Ga0496115_0230613_376_1212 270
396 3300048922 Ga0496119_0132154 Ga0496119_0132154_22_855 270
397 3300005355 Ga0070671_100109826 Ga0070671_1001098261 271
398 3300005364 Ga0070673_100015777 Ga0070673_10001577711 271
399 3300005434 Ga0070709_10030139 Ga0070709_100301393 271
400 3300005436 Ga0070713_100024471 Ga0070713_1000244713 271
401 3300005530 Ga0070679_100221366 Ga0070679_1002213662 271
402 3300005616 Ga0068852_100093087 Ga0068852_1000930873 271
403 3300006173 Ga0070716_100010634 Ga0070716_1000106343 271
404 3300006914 Ga0075436_100039498 Ga0075436_1000394982 271
405 3300025906 Ga0207699_10010688 Ga0207699_100106886 271
406 3300025912 Ga0207707_10265941 Ga0207707_102659412 271
407 3300025915 Ga0207693_10003255 Ga0207693_1000325513 271
408 3300025921 Ga0207652_10514051 Ga0207652_105140511 271
409 3300025929 Ga0207664_10065613 Ga0207664_100656134 271
410 3300025931 Ga0207644_10105521 Ga0207644_101055212 271
411 3300025939 Ga0207665_10003917 Ga0207665_100039176 271
412 3300047320 Ga0495672_0001992 Ga0495672_0001992_4360_5196 271
413 3300053125 Ga0500618_000036 Ga0500618_000036_40648_41481 271
414 3300009093 Ga0105240_10386510 Ga0105240_103865102 272
415 3300032004 Ga0307414_10019434 Ga0307414_100194344 272
416 3300049758 Ga0501241_005281 Ga0501241_005281_689_1525 272
417 iso_pu_bacteria 2977232053 2977233915 272
418 3300025914 Ga0207671_10008730 Ga0207671_100087302 273
419 3300049581 Ga0501047_0028521 Ga0501047_0028521_2820_3656 273
420 iso_pu_bacteria 2585427687 2586210014 273
421 iso_pu_bacteria 2738541302 2738854387 273
422 iso_pu_bacteria 2739367651 2739587938 273
423 iso_pu_bacteria 2739367656 2739614410 273
424 iso_pu_bacteria 2739367663 2739646658 273
425 iso_pu_bacteria 2818991437 2819545814 273
426 iso_pu_bacteria 2842722452 2842724292 273
427 iso_pu_bacteria 2842909656 2842913573 273
428 iso_pu_bacteria 2849281842 2849282614 273
429 iso_pu_bacteria 2852623160 2852625164 273
430 iso_pu_bacteria 2857627736 2857631637 273
431 iso_pu_bacteria 2884791551 2884792172 273
432 iso_pu_bacteria 2884933994 2884934180 273
433 iso_pu_bacteria 2904445276 2904449055 273
434 iso_pu_bacteria 2945997725 2945998884 273
435 iso_pu_bacteria 2954016120 2954021328 273
436 3300005467 Ga0070706_100001928 Ga0070706_1000019283 274
437 3300025910 Ga0207684_10000812 Ga0207684_1000081228 274
438 3300028654 Ga0265322_10027480 Ga0265322_100274802 274
439 3300045976 Ga0466967_0381303 Ga0466967_0381303_300_1130 274
440 3300046543 Ga0495645_0003642 Ga0495645_0003642_3283_4113 274
441 iso_pu_bacteria 2738541283 2738755691 274
442 iso_pu_bacteria 2852627209 2852629099 274
443 iso_pu_bacteria 2902048731 2902051202 274
444 iso_pu_bacteria 2919186247 2919189057 274
445 iso_pu_bacteria 2929154850 2929156035 274
446 iso_pu_bacteria 2939664404 2939666788 274
447 3300005329 Ga0070683_100040343 Ga0070683_1000403433 275
448 3300005435 Ga0070714_100001995 Ga0070714_10000199513 275
449 3300005436 Ga0070713_100000575 Ga0070713_10000057519 275
450 3300005439 Ga0070711_100197309 Ga0070711_1001973092 275
451 3300005614 Ga0068856_100042307 Ga0068856_1000423076 275
452 3300009093 Ga0105240_10004872 Ga0105240_100048728 275
453 3300009093 Ga0105240_10031483 Ga0105240_100314833 275
454 3300009177 Ga0105248_10046585 Ga0105248_100465854 275
455 3300009545 Ga0105237_10006655 Ga0105237_100066556 275
456 3300009545 Ga0105237_10086070 Ga0105237_100860702 275
457 3300009545 Ga0105237_10848719 Ga0105237_108487191 275
458 3300009551 Ga0105238_10113584 Ga0105238_101135842 275
459 3300010375 Ga0105239_10137966 Ga0105239_101379664 275
460 3300013105 Ga0157369_10098242 Ga0157369_100982422 275
461 3300013105 Ga0157369_10159442 Ga0157369_101594423 275
462 3300021384 Ga0213876_10143007 Ga0213876_101430071 275
463 3300025913 Ga0207695_10021867 Ga0207695_100218676 275
464 3300025913 Ga0207695_10077828 Ga0207695_100778283 275
465 3300025914 Ga0207671_10029864 Ga0207671_100298644 275
466 3300025924 Ga0207694_10072774 Ga0207694_100727742 275
467 3300025928 Ga0207700_10001252 Ga0207700_100012525 275
468 3300025929 Ga0207664_10023773 Ga0207664_100237734 275
469 3300025939 Ga0207665_10148690 Ga0207665_101486903 275
470 3300025941 Ga0207711_10273095 Ga0207711_102730952 275
471 3300031235 Ga0265330_10002022 Ga0265330_100020226 275
472 3300031250 Ga0265331_10029604 Ga0265331_100296044 275
473 3300031344 Ga0265316_10023161 Ga0265316_100231612 275
474 3300031711 Ga0265314_10018302 Ga0265314_100183024 275
475 3300031712 Ga0265342_10145761 Ga0265342_101457611 275
476 3300032004 Ga0307414_10113594 Ga0307414_101135943 275
477 3300032005 Ga0307411_10203152 Ga0307411_102031521 275
478 3300035089 Ga0373944_0126136 Ga0373944_0126136_39_872 275
479 3300035692 Ga0373935_0088494 Ga0373935_0088494_871_1704 275
480 3300035695 Ga0373927_0019991 Ga0373927_0019991_3249_4082 275
481 3300036401 Ga0373937_0007694 Ga0373937_0007694_6624_7457 275
482 3300036401 Ga0373937_0023028 Ga0373937_0023028_3211_4044 275
483 3300037853 Ga0436364_0758800 Ga0436364_0758800_1589_2422 275
484 3300039437 Ga0436365_0575734 Ga0436365_0575734_374_1207 275
485 3300045976 Ga0466967_0571572 Ga0466967_0571572_109_942 275
486 3300046454 Ga0495592_0144847 Ga0495592_0144847_21_851 275
487 3300046472 Ga0495580_0005048 Ga0495580_0005048_486_1319 275
488 3300046472 Ga0495580_0033221 Ga0495580_0033221_532_1368 275
489 3300046473 Ga0495582_0064851 Ga0495582_0064851_985_1818 275
490 3300046475 Ga0495639_0047864 Ga0495639_0047864_357_1190 275
491 3300046476 Ga0495662_0051091 Ga0495662_0051091_480_1313 275
492 3300046477 Ga0495664_0020526 Ga0495664_0020526_2134_2967 275
493 3300046499 Ga0495594_0032837 Ga0495594_0032837_323_1156 275
494 3300046514 Ga0495618_0019647 Ga0495618_0019647_1044_1877 275
495 3300046517 Ga0495630_0006608 Ga0495630_0006608_886_1719 275
496 3300046526 Ga0495666_0002651 Ga0495666_0002651_2001_2834 275
497 3300046533 Ga0495640_0123142 Ga0495640_0123142_67_900 275
498 3300046535 Ga0495586_0004070 Ga0495586_0004070_1165_1998 275
499 3300046559 Ga0495667_0110978 Ga0495667_0110978_757_1590 275
500 3300046642 Ga0495634_0001890 Ga0495634_0001890_15004_15837 275
501 3300046681 Ga0495647_0003772 Ga0495647_0003772_721_1554 275
502 3300046683 Ga0495658_0056164 Ga0495658_0056164_935_1768 275
503 3300046690 Ga0495624_0078000 Ga0495624_0078000_1202_2035 275
504 3300046809 Ga0495600_0071975 Ga0495600_0071975_480_1313 275
505 3300047319 Ga0495674_0042378 Ga0495674_0042378_2767_3600 275
506 3300047322 Ga0495680_0035849 Ga0495680_0035849_2848_3681 275
507 3300047471 Ga0495684_0107340 Ga0495684_0107340_717_1550 275
508 3300048089 Ga0495614_0083190 Ga0495614_0083190_251_1084 275
509 3300001990 JGI24737J22298_10000840 JGI24737J22298_100008402 276
510 3300002067 JGI24735J21928_10021300 JGI24735J21928_100213001 276
511 3300002077 JGI24744J21845_10008150 JGI24744J21845_100081502 276
512 3300003214 JGI25165J46597_1001383 JGI25165J46597_10013833 276
513 3300003214 JGI25165J46597_1010880 JGI25165J46597_10108802 276
514 3300003316 rootH1_10139411 rootH1_101394113 276
515 3300003320 rootH2_10002321 rootH2_1000232186 276
516 3300003320 rootH2_10022605 rootH2_100226053 276
517 3300003323 rootH1_10039624 rootH1_1003962410 276
518 3300003323 rootH1_10068371 rootH1_100683713 276
519 3300003323 rootH1_10235905 rootH1_102359051 276
520 3300005327 Ga0070658_10000200 Ga0070658_1000020039 276
521 3300005327 Ga0070658_10074142 Ga0070658_100741424 276
522 3300005328 Ga0070676_10002382 Ga0070676_100023825 276
523 3300005329 Ga0070683_100022500 Ga0070683_1000225003 276
524 3300005329 Ga0070683_100168911 Ga0070683_1001689113 276
525 3300005336 Ga0070680_100060347 Ga0070680_1000603472 276
526 3300005338 Ga0068868_100005678 Ga0068868_1000056784 276
527 3300005338 Ga0068868_100087456 Ga0068868_1000874561 276
528 3300005339 Ga0070660_100052135 Ga0070660_1000521351 276
529 3300005339 Ga0070660_100062739 Ga0070660_1000627392 276
530 3300005354 Ga0070675_100547737 Ga0070675_1005477371 276
531 3300005355 Ga0070671_100006664 Ga0070671_1000066644 276
532 3300005364 Ga0070673_100023233 Ga0070673_1000232333 276
533 3300005364 Ga0070673_100531917 Ga0070673_1005319172 276
534 3300005365 Ga0070688_100204885 Ga0070688_1002048851 276
535 3300005366 Ga0070659_100000242 Ga0070659_10000024230 276
536 3300005366 Ga0070659_100005922 Ga0070659_1000059224 276
537 3300005367 Ga0070667_100086003 Ga0070667_1000860033 276
538 3300005435 Ga0070714_100150627 Ga0070714_1001506271 276
539 3300005456 Ga0070678_100013519 Ga0070678_1000135192 276
540 3300005457 Ga0070662_100000877 Ga0070662_1000008774 276
541 3300005457 Ga0070662_100083699 Ga0070662_1000836992 276
542 3300005458 Ga0070681_10004904 Ga0070681_1000490410 276
543 3300005458 Ga0070681_10165503 Ga0070681_101655034 276
544 3300005459 Ga0068867_100000040 Ga0068867_1000000403 276
545 3300005518 Ga0070699_100248493 Ga0070699_1002484932 276
546 3300005530 Ga0070679_100007648 Ga0070679_1000076487 276
547 3300005535 Ga0070684_100197397 Ga0070684_1001973973 276
548 3300005535 Ga0070684_100201531 Ga0070684_1002015311 276
549 3300005539 Ga0068853_100005706 Ga0068853_1000057066 276
550 3300005548 Ga0070665_100000010 Ga0070665_100000010306 276
551 3300005548 Ga0070665_100207748 Ga0070665_1002077482 276
552 3300005548 Ga0070665_100325771 Ga0070665_1003257712 276
553 3300005563 Ga0068855_100000054 Ga0068855_10000005467 276
554 3300005563 Ga0068855_100012882 Ga0068855_1000128823 276
555 3300005563 Ga0068855_100110740 Ga0068855_1001107404 276
556 3300005563 Ga0068855_100211524 Ga0068855_1002115242 276
557 3300005577 Ga0068857_100036079 Ga0068857_1000360794 276
558 3300005578 Ga0068854_100080200 Ga0068854_1000802003 276
559 3300005614 Ga0068856_100000023 Ga0068856_10000002393 276
560 3300005614 Ga0068856_100005806 Ga0068856_1000058066 276
561 3300005614 Ga0068856_100028518 Ga0068856_1000285182 276
562 3300005614 Ga0068856_100163191 Ga0068856_1001631913 276
563 3300005614 Ga0068856_100178323 Ga0068856_1001783232 276
564 3300005614 Ga0068856_100266109 Ga0068856_1002661093 276
565 3300005616 Ga0068852_100033904 Ga0068852_1000339043 276
566 3300005718 Ga0068866_10011030 Ga0068866_100110303 276
567 3300006028 Ga0070717_10020023 Ga0070717_100200234 276
568 3300006237 Ga0097621_100000011 Ga0097621_10000001115 276
569 3300006358 Ga0068871_100003357 Ga0068871_1000033575 276
570 3300006881 Ga0068865_100001113 Ga0068865_1000011139 276
571 3300009093 Ga0105240_10003887 Ga0105240_1000388717 276
572 3300009093 Ga0105240_10012765 Ga0105240_100127657 276
573 3300009093 Ga0105240_10046934 Ga0105240_100469341 276
574 3300009093 Ga0105240_10085736 Ga0105240_100857363 276
575 3300009093 Ga0105240_10109624 Ga0105240_101096242 276
576 3300009093 Ga0105240_10133272 Ga0105240_101332724 276
577 3300009093 Ga0105240_10180658 Ga0105240_101806582 276
578 3300009093 Ga0105240_10282272 Ga0105240_102822723 276
579 3300009093 Ga0105240_10314348 Ga0105240_103143482 276
580 3300009093 Ga0105240_10447387 Ga0105240_104473872 276
581 3300009093 Ga0105240_10694057 Ga0105240_106940571 276
582 3300009174 Ga0105241_10003934 Ga0105241_100039349 276
583 3300009174 Ga0105241_10006678 Ga0105241_100066786 276
584 3300009174 Ga0105241_10710459 Ga0105241_107104591 276
585 3300009176 Ga0105242_10011984 Ga0105242_100119844 276
586 3300009176 Ga0105242_10075022 Ga0105242_100750223 276
587 3300009545 Ga0105237_10004319 Ga0105237_1000431910 276
588 3300009545 Ga0105237_10004940 Ga0105237_1000494014 276
589 3300009545 Ga0105237_10011977 Ga0105237_100119775 276
590 3300009545 Ga0105237_10056078 Ga0105237_100560783 276
591 3300009545 Ga0105237_10150727 Ga0105237_101507272 276
592 3300009545 Ga0105237_10242362 Ga0105237_102423623 276
593 3300009551 Ga0105238_10003247 Ga0105238_100032475 276
594 3300009551 Ga0105238_10031206 Ga0105238_100312067 276
595 3300010375 Ga0105239_10000011 Ga0105239_1000001183 276
596 3300010375 Ga0105239_10008277 Ga0105239_100082773 276
597 3300010375 Ga0105239_10037880 Ga0105239_100378801 276
598 3300010375 Ga0105239_10214113 Ga0105239_102141132 276
599 3300011119 Ga0105246_10002620 Ga0105246_100026205 276
600 3300011119 Ga0105246_10033519 Ga0105246_100335193 276
601 3300013100 Ga0157373_10012250 Ga0157373_100122503 276
602 3300013100 Ga0157373_10016721 Ga0157373_100167213 276
603 3300013102 Ga0157371_10050715 Ga0157371_100507152 276
604 3300013104 Ga0157370_10010467 Ga0157370_100104674 276
605 3300013104 Ga0157370_10101904 Ga0157370_101019042 276
606 3300013104 Ga0157370_10280241 Ga0157370_102802412 276
607 3300013104 Ga0157370_10297377 Ga0157370_102973772 276
608 3300013105 Ga0157369_10031489 Ga0157369_100314893 276
609 3300013105 Ga0157369_10069306 Ga0157369_100693064 276
610 3300013105 Ga0157369_10367376 Ga0157369_103673762 276
611 3300013296 Ga0157374_10000391 Ga0157374_1000039121 276
612 3300013296 Ga0157374_10001058 Ga0157374_1000105813 276
613 3300013296 Ga0157374_10137383 Ga0157374_101373832 276
614 3300013297 Ga0157378_10012884 Ga0157378_100128841 276
615 3300013297 Ga0157378_10083027 Ga0157378_100830274 276
616 3300013297 Ga0157378_10119822 Ga0157378_101198223 276
617 3300013306 Ga0163162_10000082 Ga0163162_1000008233 276
618 3300013306 Ga0163162_10005591 Ga0163162_100055917 276
619 3300013307 Ga0157372_10001395 Ga0157372_1000139517 276
620 3300013307 Ga0157372_10054272 Ga0157372_100542721 276
621 3300013307 Ga0157372_10109261 Ga0157372_101092613 276
622 3300013307 Ga0157372_10817697 Ga0157372_108176971 276
623 3300013308 Ga0157375_10009398 Ga0157375_100093983 276
624 3300014969 Ga0157376_10040319 Ga0157376_100403193 276
625 3300015261 Ga0182006_1010004 Ga0182006_10100044 276
626 3300021361 Ga0213872_10002892 Ga0213872_100028925 276
627 3300021361 Ga0213872_10051840 Ga0213872_100518402 276
628 3300021377 Ga0213874_10019751 Ga0213874_100197512 276
629 3300021384 Ga0213876_10067790 Ga0213876_100677903 276
630 3300021388 Ga0213875_10000013 Ga0213875_10000013142 276
631 3300025231 Ga0207427_100137 Ga0207427_10013734 276
632 3300025233 Ga0209437_100112 Ga0209437_10011292 276
633 3300025261 Ga0209233_1000126 Ga0209233_100012689 276
634 3300025261 Ga0209233_1001504 Ga0209233_10015044 276
635 3300025261 Ga0209233_1008644 Ga0209233_10086442 276
636 3300025904 Ga0207647_10000046 Ga0207647_1000004664 276
637 3300025904 Ga0207647_10000171 Ga0207647_1000017161 276
638 3300025907 Ga0207645_10001612 Ga0207645_1000161211 276
639 3300025909 Ga0207705_10000257 Ga0207705_1000025710 276
640 3300025911 Ga0207654_10001865 Ga0207654_100018659 276
641 3300025912 Ga0207707_10071101 Ga0207707_100711011 276
642 3300025913 Ga0207695_10043027 Ga0207695_100430274 276
643 3300025913 Ga0207695_10052703 Ga0207695_100527034 276
644 3300025913 Ga0207695_10098617 Ga0207695_100986173 276
645 3300025913 Ga0207695_10223355 Ga0207695_102233553 276
646 3300025913 Ga0207695_10298667 Ga0207695_102986672 276
647 3300025913 Ga0207695_10349272 Ga0207695_103492722 276
648 3300025913 Ga0207695_10411137 Ga0207695_104111372 276
649 3300025914 Ga0207671_10003029 Ga0207671_1000302913 276
650 3300025914 Ga0207671_10010521 Ga0207671_100105213 276
651 3300025914 Ga0207671_10019385 Ga0207671_100193853 276
652 3300025914 Ga0207671_10129435 Ga0207671_101294351 276
653 3300025917 Ga0207660_10002156 Ga0207660_100021568 276
654 3300025919 Ga0207657_10034733 Ga0207657_100347335 276
655 3300025921 Ga0207652_10264368 Ga0207652_102643681 276
656 3300025924 Ga0207694_10016698 Ga0207694_100166983 276
657 3300025926 Ga0207659_10467900 Ga0207659_104679001 276
658 3300025931 Ga0207644_10024997 Ga0207644_100249973 276
659 3300025932 Ga0207690_10001885 Ga0207690_100018858 276
660 3300025932 Ga0207690_10006251 Ga0207690_100062514 276
661 3300025933 Ga0207706_10001858 Ga0207706_1000185813 276
662 3300025938 Ga0207704_10000169 Ga0207704_100001699 276
663 3300025949 Ga0207667_10000023 Ga0207667_10000023244 276
664 3300025949 Ga0207667_10020179 Ga0207667_100201792 276
665 3300025949 Ga0207667_10037903 Ga0207667_100379033 276
666 3300025949 Ga0207667_10067382 Ga0207667_100673823 276
667 3300025949 Ga0207667_10329862 Ga0207667_103298621 276
668 3300025960 Ga0207651_10034259 Ga0207651_100342593 276
669 3300025981 Ga0207640_10030346 Ga0207640_100303464 276
670 3300026023 Ga0207677_10005304 Ga0207677_100053045 276
671 3300026041 Ga0207639_10003935 Ga0207639_100039354 276
672 3300026041 Ga0207639_10156581 Ga0207639_101565812 276
673 3300026078 Ga0207702_10000314 Ga0207702_1000031440 276
674 3300026078 Ga0207702_10012932 Ga0207702_100129322 276
675 3300026078 Ga0207702_10061438 Ga0207702_100614383 276
676 3300026078 Ga0207702_10224419 Ga0207702_102244192 276
677 3300026078 Ga0207702_10502683 Ga0207702_105026832 276
678 3300026089 Ga0207648_10000220 Ga0207648_1000022015 276
679 3300026121 Ga0207683_10154701 Ga0207683_101547012 276
680 3300026142 Ga0207698_10015037 Ga0207698_100150373 276
681 3300028379 Ga0268266_10000032 Ga0268266_10000032270 276
682 3300028379 Ga0268266_10009865 Ga0268266_100098657 276
683 3300028379 Ga0268266_10013247 Ga0268266_100132472 276
684 3300028786 Ga0307517_10000429 Ga0307517_1000042957 276
685 3300028800 Ga0265338_10001594 Ga0265338_1000159412 276
686 3300028800 Ga0265338_10020888 Ga0265338_100208884 276
687 3300031249 Ga0265339_10002485 Ga0265339_100024859 276
688 3300031251 Ga0265327_10006320 Ga0265327_1000632011 276
689 3300031665 Ga0316575_10006715 Ga0316575_100067153 276
690 3300033180 Ga0307510_10010589 Ga0307510_100105899 276
691 3300037068 Ga0373925_0036081 Ga0373925_0036081_1030_1866 276
692 3300037312 Ga0395899_0087037 Ga0395899_0087037_940_1776 276
693 3300037312 Ga0395899_0165520 Ga0395899_0165520_39_875 276
694 3300037418 Ga0395900_0000194 Ga0395900_0000194_37588_38424 276
695 3300037418 Ga0395900_0045441 Ga0395900_0045441_3031_3867 276
696 3300037418 Ga0395900_0166981 Ga0395900_0166981_948_1787 276
697 3300037466 Ga0395898_0043670 Ga0395898_0043670_565_1401 276
698 3300037466 Ga0395898_0190280 Ga0395898_0190280_323_1159 276
699 3300037471 Ga0395905_0000355 Ga0395905_0000355_20864_21700 276
700 3300037471 Ga0395905_0011403 Ga0395905_0011403_4956_5795 276
701 3300037853 Ga0436364_0794765 Ga0436364_0794765_153004_153840 276
702 3300037853 Ga0436364_1359397 Ga0436364_1359397_302_1138 276
703 3300038443 Ga0395901_0026672 Ga0395901_0026672_2834_3670 276
704 3300038443 Ga0395901_0041615 Ga0395901_0041615_3593_4429 276
705 3300038443 Ga0395901_0072785 Ga0395901_0072785_718_1557 276
706 3300039437 Ga0436365_0361465 Ga0436365_0361465_938_1774 276
707 3300039437 Ga0436365_1082274 Ga0436365_1082274_7994_8830 276
708 3300039438 Ga0436360_0295097 Ga0436360_0295097_1528_2364 276
709 3300039447 Ga0436361_1206081 Ga0436361_1206081_3713_4549 276
710 3300039450 Ga0436363_0008358 Ga0436363_0008358_510_1346 276
711 3300039450 Ga0436363_0640237 Ga0436363_0640237_312_1148 276
712 3300039453 Ga0436362_0347231 Ga0436362_0347231_3968_4804 276
713 3300042876 Ga0451577_0640125 Ga0451577_0640125_95_940 276
714 3300044712 Ga0453684_0011973 Ga0453684_0011973_10410_11255 276
715 3300045049 Ga0466959_0353321 Ga0466959_0353321_122_958 276
716 3300045976 Ga0466967_0120329 Ga0466967_0120329_1176_2012 276
717 3300046454 Ga0495592_0057917 Ga0495592_0057917_422_1297 276
718 3300046471 Ga0495650_0008037 Ga0495650_0008037_3840_4676 276
719 3300046476 Ga0495662_0024394 Ga0495662_0024394_365_1240 276
720 3300046477 Ga0495664_0001480 Ga0495664_0001480_11254_12129 276
721 3300046500 Ga0495596_0015176 Ga0495596_0015176_1664_2500 276
722 3300046516 Ga0495628_0020615 Ga0495628_0020615_4516_5391 276
723 3300046529 Ga0495652_0268578 Ga0495652_0268578_246_1121 276
724 3300046535 Ga0495586_0052124 Ga0495586_0052124_1292_2167 276
725 3300046536 Ga0495587_0091428 Ga0495587_0091428_466_1341 276
726 3300046543 Ga0495645_0024026 Ga0495645_0024026_1052_1927 276
727 3300046642 Ga0495634_0304783 Ga0495634_0304783_72_947 276
728 3300046660 Ga0495625_0000422 Ga0495625_0000422_32105_32941 276
729 3300046660 Ga0495625_0253441 Ga0495625_0253441_102_938 276
730 3300046678 Ga0495599_0008956 Ga0495599_0008956_3832_4707 276
731 3300047322 Ga0495680_0031119 Ga0495680_0031119_3358_4233 276
732 3300047443 Ga0495687_005321 Ga0495687_005321_6047_6883 276
733 3300047471 Ga0495684_0260943 Ga0495684_0260943_339_1175 276
734 3300047472 Ga0495686_0002322 Ga0495686_0002322_10270_11106 276
735 3300048929 Ga0496126_0000010 Ga0496126_0000010_629985_630821 276
736 3300048929 Ga0496126_0000095 Ga0496126_0000095_149467_150306 276
737 3300048929 Ga0496126_0007453 Ga0496126_0007453_2650_3486 276
738 3300049571 Ga0501034_0006905 Ga0501034_0006905_7976_8827 276
739 3300049593 Ga0501077_0008963 Ga0501077_0008963_2235_3071 276
740 3300049593 Ga0501077_0380387 Ga0501077_0380387_21_857 276
741 3300049741 Ga0501079_0523946 Ga0501079_0523946_57_893 276
742 3300050496 nmdc:mga07m45_34980_c1 nmdc:mga07m45_34980_c1_1885_2721 276
743 3300053077 Ga0495601_0075942 Ga0495601_0075942_515_1351 276
744 3300053080 Ga0500635_0004193 Ga0500635_0004193_349_1185 276
745 3300053080 Ga0500635_0005378 Ga0500635_0005378_776_1612 276
746 3300053130 Ga0500642_0011622 Ga0500642_0011622_595_1431 276
747 3300053156 Ga0500622_0001257 Ga0500622_0001257_4343_5179 276
748 3300003323 rootH1_10083328 rootH1_100833283 277
749 3300003781 Ga0055536_1000004 Ga0055536_100000495 277
750 3300003791 Ga0055530_10000817 Ga0055530_1000081733 277
751 3300005288 Ga0065714_10065250 Ga0065714_1006525010 277
752 3300005288 Ga0065714_10110142 Ga0065714_101101422 277
753 3300005445 Ga0070708_100000030 Ga0070708_10000003037 277
754 3300009545 Ga0105237_10013652 Ga0105237_100136523 277
755 3300009545 Ga0105237_10060642 Ga0105237_100606423 277
756 3300010375 Ga0105239_10001982 Ga0105239_1000198218 277
757 3300010375 Ga0105239_10007356 Ga0105239_100073564 277
758 3300013100 Ga0157373_10008448 Ga0157373_100084485 277
759 3300013102 Ga0157371_10005650 Ga0157371_100056504 277
760 3300013104 Ga0157370_10001193 Ga0157370_1000119331 277
761 3300013104 Ga0157370_10146649 Ga0157370_101466492 277
762 3300013105 Ga0157369_10000023 Ga0157369_1000002319 277
763 3300013306 Ga0163162_10000013 Ga0163162_100000139 277
764 3300013306 Ga0163162_10002182 Ga0163162_100021829 277
765 3300013307 Ga0157372_10067480 Ga0157372_100674802 277
766 3300014497 Ga0182008_10000600 Ga0182008_1000060014 277
767 3300015261 Ga0182006_1000849 Ga0182006_10008492 277
768 3300015261 Ga0182006_1002239 Ga0182006_10022393 277
769 3300015262 Ga0182007_10000002 Ga0182007_10000002447 277
770 3300015682 Ga0183373_1004 Ga0183373_100449 277
771 3300017792 Ga0163161_10002409 Ga0163161_100024092 277
772 3300017792 Ga0163161_10003140 Ga0163161_1000314012 277
773 3300025233 Ga0209437_100119 Ga0209437_10011975 277
774 3300025292 Ga0209676_1000009 Ga0209676_1000009458 277
775 3300025298 Ga0209050_1000048 Ga0209050_1000048254 277
776 3300025914 Ga0207671_10002980 Ga0207671_1000298016 277
777 3300025914 Ga0207671_10011192 Ga0207671_100111926 277
778 3300028379 Ga0268266_10000080 Ga0268266_1000008035 277
779 3300031731 Ga0307405_10000006 Ga0307405_1000000645 277
780 3300031903 Ga0307407_10000003 Ga0307407_10000003203 277
781 3300031995 Ga0307409_100110604 Ga0307409_1001106042 277
782 3300032002 Ga0307416_100000002 Ga0307416_100000002447 277
783 3300035695 Ga0373927_0170953 Ga0373927_0170953_229_1068 277
784 3300044658 Ga0466972_0000014 Ga0466972_0000014_22308_23144 277
785 3300044684 Ga0466966_0230552 Ga0466966_0230552_179_1018 277
786 3300044765 Ga0466970_0000352 Ga0466970_0000352_2912_3748 277
787 3300045049 Ga0466959_0055372 Ga0466959_0055372_501_1340 277
788 3300045836 Ga0466958_0188315 Ga0466958_0188315_327_1166 277
789 3300046462 Ga0495651_0003054 Ga0495651_0003054_6983_7822 277
790 3300046463 Ga0495653_0147935 Ga0495653_0147935_680_1519 277
791 3300046476 Ga0495662_0107767 Ga0495662_0107767_307_1146 277
792 3300046477 Ga0495664_0009264 Ga0495664_0009264_2141_2980 277
793 3300046507 Ga0495606_0009521 Ga0495606_0009521_4075_4914 277
794 3300046512 Ga0495610_0000148 Ga0495610_0000148_18295_19128 277
795 3300046512 Ga0495610_0002626 Ga0495610_0002626_13320_14153 277
796 3300046512 Ga0495610_0010777 Ga0495610_0010777_661_1494 277
797 3300046517 Ga0495630_0025857 Ga0495630_0025857_2477_3316 277
798 3300046517 Ga0495630_0264441 Ga0495630_0264441_225_1064 277
799 3300046529 Ga0495652_0189312 Ga0495652_0189312_220_1059 277
800 3300046531 Ga0495665_0146046 Ga0495665_0146046_35_874 277
801 3300046536 Ga0495587_0134044 Ga0495587_0134044_478_1317 277
802 3300046665 Ga0495661_0001078 Ga0495661_0001078_16676_17515 277
803 3300046665 Ga0495661_0139149 Ga0495661_0139149_360_1199 277
804 3300046678 Ga0495599_0002460 Ga0495599_0002460_7006_7845 277
805 3300046679 Ga0495623_0172534 Ga0495623_0172534_18_857 277
806 3300046680 Ga0495646_0118958 Ga0495646_0118958_434_1273 277
807 3300046809 Ga0495600_0040352 Ga0495600_0040352_926_1765 277
808 3300047317 Ga0495604_0144436 Ga0495604_0144436_769_1608 277
809 3300047319 Ga0495674_0011132 Ga0495674_0011132_6846_7685 277
810 3300049679 Ga0501249_015647 Ga0501249_015647_680_1513 277
811 3300053138 Ga0500564_127236 Ga0500564_127236_117_950 277
812 3300002773 JGI25152J39213_1000006 JGI25152J39213_100000647 278
813 3300002774 JGI25150J39212_1000005 JGI25150J39212_1000005186 278
814 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004354 278
815 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004354 278
816 3300005288 Ga0065714_10007399 Ga0065714_100073995 278
817 3300005339 Ga0070660_100000172 Ga0070660_10000017236 278
818 3300005339 Ga0070660_100019016 Ga0070660_1000190167 278
819 3300005341 Ga0070691_10009132 Ga0070691_100091323 278
820 3300005539 Ga0068853_100062754 Ga0068853_1000627544 278
821 3300005563 Ga0068855_100033711 Ga0068855_1000337113 278
822 3300005577 Ga0068857_100182735 Ga0068857_1001827352 278
823 3300005577 Ga0068857_100318782 Ga0068857_1003187822 278
824 3300005937 Ga0081455_10056904 Ga0081455_100569043 278
825 3300009174 Ga0105241_10092839 Ga0105241_100928392 278
826 3300009545 Ga0105237_10000381 Ga0105237_1000038127 278
827 3300009545 Ga0105237_10002553 Ga0105237_100025539 278
828 3300013100 Ga0157373_10018974 Ga0157373_100189746 278
829 3300013102 Ga0157371_10001686 Ga0157371_1000168611 278
830 3300013102 Ga0157371_10009615 Ga0157371_100096153 278
831 3300013102 Ga0157371_10010104 Ga0157371_100101044 278
832 3300013102 Ga0157371_10078959 Ga0157371_100789592 278
833 3300013104 Ga0157370_10000084 Ga0157370_100000846 278
834 3300013104 Ga0157370_10066433 Ga0157370_100664335 278
835 3300013105 Ga0157369_10008828 Ga0157369_100088286 278
836 3300013307 Ga0157372_10606185 Ga0157372_106061852 278
837 3300013308 Ga0157375_10034701 Ga0157375_100347014 278
838 3300014497 Ga0182008_10005586 Ga0182008_100055865 278
839 3300015261 Ga0182006_1000806 Ga0182006_10008068 278
840 3300015262 Ga0182007_10042238 Ga0182007_100422381 278
841 3300017792 Ga0163161_10002163 Ga0163161_100021636 278
842 3300017792 Ga0163161_10195333 Ga0163161_101953331 278
843 3300025245 Ga0207425_1000008 Ga0207425_100000884 278
844 3300025258 Ga0209129_1000040 Ga0209129_1000040181 278
845 3300025294 Ga0209025_1000020 Ga0209025_100002084 278
846 3300025297 Ga0209758_1000022 Ga0209758_100002284 278
847 3300025909 Ga0207705_10115602 Ga0207705_101156022 278
848 3300025911 Ga0207654_10013745 Ga0207654_100137455 278
849 3300025913 Ga0207695_10036490 Ga0207695_100364904 278
850 3300025914 Ga0207671_10000006 Ga0207671_10000006728 278
851 3300025914 Ga0207671_10005707 Ga0207671_100057079 278
852 3300025919 Ga0207657_10010910 Ga0207657_100109106 278
853 3300025919 Ga0207657_10048579 Ga0207657_100485795 278
854 3300025921 Ga0207652_10040702 Ga0207652_100407024 278
855 3300025929 Ga0207664_10035319 Ga0207664_100353193 278
856 3300025949 Ga0207667_10085121 Ga0207667_100851213 278
857 3300026041 Ga0207639_10022983 Ga0207639_100229832 278
858 3300026078 Ga0207702_10024484 Ga0207702_100244842 278
859 3300026116 Ga0207674_10038061 Ga0207674_100380617 278
860 3300026142 Ga0207698_10390424 Ga0207698_103904241 278
861 3300028381 Ga0268264_10550300 Ga0268264_105503001 278
862 3300028794 Ga0307515_10007084 Ga0307515_100070844 278
863 3300031235 Ga0265330_10004610 Ga0265330_100046105 278
864 3300031251 Ga0265327_10000006 Ga0265327_1000000699 278
865 3300031344 Ga0265316_10048954 Ga0265316_100489541 278
866 3300031911 Ga0307412_10000085 Ga0307412_100000857 278
867 3300039447 Ga0436361_0972882 Ga0436361_0972882_73290_74180 278
868 3300044658 Ga0466972_0000161 Ga0466972_0000161_31919_32755 278
869 3300046558 Ga0495633_0000450 Ga0495633_0000450_1620_2456 278
870 3300048925 Ga0496122_0000862 Ga0496122_0000862_39167_40003 278
871 3300048926 Ga0496123_0108966 Ga0496123_0108966_109_945 278
872 3300049571 Ga0501034_0067604 Ga0501034_0067604_1105_1971 278
873 3300049571 Ga0501034_0105743 Ga0501034_0105743_1593_2429 278
874 3300049572 Ga0501036_0236528 Ga0501036_0236528_46_912 278
875 3300049574 Ga0501038_0305870 Ga0501038_0305870_373_1209 278
876 3300049580 Ga0501046_0004542 Ga0501046_0004542_2844_3710 278
877 3300049582 Ga0501048_0108718 Ga0501048_0108718_274_1140 278
878 3300049758 Ga0501241_006434 Ga0501241_006434_1109_1945 278
879 3300049823 Ga0501044_0121840 Ga0501044_0121840_751_1617 278
880 3300049823 Ga0501044_0328319 Ga0501044_0328319_397_1233 278
881 3300053093 Ga0500651_0140347 Ga0500651_0140347_312_1148 278
882 3300053108 Ga0500562_000095 Ga0500562_000095_12459_13298 278
883 3300053178 Ga0500637_0090303 Ga0500637_0090303_726_1562 278
884 3300053730 Ga0500645_004861 Ga0500645_004861_1296_2135 278
885 3300055283 Ga0500661_001496 Ga0500661_001496_950_1789 278
886 3300044658 Ga0466972_0000046 Ga0466972_0000046_8747_9586 279
887 3300005563 Ga0068855_100000856 Ga0068855_10000085615 283
888 3300013296 Ga0157374_10000011 Ga0157374_1000001148 283
889 3300013296 Ga0157374_10005516 Ga0157374_100055164 283
890 3300025949 Ga0207667_10006360 Ga0207667_100063607 283
891 iso_pu_bacteria 2738541284 2738762092 283
892 iso_pu_bacteria 2738543023 2739301928 283
893 iso_pu_bacteria 2775506987 2776615282 283
894 3300009545 Ga0105237_10001316 Ga0105237_1000131613 284
895 3300014969 Ga0157376_10271248 Ga0157376_102712482 284
896 3300017792 Ga0163161_10225768 Ga0163161_102257682 284
897 3300005327 Ga0070658_10063529 Ga0070658_100635294 285
898 3300005546 Ga0070696_100075778 Ga0070696_1000757783 285
899 2162886007 SwRhRL2b_contig_3008445 SwRhRL2b_0052.00005830 287
900 3300003323 rootH1_10086794 rootH1_100867942 287
901 3300005288 Ga0065714_10004209 Ga0065714_100042095 287
902 3300005288 Ga0065714_10009634 Ga0065714_100096344 287
903 3300005289 Ga0065704_10001893 Ga0065704_100018933 287
904 3300005289 Ga0065704_10098950 Ga0065704_100989503 287
905 3300013100 Ga0157373_10049369 Ga0157373_100493693 287
906 3300013100 Ga0157373_10065552 Ga0157373_100655523 287
907 3300013102 Ga0157371_10054888 Ga0157371_100548883 287
908 3300013102 Ga0157371_10140751 Ga0157371_101407513 287
909 3300013104 Ga0157370_10083652 Ga0157370_100836523 287
910 3300013104 Ga0157370_10083711 Ga0157370_100837113 287
911 3300014497 Ga0182008_10000002 Ga0182008_10000002422 287
912 3300015261 Ga0182006_1088462 Ga0182006_10884622 287
913 3300017792 Ga0163161_10135846 Ga0163161_101358462 287
914 3300032004 Ga0307414_10114369 Ga0307414_101143693 287
915 3300053093 Ga0500651_0000078 Ga0500651_0000078_29160_30023 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

19

298

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5374 19 278
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5296 19 283
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5291 19 278
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5205 19 283
8c03-assembly1.cif.gz_A structure of slc40/ferroportin in complex with vamifeport and synthetic nanobody sy12 in outward-facing conformation 0.4174 53 287
ID Description Score Start End Superfamily
af_A0A1D8PRS0_66_261_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4707 55 281 1.20.1250.20
af_O45678_17_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4652 54 286 1.20.1250.20
af_O96156_55_269_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4612 54 278 1.20.1250.20
af_Q2FZP8_207_396_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4478 13 286 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4474 43 280 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1H7ZCC3-F1-model_v4 Probable membrane transporter protein 0.9928 10 287 GO:0005886
AF-A0A7W8QX99-F1-model_v4 Probable membrane transporter protein 0.9902 10 287 GO:0005886
AF-A0A4Q3TFN6-F1-model_v4 deleted 0.9878 10 232
AF-A0A7W8QX99-F1-model_v4 Probable membrane transporter protein 0.9867 10 287 GO:0005886
AF-A0A2V3PMI7-F1-model_v4 Probable membrane transporter protein 0.9852 9 287 GO:0005886

Feature Viewer

pLDDT pTM Quality
83.86 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map