F485599

General Info

Members Datasets Scaffolds Average Seq Length
915 318 893 197

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0835150|Ga0451577_0835150_60_713
Length 217
Sequence LEDLNFQTFQLANFQTLMLLPESIQSLINALERLPGIGPKSASRLAFYLLRATDDVSDDLALALAHLKKNTAFCQECFNITEAGRERCEVCESPKRDIGVICVVEEALDVLALERTGGFQGKYHVLQGVLSPIEGIGPDDLKIKQLVARVAGGGVKEIILATNPSMEGDATALYLRQQLEPLGVRVTRLARGLPMGGDLEYADQNTLLRALSGRQEM

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501939600 Micromonospora sp. L5 Isolate Unclassified
3 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
4 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
5 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
6 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
7 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
8 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
11 2855683550 Micromonospora sp. RP3T Isolate Unclassified
12 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
13 2858868258 Micromonospora sp. MH33 Isolate Unclassified
14 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
15 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
16 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
17 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
18 2902582711 Micromonospora sp. AP08 Isolate Unclassified
19 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
179 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
196 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
197 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
198 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
216 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
217 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
218 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
219 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
226 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
227 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
228 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
229 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
290 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
291 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
292 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
293 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
297 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
298 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
315 649633069 Micromonospora sp. L5 Isolate Unclassified
316 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
317 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
318 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.6
Metatranscriptomes 0
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.11
Rhizoplane 6.01
Rhizosphere 91.8
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2348821 2162886007 Bacteria 10295
2 JGI25406J46586_10003441 3300003203 Bacteria 7446
3 Ga0065704_10134448 3300005289 Bacteria 1588
4 Ga0065707_10000534 3300005295 Bacteria 41079
5 Ga0065707_10013151 3300005295 Bacteria 1802
6 Ga0065707_10084320 3300005295 Bacteria 7347
7 Ga0065707_10086250 3300005295 Bacteria 5573
8 Ga0065707_10088820 3300005295 Bacteria 4544
9 Ga0065707_10141701 3300005295 Bacteria 1764
10 Ga0065707_10358976 3300005295 Bacteria 907
11 Ga0070676_10465125 3300005328 Bacteria 892
12 Ga0070683_100115483 3300005329 Bacteria 2534
13 Ga0070683_100271823 3300005329 Bacteria 1612
14 Ga0070683_100505106 3300005329 Bacteria 1155
15 Ga0070690_100212680 3300005330 Bacteria 1351
16 Ga0070670_100361242 3300005331 Bacteria 1277
17 Ga0068869_100322214 3300005334 Bacteria 1254
18 Ga0068869_100646652 3300005334 Bacteria 897
19 Ga0070666_10021013 3300005335 Bacteria 4227
20 Ga0070680_100026468 3300005336 Bacteria 4639
21 Ga0070680_100160301 3300005336 Bacteria 1890
22 Ga0070680_100449132 3300005336 Unclassified 1101
23 Ga0070682_100467703 3300005337 Bacteria 970
24 Ga0070682_100934053 3300005337 Bacteria 715
25 Ga0070660_100342902 3300005339 Unclassified 1229
26 Ga0070689_100036265 3300005340 Unclassified 3771
27 Ga0070689_100077762 3300005340 Bacteria 2601
28 Ga0070691_10033186 3300005341 Bacteria 2428
29 Ga0070691_10073913 3300005341 Unclassified 1658
30 Ga0070668_100088259 3300005347 Bacteria 2441
31 Ga0070668_100875506 3300005347 Bacteria 802
32 Ga0070669_100119875 3300005353 Bacteria 2005
33 Ga0070675_100115937 3300005354 Bacteria 2271
34 Ga0070674_100016428 3300005356 Bacteria 4638
35 Ga0070674_100149071 3300005356 Bacteria 1763
36 Ga0070673_100039952 3300005364 Bacteria 3595
37 Ga0070673_100583836 3300005364 Unclassified 1018
38 Ga0070659_100120242 3300005366 Unclassified 2127
39 Ga0070659_100875949 3300005366 Bacteria 784
40 Ga0070703_10018711 3300005406 Bacteria 2005
41 Ga0070703_10072110 3300005406 Bacteria 1156
42 Ga0070714_100000067 3300005435 Bacteria 95377
43 Ga0070713_100238053 3300005436 Bacteria 1657
44 Ga0070701_10072275 3300005438 Bacteria 1847
45 Ga0070701_10253151 3300005438 Bacteria 1064
46 Ga0070711_100034032 3300005439 Bacteria 3397
47 Ga0070711_100670425 3300005439 Bacteria 871
48 Ga0070705_100054393 3300005440 Bacteria 2348
49 Ga0070705_100178734 3300005440 Unclassified 1435
50 Ga0070705_100194168 3300005440 Bacteria 1386
51 Ga0070705_100295623 3300005440 Bacteria 1158
52 Ga0070705_100961505 3300005440 Bacteria 691
53 Ga0070694_100054762 3300005444 Bacteria 2703
54 Ga0070694_100192983 3300005444 Bacteria 1513
55 Ga0070694_100281309 3300005444 Bacteria 1268
56 Ga0070694_100636319 3300005444 Archaea 862
57 Ga0070708_100009481 3300005445 Bacteria 7847
58 Ga0070708_100079412 3300005445 Bacteria 2968
59 Ga0070708_100145472 3300005445 Bacteria 2201
60 Ga0070708_100180664 3300005445 Bacteria 1972
61 Ga0070708_100325341 3300005445 Bacteria 1448
62 Ga0070708_100354828 3300005445 Bacteria 1382
63 Ga0070708_100627083 3300005445 Unclassified 1013
64 Ga0070708_100765297 3300005445 Unclassified 908
65 Ga0070663_100325203 3300005455 Bacteria 1238
66 Ga0070678_100011829 3300005456 Bacteria 5399
67 Ga0070662_100000175 3300005457 Bacteria 37363
68 Ga0070681_10106027 3300005458 Bacteria 2752
69 Ga0068867_100968143 3300005459 Unclassified 770
70 Ga0070706_100001060 3300005467 Bacteria 29793
71 Ga0070706_100067957 3300005467 Bacteria 3295
72 Ga0070706_100258043 3300005467 Bacteria 1627
73 Ga0070706_100448758 3300005467 Unclassified 1200
74 Ga0070706_100537284 3300005467 Unclassified 1087
75 Ga0070706_100607832 3300005467 Bacteria 1016
76 Ga0070707_100242914 3300005468 Bacteria 1752
77 Ga0070707_100448094 3300005468 Unclassified 1251
78 Ga0070707_100658805 3300005468 Unclassified 1009
79 Ga0070707_100899774 3300005468 Bacteria 850
80 Ga0070707_101135074 3300005468 Bacteria 747
81 Ga0070698_100000782 3300005471 Bacteria 34479
82 Ga0070698_100043703 3300005471 Bacteria 4592
83 Ga0070698_100076693 3300005471 Bacteria 3344
84 Ga0070698_100113587 3300005471 Bacteria 2673
85 Ga0070698_100608205 3300005471 Unclassified 1033
86 Ga0070699_100013854 3300005518 Bacteria 6935
87 Ga0070699_100021018 3300005518 Bacteria 5627
88 Ga0070699_100024326 3300005518 Bacteria 5219
89 Ga0070699_100146642 3300005518 Bacteria 2085
90 Ga0070699_100252969 3300005518 Bacteria 1574
91 Ga0070699_100386567 3300005518 Bacteria 1264
92 Ga0070699_100541860 3300005518 Bacteria 1059
93 Ga0070699_100595732 3300005518 Bacteria 1008
94 Ga0070679_100011448 3300005530 Bacteria 8455
95 Ga0070679_100440650 3300005530 Bacteria 1247
96 Ga0070684_100342690 3300005535 Bacteria 1374
97 Ga0070697_100170097 3300005536 Bacteria 1844
98 Ga0070697_100379975 3300005536 Unclassified 1223
99 Ga0068853_100144092 3300005539 Bacteria 2140
100 Ga0068853_100199380 3300005539 Bacteria 1821
101 Ga0068853_100326296 3300005539 Bacteria 1424
102 Ga0068853_100514436 3300005539 Unclassified 1131
103 Ga0068853_100526443 3300005539 Unclassified 1118
104 Ga0070672_100174328 3300005543 Bacteria 1790
105 Ga0070672_100331102 3300005543 Bacteria 1295
106 Ga0070672_100776818 3300005543 Unclassified 842
107 Ga0070686_100020095 3300005544 Bacteria 3949
108 Ga0070695_100023736 3300005545 Bacteria 3775
109 Ga0070695_100175407 3300005545 Bacteria 1515
110 Ga0070695_100893224 3300005545 Bacteria 717
111 Ga0070696_100041490 3300005546 Bacteria 3179
112 Ga0070696_100120100 3300005546 Bacteria 1902
113 Ga0070696_100255683 3300005546 Unclassified 1326
114 Ga0070696_100307424 3300005546 Bacteria 1216
115 Ga0070696_100451007 3300005546 Bacteria 1015
116 Ga0070696_101068549 3300005546 Bacteria 677
117 Ga0070693_100093441 3300005547 Bacteria 1818
118 Ga0070665_100110766 3300005548 Bacteria 2748
119 Ga0070665_100217308 3300005548 Bacteria 1912
120 Ga0070665_100370835 3300005548 Bacteria 1438
121 Ga0070704_100014384 3300005549 Bacteria 4941
122 Ga0068855_100428231 3300005563 Bacteria 1446
123 Ga0070664_100003171 3300005564 Bacteria 13283
124 Ga0068854_100000312 3300005578 Bacteria 32026
125 Ga0068854_100271298 3300005578 Bacteria 1362
126 Ga0068856_100033924 3300005614 Bacteria 4998
127 Ga0070702_100125186 3300005615 Bacteria 1615
128 Ga0070702_100349563 3300005615 Unclassified 1041
129 Ga0068859_100148675 3300005617 Bacteria 2418
130 Ga0068859_100267092 3300005617 Bacteria 1803
131 Ga0068859_100485630 3300005617 Bacteria 1331
132 Ga0068859_101414743 3300005617 Unclassified 767
133 Ga0068859_102019998 3300005617 Unclassified 637
134 Ga0068864_100084812 3300005618 Bacteria 2784
135 Ga0068864_100569198 3300005618 Bacteria 1097
136 Ga0068864_101446374 3300005618 Unclassified 690
137 Ga0068864_101552906 3300005618 Unclassified 665
138 Ga0068866_10001272 3300005718 Bacteria 10924
139 Ga0068861_100076406 3300005719 Bacteria 2610
140 Ga0068861_100210320 3300005719 Bacteria 1638
141 Ga0068861_100691690 3300005719 Bacteria 947
142 Ga0068863_100664845 3300005841 Bacteria 1034
143 Ga0068858_100036613 3300005842 Bacteria 4549
144 Ga0068860_100065014 3300005843 Bacteria 3464
145 Ga0068862_100032711 3300005844 Bacteria 4393
146 Ga0068862_100064965 3300005844 Unclassified 3142
147 Ga0068862_100108951 3300005844 Unclassified 2429
148 Ga0068862_100561865 3300005844 Unclassified 1091
149 Ga0068862_100680186 3300005844 Bacteria 995
150 Ga0081539_10007668 3300005985 Bacteria 9706
151 Ga0081539_10180017 3300005985 Bacteria 992
152 Ga0070717_10023259 3300006028 Bacteria 4908
153 Ga0070716_100036618 3300006173 Bacteria 2706
154 Ga0070716_100116911 3300006173 Bacteria 1663
155 Ga0070712_100009514 3300006175 Bacteria 6127
156 Ga0070712_100145424 3300006175 Bacteria 1814
157 Ga0097621_100661874 3300006237 Bacteria 959
158 Ga0068871_100439763 3300006358 Bacteria 1167
159 Ga0075428_100156802 3300006844 Bacteria 2472
160 Ga0075428_100484481 3300006844 Bacteria 1324
161 Ga0075428_100836756 3300006844 Bacteria 977
162 Ga0075431_100010382 3300006847 Bacteria 9357
163 Ga0075431_100174887 3300006847 Bacteria 2205
164 Ga0075433_10090778 3300006852 Bacteria 2700
165 Ga0075433_10111882 3300006852 Bacteria 2422
166 Ga0075433_10125566 3300006852 Bacteria 2279
167 Ga0075433_10343770 3300006852 Bacteria 1319
168 Ga0075434_100160198 3300006871 Unclassified 2270
169 Ga0075434_100183518 3300006871 Bacteria 2113
170 Ga0075434_100196783 3300006871 Bacteria 2035
171 Ga0075434_100231108 3300006871 Bacteria 1869
172 Ga0075429_100009321 3300006880 Bacteria 8523
173 Ga0075429_100020232 3300006880 Bacteria 5771
174 Ga0075429_100113319 3300006880 Bacteria 2370
175 Ga0075429_100122470 3300006880 Unclassified 2274
176 Ga0075429_100167191 3300006880 Bacteria 1926
177 Ga0075429_100249161 3300006880 Unclassified 1555
178 Ga0068865_100003121 3300006881 Bacteria 9909
179 Ga0097620_100148690 3300006931 Bacteria 2418
180 Ga0097620_100267096 3300006931 Bacteria 1803
181 Ga0097620_100485633 3300006931 Bacteria 1331
182 Ga0097620_101414102 3300006931 Unclassified 767
183 Ga0097620_102020044 3300006931 Unclassified 637
184 Ga0075435_100074302 3300007076 Bacteria 2780
185 Ga0075435_100228132 3300007076 Bacteria 1582
186 Ga0075435_100347210 3300007076 Bacteria 1272
187 Ga0105240_10137190 3300009093 Bacteria 2929
188 Ga0111539_10104065 3300009094 Bacteria 3331
189 Ga0111539_10143028 3300009094 Bacteria 2800
190 Ga0111539_10188061 3300009094 Bacteria 2411
191 Ga0105245_10145200 3300009098 Bacteria 2238
192 Ga0114129_10010107 3300009147 Bacteria 13454
193 Ga0114129_10021191 3300009147 Bacteria 9231
194 Ga0114129_10029164 3300009147 Bacteria 7817
195 Ga0114129_10078848 3300009147 Bacteria 4580
196 Ga0114129_10117940 3300009147 Bacteria 3656
197 Ga0114129_10146934 3300009147 Bacteria 3229
198 Ga0114129_10239225 3300009147 Bacteria 2441
199 Ga0114129_10243733 3300009147 Bacteria 2415
200 Ga0114129_10278551 3300009147 Bacteria 2235
201 Ga0114129_10290366 3300009147 Unclassified 2182
202 Ga0114129_10531447 3300009147 Unclassified 1532
203 Ga0114129_11609996 3300009147 Bacteria 795
204 Ga0114129_11707085 3300009147 Bacteria 768
205 Ga0105243_10005127 3300009148 Bacteria 10276
206 Ga0105243_10065680 3300009148 Bacteria 2915
207 Ga0105243_10305125 3300009148 Bacteria 1444
208 Ga0105241_10032989 3300009174 Bacteria 3885
209 Ga0105241_10205417 3300009174 Bacteria 1648
210 Ga0105241_10214673 3300009174 Bacteria 1614
211 Ga0105242_10112499 3300009176 Bacteria 2323
212 Ga0105248_10201677 3300009177 Unclassified 2241
213 Ga0105237_10189306 3300009545 Bacteria 2058
214 Ga0105237_10274250 3300009545 Bacteria 1689
215 Ga0105238_10290619 3300009551 Bacteria 1617
216 Ga0105249_10142928 3300009553 Bacteria 2296
217 Ga0105249_10143739 3300009553 Bacteria 2290
218 Ga0105249_10198590 3300009553 Bacteria 1962
219 Ga0105249_10212704 3300009553 Bacteria 1898
220 Ga0105249_10283104 3300009553 Bacteria 1657
221 Ga0105249_10478027 3300009553 Bacteria 1288
222 Ga0105249_11099261 3300009553 Unclassified 865
223 Ga0105239_10042512 3300010375 Bacteria 4980
224 Ga0105239_10135905 3300010375 Bacteria 2737
225 Ga0105239_10191973 3300010375 Unclassified 2286
226 Ga0105246_10002516 3300011119 Bacteria 11081
227 Ga0105246_10048892 3300011119 Bacteria 2893
228 Ga0105246_10741936 3300011119 Bacteria 865
229 Ga0157375_10730471 3300013308 Unclassified 1142
230 Ga0157380_10140187 3300014326 Unclassified 2076
231 Ga0157380_10259749 3300014326 Bacteria 1577
232 Ga0157377_10238608 3300014745 Bacteria 1172
233 Ga0157377_10364569 3300014745 Unclassified 973
234 Ga0157379_10045576 3300014968 Bacteria 3913
235 Ga0157379_10296718 3300014968 Bacteria 1473
236 Ga0157379_10407418 3300014968 Bacteria 1251
237 Ga0157376_10198018 3300014969 Bacteria 1846
238 Ga0213875_10046672 3300021388 Bacteria 2032
239 Ga0207697_10146951 3300025315 Bacteria 1024
240 Ga0207653_10029888 3300025885 Bacteria 1756
241 Ga0207653_10180235 3300025885 Bacteria 790
242 Ga0207685_10019627 3300025905 Bacteria 2231
243 Ga0207645_10306816 3300025907 Bacteria 1057
244 Ga0207684_10000159 3300025910 Bacteria 115668
245 Ga0207684_10049454 3300025910 Bacteria 3566
246 Ga0207684_10081808 3300025910 Bacteria 2749
247 Ga0207684_10123993 3300025910 Bacteria 2216
248 Ga0207684_10501854 3300025910 Bacteria 1040
249 Ga0207684_10635453 3300025910 Bacteria 910
250 Ga0207654_10146087 3300025911 Bacteria 1513
251 Ga0207654_10204764 3300025911 Bacteria 1301
252 Ga0207707_10006178 3300025912 Bacteria 10463
253 Ga0207707_10011727 3300025912 Bacteria 7628
254 Ga0207707_10559145 3300025912 Unclassified 971
255 Ga0207695_10144179 3300025913 Bacteria 2327
256 Ga0207663_10039433 3300025916 Bacteria 2862
257 Ga0207660_10021979 3300025917 Bacteria 4295
258 Ga0207660_10553989 3300025917 Unclassified 935
259 Ga0207657_10109049 3300025919 Bacteria 2288
260 Ga0207649_10321257 3300025920 Unclassified 1137
261 Ga0207652_10048218 3300025921 Bacteria 3641
262 Ga0207652_10607046 3300025921 Bacteria 981
263 Ga0207646_10015191 3300025922 Bacteria 7283
264 Ga0207646_10088117 3300025922 Bacteria 2777
265 Ga0207646_10228718 3300025922 Bacteria 1680
266 Ga0207646_10497955 3300025922 Bacteria 1098
267 Ga0207646_10770538 3300025922 Bacteria 858
268 Ga0207646_10827365 3300025922 Bacteria 824
269 Ga0207681_10259671 3300025923 Bacteria 1359
270 Ga0207681_10429921 3300025923 Unclassified 1071
271 Ga0207659_10160920 3300025926 Bacteria 1762
272 Ga0207659_10619584 3300025926 Bacteria 923
273 Ga0207700_10076419 3300025928 Bacteria 2598
274 Ga0207700_10494508 3300025928 Bacteria 1082
275 Ga0207664_10000005 3300025929 Bacteria 485048
276 Ga0207706_10000848 3300025933 Bacteria 31450
277 Ga0207706_10269607 3300025933 Bacteria 1485
278 Ga0207686_10000201 3300025934 Bacteria 45929
279 Ga0207709_10011036 3300025935 Bacteria 4980
280 Ga0207670_10065960 3300025936 Bacteria 2486
281 Ga0207670_10423173 3300025936 Unclassified 1069
282 Ga0207669_10000885 3300025937 Bacteria 12673
283 Ga0207669_10276102 3300025937 Unclassified 1265
284 Ga0207704_10002345 3300025938 Bacteria 8502
285 Ga0207665_10201555 3300025939 Bacteria 1450
286 Ga0207665_10360195 3300025939 Bacteria 1100
287 Ga0207691_10154637 3300025940 Unclassified 2015
288 Ga0207691_10164759 3300025940 Bacteria 1943
289 Ga0207691_10288999 3300025940 Bacteria 1410
290 Ga0207711_10006077 3300025941 Bacteria 10202
291 Ga0207711_10154980 3300025941 Unclassified 2070
292 Ga0207689_10173239 3300025942 Bacteria 1779
293 Ga0207689_10359911 3300025942 Bacteria 1210
294 Ga0207661_10427868 3300025944 Bacteria 1203
295 Ga0207679_10018043 3300025945 Bacteria 4718
296 Ga0207679_10034422 3300025945 Bacteria 3573
297 Ga0207679_10083650 3300025945 Bacteria 2446
298 Ga0207679_10097168 3300025945 Bacteria 2293
299 Ga0207667_10432950 3300025949 Bacteria 1338
300 Ga0207712_10008379 3300025961 Bacteria 6532
301 Ga0207712_10020882 3300025961 Bacteria 4295
302 Ga0207712_10085765 3300025961 Bacteria 2305
303 Ga0207712_10117842 3300025961 Bacteria 2003
304 Ga0207712_10435190 3300025961 Bacteria 1109
305 Ga0207668_10048982 3300025972 Bacteria 2902
306 Ga0207668_10250138 3300025972 Bacteria 1439
307 Ga0207640_10007499 3300025981 Bacteria 6026
308 Ga0207658_10057435 3300025986 Bacteria 2892
309 Ga0207703_10088690 3300026035 Bacteria 2596
310 Ga0207703_11268826 3300026035 Bacteria 708
311 Ga0207639_10486911 3300026041 Unclassified 1125
312 Ga0207639_10631223 3300026041 Bacteria 990
313 Ga0207639_10969204 3300026041 Unclassified 796
314 Ga0207678_10145048 3300026067 Bacteria 2026
315 Ga0207678_10272391 3300026067 Unclassified 1452
316 Ga0207708_10204179 3300026075 Bacteria 1577
317 Ga0207641_10835392 3300026088 Bacteria 912
318 Ga0207648_10756722 3300026089 Unclassified 902
319 Ga0207676_10131003 3300026095 Bacteria 2132
320 Ga0207676_10536291 3300026095 Bacteria 1116
321 Ga0207674_10316977 3300026116 Unclassified 1508
322 Ga0207675_100056569 3300026118 Bacteria 3659
323 Ga0207675_100222674 3300026118 Bacteria 1818
324 Ga0207675_100284184 3300026118 Bacteria 1608
325 Ga0207675_100533773 3300026118 Unclassified 1171
326 Ga0207683_10018893 3300026121 Bacteria 5880
327 Ga0209995_1010399 3300027471 Bacteria 1509
328 Ga0209970_1005970 3300027614 Bacteria 1999
329 Ga0209966_1006415 3300027695 Bacteria 2041
330 Ga0209974_10007755 3300027876 Bacteria 3690
331 Ga0268266_10082293 3300028379 Bacteria 2808
332 Ga0268265_10073673 3300028380 Unclassified 2668
333 Ga0268265_10089853 3300028380 Bacteria 2452
334 Ga0268265_10217107 3300028380 Bacteria 1670
335 Ga0268265_10339237 3300028380 Unclassified 1368
336 Ga0268265_10659992 3300028380 Bacteria 1006
337 Ga0268264_10040037 3300028381 Bacteria 3872
338 Ga0268264_10669913 3300028381 Bacteria 1028
339 Ga0265326_10013118 3300028558 Bacteria 2427
340 Ga0265319_1105946 3300028563 Unclassified 881
341 Ga0265318_10006693 3300028577 Bacteria 5279
342 Ga0265338_10019132 3300028800 Bacteria 7288
343 Ga0265338_10033218 3300028800 Bacteria 5012
344 Ga0265324_10097390 3300029957 Unclassified 1000
345 Ga0316182_1284667 3300030745 Bacteria 852
346 Ga0265320_10017108 3300031240 Bacteria 4038
347 Ga0265340_10000496 3300031247 Bacteria 21514
348 Ga0265331_10003063 3300031250 Bacteria 10964
349 Ga0265327_10029297 3300031251 Bacteria 3133
350 Ga0265316_10022181 3300031344 Bacteria 5362
351 Ga0265316_10250679 3300031344 Bacteria 1300
352 Ga0307408_100030877 3300031548 Bacteria 3725
353 Ga0307408_100100038 3300031548 Unclassified 2207
354 Ga0307408_100128545 3300031548 Bacteria 1974
355 Ga0307408_100752092 3300031548 Unclassified 880
356 Ga0316575_10029238 3300031665 Bacteria 2151
357 Ga0316575_10056419 3300031665 Bacteria 1565
358 Ga0316575_10067288 3300031665 Unclassified 1436
359 Ga0316579_10018952 3300031691 Bacteria 3035
360 Ga0316579_10029713 3300031691 Bacteria 2494
361 Ga0316579_10030624 3300031691 Bacteria 2460
362 Ga0316579_10048627 3300031691 Bacteria 1981
363 Ga0316579_10089369 3300031691 Bacteria 1470
364 Ga0265314_10179587 3300031711 Bacteria 1270
365 Ga0316576_10007136 3300031727 Bacteria 7007
366 Ga0316576_10015588 3300031727 Bacteria 5106
367 Ga0316576_10058536 3300031727 Bacteria 2819
368 Ga0316576_10081950 3300031727 Bacteria 2395
369 Ga0316576_10084279 3300031727 Bacteria 2362
370 Ga0316576_10125227 3300031727 Bacteria 1931
371 Ga0316576_10292374 3300031727 Bacteria 1219
372 Ga0316576_10345877 3300031727 Unclassified 1107
373 Ga0316576_10418355 3300031727 Bacteria 992
374 Ga0316576_10468535 3300031727 Bacteria 929
375 Ga0316576_10791688 3300031727 Bacteria 683
376 Ga0316576_10798224 3300031727 Unclassified 680
377 Ga0316578_10001246 3300031728 Bacteria 10145
378 Ga0316578_10012349 3300031728 Bacteria 4502
379 Ga0316578_10014345 3300031728 Bacteria 4230
380 Ga0316578_10073604 3300031728 Bacteria 2025
381 Ga0316578_10085971 3300031728 Bacteria 1874
382 Ga0316578_10116905 3300031728 Bacteria 1602
383 Ga0316578_10156744 3300031728 Bacteria 1372
384 Ga0316578_10360432 3300031728 Unclassified 865
385 Ga0307405_10010387 3300031731 Bacteria 4821
386 Ga0307405_10015832 3300031731 Bacteria 4095
387 Ga0307405_10316366 3300031731 Bacteria 1190
388 Ga0307405_10513619 3300031731 Unclassified 963
389 Ga0316577_10005627 3300031733 Bacteria 6578
390 Ga0316577_10007877 3300031733 Bacteria 5687
391 Ga0316577_10008151 3300031733 Bacteria 5604
392 Ga0316577_10017018 3300031733 Bacteria 4012
393 Ga0316577_10022869 3300031733 Bacteria 3472
394 Ga0316577_10029358 3300031733 Bacteria 3069
395 Ga0316577_10220244 3300031733 Bacteria 1073
396 Ga0316577_10285354 3300031733 Unclassified 935
397 Ga0316577_10367095 3300031733 Bacteria 817
398 Ga0307413_10010848 3300031824 Bacteria 4445
399 Ga0307413_10011241 3300031824 Bacteria 4390
400 Ga0307413_10020474 3300031824 Bacteria 3519
401 Ga0307413_10026919 3300031824 Bacteria 3177
402 Ga0307413_10068690 3300031824 Bacteria 2220
403 Ga0307413_10108119 3300031824 Bacteria 1855
404 Ga0307413_10228898 3300031824 Bacteria 1364
405 Ga0307410_10001224 3300031852 Bacteria 11400
406 Ga0307410_10001448 3300031852 Bacteria 10712
407 Ga0307410_10023400 3300031852 Bacteria 3839
408 Ga0307410_10046243 3300031852 Bacteria 2903
409 Ga0307410_10189333 3300031852 Bacteria 1563
410 Ga0307410_10414061 3300031852 Bacteria 1092
411 Ga0307406_10024221 3300031901 Bacteria 3622
412 Ga0307406_10047871 3300031901 Bacteria 2697
413 Ga0307406_10064849 3300031901 Unclassified 2372
414 Ga0307406_10092163 3300031901 Bacteria 2043
415 Ga0307406_10226913 3300031901 Bacteria 1392
416 Ga0307406_10388662 3300031901 Bacteria 1102
417 Ga0307407_10003455 3300031903 Bacteria 6482
418 Ga0307407_10006596 3300031903 Bacteria 5178
419 Ga0307407_10012302 3300031903 Bacteria 4108
420 Ga0307407_10014158 3300031903 Bacteria 3897
421 Ga0307407_10032405 3300031903 Bacteria 2841
422 Ga0307407_10122801 3300031903 Bacteria 1649
423 Ga0307407_10156862 3300031903 Bacteria 1485
424 Ga0307407_10362994 3300031903 Bacteria 1029
425 Ga0307412_10016230 3300031911 Bacteria 4431
426 Ga0307412_10095716 3300031911 Bacteria 2088
427 Ga0307409_100003528 3300031995 Bacteria 8527
428 Ga0307409_100016327 3300031995 Bacteria 4908
429 Ga0307409_100051378 3300031995 Bacteria 3154
430 Ga0307409_100062269 3300031995 Bacteria 2920
431 Ga0307409_100134150 3300031995 Bacteria 2121
432 Ga0307409_100343473 3300031995 Bacteria 1406
433 Ga0307409_100388310 3300031995 Bacteria 1329
434 Ga0307409_100471522 3300031995 Bacteria 1216
435 Ga0307409_100934691 3300031995 Bacteria 882
436 Ga0307409_101107001 3300031995 Bacteria 813
437 Ga0307416_100000541 3300032002 Bacteria 19240
438 Ga0307416_100007241 3300032002 Bacteria 7030
439 Ga0307416_100343901 3300032002 Bacteria 1506
440 Ga0307416_100474261 3300032002 Unclassified 1310
441 Ga0307416_100635177 3300032002 Bacteria 1151
442 Ga0307416_100935969 3300032002 Viruses 968
443 Ga0307414_10005050 3300032004 Bacteria 7228
444 Ga0307414_10025824 3300032004 Bacteria 3769
445 Ga0307414_10040556 3300032004 Bacteria 3146
446 Ga0307414_10196999 3300032004 Bacteria 1635
447 Ga0307414_10472672 3300032004 Bacteria 1104
448 Ga0307411_10000173 3300032005 Bacteria 20758
449 Ga0307411_10005030 3300032005 Bacteria 6431
450 Ga0307411_10069195 3300032005 Unclassified 2383
451 Ga0307411_10468139 3300032005 Bacteria 1058
452 Ga0307411_10760663 3300032005 Bacteria 849
453 Ga0307411_10780622 3300032005 Bacteria 839
454 Ga0307415_100000895 3300032126 Bacteria 13628
455 Ga0307415_100067475 3300032126 Bacteria 2500
456 Ga0307415_100141234 3300032126 Bacteria 1839
457 Ga0307415_101180235 3300032126 Bacteria 720
458 Ga0316583_10073276 3300032133 Bacteria 1198
459 Ga0316585_10004967 3300032137 Bacteria 3739
460 Ga0316585_10021498 3300032137 Bacteria 1982
461 Ga0316585_10047429 3300032137 Unclassified 1376
462 Ga0316585_10100968 3300032137 Bacteria 947
463 Ga0373948_0085149 3300034817 Bacteria 727
464 Ga0373950_0094111 3300034818 Unclassified 639
465 Ga0373959_0042392 3300034820 Bacteria 959
466 Ga0373940_0009626 3300035088 Unclassified 2251
467 Ga0373940_0025053 3300035088 Bacteria 1551
468 Ga0373944_0009412 3300035089 Bacteria 2650
469 Ga0373949_0021585 3300035090 Bacteria 1479
470 Ga0373941_0029835 3300035115 Unclassified 1612
471 Ga0373960_0097004 3300035121 Unclassified 950
472 Ga0373943_0029867 3300035170 Bacteria 2577
473 Ga0373961_0047624 3300035241 Bacteria 1260
474 Ga0373961_0071888 3300035241 Bacteria 1071
475 Ga0373962_0092088 3300035242 Bacteria 935
476 Ga0316574_0001564 3300035398 Bacteria 10935
477 Ga0316574_0004212 3300035398 Bacteria 7503
478 Ga0316574_0015481 3300035398 Bacteria 4426
479 Ga0316574_0031035 3300035398 Bacteria 3240
480 Ga0316574_0042804 3300035398 Bacteria 2796
481 Ga0316574_0075215 3300035398 Bacteria 2138
482 Ga0316574_0113155 3300035398 Bacteria 1740
483 Ga0316574_0132380 3300035398 Bacteria 1605
484 Ga0316574_0650722 3300035398 Unclassified 649
485 Ga0373931_0013435 3300035691 Bacteria 3987
486 Ga0373931_0032371 3300035691 Bacteria 2706
487 Ga0373935_0029116 3300035692 Bacteria 3417
488 Ga0316582_0008508 3300036647 Bacteria 5522
489 Ga0316582_0015308 3300036647 Bacteria 4381
490 Ga0316582_0019296 3300036647 Bacteria 3988
491 Ga0316582_0027872 3300036647 Bacteria 3417
492 Ga0316582_0036767 3300036647 Bacteria 3032
493 Ga0316582_0040425 3300036647 Bacteria 2910
494 Ga0316582_0055441 3300036647 Bacteria 2526
495 Ga0316582_0094522 3300036647 Bacteria 1972
496 Ga0316582_0116258 3300036647 Bacteria 1785
497 Ga0316582_0183693 3300036647 Bacteria 1423
498 Ga0316582_0197377 3300036647 Bacteria 1372
499 Ga0316582_0210584 3300036647 Unclassified 1328
500 Ga0316582_0406096 3300036647 Unclassified 938
501 Ga0316582_0450969 3300036647 Bacteria 887
502 Ga0316582_0564491 3300036647 Bacteria 784
503 Ga0316582_0580519 3300036647 Unclassified 772
504 Ga0316584_0002917 3300036712 Bacteria 10987
505 Ga0316584_0004330 3300036712 Bacteria 9396
506 Ga0316584_0004962 3300036712 Bacteria 8860
507 Ga0316584_0015772 3300036712 Bacteria 5408
508 Ga0316584_0022049 3300036712 Bacteria 4641
509 Ga0316584_0049440 3300036712 Bacteria 3143
510 Ga0316584_0228119 3300036712 Bacteria 1366
511 Ga0316584_0247978 3300036712 Bacteria 1301
512 Ga0316581_0003768 3300037588 Unclassified 3808
513 Ga0316581_0015819 3300037588 Bacteria 2161
514 Ga0316581_0027578 3300037588 Bacteria 1699
515 Ga0316581_0033546 3300037588 Bacteria 1551
516 Ga0316581_0033733 3300037588 Bacteria 1547
517 Ga0436364_0918438 3300037853 Unclassified 3709
518 Ga0400490_09994 3300038726 Bacteria 1167
519 Ga0242420_026140 3300038996 Unclassified 1064
520 Ga0242420_027550 3300038996 Bacteria 1042
521 Ga0242420_035811 3300038996 Bacteria 935
522 Ga0400483_103554 3300039062 Bacteria 2450
523 Ga0400483_200081 3300039062 Bacteria 2188
524 Ga0400489_30506 3300039093 Bacteria 13751
525 Ga0400487_16533 3300039110 Unclassified 2853
526 Ga0439436_0053281 3300041404 Bacteria 1140
527 Ga0439439_0006898 3300041406 Bacteria 2637
528 Ga0439439_0074907 3300041406 Bacteria 910
529 Ga0439453_0014689 3300041408 Bacteria 1346
530 Ga0439466_0145326 3300041411 Unclassified 727
531 Ga0451807_0805302 3300041486 Bacteria 2780
532 Ga0451849_1479746 3300041505 Unclassified 774
533 Ga0439462_0024787 3300042015 Bacteria 1578
534 Ga0450923_036877 3300042125 Bacteria 1015
535 Ga0450895_005399 3300042132 Bacteria 1030
536 Ga0450896_010855 3300042133 Bacteria 1280
537 Ga0439446_0117866 3300042156 Bacteria 852
538 Ga0439459_0011765 3300042438 Bacteria 1547
539 Ga0439460_0121843 3300042461 Unclassified 854
540 Ga0451577_0008058 3300042876 Bacteria 10280
541 Ga0451577_0008331 3300042876 Bacteria 10087
542 Ga0451577_0036429 3300042876 Bacteria 4428
543 Ga0451577_0047073 3300042876 Bacteria 3857
544 Ga0451577_0052120 3300042876 Bacteria 3654
545 Ga0451577_0109387 3300042876 Bacteria 2472
546 Ga0451577_0134782 3300042876 Bacteria 2217
547 Ga0451577_0152166 3300042876 Unclassified 2082
548 Ga0451577_0170318 3300042876 Bacteria 1962
549 Ga0451577_0179660 3300042876 Bacteria 1907
550 Ga0451577_0299396 3300042876 Bacteria 1457
551 Ga0451577_0302080 3300042876 Bacteria 1450
552 Ga0451577_0312850 3300042876 Bacteria 1423
553 Ga0451577_0511297 3300042876 Unclassified 1091
554 Ga0451577_0577950 3300042876 Bacteria 1020
555 Ga0451577_0835150 3300042876 Bacteria 831
556 Ga0451577_1069996 3300042876 Bacteria 723
557 Ga0439440_0078259 3300042993 Unclassified 871
558 Ga0453683_0000006 3300044673 Bacteria 586638
559 Ga0453683_0001504 3300044673 Bacteria 19914
560 Ga0453683_0004070 3300044673 Bacteria 10521
561 Ga0453683_0034751 3300044673 Bacteria 3177
562 Ga0453683_0037986 3300044673 Bacteria 3028
563 Ga0453683_0038390 3300044673 Bacteria 3010
564 Ga0453683_0101522 3300044673 Bacteria 1806
565 Ga0453683_0119313 3300044673 Bacteria 1660
566 Ga0453683_0152183 3300044673 Bacteria 1462
567 Ga0453683_0178635 3300044673 Bacteria 1346
568 Ga0453683_0502519 3300044673 Bacteria 787
569 Ga0466963_0349824 3300044694 Bacteria 1041
570 Ga0466964_0071734 3300044706 Bacteria 1466
571 Ga0453684_0000023 3300044712 Bacteria 857153
572 Ga0453684_0000035 3300044712 Bacteria 725956
573 Ga0453684_0000047 3300044712 Bacteria 560243
574 Ga0453684_0000128 3300044712 Bacteria 335864
575 Ga0453684_0000752 3300044712 Bacteria 112676
576 Ga0453684_0003360 3300044712 Bacteria 36236
577 Ga0453684_0003688 3300044712 Bacteria 33939
578 Ga0453684_0004409 3300044712 Unclassified 29768
579 Ga0453684_0005202 3300044712 Bacteria 26137
580 Ga0453684_0006103 3300044712 Bacteria 23235
581 Ga0453684_0006177 3300044712 Bacteria 23001
582 Ga0453684_0013654 3300044712 Bacteria 13159
583 Ga0453684_0031253 3300044712 Bacteria 7489
584 Ga0453684_0045211 3300044712 Bacteria 5877
585 Ga0453684_0050605 3300044712 Bacteria 5462
586 Ga0453684_0067960 3300044712 Bacteria 4528
587 Ga0453684_0070158 3300044712 Bacteria 4439
588 Ga0453684_0076068 3300044712 Bacteria 4216
589 Ga0453684_0088924 3300044712 Bacteria 3822
590 Ga0453684_0091086 3300044712 Bacteria 3765
591 Ga0453684_0097350 3300044712 Bacteria 3611
592 Ga0453684_0112808 3300044712 Unclassified 3299
593 Ga0453684_0133603 3300044712 Bacteria 2974
594 Ga0453684_0138328 3300044712 Bacteria 2912
595 Ga0453684_0156563 3300044712 Bacteria 2700
596 Ga0453684_0168390 3300044712 Bacteria 2584
597 Ga0453684_0170627 3300044712 Bacteria 2564
598 Ga0453684_0216052 3300044712 Bacteria 2224
599 Ga0453684_0288899 3300044712 Bacteria 1868
600 Ga0453684_0320875 3300044712 Bacteria 1754
601 Ga0453684_0688720 3300044712 Bacteria 1112
602 Ga0453684_0696353 3300044712 Bacteria 1104
603 Ga0453684_0895593 3300044712 Unclassified 950
604 Ga0453684_0962023 3300044712 Bacteria 910
605 Ga0453684_1140464 3300044712 Bacteria 821
606 Ga0453684_1525140 3300044712 Bacteria 689
607 Ga0453684_1612015 3300044712 Bacteria 666
608 Ga0466959_0517578 3300045049 Bacteria 806
609 Ga0451576_0000014 3300045051 Bacteria 593082
610 Ga0451576_0000138 3300045051 Bacteria 185167
611 Ga0451576_0001446 3300045051 Bacteria 40410
612 Ga0451576_0004639 3300045051 Bacteria 17731
613 Ga0451576_0005380 3300045051 Bacteria 16092
614 Ga0451576_0039017 3300045051 Bacteria 5026
615 Ga0451576_0127974 3300045051 Bacteria 2646
616 Ga0451576_0140794 3300045051 Bacteria 2515
617 Ga0451576_0152613 3300045051 Bacteria 2409
618 Ga0451576_0312282 3300045051 Bacteria 1645
619 Ga0451576_0328766 3300045051 Bacteria 1600
620 Ga0451576_0338672 3300045051 Bacteria 1574
621 Ga0451576_0632412 3300045051 Bacteria 1124
622 Ga0451576_0676289 3300045051 Bacteria 1084
623 Ga0451576_0805265 3300045051 Bacteria 986
624 Ga0451576_1101719 3300045051 Unclassified 831
625 Ga0495603_0033578 3300046455 Bacteria 3087
626 Ga0495603_0127260 3300046455 Bacteria 1484
627 Ga0495639_0334731 3300046475 Bacteria 758
628 Ga0495594_0033430 3300046499 Bacteria 2796
629 Ga0495633_0251696 3300046558 Unclassified 806
630 Ga0495588_0016497 3300046674 Bacteria 3571
631 Ga0495670_0154783 3300046691 Unclassified 1203
632 Ga0496100_0144016 3300048903 Bacteria 1693
633 Ga0496100_0251964 3300048903 Bacteria 1306
634 Ga0496101_0023497 3300048904 Bacteria 4260
635 Ga0496101_0136016 3300048904 Bacteria 1870
636 Ga0496101_0265528 3300048904 Bacteria 1339
637 Ga0496101_0272323 3300048904 Bacteria 1322
638 Ga0496101_0401276 3300048904 Bacteria 1080
639 Ga0496102_0019829 3300048905 Bacteria 5927
640 Ga0496102_0100065 3300048905 Bacteria 2692
641 Ga0496102_0134628 3300048905 Bacteria 2315
642 Ga0496102_0188462 3300048905 Bacteria 1944
643 Ga0496102_0196132 3300048905 Bacteria 1903
644 Ga0496103_0012347 3300048906 Bacteria 5067
645 Ga0496103_0313746 3300048906 Unclassified 1009
646 Ga0496104_0008614 3300048907 Bacteria 9072
647 Ga0496104_0014243 3300048907 Bacteria 7178
648 Ga0496104_0065065 3300048907 Bacteria 3459
649 Ga0496105_0107876 3300048908 Bacteria 2299
650 Ga0496105_0116781 3300048908 Unclassified 2201
651 Ga0496105_0224633 3300048908 Bacteria 1528
652 Ga0496105_0423589 3300048908 Bacteria 1054
653 Ga0496106_0079117 3300048909 Bacteria 2524
654 Ga0496106_0370254 3300048909 Bacteria 1151
655 Ga0496107_0042676 3300048910 Bacteria 3258
656 Ga0496107_0081080 3300048910 Bacteria 2367
657 Ga0496108_0012560 3300048911 Bacteria 6898
658 Ga0496108_0022374 3300048911 Bacteria 5196
659 Ga0496108_0052467 3300048911 Bacteria 3417
660 Ga0496108_0073537 3300048911 Bacteria 2885
661 Ga0496108_0168371 3300048911 Bacteria 1895
662 Ga0496109_0004685 3300048912 Bacteria 11416
663 Ga0496109_0029731 3300048912 Bacteria 4895
664 Ga0496109_0053147 3300048912 Bacteria 3693
665 Ga0496109_0090946 3300048912 Bacteria 2822
666 Ga0496109_0316797 3300048912 Bacteria 1472
667 Ga0496110_0003860 3300048913 Bacteria 11550
668 Ga0496110_0011067 3300048913 Bacteria 7366
669 Ga0496110_0031150 3300048913 Bacteria 4600
670 Ga0496110_0189729 3300048913 Unclassified 1867
671 Ga0496110_0197832 3300048913 Bacteria 1826
672 Ga0496111_0003621 3300048914 Bacteria 9579
673 Ga0496111_0081193 3300048914 Bacteria 2367
674 Ga0496111_0263609 3300048914 Bacteria 1278
675 Ga0496111_0380705 3300048914 Unclassified 1043
676 Ga0496112_0008505 3300048915 Bacteria 9195
677 Ga0496112_0072542 3300048915 Bacteria 3403
678 Ga0496112_0119467 3300048915 Unclassified 2606
679 Ga0496112_0414367 3300048915 Bacteria 1286
680 Ga0496113_0001290 3300048916 Bacteria 13845
681 Ga0496113_0010962 3300048916 Bacteria 6021
682 Ga0496113_0021911 3300048916 Bacteria 4512
683 Ga0496114_1072555 3300048917 Bacteria 690
684 Ga0496115_0044110 3300048918 Bacteria 3556
685 Ga0496115_0159372 3300048918 Bacteria 1865
686 Ga0501031_0003016 3300049568 Bacteria 10770
687 Ga0501031_0091586 3300049568 Bacteria 1983
688 Ga0501031_0203720 3300049568 Bacteria 1291
689 Ga0501032_0064982 3300049569 Bacteria 2442
690 Ga0501033_0049373 3300049570 Bacteria 3123
691 Ga0501033_0106855 3300049570 Bacteria 2039
692 Ga0501033_0413635 3300049570 Unclassified 940
693 Ga0501033_0447619 3300049570 Bacteria 897
694 Ga0501034_0015001 3300049571 Bacteria 7970
695 Ga0501034_0181110 3300049571 Bacteria 2072
696 Ga0501034_0248416 3300049571 Bacteria 1724
697 Ga0501034_0425272 3300049571 Bacteria 1249
698 Ga0501036_0075815 3300049572 Bacteria 2844
699 Ga0501036_0103083 3300049572 Bacteria 2414
700 Ga0501036_0142162 3300049572 Bacteria 2025
701 Ga0501036_0176536 3300049572 Bacteria 1799
702 Ga0501036_0198967 3300049572 Bacteria 1685
703 Ga0501036_0368081 3300049572 Bacteria 1200
704 Ga0501037_0074331 3300049573 Bacteria 2470
705 Ga0501037_0365847 3300049573 Unclassified 993
706 Ga0501038_0021422 3300049574 Bacteria 5802
707 Ga0501038_0085413 3300049574 Bacteria 2654
708 Ga0501038_0365115 3300049574 Bacteria 1122
709 Ga0501038_0571479 3300049574 Bacteria 858
710 Ga0501038_0599816 3300049574 Bacteria 833
711 Ga0501039_0015901 3300049575 Bacteria 5761
712 Ga0501039_0067424 3300049575 Bacteria 2779
713 Ga0501039_0302051 3300049575 Bacteria 1258
714 Ga0501040_0049355 3300049576 Bacteria 2877
715 Ga0501040_0049708 3300049576 Bacteria 2867
716 Ga0501040_0112023 3300049576 Bacteria 1908
717 Ga0501040_0429170 3300049576 Unclassified 950
718 Ga0501041_0011952 3300049577 Bacteria 5139
719 Ga0501041_0032929 3300049577 Bacteria 3133
720 Ga0501041_0072095 3300049577 Bacteria 2121
721 Ga0501041_0123290 3300049577 Bacteria 1611
722 Ga0501042_0008450 3300049578 Bacteria 6798
723 Ga0501042_0069182 3300049578 Bacteria 2525
724 Ga0501042_0154820 3300049578 Bacteria 1653
725 Ga0501043_0110482 3300049579 Bacteria 2159
726 Ga0501046_0053529 3300049580 Bacteria 3178
727 Ga0501046_0132337 3300049580 Bacteria 1891
728 Ga0501046_0188308 3300049580 Bacteria 1540
729 Ga0501046_0284554 3300049580 Bacteria 1210
730 Ga0501047_0214150 3300049581 Bacteria 1784
731 Ga0501048_0033076 3300049582 Bacteria 3737
732 Ga0501048_0117375 3300049582 Bacteria 1880
733 Ga0501067_0004053 3300049583 Bacteria 8078
734 Ga0501067_0129190 3300049583 Unclassified 1406
735 Ga0501068_0000731 3300049584 Bacteria 16826
736 Ga0501068_0007837 3300049584 Bacteria 5917
737 Ga0501068_0121591 3300049584 Bacteria 1628
738 Ga0501069_0000181 3300049585 Bacteria 28434
739 Ga0501069_0002048 3300049585 Bacteria 10117
740 Ga0501069_0007387 3300049585 Bacteria 5766
741 Ga0501069_0185437 3300049585 Bacteria 1203
742 Ga0501069_0482735 3300049585 Bacteria 738
743 Ga0501070_0011360 3300049586 Bacteria 7525
744 Ga0501070_0023269 3300049586 Bacteria 5189
745 Ga0501070_0169327 3300049586 Bacteria 1799
746 Ga0501071_0002939 3300049587 Bacteria 10526
747 Ga0501071_0008445 3300049587 Bacteria 6808
748 Ga0501071_0010088 3300049587 Bacteria 6315
749 Ga0501071_0171094 3300049587 Bacteria 1626
750 Ga0501071_0212523 3300049587 Bacteria 1455
751 Ga0501072_0002185 3300049588 Bacteria 14619
752 Ga0501072_0010662 3300049588 Bacteria 7000
753 Ga0501072_0033950 3300049588 Bacteria 3997
754 Ga0501072_0146005 3300049588 Bacteria 1886
755 Ga0501072_0190637 3300049588 Bacteria 1635
756 Ga0501072_0253205 3300049588 Bacteria 1402
757 Ga0501073_0018933 3300049589 Bacteria 4975
758 Ga0501073_0040128 3300049589 Bacteria 3314
759 Ga0501073_0045233 3300049589 Bacteria 3101
760 Ga0501073_0182255 3300049589 Bacteria 1453
761 Ga0501073_0228603 3300049589 Bacteria 1285
762 Ga0501073_0239775 3300049589 Bacteria 1252
763 Ga0501074_0002532 3300049590 Bacteria 12755
764 Ga0501074_0007142 3300049590 Bacteria 8066
765 Ga0501074_0021223 3300049590 Bacteria 4717
766 Ga0501074_0103993 3300049590 Bacteria 2033
767 Ga0501074_0205234 3300049590 Bacteria 1404
768 Ga0501074_0208335 3300049590 Bacteria 1393
769 Ga0501074_0269075 3300049590 Bacteria 1211
770 Ga0501074_0346193 3300049590 Bacteria 1055
771 Ga0501074_0391454 3300049590 Bacteria 986
772 Ga0501075_0005015 3300049591 Bacteria 9036
773 Ga0501075_0005163 3300049591 Bacteria 8934
774 Ga0501075_0006152 3300049591 Bacteria 8248
775 Ga0501075_0480604 3300049591 Unclassified 948
776 Ga0501076_0010660 3300049592 Bacteria 6827
777 Ga0501076_0014150 3300049592 Bacteria 6001
778 Ga0501076_0034669 3300049592 Bacteria 3946
779 Ga0501076_0065852 3300049592 Bacteria 2890
780 Ga0501076_0073596 3300049592 Bacteria 2736
781 Ga0501076_0264329 3300049592 Bacteria 1409
782 Ga0501076_0480006 3300049592 Unclassified 1024
783 Ga0501076_0591082 3300049592 Bacteria 916
784 Ga0501077_0000834 3300049593 Bacteria 18654
785 Ga0501077_0011587 3300049593 Bacteria 5510
786 Ga0501077_0260843 3300049593 Unclassified 1102
787 Ga0501209_060080 3300049656 Bacteria 1059
788 Ga0501217_040063 3300049661 Bacteria 1189
789 Ga0501235_035235 3300049669 Bacteria 1136
790 Ga0501243_019656 3300049675 Bacteria 1107
791 Ga0501249_090899 3300049679 Unclassified 724
792 Ga0501079_0017498 3300049741 Bacteria 5474
793 Ga0501079_0028768 3300049741 Bacteria 4266
794 Ga0501079_0031892 3300049741 Bacteria 4049
795 Ga0501079_0039426 3300049741 Bacteria 3643
796 Ga0501079_0048471 3300049741 Bacteria 3278
797 Ga0501079_0121191 3300049741 Bacteria 2034
798 Ga0501079_0144760 3300049741 Bacteria 1852
799 Ga0501079_0201128 3300049741 Bacteria 1556
800 Ga0501079_0259801 3300049741 Bacteria 1357
801 Ga0501079_0493837 3300049741 Bacteria 962
802 Ga0501080_0008681 3300049742 Bacteria 9228
803 Ga0501080_0017058 3300049742 Bacteria 6706
804 Ga0501080_0044347 3300049742 Bacteria 4140
805 Ga0501080_0093193 3300049742 Bacteria 2797
806 Ga0501080_0106422 3300049742 Bacteria 2599
807 Ga0501080_0110178 3300049742 Bacteria 2552
808 Ga0501080_0169409 3300049742 Bacteria 2015
809 Ga0501080_0854687 3300049742 Bacteria 795
810 Ga0501081_0018822 3300049743 Bacteria 4587
811 Ga0501081_0027762 3300049743 Bacteria 3816
812 Ga0501081_0194161 3300049743 Bacteria 1471
813 Ga0501081_0197211 3300049743 Bacteria 1459
814 Ga0501081_0279459 3300049743 Bacteria 1222
815 Ga0501081_0359723 3300049743 Bacteria 1073
816 Ga0501081_0752187 3300049743 Bacteria 732
817 Ga0501083_0013899 3300049744 Bacteria 5628
818 Ga0501083_0033641 3300049744 Bacteria 3508
819 Ga0501083_0084399 3300049744 Bacteria 2103
820 Ga0501083_0153232 3300049744 Bacteria 1509
821 Ga0501271_009461 3300049768 Bacteria 1015
822 Ga0501035_0009554 3300049822 Bacteria 9019
823 Ga0501035_0226194 3300049822 Bacteria 1596
824 Ga0501035_0763264 3300049822 Unclassified 775
825 Ga0501045_0008967 3300049824 Bacteria 6986
826 Ga0501045_0034289 3300049824 Bacteria 3684
827 Ga0501045_0147488 3300049824 Bacteria 1750
828 Ga0501045_0343120 3300049824 Bacteria 1112
829 Ga0501045_0385216 3300049824 Bacteria 1044
830 nmdc:mga05p37_15211_c1 3300050507 Bacteria 9241
831 nmdc:mga05p37_172664_c1 3300050507 Bacteria 2636
832 nmdc:mga05p37_186995_c1 3300050507 Bacteria 2518
833 nmdc:mga05p37_378520_c1 3300050507 Unclassified 1659
834 nmdc:mga05p37_38365_c1 3300050507 Bacteria 5876
835 nmdc:mga05p37_508900_c1 3300050507 Unclassified 1380
836 nmdc:mga05p37_551032_c1 3300050507 Bacteria 1313
837 nmdc:mga05p37_77476_c1 3300050507 Unclassified 4093
838 nmdc:mga05p37_844229_c1 3300050507 Bacteria 996
839 nmdc:mga05p37_87209_c1 3300050507 Bacteria 3847
840 nmdc:mga05p37_94064_c1 3300050507 Bacteria 3693
841 nmdc:mga05p37_944916_c1 3300050507 Bacteria 923
842 nmdc:mga09592_104656_c1 3300050508 Bacteria 2425
843 nmdc:mga09592_111845_c1 3300050508 Unclassified 2343
844 nmdc:mga09592_131559_c1 3300050508 Unclassified 2153
845 nmdc:mga09592_23260_c1 3300050508 Bacteria 5118
846 nmdc:mga09592_302873_c1 3300050508 Unclassified 1386
847 nmdc:mga09592_5756_c1 3300050508 Bacteria 10106
848 nmdc:mga09592_73986_c1 3300050508 Unclassified 2896
849 nmdc:mga0qj67_90348_c1 3300050509 Bacteria 2460
850 nmdc:mga06r32_146310_c1 3300050510 Bacteria 2340
851 nmdc:mga06r32_37252_c1 3300050510 Bacteria 4601
852 nmdc:mga06r32_847432_c1 3300050510 Bacteria 873
853 nmdc:mga08y16_461826_c1 3300050511 Bacteria 1294
854 nmdc:mga0n895_1708354_c1 3300050512 Bacteria 592
855 nmdc:mga0n895_229995_c1 3300050512 Unclassified 1882
856 nmdc:mga0n895_237478_c1 3300050512 Bacteria 1850
857 nmdc:mga0n895_321481_c1 3300050512 Bacteria 1568
858 nmdc:mga0n895_323502_c1 3300050512 Bacteria 1563
859 nmdc:mga0rr50_219609_c1 3300050513 Bacteria 1569
860 nmdc:mga0rr50_71479_c1 3300050513 Bacteria 2648
861 nmdc:mga0rr50_726525_c1 3300050513 Unclassified 848
862 nmdc:mga0a205_12549_c1 3300050515 Bacteria 7842
863 nmdc:mga0a205_192078_c1 3300050515 Bacteria 1934
864 nmdc:mga0a205_241057_c1 3300050515 Bacteria 1689
865 nmdc:mga0a205_397311_c1 3300050515 Bacteria 1242
866 nmdc:mga0a205_70962_c1 3300050515 Bacteria 3364
867 Ga0501084_0002802 3300054114 Bacteria 14074
868 Ga0501084_0005414 3300054114 Bacteria 10465
869 Ga0501084_0059438 3300054114 Bacteria 3200
870 Ga0501084_0065265 3300054114 Bacteria 3045
871 Ga0501084_0068622 3300054114 Bacteria 2968
872 Ga0501084_0076412 3300054114 Bacteria 2807
873 Ga0501084_0086287 3300054114 Bacteria 2635
874 Ga0501084_0102515 3300054114 Bacteria 2403
875 Ga0501084_0130341 3300054114 Bacteria 2117
876 Ga0501084_1105031 3300054114 Bacteria 666
877 Ga0590071_000641 3300059421 Bacteria 9939
878 Ga0590071_013948 3300059421 Bacteria 1883
879 Ga0590071_108556 3300059421 Bacteria 703
880 Ga0590075_003140 3300059424 Bacteria 3929
881 Ga0590077_003991 3300059426 Bacteria 3041
882 Ga0501082_0010117 3300060353 Bacteria 8122
883 Ga0501082_0010983 3300060353 Bacteria 7790
884 Ga0501082_0012220 3300060353 Bacteria 7377
885 Ga0501082_0015371 3300060353 Bacteria 6586
886 Ga0501082_0019229 3300060353 Bacteria 5887
887 Ga0501082_0233859 3300060353 Bacteria 1599
888 Ga0501082_1099916 3300060353 Bacteria 695
889 Ga0530510_0119214 3300061734 Bacteria 1936
890 Ga0530510_0139586 3300061734 Bacteria 1785
891 Ga0530510_0311488 3300061734 Bacteria 1179
892 Ga0530510_0352835 3300061734 Bacteria 1105
893 Ga0530510_0620919 3300061734 Bacteria 822

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100212680 Ga0070690_1002126801 160
2 3300005366 Ga0070659_100875949 Ga0070659_1008759492 160
3 3300050512 nmdc:mga0n895_1708354_c1 nmdc:mga0n895_1708354_c1_81_569 162
4 3300035398 Ga0316574_0650722 Ga0316574_0650722_64_579 171
5 3300036712 Ga0316584_0004962 Ga0316584_0004962_768_1373 180
6 3300036712 Ga0316584_0228119 Ga0316584_0228119_587_1192 180
7 3300044712 Ga0453684_0070158 Ga0453684_0070158_830_1435 180
8 3300036647 Ga0316582_0019296 Ga0316582_0019296_1919_2527 181
9 3300039110 Ga0400487_16533 Ga0400487_16533_2181_2762 181
10 3300044712 Ga0453684_0288899 Ga0453684_0288899_1142_1750 181
11 3300044712 Ga0453684_0320875 Ga0453684_0320875_950_1558 181
12 3300031665 Ga0316575_10029238 Ga0316575_100292382 182
13 3300031728 Ga0316578_10014345 Ga0316578_100143454 182
14 3300035398 Ga0316574_0015481 Ga0316574_0015481_963_1562 182
15 3300005329 Ga0070683_100115483 Ga0070683_1001154832 183
16 3300005844 Ga0068862_100108951 Ga0068862_1001089513 183
17 3300014326 Ga0157380_10140187 Ga0157380_101401872 183
18 3300028380 Ga0268265_10073673 Ga0268265_100736734 183
19 3300035398 Ga0316574_0031035 Ga0316574_0031035_1044_1649 184
20 3300005545 Ga0070695_100893224 Ga0070695_1008932241 185
21 3300036712 Ga0316584_0022049 Ga0316584_0022049_2684_3283 185
22 3300044712 Ga0453684_0006103 Ga0453684_0006103_16556_17164 185
23 3300044712 Ga0453684_0000752 Ga0453684_0000752_74839_75444 186
24 3300005336 Ga0070680_100026468 Ga0070680_1000264687 187
25 3300005458 Ga0070681_10106027 Ga0070681_101060272 187
26 3300005530 Ga0070679_100011448 Ga0070679_1000114483 187
27 3300005546 Ga0070696_100255683 Ga0070696_1002556831 187
28 3300025912 Ga0207707_10006178 Ga0207707_100061789 187
29 3300025917 Ga0207660_10021979 Ga0207660_100219793 187
30 3300025921 Ga0207652_10048218 Ga0207652_100482183 187
31 3300028563 Ga0265319_1105946 Ga0265319_11059461 188
32 3300031727 Ga0316576_10084279 Ga0316576_100842793 188
33 3300041505 Ga0451849_1479746 Ga0451849_1479746_151_717 188
34 3300031727 Ga0316576_10292374 Ga0316576_102923741 189
35 3300036647 Ga0316582_0450969 Ga0316582_0450969_87_692 190
36 3300044712 Ga0453684_0000047 Ga0453684_0000047_460321_460929 190
37 3300049571 Ga0501034_0015001 Ga0501034_0015001_2246_2833 190
38 3300049574 Ga0501038_0365115 Ga0501038_0365115_351_938 190
39 3300049583 Ga0501067_0004053 Ga0501067_0004053_4983_5570 190
40 3300049584 Ga0501068_0007837 Ga0501068_0007837_4762_5349 190
41 3300049585 Ga0501069_0000181 Ga0501069_0000181_2318_2905 190
42 3300049586 Ga0501070_0011360 Ga0501070_0011360_2211_2798 190
43 3300049587 Ga0501071_0002939 Ga0501071_0002939_4863_5450 190
44 3300049588 Ga0501072_0002185 Ga0501072_0002185_8753_9340 190
45 3300049590 Ga0501074_0007142 Ga0501074_0007142_2192_2779 190
46 3300049741 Ga0501079_0121191 Ga0501079_0121191_365_952 190
47 3300049742 Ga0501080_0008681 Ga0501080_0008681_3486_4073 190
48 3300049743 Ga0501081_0359723 Ga0501081_0359723_355_942 190
49 3300049744 Ga0501083_0033641 Ga0501083_0033641_2166_2753 190
50 3300054114 Ga0501084_0005414 Ga0501084_0005414_5250_5837 190
51 3300060353 Ga0501082_0019229 Ga0501082_0019229_4545_5132 190
52 3300061734 Ga0530510_0620919 Ga0530510_0620919_212_799 190
53 3300045051 Ga0451576_1101719 Ga0451576_1101719_20_601 193
54 iso_pu_bacteria 2501939600 2501941923 193
55 iso_pu_bacteria 2515154088 2515495350 193
56 iso_pu_bacteria 2515154129 2515720142 193
57 iso_pu_bacteria 2515154137 2515759089 193
58 iso_pu_bacteria 2515154202 2516086225 193
59 iso_pu_bacteria 2515154203 2516092204 193
60 iso_pu_bacteria 2622736626 2623585527 193
61 iso_pu_bacteria 2751185782 2753266898 193
62 iso_pu_bacteria 2772190715 2772645209 193
63 iso_pu_bacteria 2855683550 2855688199 193
64 iso_pu_bacteria 2856858025 2856859425 193
65 iso_pu_bacteria 2858868258 2858872165 193
66 iso_pu_bacteria 2858902515 2858908657 193
67 iso_pu_bacteria 2867507094 2867510467 193
68 iso_pu_bacteria 2880489317 2880494701 193
69 iso_pu_bacteria 2880495981 2880497622 193
70 iso_pu_bacteria 2902582711 2902585805 193
71 iso_pu_bacteria 2929219909 2929226178 193
72 iso_pu_bacteria 649633069 649812710 193
73 iso_pu_bacteria 8003830390 8003836502 193
74 iso_pu_bacteria 8003870546 8003875049 193
75 iso_pu_bacteria 8055412473 8055412672 193
76 3300044712 Ga0453684_0962023 Ga0453684_0962023_215_805 194
77 3300005548 Ga0070665_100370835 Ga0070665_1003708351 195
78 3300028379 Ga0268266_10082293 Ga0268266_100822934 195
79 3300041408 Ga0439453_0014689 Ga0439453_0014689_562_1149 195
80 3300041486 Ga0451807_0805302 Ga0451807_0805302_102_689 195
81 3300049571 Ga0501034_0425272 Ga0501034_0425272_461_1048 195
82 3300049581 Ga0501047_0214150 Ga0501047_0214150_664_1251 195
83 3300049584 Ga0501068_0000731 Ga0501068_0000731_13725_14312 195
84 3300049585 Ga0501069_0002048 Ga0501069_0002048_6356_6943 195
85 3300049585 Ga0501069_0007387 Ga0501069_0007387_4166_4753 195
86 3300049586 Ga0501070_0023269 Ga0501070_0023269_2456_3043 195
87 3300049586 Ga0501070_0169327 Ga0501070_0169327_235_822 195
88 3300049588 Ga0501072_0146005 Ga0501072_0146005_582_1169 195
89 3300049589 Ga0501073_0040128 Ga0501073_0040128_109_696 195
90 3300049590 Ga0501074_0002532 Ga0501074_0002532_11804_12391 195
91 3300049590 Ga0501074_0269075 Ga0501074_0269075_585_1172 195
92 3300049592 Ga0501076_0073596 Ga0501076_0073596_427_1014 195
93 3300049741 Ga0501079_0048471 Ga0501079_0048471_520_1107 195
94 3300049742 Ga0501080_0017058 Ga0501080_0017058_3107_3694 195
95 3300049742 Ga0501080_0044347 Ga0501080_0044347_1849_2436 195
96 3300049742 Ga0501080_0106422 Ga0501080_0106422_1778_2365 195
97 3300049744 Ga0501083_0013899 Ga0501083_0013899_4331_4918 195
98 3300049744 Ga0501083_0153232 Ga0501083_0153232_268_855 195
99 3300054114 Ga0501084_0002802 Ga0501084_0002802_12852_13439 195
100 3300060353 Ga0501082_0010983 Ga0501082_0010983_3123_3710 195
101 3300005328 Ga0070676_10465125 Ga0070676_104651251 196
102 3300005329 Ga0070683_100271823 Ga0070683_1002718233 196
103 3300005329 Ga0070683_100505106 Ga0070683_1005051061 196
104 3300005331 Ga0070670_100361242 Ga0070670_1003612423 196
105 3300005334 Ga0068869_100322214 Ga0068869_1003222143 196
106 3300005335 Ga0070666_10021013 Ga0070666_100210134 196
107 3300005336 Ga0070680_100160301 Ga0070680_1001603012 196
108 3300005336 Ga0070680_100449132 Ga0070680_1004491322 196
109 3300005337 Ga0070682_100467703 Ga0070682_1004677032 196
110 3300005339 Ga0070660_100342902 Ga0070660_1003429021 196
111 3300005340 Ga0070689_100077762 Ga0070689_1000777623 196
112 3300005341 Ga0070691_10033186 Ga0070691_100331863 196
113 3300005341 Ga0070691_10073913 Ga0070691_100739132 196
114 3300005347 Ga0070668_100088259 Ga0070668_1000882593 196
115 3300005347 Ga0070668_100875506 Ga0070668_1008755062 196
116 3300005353 Ga0070669_100119875 Ga0070669_1001198752 196
117 3300005354 Ga0070675_100115937 Ga0070675_1001159373 196
118 3300005356 Ga0070674_100016428 Ga0070674_1000164284 196
119 3300005356 Ga0070674_100149071 Ga0070674_1001490711 196
120 3300005364 Ga0070673_100039952 Ga0070673_1000399524 196
121 3300005364 Ga0070673_100583836 Ga0070673_1005838362 196
122 3300005366 Ga0070659_100120242 Ga0070659_1001202423 196
123 3300005438 Ga0070701_10253151 Ga0070701_102531512 196
124 3300005439 Ga0070711_100034032 Ga0070711_1000340323 196
125 3300005439 Ga0070711_100670425 Ga0070711_1006704252 196
126 3300005440 Ga0070705_100054393 Ga0070705_1000543933 196
127 3300005440 Ga0070705_100178734 Ga0070705_1001787343 196
128 3300005444 Ga0070694_100054762 Ga0070694_1000547623 196
129 3300005444 Ga0070694_100281309 Ga0070694_1002813092 196
130 3300005445 Ga0070708_100145472 Ga0070708_1001454724 196
131 3300005445 Ga0070708_100354828 Ga0070708_1003548281 196
132 3300005445 Ga0070708_100765297 Ga0070708_1007652972 196
133 3300005455 Ga0070663_100325203 Ga0070663_1003252032 196
134 3300005456 Ga0070678_100011829 Ga0070678_1000118293 196
135 3300005457 Ga0070662_100000175 Ga0070662_10000017528 196
136 3300005459 Ga0068867_100968143 Ga0068867_1009681432 196
137 3300005467 Ga0070706_100607832 Ga0070706_1006078321 196
138 3300005468 Ga0070707_100242914 Ga0070707_1002429141 196
139 3300005518 Ga0070699_100386567 Ga0070699_1003865672 196
140 3300005530 Ga0070679_100440650 Ga0070679_1004406501 196
141 3300005535 Ga0070684_100342690 Ga0070684_1003426903 196
142 3300005536 Ga0070697_100170097 Ga0070697_1001700973 196
143 3300005539 Ga0068853_100199380 Ga0068853_1001993802 196
144 3300005539 Ga0068853_100326296 Ga0068853_1003262962 196
145 3300005539 Ga0068853_100514436 Ga0068853_1005144362 196
146 3300005539 Ga0068853_100526443 Ga0068853_1005264432 196
147 3300005543 Ga0070672_100174328 Ga0070672_1001743283 196
148 3300005543 Ga0070672_100331102 Ga0070672_1003311022 196
149 3300005543 Ga0070672_100776818 Ga0070672_1007768182 196
150 3300005544 Ga0070686_100020095 Ga0070686_1000200955 196
151 3300005545 Ga0070695_100023736 Ga0070695_1000237363 196
152 3300005545 Ga0070695_100175407 Ga0070695_1001754073 196
153 3300005546 Ga0070696_100041490 Ga0070696_1000414903 196
154 3300005546 Ga0070696_100120100 Ga0070696_1001201003 196
155 3300005547 Ga0070693_100093441 Ga0070693_1000934413 196
156 3300005548 Ga0070665_100110766 Ga0070665_1001107662 196
157 3300005564 Ga0070664_100003171 Ga0070664_10000317113 196
158 3300005578 Ga0068854_100000312 Ga0068854_1000003129 196
159 3300005578 Ga0068854_100271298 Ga0068854_1002712982 196
160 3300005615 Ga0070702_100125186 Ga0070702_1001251861 196
161 3300005615 Ga0070702_100349563 Ga0070702_1003495632 196
162 3300005617 Ga0068859_100148675 Ga0068859_1001486752 196
163 3300005617 Ga0068859_100267092 Ga0068859_1002670922 196
164 3300005617 Ga0068859_101414743 Ga0068859_1014147431 196
165 3300005617 Ga0068859_102019998 Ga0068859_1020199981 196
166 3300005618 Ga0068864_101446374 Ga0068864_1014463741 196
167 3300005718 Ga0068866_10001272 Ga0068866_100012726 196
168 3300005719 Ga0068861_100076406 Ga0068861_1000764063 196
169 3300005719 Ga0068861_100691690 Ga0068861_1006916901 196
170 3300005841 Ga0068863_100664845 Ga0068863_1006648451 196
171 3300005842 Ga0068858_100036613 Ga0068858_1000366131 196
172 3300005843 Ga0068860_100065014 Ga0068860_1000650143 196
173 3300005844 Ga0068862_100032711 Ga0068862_1000327115 196
174 3300005844 Ga0068862_100561865 Ga0068862_1005618652 196
175 3300005844 Ga0068862_100680186 Ga0068862_1006801862 196
176 3300006175 Ga0070712_100145424 Ga0070712_1001454242 196
177 3300006237 Ga0097621_100661874 Ga0097621_1006618742 196
178 3300006358 Ga0068871_100439763 Ga0068871_1004397632 196
179 3300006844 Ga0075428_100484481 Ga0075428_1004844811 196
180 3300006852 Ga0075433_10111882 Ga0075433_101118823 196
181 3300006852 Ga0075433_10125566 Ga0075433_101255663 196
182 3300006852 Ga0075433_10343770 Ga0075433_103437703 196
183 3300006871 Ga0075434_100183518 Ga0075434_1001835183 196
184 3300006871 Ga0075434_100231108 Ga0075434_1002311083 196
185 3300006881 Ga0068865_100003121 Ga0068865_1000031212 196
186 3300006931 Ga0097620_100148690 Ga0097620_1001486902 196
187 3300006931 Ga0097620_100267096 Ga0097620_1002670962 196
188 3300006931 Ga0097620_101414102 Ga0097620_1014141021 196
189 3300006931 Ga0097620_102020044 Ga0097620_1020200441 196
190 3300007076 Ga0075435_100228132 Ga0075435_1002281323 196
191 3300009093 Ga0105240_10137190 Ga0105240_101371903 196
192 3300009094 Ga0111539_10104065 Ga0111539_101040653 196
193 3300009094 Ga0111539_10143028 Ga0111539_101430283 196
194 3300009098 Ga0105245_10145200 Ga0105245_101452002 196
195 3300009147 Ga0114129_10029164 Ga0114129_100291645 196
196 3300009148 Ga0105243_10005127 Ga0105243_100051277 196
197 3300009174 Ga0105241_10032989 Ga0105241_100329893 196
198 3300009176 Ga0105242_10112499 Ga0105242_101124992 196
199 3300009177 Ga0105248_10201677 Ga0105248_102016773 196
200 3300009545 Ga0105237_10189306 Ga0105237_101893063 196
201 3300009545 Ga0105237_10274250 Ga0105237_102742502 196
202 3300009551 Ga0105238_10290619 Ga0105238_102906193 196
203 3300009553 Ga0105249_10142928 Ga0105249_101429283 196
204 3300009553 Ga0105249_10212704 Ga0105249_102127042 196
205 3300009553 Ga0105249_10478027 Ga0105249_104780272 196
206 3300010375 Ga0105239_10042512 Ga0105239_100425126 196
207 3300010375 Ga0105239_10135905 Ga0105239_101359053 196
208 3300010375 Ga0105239_10191973 Ga0105239_101919733 196
209 3300013308 Ga0157375_10730471 Ga0157375_107304712 196
210 3300014326 Ga0157380_10259749 Ga0157380_102597493 196
211 3300014745 Ga0157377_10238608 Ga0157377_102386083 196
212 3300014968 Ga0157379_10045576 Ga0157379_100455764 196
213 3300014968 Ga0157379_10296718 Ga0157379_102967183 196
214 3300014968 Ga0157379_10407418 Ga0157379_104074183 196
215 3300014969 Ga0157376_10198018 Ga0157376_101980182 196
216 3300025905 Ga0207685_10019627 Ga0207685_100196274 196
217 3300025907 Ga0207645_10306816 Ga0207645_103068162 196
218 3300025910 Ga0207684_10501854 Ga0207684_105018542 196
219 3300025912 Ga0207707_10011727 Ga0207707_100117275 196
220 3300025912 Ga0207707_10559145 Ga0207707_105591452 196
221 3300025913 Ga0207695_10144179 Ga0207695_101441792 196
222 3300025916 Ga0207663_10039433 Ga0207663_100394333 196
223 3300025917 Ga0207660_10553989 Ga0207660_105539892 196
224 3300025919 Ga0207657_10109049 Ga0207657_101090493 196
225 3300025920 Ga0207649_10321257 Ga0207649_103212573 196
226 3300025921 Ga0207652_10607046 Ga0207652_106070461 196
227 3300025922 Ga0207646_10228718 Ga0207646_102287183 196
228 3300025922 Ga0207646_10497955 Ga0207646_104979553 196
229 3300025923 Ga0207681_10259671 Ga0207681_102596712 196
230 3300025923 Ga0207681_10429921 Ga0207681_104299212 196
231 3300025926 Ga0207659_10160920 Ga0207659_101609202 196
232 3300025926 Ga0207659_10619584 Ga0207659_106195841 196
233 3300025928 Ga0207700_10494508 Ga0207700_104945082 196
234 3300025933 Ga0207706_10000848 Ga0207706_100008483 196
235 3300025933 Ga0207706_10269607 Ga0207706_102696071 196
236 3300025934 Ga0207686_10000201 Ga0207686_1000020128 196
237 3300025935 Ga0207709_10011036 Ga0207709_100110364 196
238 3300025936 Ga0207670_10065960 Ga0207670_100659604 196
239 3300025937 Ga0207669_10000885 Ga0207669_1000088511 196
240 3300025937 Ga0207669_10276102 Ga0207669_102761022 196
241 3300025938 Ga0207704_10002345 Ga0207704_1000234510 196
242 3300025940 Ga0207691_10154637 Ga0207691_101546373 196
243 3300025940 Ga0207691_10164759 Ga0207691_101647593 196
244 3300025940 Ga0207691_10288999 Ga0207691_102889992 196
245 3300025941 Ga0207711_10006077 Ga0207711_100060773 196
246 3300025941 Ga0207711_10154980 Ga0207711_101549803 196
247 3300025942 Ga0207689_10173239 Ga0207689_101732393 196
248 3300025942 Ga0207689_10359911 Ga0207689_103599112 196
249 3300025944 Ga0207661_10427868 Ga0207661_104278683 196
250 3300025945 Ga0207679_10018043 Ga0207679_100180436 196
251 3300025945 Ga0207679_10034422 Ga0207679_100344223 196
252 3300025945 Ga0207679_10083650 Ga0207679_100836504 196
253 3300025945 Ga0207679_10097168 Ga0207679_100971684 196
254 3300025961 Ga0207712_10008379 Ga0207712_100083797 196
255 3300025961 Ga0207712_10117842 Ga0207712_101178423 196
256 3300025961 Ga0207712_10435190 Ga0207712_104351903 196
257 3300025972 Ga0207668_10048982 Ga0207668_100489823 196
258 3300025972 Ga0207668_10250138 Ga0207668_102501382 196
259 3300025981 Ga0207640_10007499 Ga0207640_100074993 196
260 3300025986 Ga0207658_10057435 Ga0207658_100574353 196
261 3300026035 Ga0207703_10088690 Ga0207703_100886903 196
262 3300026041 Ga0207639_10486911 Ga0207639_104869112 196
263 3300026041 Ga0207639_10969204 Ga0207639_109692042 196
264 3300026067 Ga0207678_10145048 Ga0207678_101450484 196
265 3300026067 Ga0207678_10272391 Ga0207678_102723913 196
266 3300026088 Ga0207641_10835392 Ga0207641_108353921 196
267 3300026089 Ga0207648_10756722 Ga0207648_107567221 196
268 3300026116 Ga0207674_10316977 Ga0207674_103169773 196
269 3300026118 Ga0207675_100056569 Ga0207675_1000565693 196
270 3300026118 Ga0207675_100222674 Ga0207675_1002226742 196
271 3300026118 Ga0207675_100533773 Ga0207675_1005337731 196
272 3300026121 Ga0207683_10018893 Ga0207683_100188933 196
273 3300027471 Ga0209995_1010399 Ga0209995_10103991 196
274 3300027614 Ga0209970_1005970 Ga0209970_10059703 196
275 3300027876 Ga0209974_10007755 Ga0209974_100077554 196
276 3300028380 Ga0268265_10217107 Ga0268265_102171074 196
277 3300028380 Ga0268265_10339237 Ga0268265_103392373 196
278 3300028380 Ga0268265_10659992 Ga0268265_106599922 196
279 3300028381 Ga0268264_10040037 Ga0268264_100400375 196
280 3300028381 Ga0268264_10669913 Ga0268264_106699132 196
281 3300030745 Ga0316182_1284667 Ga0316182_12846672 196
282 3300031548 Ga0307408_100030877 Ga0307408_1000308773 196
283 3300031548 Ga0307408_100100038 Ga0307408_1001000383 196
284 3300031548 Ga0307408_100128545 Ga0307408_1001285453 196
285 3300031548 Ga0307408_100752092 Ga0307408_1007520922 196
286 3300031691 Ga0316579_10048627 Ga0316579_100486273 196
287 3300031727 Ga0316576_10058536 Ga0316576_100585363 196
288 3300031728 Ga0316578_10001246 Ga0316578_100012465 196
289 3300031731 Ga0307405_10010387 Ga0307405_100103873 196
290 3300031731 Ga0307405_10015832 Ga0307405_100158323 196
291 3300031731 Ga0307405_10513619 Ga0307405_105136192 196
292 3300031733 Ga0316577_10005627 Ga0316577_100056273 196
293 3300031733 Ga0316577_10008151 Ga0316577_100081512 196
294 3300031824 Ga0307413_10010848 Ga0307413_100108482 196
295 3300031824 Ga0307413_10011241 Ga0307413_100112416 196
296 3300031824 Ga0307413_10020474 Ga0307413_100204746 196
297 3300031824 Ga0307413_10026919 Ga0307413_100269196 196
298 3300031824 Ga0307413_10068690 Ga0307413_100686903 196
299 3300031824 Ga0307413_10228898 Ga0307413_102288982 196
300 3300031852 Ga0307410_10001224 Ga0307410_1000122410 196
301 3300031852 Ga0307410_10001448 Ga0307410_100014484 196
302 3300031852 Ga0307410_10023400 Ga0307410_100234003 196
303 3300031852 Ga0307410_10046243 Ga0307410_100462435 196
304 3300031852 Ga0307410_10189333 Ga0307410_101893333 196
305 3300031852 Ga0307410_10414061 Ga0307410_104140612 196
306 3300031901 Ga0307406_10024221 Ga0307406_100242213 196
307 3300031901 Ga0307406_10047871 Ga0307406_100478714 196
308 3300031901 Ga0307406_10064849 Ga0307406_100648493 196
309 3300031901 Ga0307406_10092163 Ga0307406_100921633 196
310 3300031901 Ga0307406_10226913 Ga0307406_102269132 196
311 3300031901 Ga0307406_10388662 Ga0307406_103886622 196
312 3300031903 Ga0307407_10003455 Ga0307407_100034554 196
313 3300031903 Ga0307407_10006596 Ga0307407_100065967 196
314 3300031903 Ga0307407_10012302 Ga0307407_100123024 196
315 3300031903 Ga0307407_10014158 Ga0307407_100141586 196
316 3300031903 Ga0307407_10122801 Ga0307407_101228012 196
317 3300031903 Ga0307407_10156862 Ga0307407_101568623 196
318 3300031903 Ga0307407_10362994 Ga0307407_103629941 196
319 3300031911 Ga0307412_10016230 Ga0307412_100162307 196
320 3300031911 Ga0307412_10095716 Ga0307412_100957162 196
321 3300031995 Ga0307409_100003528 Ga0307409_1000035285 196
322 3300031995 Ga0307409_100016327 Ga0307409_1000163277 196
323 3300031995 Ga0307409_100051378 Ga0307409_1000513783 196
324 3300031995 Ga0307409_100062269 Ga0307409_1000622695 196
325 3300031995 Ga0307409_100134150 Ga0307409_1001341501 196
326 3300031995 Ga0307409_100343473 Ga0307409_1003434732 196
327 3300031995 Ga0307409_100388310 Ga0307409_1003883101 196
328 3300031995 Ga0307409_100471522 Ga0307409_1004715222 196
329 3300032002 Ga0307416_100000541 Ga0307416_10000054116 196
330 3300032002 Ga0307416_100007241 Ga0307416_1000072417 196
331 3300032002 Ga0307416_100343901 Ga0307416_1003439013 196
332 3300032002 Ga0307416_100474261 Ga0307416_1004742613 196
333 3300032002 Ga0307416_100635177 Ga0307416_1006351772 196
334 3300032004 Ga0307414_10005050 Ga0307414_100050504 196
335 3300032004 Ga0307414_10025824 Ga0307414_100258243 196
336 3300032004 Ga0307414_10040556 Ga0307414_100405565 196
337 3300032004 Ga0307414_10196999 Ga0307414_101969992 196
338 3300032004 Ga0307414_10472672 Ga0307414_104726722 196
339 3300032005 Ga0307411_10000173 Ga0307411_1000017310 196
340 3300032005 Ga0307411_10005030 Ga0307411_100050303 196
341 3300032005 Ga0307411_10069195 Ga0307411_100691953 196
342 3300032005 Ga0307411_10468139 Ga0307411_104681393 196
343 3300032005 Ga0307411_10760663 Ga0307411_107606632 196
344 3300032005 Ga0307411_10780622 Ga0307411_107806221 196
345 3300032126 Ga0307415_100000895 Ga0307415_1000008956 196
346 3300032126 Ga0307415_100067475 Ga0307415_1000674754 196
347 3300032126 Ga0307415_100141234 Ga0307415_1001412343 196
348 3300032137 Ga0316585_10021498 Ga0316585_100214981 196
349 3300034817 Ga0373948_0085149 Ga0373948_0085149_113_703 196
350 3300034818 Ga0373950_0094111 Ga0373950_0094111_11_601 196
351 3300034820 Ga0373959_0042392 Ga0373959_0042392_134_724 196
352 3300035088 Ga0373940_0009626 Ga0373940_0009626_1223_1813 196
353 3300035088 Ga0373940_0025053 Ga0373940_0025053_615_1205 196
354 3300035090 Ga0373949_0021585 Ga0373949_0021585_255_845 196
355 3300035115 Ga0373941_0029835 Ga0373941_0029835_273_863 196
356 3300035121 Ga0373960_0097004 Ga0373960_0097004_26_616 196
357 3300035241 Ga0373961_0047624 Ga0373961_0047624_229_819 196
358 3300035242 Ga0373962_0092088 Ga0373962_0092088_184_774 196
359 3300035691 Ga0373931_0013435 Ga0373931_0013435_550_1140 196
360 3300035691 Ga0373931_0032371 Ga0373931_0032371_2044_2634 196
361 3300036647 Ga0316582_0015308 Ga0316582_0015308_1082_1681 196
362 3300036647 Ga0316582_0036767 Ga0316582_0036767_550_1149 196
363 3300036647 Ga0316582_0183693 Ga0316582_0183693_348_947 196
364 3300036712 Ga0316584_0049440 Ga0316584_0049440_534_1133 196
365 3300038996 Ga0242420_026140 Ga0242420_026140_358_948 196
366 3300038996 Ga0242420_035811 Ga0242420_035811_311_901 196
367 3300039093 Ga0400489_30506 Ga0400489_30506_4883_5473 196
368 3300041404 Ga0439436_0053281 Ga0439436_0053281_53_643 196
369 3300041406 Ga0439439_0006898 Ga0439439_0006898_504_1094 196
370 3300041406 Ga0439439_0074907 Ga0439439_0074907_86_676 196
371 3300041411 Ga0439466_0145326 Ga0439466_0145326_16_606 196
372 3300042015 Ga0439462_0024787 Ga0439462_0024787_550_1140 196
373 3300042125 Ga0450923_036877 Ga0450923_036877_92_682 196
374 3300042132 Ga0450895_005399 Ga0450895_005399_23_613 196
375 3300042133 Ga0450896_010855 Ga0450896_010855_464_1054 196
376 3300042156 Ga0439446_0117866 Ga0439446_0117866_243_833 196
377 3300042438 Ga0439459_0011765 Ga0439459_0011765_638_1228 196
378 3300042461 Ga0439460_0121843 Ga0439460_0121843_120_710 196
379 3300042876 Ga0451577_0008058 Ga0451577_0008058_6939_7529 196
380 3300042876 Ga0451577_0170318 Ga0451577_0170318_588_1178 196
381 3300042993 Ga0439440_0078259 Ga0439440_0078259_159_749 196
382 3300044706 Ga0466964_0071734 Ga0466964_0071734_316_906 196
383 3300045049 Ga0466959_0517578 Ga0466959_0517578_81_692 196
384 3300045051 Ga0451576_0127974 Ga0451576_0127974_1468_2058 196
385 3300046455 Ga0495603_0033578 Ga0495603_0033578_2263_2853 196
386 3300046455 Ga0495603_0127260 Ga0495603_0127260_227_817 196
387 3300046475 Ga0495639_0334731 Ga0495639_0334731_148_738 196
388 3300046499 Ga0495594_0033430 Ga0495594_0033430_1661_2251 196
389 3300046558 Ga0495633_0251696 Ga0495633_0251696_110_700 196
390 3300048903 Ga0496100_0144016 Ga0496100_0144016_939_1529 196
391 3300048903 Ga0496100_0251964 Ga0496100_0251964_195_785 196
392 3300048904 Ga0496101_0023497 Ga0496101_0023497_2698_3288 196
393 3300048904 Ga0496101_0136016 Ga0496101_0136016_1050_1640 196
394 3300048904 Ga0496101_0265528 Ga0496101_0265528_546_1136 196
395 3300048904 Ga0496101_0272323 Ga0496101_0272323_615_1205 196
396 3300048904 Ga0496101_0401276 Ga0496101_0401276_231_821 196
397 3300048905 Ga0496102_0019829 Ga0496102_0019829_2651_3241 196
398 3300048905 Ga0496102_0100065 Ga0496102_0100065_2051_2641 196
399 3300048905 Ga0496102_0134628 Ga0496102_0134628_841_1431 196
400 3300048905 Ga0496102_0188462 Ga0496102_0188462_235_825 196
401 3300048905 Ga0496102_0196132 Ga0496102_0196132_421_1011 196
402 3300048906 Ga0496103_0012347 Ga0496103_0012347_532_1122 196
403 3300048906 Ga0496103_0313746 Ga0496103_0313746_404_994 196
404 3300048907 Ga0496104_0008614 Ga0496104_0008614_6312_6902 196
405 3300048907 Ga0496104_0014243 Ga0496104_0014243_3786_4376 196
406 3300048907 Ga0496104_0065065 Ga0496104_0065065_2084_2674 196
407 3300048908 Ga0496105_0107876 Ga0496105_0107876_979_1569 196
408 3300048908 Ga0496105_0116781 Ga0496105_0116781_865_1455 196
409 3300048908 Ga0496105_0224633 Ga0496105_0224633_86_676 196
410 3300048908 Ga0496105_0423589 Ga0496105_0423589_39_629 196
411 3300048909 Ga0496106_0079117 Ga0496106_0079117_1174_1764 196
412 3300048909 Ga0496106_0370254 Ga0496106_0370254_108_698 196
413 3300048910 Ga0496107_0042676 Ga0496107_0042676_2090_2680 196
414 3300048910 Ga0496107_0081080 Ga0496107_0081080_1476_2066 196
415 3300048911 Ga0496108_0012560 Ga0496108_0012560_4078_4668 196
416 3300048911 Ga0496108_0022374 Ga0496108_0022374_3083_3673 196
417 3300048911 Ga0496108_0052467 Ga0496108_0052467_2240_2830 196
418 3300048911 Ga0496108_0073537 Ga0496108_0073537_1116_1706 196
419 3300048911 Ga0496108_0168371 Ga0496108_0168371_409_999 196
420 3300048912 Ga0496109_0004685 Ga0496109_0004685_2953_3543 196
421 3300048912 Ga0496109_0029731 Ga0496109_0029731_3442_4032 196
422 3300048912 Ga0496109_0053147 Ga0496109_0053147_2162_2752 196
423 3300048912 Ga0496109_0090946 Ga0496109_0090946_1526_2116 196
424 3300048912 Ga0496109_0316797 Ga0496109_0316797_35_625 196
425 3300048913 Ga0496110_0003860 Ga0496110_0003860_8277_8867 196
426 3300048913 Ga0496110_0011067 Ga0496110_0011067_4062_4652 196
427 3300048913 Ga0496110_0031150 Ga0496110_0031150_903_1493 196
428 3300048913 Ga0496110_0189729 Ga0496110_0189729_548_1138 196
429 3300048913 Ga0496110_0197832 Ga0496110_0197832_754_1344 196
430 3300048914 Ga0496111_0003621 Ga0496111_0003621_5937_6527 196
431 3300048914 Ga0496111_0081193 Ga0496111_0081193_1663_2253 196
432 3300048914 Ga0496111_0263609 Ga0496111_0263609_102_692 196
433 3300048914 Ga0496111_0380705 Ga0496111_0380705_437_1027 196
434 3300048915 Ga0496112_0008505 Ga0496112_0008505_4379_4969 196
435 3300048915 Ga0496112_0072542 Ga0496112_0072542_597_1187 196
436 3300048915 Ga0496112_0119467 Ga0496112_0119467_643_1233 196
437 3300048916 Ga0496113_0001290 Ga0496113_0001290_2644_3234 196
438 3300048916 Ga0496113_0010962 Ga0496113_0010962_1378_1968 196
439 3300048916 Ga0496113_0021911 Ga0496113_0021911_2349_2939 196
440 3300048917 Ga0496114_1072555 Ga0496114_1072555_28_618 196
441 3300048918 Ga0496115_0044110 Ga0496115_0044110_2417_3007 196
442 3300048918 Ga0496115_0159372 Ga0496115_0159372_221_811 196
443 3300049568 Ga0501031_0003016 Ga0501031_0003016_6207_6797 196
444 3300049568 Ga0501031_0091586 Ga0501031_0091586_529_1119 196
445 3300049568 Ga0501031_0203720 Ga0501031_0203720_524_1114 196
446 3300049569 Ga0501032_0064982 Ga0501032_0064982_943_1533 196
447 3300049570 Ga0501033_0049373 Ga0501033_0049373_325_915 196
448 3300049570 Ga0501033_0106855 Ga0501033_0106855_1089_1679 196
449 3300049570 Ga0501033_0413635 Ga0501033_0413635_260_850 196
450 3300049570 Ga0501033_0447619 Ga0501033_0447619_234_824 196
451 3300049571 Ga0501034_0248416 Ga0501034_0248416_701_1291 196
452 3300049572 Ga0501036_0075815 Ga0501036_0075815_1162_1752 196
453 3300049572 Ga0501036_0103083 Ga0501036_0103083_772_1362 196
454 3300049572 Ga0501036_0176536 Ga0501036_0176536_770_1360 196
455 3300049572 Ga0501036_0198967 Ga0501036_0198967_365_955 196
456 3300049572 Ga0501036_0368081 Ga0501036_0368081_25_615 196
457 3300049573 Ga0501037_0074331 Ga0501037_0074331_305_895 196
458 3300049573 Ga0501037_0365847 Ga0501037_0365847_331_921 196
459 3300049574 Ga0501038_0021422 Ga0501038_0021422_1421_2011 196
460 3300049574 Ga0501038_0085413 Ga0501038_0085413_202_792 196
461 3300049574 Ga0501038_0599816 Ga0501038_0599816_188_778 196
462 3300049575 Ga0501039_0015901 Ga0501039_0015901_1909_2499 196
463 3300049575 Ga0501039_0067424 Ga0501039_0067424_604_1194 196
464 3300049575 Ga0501039_0302051 Ga0501039_0302051_445_1035 196
465 3300049576 Ga0501040_0049355 Ga0501040_0049355_806_1396 196
466 3300049576 Ga0501040_0049708 Ga0501040_0049708_925_1515 196
467 3300049576 Ga0501040_0112023 Ga0501040_0112023_1121_1711 196
468 3300049576 Ga0501040_0429170 Ga0501040_0429170_322_912 196
469 3300049577 Ga0501041_0011952 Ga0501041_0011952_1896_2486 196
470 3300049577 Ga0501041_0032929 Ga0501041_0032929_1320_1910 196
471 3300049577 Ga0501041_0072095 Ga0501041_0072095_921_1511 196
472 3300049578 Ga0501042_0008450 Ga0501042_0008450_744_1334 196
473 3300049578 Ga0501042_0069182 Ga0501042_0069182_799_1389 196
474 3300049578 Ga0501042_0154820 Ga0501042_0154820_40_630 196
475 3300049579 Ga0501043_0110482 Ga0501043_0110482_322_912 196
476 3300049580 Ga0501046_0053529 Ga0501046_0053529_256_846 196
477 3300049580 Ga0501046_0132337 Ga0501046_0132337_755_1345 196
478 3300049580 Ga0501046_0188308 Ga0501046_0188308_935_1525 196
479 3300049582 Ga0501048_0033076 Ga0501048_0033076_925_1515 196
480 3300049582 Ga0501048_0117375 Ga0501048_0117375_208_798 196
481 3300049583 Ga0501067_0129190 Ga0501067_0129190_767_1357 196
482 3300049584 Ga0501068_0121591 Ga0501068_0121591_872_1462 196
483 3300049585 Ga0501069_0185437 Ga0501069_0185437_248_838 196
484 3300049585 Ga0501069_0482735 Ga0501069_0482735_63_653 196
485 3300049587 Ga0501071_0008445 Ga0501071_0008445_2433_3023 196
486 3300049587 Ga0501071_0010088 Ga0501071_0010088_4504_5094 196
487 3300049587 Ga0501071_0212523 Ga0501071_0212523_285_875 196
488 3300049588 Ga0501072_0010662 Ga0501072_0010662_4360_4950 196
489 3300049588 Ga0501072_0033950 Ga0501072_0033950_2623_3213 196
490 3300049588 Ga0501072_0253205 Ga0501072_0253205_683_1273 196
491 3300049589 Ga0501073_0228603 Ga0501073_0228603_175_765 196
492 3300049589 Ga0501073_0239775 Ga0501073_0239775_107_697 196
493 3300049590 Ga0501074_0021223 Ga0501074_0021223_1301_1891 196
494 3300049590 Ga0501074_0205234 Ga0501074_0205234_285_875 196
495 3300049590 Ga0501074_0208335 Ga0501074_0208335_29_619 196
496 3300049591 Ga0501075_0005163 Ga0501075_0005163_5973_6563 196
497 3300049591 Ga0501075_0006152 Ga0501075_0006152_6478_7068 196
498 3300049591 Ga0501075_0480604 Ga0501075_0480604_282_872 196
499 3300049592 Ga0501076_0014150 Ga0501076_0014150_1650_2240 196
500 3300049592 Ga0501076_0034669 Ga0501076_0034669_2373_2963 196
501 3300049592 Ga0501076_0065852 Ga0501076_0065852_1312_1902 196
502 3300049592 Ga0501076_0264329 Ga0501076_0264329_513_1103 196
503 3300049592 Ga0501076_0480006 Ga0501076_0480006_28_618 196
504 3300049593 Ga0501077_0000834 Ga0501077_0000834_2448_3038 196
505 3300049593 Ga0501077_0011587 Ga0501077_0011587_1803_2393 196
506 3300049593 Ga0501077_0260843 Ga0501077_0260843_376_966 196
507 3300049656 Ga0501209_060080 Ga0501209_060080_108_698 196
508 3300049661 Ga0501217_040063 Ga0501217_040063_268_858 196
509 3300049669 Ga0501235_035235 Ga0501235_035235_437_1027 196
510 3300049675 Ga0501243_019656 Ga0501243_019656_56_646 196
511 3300049679 Ga0501249_090899 Ga0501249_090899_124_714 196
512 3300049741 Ga0501079_0017498 Ga0501079_0017498_2476_3066 196
513 3300049741 Ga0501079_0031892 Ga0501079_0031892_1012_1602 196
514 3300049741 Ga0501079_0039426 Ga0501079_0039426_2108_2698 196
515 3300049741 Ga0501079_0144760 Ga0501079_0144760_73_663 196
516 3300049741 Ga0501079_0259801 Ga0501079_0259801_551_1141 196
517 3300049742 Ga0501080_0093193 Ga0501080_0093193_1316_1906 196
518 3300049742 Ga0501080_0169409 Ga0501080_0169409_641_1231 196
519 3300049742 Ga0501080_0854687 Ga0501080_0854687_11_601 196
520 3300049743 Ga0501081_0018822 Ga0501081_0018822_583_1173 196
521 3300049743 Ga0501081_0027762 Ga0501081_0027762_207_797 196
522 3300049743 Ga0501081_0194161 Ga0501081_0194161_463_1053 196
523 3300049743 Ga0501081_0197211 Ga0501081_0197211_364_954 196
524 3300049744 Ga0501083_0084399 Ga0501083_0084399_621_1211 196
525 3300049768 Ga0501271_009461 Ga0501271_009461_311_901 196
526 3300049822 Ga0501035_0009554 Ga0501035_0009554_734_1324 196
527 3300049822 Ga0501035_0763264 Ga0501035_0763264_150_740 196
528 3300049824 Ga0501045_0008967 Ga0501045_0008967_5683_6273 196
529 3300049824 Ga0501045_0034289 Ga0501045_0034289_108_698 196
530 3300049824 Ga0501045_0147488 Ga0501045_0147488_770_1360 196
531 3300049824 Ga0501045_0385216 Ga0501045_0385216_298_888 196
532 3300050507 nmdc:mga05p37_378520_c1 nmdc:mga05p37_378520_c1_781_1371 196
533 3300050512 nmdc:mga0n895_237478_c1 nmdc:mga0n895_237478_c1_805_1395 196
534 3300050512 nmdc:mga0n895_321481_c1 nmdc:mga0n895_321481_c1_886_1476 196
535 3300050513 nmdc:mga0rr50_219609_c1 nmdc:mga0rr50_219609_c1_55_645 196
536 3300050515 nmdc:mga0a205_12549_c1 nmdc:mga0a205_12549_c1_2636_3226 196
537 3300050515 nmdc:mga0a205_241057_c1 nmdc:mga0a205_241057_c1_249_839 196
538 3300054114 Ga0501084_0068622 Ga0501084_0068622_186_776 196
539 3300054114 Ga0501084_0076412 Ga0501084_0076412_2205_2795 196
540 3300054114 Ga0501084_0086287 Ga0501084_0086287_1222_1812 196
541 3300054114 Ga0501084_0102515 Ga0501084_0102515_887_1477 196
542 3300054114 Ga0501084_0130341 Ga0501084_0130341_576_1166 196
543 3300054114 Ga0501084_1105031 Ga0501084_1105031_48_638 196
544 3300059421 Ga0590071_000641 Ga0590071_000641_2371_2961 196
545 3300059421 Ga0590071_013948 Ga0590071_013948_424_1014 196
546 3300059421 Ga0590071_108556 Ga0590071_108556_18_608 196
547 3300059424 Ga0590075_003140 Ga0590075_003140_28_618 196
548 3300059426 Ga0590077_003991 Ga0590077_003991_1940_2530 196
549 3300060353 Ga0501082_0010117 Ga0501082_0010117_2394_2984 196
550 3300060353 Ga0501082_0012220 Ga0501082_0012220_3231_3821 196
551 3300060353 Ga0501082_0015371 Ga0501082_0015371_2454_3044 196
552 3300061734 Ga0530510_0119214 Ga0530510_0119214_621_1211 196
553 3300061734 Ga0530510_0139586 Ga0530510_0139586_1022_1612 196
554 3300061734 Ga0530510_0311488 Ga0530510_0311488_471_1061 196
555 3300061734 Ga0530510_0352835 Ga0530510_0352835_396_986 196
556 3300036647 Ga0316582_0094522 Ga0316582_0094522_258_860 197
557 3300037588 Ga0316581_0033546 Ga0316581_0033546_67_669 197
558 3300042876 Ga0451577_0152166 Ga0451577_0152166_698_1318 197
559 3300045051 Ga0451576_0005380 Ga0451576_0005380_8573_9193 197
560 3300005295 Ga0065707_10013151 Ga0065707_100131512 198
561 3300005406 Ga0070703_10018711 Ga0070703_100187112 198
562 3300005435 Ga0070714_100000067 Ga0070714_10000006785 198
563 3300005436 Ga0070713_100238053 Ga0070713_1002380532 198
564 3300005440 Ga0070705_100194168 Ga0070705_1001941681 198
565 3300005440 Ga0070705_100295623 Ga0070705_1002956232 198
566 3300005444 Ga0070694_100636319 Ga0070694_1006363191 198
567 3300005445 Ga0070708_100009481 Ga0070708_1000094812 198
568 3300005445 Ga0070708_100079412 Ga0070708_1000794122 198
569 3300005445 Ga0070708_100180664 Ga0070708_1001806642 198
570 3300005445 Ga0070708_100325341 Ga0070708_1003253413 198
571 3300005445 Ga0070708_100627083 Ga0070708_1006270831 198
572 3300005467 Ga0070706_100001060 Ga0070706_1000010606 198
573 3300005467 Ga0070706_100067957 Ga0070706_1000679572 198
574 3300005467 Ga0070706_100448758 Ga0070706_1004487581 198
575 3300005467 Ga0070706_100537284 Ga0070706_1005372842 198
576 3300005468 Ga0070707_100448094 Ga0070707_1004480941 198
577 3300005468 Ga0070707_100658805 Ga0070707_1006588051 198
578 3300005468 Ga0070707_100899774 Ga0070707_1008997742 198
579 3300005471 Ga0070698_100000782 Ga0070698_1000007823 198
580 3300005471 Ga0070698_100113587 Ga0070698_1001135873 198
581 3300005471 Ga0070698_100608205 Ga0070698_1006082052 198
582 3300005518 Ga0070699_100146642 Ga0070699_1001466423 198
583 3300005518 Ga0070699_100252969 Ga0070699_1002529691 198
584 3300005518 Ga0070699_100541860 Ga0070699_1005418603 198
585 3300005518 Ga0070699_100595732 Ga0070699_1005957321 198
586 3300005536 Ga0070697_100379975 Ga0070697_1003799752 198
587 3300005539 Ga0068853_100144092 Ga0068853_1001440921 198
588 3300005546 Ga0070696_100307424 Ga0070696_1003074243 198
589 3300005546 Ga0070696_101068549 Ga0070696_1010685491 198
590 3300005548 Ga0070665_100217308 Ga0070665_1002173082 198
591 3300005549 Ga0070704_100014384 Ga0070704_1000143843 198
592 3300005563 Ga0068855_100428231 Ga0068855_1004282312 198
593 3300005614 Ga0068856_100033924 Ga0068856_1000339242 198
594 3300006028 Ga0070717_10023259 Ga0070717_100232593 198
595 3300006173 Ga0070716_100036618 Ga0070716_1000366183 198
596 3300006173 Ga0070716_100116911 Ga0070716_1001169112 198
597 3300006175 Ga0070712_100009514 Ga0070712_1000095142 198
598 3300006844 Ga0075428_100156802 Ga0075428_1001568023 198
599 3300006847 Ga0075431_100010382 Ga0075431_1000103829 198
600 3300006852 Ga0075433_10090778 Ga0075433_100907782 198
601 3300006871 Ga0075434_100196783 Ga0075434_1001967832 198
602 3300006880 Ga0075429_100020232 Ga0075429_1000202323 198
603 3300007076 Ga0075435_100074302 Ga0075435_1000743023 198
604 3300007076 Ga0075435_100347210 Ga0075435_1003472102 198
605 3300009147 Ga0114129_10078848 Ga0114129_100788483 198
606 3300009147 Ga0114129_10239225 Ga0114129_102392253 198
607 3300009147 Ga0114129_10243733 Ga0114129_102437334 198
608 3300009147 Ga0114129_10290366 Ga0114129_102903661 198
609 3300009147 Ga0114129_10531447 Ga0114129_105314472 198
610 3300009147 Ga0114129_11707085 Ga0114129_117070851 198
611 3300009174 Ga0105241_10214673 Ga0105241_102146732 198
612 3300021388 Ga0213875_10046672 Ga0213875_100466723 198
613 3300025885 Ga0207653_10029888 Ga0207653_100298882 198
614 3300025910 Ga0207684_10000159 Ga0207684_1000015917 198
615 3300025910 Ga0207684_10049454 Ga0207684_100494545 198
616 3300025910 Ga0207684_10081808 Ga0207684_100818082 198
617 3300025910 Ga0207684_10635453 Ga0207684_106354531 198
618 3300025911 Ga0207654_10204764 Ga0207654_102047642 198
619 3300025922 Ga0207646_10015191 Ga0207646_1001519111 198
620 3300025922 Ga0207646_10088117 Ga0207646_100881172 198
621 3300025922 Ga0207646_10770538 Ga0207646_107705382 198
622 3300025922 Ga0207646_10827365 Ga0207646_108273652 198
623 3300025928 Ga0207700_10076419 Ga0207700_100764192 198
624 3300025929 Ga0207664_10000005 Ga0207664_10000005397 198
625 3300025939 Ga0207665_10201555 Ga0207665_102015552 198
626 3300025939 Ga0207665_10360195 Ga0207665_103601952 198
627 3300025949 Ga0207667_10432950 Ga0207667_104329503 198
628 3300026035 Ga0207703_11268826 Ga0207703_112688261 198
629 3300026041 Ga0207639_10631223 Ga0207639_106312231 198
630 3300028800 Ga0265338_10019132 Ga0265338_100191324 198
631 3300031665 Ga0316575_10067288 Ga0316575_100672881 198
632 3300031711 Ga0265314_10179587 Ga0265314_101795872 198
633 3300031727 Ga0316576_10015588 Ga0316576_100155883 198
634 3300031727 Ga0316576_10125227 Ga0316576_101252273 198
635 3300031727 Ga0316576_10418355 Ga0316576_104183552 198
636 3300031727 Ga0316576_10468535 Ga0316576_104685352 198
637 3300031727 Ga0316576_10798224 Ga0316576_107982241 198
638 3300031728 Ga0316578_10360432 Ga0316578_103604322 198
639 3300031733 Ga0316577_10017018 Ga0316577_100170184 198
640 3300031733 Ga0316577_10022869 Ga0316577_100228692 198
641 3300032137 Ga0316585_10047429 Ga0316585_100474291 198
642 3300035089 Ga0373944_0009412 Ga0373944_0009412_1752_2354 198
643 3300035170 Ga0373943_0029867 Ga0373943_0029867_97_699 198
644 3300035398 Ga0316574_0075215 Ga0316574_0075215_44_643 198
645 3300035398 Ga0316574_0113155 Ga0316574_0113155_869_1519 198
646 3300035692 Ga0373935_0029116 Ga0373935_0029116_724_1326 198
647 3300036647 Ga0316582_0055441 Ga0316582_0055441_1331_1930 198
648 3300036647 Ga0316582_0197377 Ga0316582_0197377_58_657 198
649 3300036647 Ga0316582_0564491 Ga0316582_0564491_70_675 198
650 3300036647 Ga0316582_0580519 Ga0316582_0580519_154_753 198
651 3300037853 Ga0436364_0918438 Ga0436364_0918438_912_1526 198
652 3300038726 Ga0400490_09994 Ga0400490_09994_441_1040 198
653 3300039062 Ga0400483_103554 Ga0400483_103554_1225_1821 198
654 3300039062 Ga0400483_200081 Ga0400483_200081_188_784 198
655 3300042876 Ga0451577_0302080 Ga0451577_0302080_438_1037 198
656 3300044673 Ga0453683_0000006 Ga0453683_0000006_110704_111300 198
657 3300044673 Ga0453683_0001504 Ga0453683_0001504_4365_4988 198
658 3300044673 Ga0453683_0502519 Ga0453683_0502519_149_748 198
659 3300044694 Ga0466963_0349824 Ga0466963_0349824_287_898 198
660 3300044712 Ga0453684_0004409 Ga0453684_0004409_28548_29144 198
661 3300044712 Ga0453684_0031253 Ga0453684_0031253_2363_2986 198
662 3300044712 Ga0453684_0170627 Ga0453684_0170627_558_1157 198
663 3300045051 Ga0451576_0000014 Ga0451576_0000014_89345_89968 198
664 3300045051 Ga0451576_0000138 Ga0451576_0000138_134171_134770 198
665 3300046674 Ga0495588_0016497 Ga0495588_0016497_2954_3550 198
666 3300048915 Ga0496112_0414367 Ga0496112_0414367_267_869 198
667 3300049571 Ga0501034_0181110 Ga0501034_0181110_1036_1632 198
668 3300050507 nmdc:mga05p37_172664_c1 nmdc:mga05p37_172664_c1_656_1258 198
669 3300050507 nmdc:mga05p37_38365_c1 nmdc:mga05p37_38365_c1_3814_4416 198
670 3300050507 nmdc:mga05p37_844229_c1 nmdc:mga05p37_844229_c1_102_704 198
671 3300050507 nmdc:mga05p37_87209_c1 nmdc:mga05p37_87209_c1_2032_2634 198
672 3300050507 nmdc:mga05p37_94064_c1 nmdc:mga05p37_94064_c1_1582_2184 198
673 3300050508 nmdc:mga09592_23260_c1 nmdc:mga09592_23260_c1_618_1220 198
674 3300050510 nmdc:mga06r32_37252_c1 nmdc:mga06r32_37252_c1_3716_4318 198
675 3300050512 nmdc:mga0n895_323502_c1 nmdc:mga0n895_323502_c1_680_1282 198
676 3300050513 nmdc:mga0rr50_71479_c1 nmdc:mga0rr50_71479_c1_1876_2478 198
677 3300050513 nmdc:mga0rr50_726525_c1 nmdc:mga0rr50_726525_c1_159_761 198
678 3300050515 nmdc:mga0a205_192078_c1 nmdc:mga0a205_192078_c1_215_817 198
679 3300025315 Ga0207697_10146951 Ga0207697_101469511 199
680 3300031665 Ga0316575_10056419 Ga0316575_100564192 199
681 3300031691 Ga0316579_10018952 Ga0316579_100189522 199
682 3300031733 Ga0316577_10029358 Ga0316577_100293581 199
683 3300035398 Ga0316574_0042804 Ga0316574_0042804_1743_2348 199
684 3300035398 Ga0316574_0132380 Ga0316574_0132380_695_1297 199
685 3300037588 Ga0316581_0015819 Ga0316581_0015819_1421_2029 199
686 3300003203 JGI25406J46586_10003441 JGI25406J46586_100034417 200
687 3300005295 Ga0065707_10088820 Ga0065707_100888205 200
688 3300005295 Ga0065707_10358976 Ga0065707_103589762 200
689 3300005334 Ga0068869_100646652 Ga0068869_1006466521 200
690 3300005471 Ga0070698_100043703 Ga0070698_1000437034 200
691 3300005518 Ga0070699_100013854 Ga0070699_1000138544 200
692 3300005546 Ga0070696_100451007 Ga0070696_1004510072 200
693 3300005617 Ga0068859_100485630 Ga0068859_1004856302 200
694 3300005985 Ga0081539_10007668 Ga0081539_100076688 200
695 3300006844 Ga0075428_100836756 Ga0075428_1008367562 200
696 3300006880 Ga0075429_100113319 Ga0075429_1001133193 200
697 3300006931 Ga0097620_100485633 Ga0097620_1004856332 200
698 3300009147 Ga0114129_10117940 Ga0114129_101179404 200
699 3300009553 Ga0105249_10143739 Ga0105249_101437393 200
700 3300025961 Ga0207712_10020882 Ga0207712_100208825 200
701 3300027695 Ga0209966_1006415 Ga0209966_10064154 200
702 3300031344 Ga0265316_10250679 Ga0265316_102506792 200
703 3300031727 Ga0316576_10791688 Ga0316576_107916881 200
704 3300031731 Ga0307405_10316366 Ga0307405_103163662 200
705 3300031824 Ga0307413_10108119 Ga0307413_101081193 200
706 3300031903 Ga0307407_10032405 Ga0307407_100324053 200
707 3300031995 Ga0307409_100934691 Ga0307409_1009346911 200
708 3300032126 Ga0307415_101180235 Ga0307415_1011802351 200
709 3300036647 Ga0316582_0406096 Ga0316582_0406096_211_816 200
710 3300036712 Ga0316584_0004330 Ga0316584_0004330_1557_2162 200
711 3300042876 Ga0451577_0109387 Ga0451577_0109387_1205_1810 200
712 3300042876 Ga0451577_0835150 Ga0451577_0835150_60_713 200
713 3300044712 Ga0453684_0088924 Ga0453684_0088924_2906_3511 200
714 3300044712 Ga0453684_1140464 Ga0453684_1140464_209_811 200
715 3300044712 Ga0453684_1612015 Ga0453684_1612015_23_625 200
716 3300045051 Ga0451576_0152613 Ga0451576_0152613_1574_2176 200
717 3300049572 Ga0501036_0142162 Ga0501036_0142162_1254_1856 200
718 3300049574 Ga0501038_0571479 Ga0501038_0571479_85_687 200
719 3300049577 Ga0501041_0123290 Ga0501041_0123290_767_1369 200
720 3300049580 Ga0501046_0284554 Ga0501046_0284554_182_784 200
721 3300049587 Ga0501071_0171094 Ga0501071_0171094_396_998 200
722 3300049590 Ga0501074_0103993 Ga0501074_0103993_1257_1859 200
723 3300049591 Ga0501075_0005015 Ga0501075_0005015_5316_5918 200
724 3300049592 Ga0501076_0010660 Ga0501076_0010660_2776_3378 200
725 3300049741 Ga0501079_0028768 Ga0501079_0028768_603_1205 200
726 3300049742 Ga0501080_0110178 Ga0501080_0110178_972_1574 200
727 3300049743 Ga0501081_0752187 Ga0501081_0752187_41_643 200
728 3300049822 Ga0501035_0226194 Ga0501035_0226194_142_744 200
729 3300050507 nmdc:mga05p37_551032_c1 nmdc:mga05p37_551032_c1_590_1192 200
730 3300050508 nmdc:mga09592_73986_c1 nmdc:mga09592_73986_c1_584_1186 200
731 3300050510 nmdc:mga06r32_847432_c1 nmdc:mga06r32_847432_c1_218_820 200
732 3300054114 Ga0501084_0059438 Ga0501084_0059438_1448_2050 200
733 2162886007 SwRhRL2b_contig_2348821 SwRhRL2b_0582.00000560 201
734 3300005289 Ga0065704_10134448 Ga0065704_101344483 201
735 3300005295 Ga0065707_10000534 Ga0065707_100005343 201
736 3300005295 Ga0065707_10084320 Ga0065707_100843203 201
737 3300005295 Ga0065707_10086250 Ga0065707_100862505 201
738 3300005295 Ga0065707_10141701 Ga0065707_101417012 201
739 3300005337 Ga0070682_100934053 Ga0070682_1009340531 201
740 3300005340 Ga0070689_100036265 Ga0070689_1000362653 201
741 3300005406 Ga0070703_10072110 Ga0070703_100721101 201
742 3300005438 Ga0070701_10072275 Ga0070701_100722753 201
743 3300005440 Ga0070705_100961505 Ga0070705_1009615051 201
744 3300005444 Ga0070694_100192983 Ga0070694_1001929832 201
745 3300005467 Ga0070706_100258043 Ga0070706_1002580432 201
746 3300005468 Ga0070707_101135074 Ga0070707_1011350741 201
747 3300005471 Ga0070698_100076693 Ga0070698_1000766932 201
748 3300005518 Ga0070699_100021018 Ga0070699_1000210186 201
749 3300005518 Ga0070699_100024326 Ga0070699_1000243262 201
750 3300005618 Ga0068864_100084812 Ga0068864_1000848123 201
751 3300005618 Ga0068864_100569198 Ga0068864_1005691982 201
752 3300005618 Ga0068864_101552906 Ga0068864_1015529061 201
753 3300005719 Ga0068861_100210320 Ga0068861_1002103201 201
754 3300005844 Ga0068862_100064965 Ga0068862_1000649653 201
755 3300005985 Ga0081539_10180017 Ga0081539_101800172 201
756 3300006847 Ga0075431_100174887 Ga0075431_1001748873 201
757 3300006871 Ga0075434_100160198 Ga0075434_1001601983 201
758 3300006880 Ga0075429_100009321 Ga0075429_1000093218 201
759 3300006880 Ga0075429_100122470 Ga0075429_1001224702 201
760 3300006880 Ga0075429_100167191 Ga0075429_1001671913 201
761 3300006880 Ga0075429_100249161 Ga0075429_1002491612 201
762 3300009094 Ga0111539_10188061 Ga0111539_101880613 201
763 3300009147 Ga0114129_10010107 Ga0114129_100101074 201
764 3300009147 Ga0114129_10021191 Ga0114129_100211915 201
765 3300009147 Ga0114129_10146934 Ga0114129_101469343 201
766 3300009147 Ga0114129_10278551 Ga0114129_102785512 201
767 3300009147 Ga0114129_11609996 Ga0114129_116099961 201
768 3300009148 Ga0105243_10065680 Ga0105243_100656803 201
769 3300009148 Ga0105243_10305125 Ga0105243_103051252 201
770 3300009174 Ga0105241_10205417 Ga0105241_102054172 201
771 3300009553 Ga0105249_10198590 Ga0105249_101985903 201
772 3300009553 Ga0105249_10283104 Ga0105249_102831042 201
773 3300009553 Ga0105249_11099261 Ga0105249_110992611 201
774 3300011119 Ga0105246_10002516 Ga0105246_100025162 201
775 3300011119 Ga0105246_10048892 Ga0105246_100488923 201
776 3300011119 Ga0105246_10741936 Ga0105246_107419361 201
777 3300014745 Ga0157377_10364569 Ga0157377_103645691 201
778 3300025885 Ga0207653_10180235 Ga0207653_101802351 201
779 3300025910 Ga0207684_10123993 Ga0207684_101239932 201
780 3300025911 Ga0207654_10146087 Ga0207654_101460872 201
781 3300025936 Ga0207670_10423173 Ga0207670_104231731 201
782 3300025961 Ga0207712_10085765 Ga0207712_100857653 201
783 3300026075 Ga0207708_10204179 Ga0207708_102041792 201
784 3300026095 Ga0207676_10131003 Ga0207676_101310032 201
785 3300026095 Ga0207676_10536291 Ga0207676_105362911 201
786 3300026118 Ga0207675_100284184 Ga0207675_1002841841 201
787 3300028380 Ga0268265_10089853 Ga0268265_100898532 201
788 3300028558 Ga0265326_10013118 Ga0265326_100131182 201
789 3300028577 Ga0265318_10006693 Ga0265318_100066933 201
790 3300028800 Ga0265338_10033218 Ga0265338_100332184 201
791 3300029957 Ga0265324_10097390 Ga0265324_100973902 201
792 3300031240 Ga0265320_10017108 Ga0265320_100171085 201
793 3300031247 Ga0265340_10000496 Ga0265340_1000049623 201
794 3300031250 Ga0265331_10003063 Ga0265331_100030637 201
795 3300031251 Ga0265327_10029297 Ga0265327_100292971 201
796 3300031344 Ga0265316_10022181 Ga0265316_100221815 201
797 3300031691 Ga0316579_10029713 Ga0316579_100297133 201
798 3300031691 Ga0316579_10030624 Ga0316579_100306243 201
799 3300031691 Ga0316579_10089369 Ga0316579_100893692 201
800 3300031727 Ga0316576_10007136 Ga0316576_100071367 201
801 3300031727 Ga0316576_10081950 Ga0316576_100819503 201
802 3300031727 Ga0316576_10345877 Ga0316576_103458771 201
803 3300031728 Ga0316578_10012349 Ga0316578_100123492 201
804 3300031728 Ga0316578_10073604 Ga0316578_100736042 201
805 3300031728 Ga0316578_10085971 Ga0316578_100859712 201
806 3300031728 Ga0316578_10116905 Ga0316578_101169052 201
807 3300031728 Ga0316578_10156744 Ga0316578_101567441 201
808 3300031733 Ga0316577_10007877 Ga0316577_100078773 201
809 3300031733 Ga0316577_10220244 Ga0316577_102202442 201
810 3300031733 Ga0316577_10285354 Ga0316577_102853541 201
811 3300031733 Ga0316577_10367095 Ga0316577_103670952 201
812 3300031995 Ga0307409_101107001 Ga0307409_1011070011 201
813 3300032002 Ga0307416_100935969 Ga0307416_1009359692 201
814 3300032133 Ga0316583_10073276 Ga0316583_100732761 201
815 3300032137 Ga0316585_10004967 Ga0316585_100049675 201
816 3300032137 Ga0316585_10100968 Ga0316585_101009681 201
817 3300035241 Ga0373961_0071888 Ga0373961_0071888_29_634 201
818 3300035398 Ga0316574_0001564 Ga0316574_0001564_3682_4290 201
819 3300035398 Ga0316574_0004212 Ga0316574_0004212_5910_6515 201
820 3300036647 Ga0316582_0008508 Ga0316582_0008508_4272_4877 201
821 3300036647 Ga0316582_0027872 Ga0316582_0027872_1967_2572 201
822 3300036647 Ga0316582_0040425 Ga0316582_0040425_842_1447 201
823 3300036647 Ga0316582_0116258 Ga0316582_0116258_424_1032 201
824 3300036647 Ga0316582_0210584 Ga0316582_0210584_648_1253 201
825 3300036712 Ga0316584_0002917 Ga0316584_0002917_6843_7451 201
826 3300036712 Ga0316584_0015772 Ga0316584_0015772_4062_4667 201
827 3300036712 Ga0316584_0247978 Ga0316584_0247978_558_1163 201
828 3300037588 Ga0316581_0003768 Ga0316581_0003768_1782_2390 201
829 3300037588 Ga0316581_0027578 Ga0316581_0027578_20_625 201
830 3300037588 Ga0316581_0033733 Ga0316581_0033733_11_616 201
831 3300038996 Ga0242420_027550 Ga0242420_027550_394_999 201
832 3300042876 Ga0451577_0008331 Ga0451577_0008331_7175_7780 201
833 3300042876 Ga0451577_0036429 Ga0451577_0036429_511_1116 201
834 3300042876 Ga0451577_0047073 Ga0451577_0047073_2841_3446 201
835 3300042876 Ga0451577_0052120 Ga0451577_0052120_1847_2452 201
836 3300042876 Ga0451577_0134782 Ga0451577_0134782_703_1308 201
837 3300042876 Ga0451577_0179660 Ga0451577_0179660_138_743 201
838 3300042876 Ga0451577_0299396 Ga0451577_0299396_280_885 201
839 3300042876 Ga0451577_0312850 Ga0451577_0312850_507_1130 201
840 3300042876 Ga0451577_0511297 Ga0451577_0511297_454_1059 201
841 3300042876 Ga0451577_0577950 Ga0451577_0577950_329_937 201
842 3300042876 Ga0451577_1069996 Ga0451577_1069996_78_686 201
843 3300044673 Ga0453683_0004070 Ga0453683_0004070_8452_9057 201
844 3300044673 Ga0453683_0034751 Ga0453683_0034751_553_1158 201
845 3300044673 Ga0453683_0037986 Ga0453683_0037986_1698_2303 201
846 3300044673 Ga0453683_0038390 Ga0453683_0038390_1362_1967 201
847 3300044673 Ga0453683_0101522 Ga0453683_0101522_446_1051 201
848 3300044673 Ga0453683_0119313 Ga0453683_0119313_722_1327 201
849 3300044673 Ga0453683_0152183 Ga0453683_0152183_143_748 201
850 3300044673 Ga0453683_0178635 Ga0453683_0178635_191_796 201
851 3300044712 Ga0453684_0000023 Ga0453684_0000023_5025_5630 201
852 3300044712 Ga0453684_0000035 Ga0453684_0000035_568473_569078 201
853 3300044712 Ga0453684_0000128 Ga0453684_0000128_331450_332055 201
854 3300044712 Ga0453684_0003360 Ga0453684_0003360_18498_19106 201
855 3300044712 Ga0453684_0003688 Ga0453684_0003688_4937_5542 201
856 3300044712 Ga0453684_0005202 Ga0453684_0005202_23421_24026 201
857 3300044712 Ga0453684_0006177 Ga0453684_0006177_11832_12440 201
858 3300044712 Ga0453684_0013654 Ga0453684_0013654_8431_9036 201
859 3300044712 Ga0453684_0045211 Ga0453684_0045211_4238_4843 201
860 3300044712 Ga0453684_0050605 Ga0453684_0050605_1156_1803 201
861 3300044712 Ga0453684_0067960 Ga0453684_0067960_2600_3205 201
862 3300044712 Ga0453684_0076068 Ga0453684_0076068_1877_2482 201
863 3300044712 Ga0453684_0091086 Ga0453684_0091086_1712_2317 201
864 3300044712 Ga0453684_0097350 Ga0453684_0097350_793_1398 201
865 3300044712 Ga0453684_0112808 Ga0453684_0112808_1186_1791 201
866 3300044712 Ga0453684_0133603 Ga0453684_0133603_611_1216 201
867 3300044712 Ga0453684_0138328 Ga0453684_0138328_1132_1740 201
868 3300044712 Ga0453684_0156563 Ga0453684_0156563_581_1186 201
869 3300044712 Ga0453684_0168390 Ga0453684_0168390_1772_2377 201
870 3300044712 Ga0453684_0216052 Ga0453684_0216052_940_1545 201
871 3300044712 Ga0453684_0688720 Ga0453684_0688720_492_1097 201
872 3300044712 Ga0453684_0696353 Ga0453684_0696353_17_622 201
873 3300044712 Ga0453684_0895593 Ga0453684_0895593_138_743 201
874 3300044712 Ga0453684_1525140 Ga0453684_1525140_29_634 201
875 3300045051 Ga0451576_0001446 Ga0451576_0001446_735_1340 201
876 3300045051 Ga0451576_0004639 Ga0451576_0004639_1487_2092 201
877 3300045051 Ga0451576_0039017 Ga0451576_0039017_1818_2423 201
878 3300045051 Ga0451576_0140794 Ga0451576_0140794_1862_2470 201
879 3300045051 Ga0451576_0312282 Ga0451576_0312282_850_1458 201
880 3300045051 Ga0451576_0328766 Ga0451576_0328766_317_922 201
881 3300045051 Ga0451576_0338672 Ga0451576_0338672_79_684 201
882 3300045051 Ga0451576_0632412 Ga0451576_0632412_306_911 201
883 3300045051 Ga0451576_0676289 Ga0451576_0676289_23_628 201
884 3300045051 Ga0451576_0805265 Ga0451576_0805265_142_747 201
885 3300046691 Ga0495670_0154783 Ga0495670_0154783_30_635 201
886 3300049588 Ga0501072_0190637 Ga0501072_0190637_614_1219 201
887 3300049589 Ga0501073_0018933 Ga0501073_0018933_725_1330 201
888 3300049589 Ga0501073_0045233 Ga0501073_0045233_2094_2699 201
889 3300049589 Ga0501073_0182255 Ga0501073_0182255_349_954 201
890 3300049590 Ga0501074_0346193 Ga0501074_0346193_115_720 201
891 3300049590 Ga0501074_0391454 Ga0501074_0391454_65_670 201
892 3300049592 Ga0501076_0591082 Ga0501076_0591082_100_705 201
893 3300049741 Ga0501079_0201128 Ga0501079_0201128_850_1455 201
894 3300049741 Ga0501079_0493837 Ga0501079_0493837_235_840 201
895 3300049743 Ga0501081_0279459 Ga0501081_0279459_415_1020 201
896 3300049824 Ga0501045_0343120 Ga0501045_0343120_461_1066 201
897 3300050507 nmdc:mga05p37_15211_c1 nmdc:mga05p37_15211_c1_2984_3589 201
898 3300050507 nmdc:mga05p37_186995_c1 nmdc:mga05p37_186995_c1_1470_2075 201
899 3300050507 nmdc:mga05p37_508900_c1 nmdc:mga05p37_508900_c1_696_1301 201
900 3300050507 nmdc:mga05p37_77476_c1 nmdc:mga05p37_77476_c1_505_1110 201
901 3300050507 nmdc:mga05p37_944916_c1 nmdc:mga05p37_944916_c1_246_851 201
902 3300050508 nmdc:mga09592_104656_c1 nmdc:mga09592_104656_c1_1747_2352 201
903 3300050508 nmdc:mga09592_111845_c1 nmdc:mga09592_111845_c1_1266_1871 201
904 3300050508 nmdc:mga09592_131559_c1 nmdc:mga09592_131559_c1_1309_1914 201
905 3300050508 nmdc:mga09592_302873_c1 nmdc:mga09592_302873_c1_749_1354 201
906 3300050508 nmdc:mga09592_5756_c1 nmdc:mga09592_5756_c1_6731_7336 201
907 3300050509 nmdc:mga0qj67_90348_c1 nmdc:mga0qj67_90348_c1_499_1104 201
908 3300050510 nmdc:mga06r32_146310_c1 nmdc:mga06r32_146310_c1_288_893 201
909 3300050511 nmdc:mga08y16_461826_c1 nmdc:mga08y16_461826_c1_49_654 201
910 3300050512 nmdc:mga0n895_229995_c1 nmdc:mga0n895_229995_c1_1021_1626 201
911 3300050515 nmdc:mga0a205_397311_c1 nmdc:mga0a205_397311_c1_93_698 201
912 3300050515 nmdc:mga0a205_70962_c1 nmdc:mga0a205_70962_c1_1552_2157 201
913 3300054114 Ga0501084_0065265 Ga0501084_0065265_557_1162 201
914 3300060353 Ga0501082_0233859 Ga0501082_0233859_526_1131 201
915 3300060353 Ga0501082_1099916 Ga0501082_1099916_51_656 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

192

215

0.99

PF13662

Toprim_4

Toprim domain

99

190

0.98

PF21176

RecR_HhH

RecR, helix-hairpin-helix

24

68

0.96

PF01751

Toprim

Toprim domain

100

189

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9519 82 173
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9419 82 173
8ab0-assembly1.cif.gz_F complex of reco-recr-dna from thermus thermophilus. 0.904 4 169
8ab0-assembly1.cif.gz_F complex of reco-recr-dna from thermus thermophilus. 0.8875 4 169
8a93-assembly1.cif.gz_D complex of recf-recr-dna from thermus thermophilus. 0.8859 4 47
ID Description Score Start End Superfamily
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9883 79 200 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9803 79 200 3.40.1360.10
1vddB01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9736 4 53 1.10.8.420
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9724 79 172 3.40.1360.10
3vdpB01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9682 4 52 1.10.8.420
ID Description Score Start End GO Terms
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.9892 60 157 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9889 73 175 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A7X3ZD69-F1-model_v4 Recombination protein RecR 0.9874 2 92 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A7X8Z779-F1-model_v4 Recombination protein RecR 0.9739 2 160 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-W1XYN8-F1-model_v4 Recombination protein RecR 0.9733 40 154 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.63 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map