F485599
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 915 | 318 | 893 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0835150|Ga0451577_0835150_60_713 |
| Length | 217 |
| Sequence | LEDLNFQTFQLANFQTLMLLPESIQSLINALERLPGIGPKSASRLAFYLLRATDDVSDDLALALAHLKKNTAFCQECFNITEAGRERCEVCESPKRDIGVICVVEEALDVLALERTGGFQGKYHVLQGVLSPIEGIGPDDLKIKQLVARVAGGGVKEIILATNPSMEGDATALYLRQQLEPLGVRVTRLARGLPMGGDLEYADQNTLLRALSGRQEM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 3 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 4 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 5 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 6 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 7 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 8 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 9 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 10 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 11 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 12 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 13 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 14 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 15 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 16 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 17 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 18 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 19 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 20 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 179 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 182 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 196 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 197 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 198 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 212 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 213 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 214 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 215 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 216 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 217 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 218 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 219 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 222 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 223 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 224 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 226 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 227 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 228 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 229 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 230 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 231 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 232 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 291 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 293 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 294 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 311 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 312 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 313 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 315 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 316 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 317 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 318 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.6 |
| Metatranscriptomes | 0 |
| Isolates | 2.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.11 |
| Rhizoplane | 6.01 |
| Rhizosphere | 91.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2348821 | 2162886007 | Bacteria | 10295 |
| 2 | JGI25406J46586_10003441 | 3300003203 | Bacteria | 7446 |
| 3 | Ga0065704_10134448 | 3300005289 | Bacteria | 1588 |
| 4 | Ga0065707_10000534 | 3300005295 | Bacteria | 41079 |
| 5 | Ga0065707_10013151 | 3300005295 | Bacteria | 1802 |
| 6 | Ga0065707_10084320 | 3300005295 | Bacteria | 7347 |
| 7 | Ga0065707_10086250 | 3300005295 | Bacteria | 5573 |
| 8 | Ga0065707_10088820 | 3300005295 | Bacteria | 4544 |
| 9 | Ga0065707_10141701 | 3300005295 | Bacteria | 1764 |
| 10 | Ga0065707_10358976 | 3300005295 | Bacteria | 907 |
| 11 | Ga0070676_10465125 | 3300005328 | Bacteria | 892 |
| 12 | Ga0070683_100115483 | 3300005329 | Bacteria | 2534 |
| 13 | Ga0070683_100271823 | 3300005329 | Bacteria | 1612 |
| 14 | Ga0070683_100505106 | 3300005329 | Bacteria | 1155 |
| 15 | Ga0070690_100212680 | 3300005330 | Bacteria | 1351 |
| 16 | Ga0070670_100361242 | 3300005331 | Bacteria | 1277 |
| 17 | Ga0068869_100322214 | 3300005334 | Bacteria | 1254 |
| 18 | Ga0068869_100646652 | 3300005334 | Bacteria | 897 |
| 19 | Ga0070666_10021013 | 3300005335 | Bacteria | 4227 |
| 20 | Ga0070680_100026468 | 3300005336 | Bacteria | 4639 |
| 21 | Ga0070680_100160301 | 3300005336 | Bacteria | 1890 |
| 22 | Ga0070680_100449132 | 3300005336 | Unclassified | 1101 |
| 23 | Ga0070682_100467703 | 3300005337 | Bacteria | 970 |
| 24 | Ga0070682_100934053 | 3300005337 | Bacteria | 715 |
| 25 | Ga0070660_100342902 | 3300005339 | Unclassified | 1229 |
| 26 | Ga0070689_100036265 | 3300005340 | Unclassified | 3771 |
| 27 | Ga0070689_100077762 | 3300005340 | Bacteria | 2601 |
| 28 | Ga0070691_10033186 | 3300005341 | Bacteria | 2428 |
| 29 | Ga0070691_10073913 | 3300005341 | Unclassified | 1658 |
| 30 | Ga0070668_100088259 | 3300005347 | Bacteria | 2441 |
| 31 | Ga0070668_100875506 | 3300005347 | Bacteria | 802 |
| 32 | Ga0070669_100119875 | 3300005353 | Bacteria | 2005 |
| 33 | Ga0070675_100115937 | 3300005354 | Bacteria | 2271 |
| 34 | Ga0070674_100016428 | 3300005356 | Bacteria | 4638 |
| 35 | Ga0070674_100149071 | 3300005356 | Bacteria | 1763 |
| 36 | Ga0070673_100039952 | 3300005364 | Bacteria | 3595 |
| 37 | Ga0070673_100583836 | 3300005364 | Unclassified | 1018 |
| 38 | Ga0070659_100120242 | 3300005366 | Unclassified | 2127 |
| 39 | Ga0070659_100875949 | 3300005366 | Bacteria | 784 |
| 40 | Ga0070703_10018711 | 3300005406 | Bacteria | 2005 |
| 41 | Ga0070703_10072110 | 3300005406 | Bacteria | 1156 |
| 42 | Ga0070714_100000067 | 3300005435 | Bacteria | 95377 |
| 43 | Ga0070713_100238053 | 3300005436 | Bacteria | 1657 |
| 44 | Ga0070701_10072275 | 3300005438 | Bacteria | 1847 |
| 45 | Ga0070701_10253151 | 3300005438 | Bacteria | 1064 |
| 46 | Ga0070711_100034032 | 3300005439 | Bacteria | 3397 |
| 47 | Ga0070711_100670425 | 3300005439 | Bacteria | 871 |
| 48 | Ga0070705_100054393 | 3300005440 | Bacteria | 2348 |
| 49 | Ga0070705_100178734 | 3300005440 | Unclassified | 1435 |
| 50 | Ga0070705_100194168 | 3300005440 | Bacteria | 1386 |
| 51 | Ga0070705_100295623 | 3300005440 | Bacteria | 1158 |
| 52 | Ga0070705_100961505 | 3300005440 | Bacteria | 691 |
| 53 | Ga0070694_100054762 | 3300005444 | Bacteria | 2703 |
| 54 | Ga0070694_100192983 | 3300005444 | Bacteria | 1513 |
| 55 | Ga0070694_100281309 | 3300005444 | Bacteria | 1268 |
| 56 | Ga0070694_100636319 | 3300005444 | Archaea | 862 |
| 57 | Ga0070708_100009481 | 3300005445 | Bacteria | 7847 |
| 58 | Ga0070708_100079412 | 3300005445 | Bacteria | 2968 |
| 59 | Ga0070708_100145472 | 3300005445 | Bacteria | 2201 |
| 60 | Ga0070708_100180664 | 3300005445 | Bacteria | 1972 |
| 61 | Ga0070708_100325341 | 3300005445 | Bacteria | 1448 |
| 62 | Ga0070708_100354828 | 3300005445 | Bacteria | 1382 |
| 63 | Ga0070708_100627083 | 3300005445 | Unclassified | 1013 |
| 64 | Ga0070708_100765297 | 3300005445 | Unclassified | 908 |
| 65 | Ga0070663_100325203 | 3300005455 | Bacteria | 1238 |
| 66 | Ga0070678_100011829 | 3300005456 | Bacteria | 5399 |
| 67 | Ga0070662_100000175 | 3300005457 | Bacteria | 37363 |
| 68 | Ga0070681_10106027 | 3300005458 | Bacteria | 2752 |
| 69 | Ga0068867_100968143 | 3300005459 | Unclassified | 770 |
| 70 | Ga0070706_100001060 | 3300005467 | Bacteria | 29793 |
| 71 | Ga0070706_100067957 | 3300005467 | Bacteria | 3295 |
| 72 | Ga0070706_100258043 | 3300005467 | Bacteria | 1627 |
| 73 | Ga0070706_100448758 | 3300005467 | Unclassified | 1200 |
| 74 | Ga0070706_100537284 | 3300005467 | Unclassified | 1087 |
| 75 | Ga0070706_100607832 | 3300005467 | Bacteria | 1016 |
| 76 | Ga0070707_100242914 | 3300005468 | Bacteria | 1752 |
| 77 | Ga0070707_100448094 | 3300005468 | Unclassified | 1251 |
| 78 | Ga0070707_100658805 | 3300005468 | Unclassified | 1009 |
| 79 | Ga0070707_100899774 | 3300005468 | Bacteria | 850 |
| 80 | Ga0070707_101135074 | 3300005468 | Bacteria | 747 |
| 81 | Ga0070698_100000782 | 3300005471 | Bacteria | 34479 |
| 82 | Ga0070698_100043703 | 3300005471 | Bacteria | 4592 |
| 83 | Ga0070698_100076693 | 3300005471 | Bacteria | 3344 |
| 84 | Ga0070698_100113587 | 3300005471 | Bacteria | 2673 |
| 85 | Ga0070698_100608205 | 3300005471 | Unclassified | 1033 |
| 86 | Ga0070699_100013854 | 3300005518 | Bacteria | 6935 |
| 87 | Ga0070699_100021018 | 3300005518 | Bacteria | 5627 |
| 88 | Ga0070699_100024326 | 3300005518 | Bacteria | 5219 |
| 89 | Ga0070699_100146642 | 3300005518 | Bacteria | 2085 |
| 90 | Ga0070699_100252969 | 3300005518 | Bacteria | 1574 |
| 91 | Ga0070699_100386567 | 3300005518 | Bacteria | 1264 |
| 92 | Ga0070699_100541860 | 3300005518 | Bacteria | 1059 |
| 93 | Ga0070699_100595732 | 3300005518 | Bacteria | 1008 |
| 94 | Ga0070679_100011448 | 3300005530 | Bacteria | 8455 |
| 95 | Ga0070679_100440650 | 3300005530 | Bacteria | 1247 |
| 96 | Ga0070684_100342690 | 3300005535 | Bacteria | 1374 |
| 97 | Ga0070697_100170097 | 3300005536 | Bacteria | 1844 |
| 98 | Ga0070697_100379975 | 3300005536 | Unclassified | 1223 |
| 99 | Ga0068853_100144092 | 3300005539 | Bacteria | 2140 |
| 100 | Ga0068853_100199380 | 3300005539 | Bacteria | 1821 |
| 101 | Ga0068853_100326296 | 3300005539 | Bacteria | 1424 |
| 102 | Ga0068853_100514436 | 3300005539 | Unclassified | 1131 |
| 103 | Ga0068853_100526443 | 3300005539 | Unclassified | 1118 |
| 104 | Ga0070672_100174328 | 3300005543 | Bacteria | 1790 |
| 105 | Ga0070672_100331102 | 3300005543 | Bacteria | 1295 |
| 106 | Ga0070672_100776818 | 3300005543 | Unclassified | 842 |
| 107 | Ga0070686_100020095 | 3300005544 | Bacteria | 3949 |
| 108 | Ga0070695_100023736 | 3300005545 | Bacteria | 3775 |
| 109 | Ga0070695_100175407 | 3300005545 | Bacteria | 1515 |
| 110 | Ga0070695_100893224 | 3300005545 | Bacteria | 717 |
| 111 | Ga0070696_100041490 | 3300005546 | Bacteria | 3179 |
| 112 | Ga0070696_100120100 | 3300005546 | Bacteria | 1902 |
| 113 | Ga0070696_100255683 | 3300005546 | Unclassified | 1326 |
| 114 | Ga0070696_100307424 | 3300005546 | Bacteria | 1216 |
| 115 | Ga0070696_100451007 | 3300005546 | Bacteria | 1015 |
| 116 | Ga0070696_101068549 | 3300005546 | Bacteria | 677 |
| 117 | Ga0070693_100093441 | 3300005547 | Bacteria | 1818 |
| 118 | Ga0070665_100110766 | 3300005548 | Bacteria | 2748 |
| 119 | Ga0070665_100217308 | 3300005548 | Bacteria | 1912 |
| 120 | Ga0070665_100370835 | 3300005548 | Bacteria | 1438 |
| 121 | Ga0070704_100014384 | 3300005549 | Bacteria | 4941 |
| 122 | Ga0068855_100428231 | 3300005563 | Bacteria | 1446 |
| 123 | Ga0070664_100003171 | 3300005564 | Bacteria | 13283 |
| 124 | Ga0068854_100000312 | 3300005578 | Bacteria | 32026 |
| 125 | Ga0068854_100271298 | 3300005578 | Bacteria | 1362 |
| 126 | Ga0068856_100033924 | 3300005614 | Bacteria | 4998 |
| 127 | Ga0070702_100125186 | 3300005615 | Bacteria | 1615 |
| 128 | Ga0070702_100349563 | 3300005615 | Unclassified | 1041 |
| 129 | Ga0068859_100148675 | 3300005617 | Bacteria | 2418 |
| 130 | Ga0068859_100267092 | 3300005617 | Bacteria | 1803 |
| 131 | Ga0068859_100485630 | 3300005617 | Bacteria | 1331 |
| 132 | Ga0068859_101414743 | 3300005617 | Unclassified | 767 |
| 133 | Ga0068859_102019998 | 3300005617 | Unclassified | 637 |
| 134 | Ga0068864_100084812 | 3300005618 | Bacteria | 2784 |
| 135 | Ga0068864_100569198 | 3300005618 | Bacteria | 1097 |
| 136 | Ga0068864_101446374 | 3300005618 | Unclassified | 690 |
| 137 | Ga0068864_101552906 | 3300005618 | Unclassified | 665 |
| 138 | Ga0068866_10001272 | 3300005718 | Bacteria | 10924 |
| 139 | Ga0068861_100076406 | 3300005719 | Bacteria | 2610 |
| 140 | Ga0068861_100210320 | 3300005719 | Bacteria | 1638 |
| 141 | Ga0068861_100691690 | 3300005719 | Bacteria | 947 |
| 142 | Ga0068863_100664845 | 3300005841 | Bacteria | 1034 |
| 143 | Ga0068858_100036613 | 3300005842 | Bacteria | 4549 |
| 144 | Ga0068860_100065014 | 3300005843 | Bacteria | 3464 |
| 145 | Ga0068862_100032711 | 3300005844 | Bacteria | 4393 |
| 146 | Ga0068862_100064965 | 3300005844 | Unclassified | 3142 |
| 147 | Ga0068862_100108951 | 3300005844 | Unclassified | 2429 |
| 148 | Ga0068862_100561865 | 3300005844 | Unclassified | 1091 |
| 149 | Ga0068862_100680186 | 3300005844 | Bacteria | 995 |
| 150 | Ga0081539_10007668 | 3300005985 | Bacteria | 9706 |
| 151 | Ga0081539_10180017 | 3300005985 | Bacteria | 992 |
| 152 | Ga0070717_10023259 | 3300006028 | Bacteria | 4908 |
| 153 | Ga0070716_100036618 | 3300006173 | Bacteria | 2706 |
| 154 | Ga0070716_100116911 | 3300006173 | Bacteria | 1663 |
| 155 | Ga0070712_100009514 | 3300006175 | Bacteria | 6127 |
| 156 | Ga0070712_100145424 | 3300006175 | Bacteria | 1814 |
| 157 | Ga0097621_100661874 | 3300006237 | Bacteria | 959 |
| 158 | Ga0068871_100439763 | 3300006358 | Bacteria | 1167 |
| 159 | Ga0075428_100156802 | 3300006844 | Bacteria | 2472 |
| 160 | Ga0075428_100484481 | 3300006844 | Bacteria | 1324 |
| 161 | Ga0075428_100836756 | 3300006844 | Bacteria | 977 |
| 162 | Ga0075431_100010382 | 3300006847 | Bacteria | 9357 |
| 163 | Ga0075431_100174887 | 3300006847 | Bacteria | 2205 |
| 164 | Ga0075433_10090778 | 3300006852 | Bacteria | 2700 |
| 165 | Ga0075433_10111882 | 3300006852 | Bacteria | 2422 |
| 166 | Ga0075433_10125566 | 3300006852 | Bacteria | 2279 |
| 167 | Ga0075433_10343770 | 3300006852 | Bacteria | 1319 |
| 168 | Ga0075434_100160198 | 3300006871 | Unclassified | 2270 |
| 169 | Ga0075434_100183518 | 3300006871 | Bacteria | 2113 |
| 170 | Ga0075434_100196783 | 3300006871 | Bacteria | 2035 |
| 171 | Ga0075434_100231108 | 3300006871 | Bacteria | 1869 |
| 172 | Ga0075429_100009321 | 3300006880 | Bacteria | 8523 |
| 173 | Ga0075429_100020232 | 3300006880 | Bacteria | 5771 |
| 174 | Ga0075429_100113319 | 3300006880 | Bacteria | 2370 |
| 175 | Ga0075429_100122470 | 3300006880 | Unclassified | 2274 |
| 176 | Ga0075429_100167191 | 3300006880 | Bacteria | 1926 |
| 177 | Ga0075429_100249161 | 3300006880 | Unclassified | 1555 |
| 178 | Ga0068865_100003121 | 3300006881 | Bacteria | 9909 |
| 179 | Ga0097620_100148690 | 3300006931 | Bacteria | 2418 |
| 180 | Ga0097620_100267096 | 3300006931 | Bacteria | 1803 |
| 181 | Ga0097620_100485633 | 3300006931 | Bacteria | 1331 |
| 182 | Ga0097620_101414102 | 3300006931 | Unclassified | 767 |
| 183 | Ga0097620_102020044 | 3300006931 | Unclassified | 637 |
| 184 | Ga0075435_100074302 | 3300007076 | Bacteria | 2780 |
| 185 | Ga0075435_100228132 | 3300007076 | Bacteria | 1582 |
| 186 | Ga0075435_100347210 | 3300007076 | Bacteria | 1272 |
| 187 | Ga0105240_10137190 | 3300009093 | Bacteria | 2929 |
| 188 | Ga0111539_10104065 | 3300009094 | Bacteria | 3331 |
| 189 | Ga0111539_10143028 | 3300009094 | Bacteria | 2800 |
| 190 | Ga0111539_10188061 | 3300009094 | Bacteria | 2411 |
| 191 | Ga0105245_10145200 | 3300009098 | Bacteria | 2238 |
| 192 | Ga0114129_10010107 | 3300009147 | Bacteria | 13454 |
| 193 | Ga0114129_10021191 | 3300009147 | Bacteria | 9231 |
| 194 | Ga0114129_10029164 | 3300009147 | Bacteria | 7817 |
| 195 | Ga0114129_10078848 | 3300009147 | Bacteria | 4580 |
| 196 | Ga0114129_10117940 | 3300009147 | Bacteria | 3656 |
| 197 | Ga0114129_10146934 | 3300009147 | Bacteria | 3229 |
| 198 | Ga0114129_10239225 | 3300009147 | Bacteria | 2441 |
| 199 | Ga0114129_10243733 | 3300009147 | Bacteria | 2415 |
| 200 | Ga0114129_10278551 | 3300009147 | Bacteria | 2235 |
| 201 | Ga0114129_10290366 | 3300009147 | Unclassified | 2182 |
| 202 | Ga0114129_10531447 | 3300009147 | Unclassified | 1532 |
| 203 | Ga0114129_11609996 | 3300009147 | Bacteria | 795 |
| 204 | Ga0114129_11707085 | 3300009147 | Bacteria | 768 |
| 205 | Ga0105243_10005127 | 3300009148 | Bacteria | 10276 |
| 206 | Ga0105243_10065680 | 3300009148 | Bacteria | 2915 |
| 207 | Ga0105243_10305125 | 3300009148 | Bacteria | 1444 |
| 208 | Ga0105241_10032989 | 3300009174 | Bacteria | 3885 |
| 209 | Ga0105241_10205417 | 3300009174 | Bacteria | 1648 |
| 210 | Ga0105241_10214673 | 3300009174 | Bacteria | 1614 |
| 211 | Ga0105242_10112499 | 3300009176 | Bacteria | 2323 |
| 212 | Ga0105248_10201677 | 3300009177 | Unclassified | 2241 |
| 213 | Ga0105237_10189306 | 3300009545 | Bacteria | 2058 |
| 214 | Ga0105237_10274250 | 3300009545 | Bacteria | 1689 |
| 215 | Ga0105238_10290619 | 3300009551 | Bacteria | 1617 |
| 216 | Ga0105249_10142928 | 3300009553 | Bacteria | 2296 |
| 217 | Ga0105249_10143739 | 3300009553 | Bacteria | 2290 |
| 218 | Ga0105249_10198590 | 3300009553 | Bacteria | 1962 |
| 219 | Ga0105249_10212704 | 3300009553 | Bacteria | 1898 |
| 220 | Ga0105249_10283104 | 3300009553 | Bacteria | 1657 |
| 221 | Ga0105249_10478027 | 3300009553 | Bacteria | 1288 |
| 222 | Ga0105249_11099261 | 3300009553 | Unclassified | 865 |
| 223 | Ga0105239_10042512 | 3300010375 | Bacteria | 4980 |
| 224 | Ga0105239_10135905 | 3300010375 | Bacteria | 2737 |
| 225 | Ga0105239_10191973 | 3300010375 | Unclassified | 2286 |
| 226 | Ga0105246_10002516 | 3300011119 | Bacteria | 11081 |
| 227 | Ga0105246_10048892 | 3300011119 | Bacteria | 2893 |
| 228 | Ga0105246_10741936 | 3300011119 | Bacteria | 865 |
| 229 | Ga0157375_10730471 | 3300013308 | Unclassified | 1142 |
| 230 | Ga0157380_10140187 | 3300014326 | Unclassified | 2076 |
| 231 | Ga0157380_10259749 | 3300014326 | Bacteria | 1577 |
| 232 | Ga0157377_10238608 | 3300014745 | Bacteria | 1172 |
| 233 | Ga0157377_10364569 | 3300014745 | Unclassified | 973 |
| 234 | Ga0157379_10045576 | 3300014968 | Bacteria | 3913 |
| 235 | Ga0157379_10296718 | 3300014968 | Bacteria | 1473 |
| 236 | Ga0157379_10407418 | 3300014968 | Bacteria | 1251 |
| 237 | Ga0157376_10198018 | 3300014969 | Bacteria | 1846 |
| 238 | Ga0213875_10046672 | 3300021388 | Bacteria | 2032 |
| 239 | Ga0207697_10146951 | 3300025315 | Bacteria | 1024 |
| 240 | Ga0207653_10029888 | 3300025885 | Bacteria | 1756 |
| 241 | Ga0207653_10180235 | 3300025885 | Bacteria | 790 |
| 242 | Ga0207685_10019627 | 3300025905 | Bacteria | 2231 |
| 243 | Ga0207645_10306816 | 3300025907 | Bacteria | 1057 |
| 244 | Ga0207684_10000159 | 3300025910 | Bacteria | 115668 |
| 245 | Ga0207684_10049454 | 3300025910 | Bacteria | 3566 |
| 246 | Ga0207684_10081808 | 3300025910 | Bacteria | 2749 |
| 247 | Ga0207684_10123993 | 3300025910 | Bacteria | 2216 |
| 248 | Ga0207684_10501854 | 3300025910 | Bacteria | 1040 |
| 249 | Ga0207684_10635453 | 3300025910 | Bacteria | 910 |
| 250 | Ga0207654_10146087 | 3300025911 | Bacteria | 1513 |
| 251 | Ga0207654_10204764 | 3300025911 | Bacteria | 1301 |
| 252 | Ga0207707_10006178 | 3300025912 | Bacteria | 10463 |
| 253 | Ga0207707_10011727 | 3300025912 | Bacteria | 7628 |
| 254 | Ga0207707_10559145 | 3300025912 | Unclassified | 971 |
| 255 | Ga0207695_10144179 | 3300025913 | Bacteria | 2327 |
| 256 | Ga0207663_10039433 | 3300025916 | Bacteria | 2862 |
| 257 | Ga0207660_10021979 | 3300025917 | Bacteria | 4295 |
| 258 | Ga0207660_10553989 | 3300025917 | Unclassified | 935 |
| 259 | Ga0207657_10109049 | 3300025919 | Bacteria | 2288 |
| 260 | Ga0207649_10321257 | 3300025920 | Unclassified | 1137 |
| 261 | Ga0207652_10048218 | 3300025921 | Bacteria | 3641 |
| 262 | Ga0207652_10607046 | 3300025921 | Bacteria | 981 |
| 263 | Ga0207646_10015191 | 3300025922 | Bacteria | 7283 |
| 264 | Ga0207646_10088117 | 3300025922 | Bacteria | 2777 |
| 265 | Ga0207646_10228718 | 3300025922 | Bacteria | 1680 |
| 266 | Ga0207646_10497955 | 3300025922 | Bacteria | 1098 |
| 267 | Ga0207646_10770538 | 3300025922 | Bacteria | 858 |
| 268 | Ga0207646_10827365 | 3300025922 | Bacteria | 824 |
| 269 | Ga0207681_10259671 | 3300025923 | Bacteria | 1359 |
| 270 | Ga0207681_10429921 | 3300025923 | Unclassified | 1071 |
| 271 | Ga0207659_10160920 | 3300025926 | Bacteria | 1762 |
| 272 | Ga0207659_10619584 | 3300025926 | Bacteria | 923 |
| 273 | Ga0207700_10076419 | 3300025928 | Bacteria | 2598 |
| 274 | Ga0207700_10494508 | 3300025928 | Bacteria | 1082 |
| 275 | Ga0207664_10000005 | 3300025929 | Bacteria | 485048 |
| 276 | Ga0207706_10000848 | 3300025933 | Bacteria | 31450 |
| 277 | Ga0207706_10269607 | 3300025933 | Bacteria | 1485 |
| 278 | Ga0207686_10000201 | 3300025934 | Bacteria | 45929 |
| 279 | Ga0207709_10011036 | 3300025935 | Bacteria | 4980 |
| 280 | Ga0207670_10065960 | 3300025936 | Bacteria | 2486 |
| 281 | Ga0207670_10423173 | 3300025936 | Unclassified | 1069 |
| 282 | Ga0207669_10000885 | 3300025937 | Bacteria | 12673 |
| 283 | Ga0207669_10276102 | 3300025937 | Unclassified | 1265 |
| 284 | Ga0207704_10002345 | 3300025938 | Bacteria | 8502 |
| 285 | Ga0207665_10201555 | 3300025939 | Bacteria | 1450 |
| 286 | Ga0207665_10360195 | 3300025939 | Bacteria | 1100 |
| 287 | Ga0207691_10154637 | 3300025940 | Unclassified | 2015 |
| 288 | Ga0207691_10164759 | 3300025940 | Bacteria | 1943 |
| 289 | Ga0207691_10288999 | 3300025940 | Bacteria | 1410 |
| 290 | Ga0207711_10006077 | 3300025941 | Bacteria | 10202 |
| 291 | Ga0207711_10154980 | 3300025941 | Unclassified | 2070 |
| 292 | Ga0207689_10173239 | 3300025942 | Bacteria | 1779 |
| 293 | Ga0207689_10359911 | 3300025942 | Bacteria | 1210 |
| 294 | Ga0207661_10427868 | 3300025944 | Bacteria | 1203 |
| 295 | Ga0207679_10018043 | 3300025945 | Bacteria | 4718 |
| 296 | Ga0207679_10034422 | 3300025945 | Bacteria | 3573 |
| 297 | Ga0207679_10083650 | 3300025945 | Bacteria | 2446 |
| 298 | Ga0207679_10097168 | 3300025945 | Bacteria | 2293 |
| 299 | Ga0207667_10432950 | 3300025949 | Bacteria | 1338 |
| 300 | Ga0207712_10008379 | 3300025961 | Bacteria | 6532 |
| 301 | Ga0207712_10020882 | 3300025961 | Bacteria | 4295 |
| 302 | Ga0207712_10085765 | 3300025961 | Bacteria | 2305 |
| 303 | Ga0207712_10117842 | 3300025961 | Bacteria | 2003 |
| 304 | Ga0207712_10435190 | 3300025961 | Bacteria | 1109 |
| 305 | Ga0207668_10048982 | 3300025972 | Bacteria | 2902 |
| 306 | Ga0207668_10250138 | 3300025972 | Bacteria | 1439 |
| 307 | Ga0207640_10007499 | 3300025981 | Bacteria | 6026 |
| 308 | Ga0207658_10057435 | 3300025986 | Bacteria | 2892 |
| 309 | Ga0207703_10088690 | 3300026035 | Bacteria | 2596 |
| 310 | Ga0207703_11268826 | 3300026035 | Bacteria | 708 |
| 311 | Ga0207639_10486911 | 3300026041 | Unclassified | 1125 |
| 312 | Ga0207639_10631223 | 3300026041 | Bacteria | 990 |
| 313 | Ga0207639_10969204 | 3300026041 | Unclassified | 796 |
| 314 | Ga0207678_10145048 | 3300026067 | Bacteria | 2026 |
| 315 | Ga0207678_10272391 | 3300026067 | Unclassified | 1452 |
| 316 | Ga0207708_10204179 | 3300026075 | Bacteria | 1577 |
| 317 | Ga0207641_10835392 | 3300026088 | Bacteria | 912 |
| 318 | Ga0207648_10756722 | 3300026089 | Unclassified | 902 |
| 319 | Ga0207676_10131003 | 3300026095 | Bacteria | 2132 |
| 320 | Ga0207676_10536291 | 3300026095 | Bacteria | 1116 |
| 321 | Ga0207674_10316977 | 3300026116 | Unclassified | 1508 |
| 322 | Ga0207675_100056569 | 3300026118 | Bacteria | 3659 |
| 323 | Ga0207675_100222674 | 3300026118 | Bacteria | 1818 |
| 324 | Ga0207675_100284184 | 3300026118 | Bacteria | 1608 |
| 325 | Ga0207675_100533773 | 3300026118 | Unclassified | 1171 |
| 326 | Ga0207683_10018893 | 3300026121 | Bacteria | 5880 |
| 327 | Ga0209995_1010399 | 3300027471 | Bacteria | 1509 |
| 328 | Ga0209970_1005970 | 3300027614 | Bacteria | 1999 |
| 329 | Ga0209966_1006415 | 3300027695 | Bacteria | 2041 |
| 330 | Ga0209974_10007755 | 3300027876 | Bacteria | 3690 |
| 331 | Ga0268266_10082293 | 3300028379 | Bacteria | 2808 |
| 332 | Ga0268265_10073673 | 3300028380 | Unclassified | 2668 |
| 333 | Ga0268265_10089853 | 3300028380 | Bacteria | 2452 |
| 334 | Ga0268265_10217107 | 3300028380 | Bacteria | 1670 |
| 335 | Ga0268265_10339237 | 3300028380 | Unclassified | 1368 |
| 336 | Ga0268265_10659992 | 3300028380 | Bacteria | 1006 |
| 337 | Ga0268264_10040037 | 3300028381 | Bacteria | 3872 |
| 338 | Ga0268264_10669913 | 3300028381 | Bacteria | 1028 |
| 339 | Ga0265326_10013118 | 3300028558 | Bacteria | 2427 |
| 340 | Ga0265319_1105946 | 3300028563 | Unclassified | 881 |
| 341 | Ga0265318_10006693 | 3300028577 | Bacteria | 5279 |
| 342 | Ga0265338_10019132 | 3300028800 | Bacteria | 7288 |
| 343 | Ga0265338_10033218 | 3300028800 | Bacteria | 5012 |
| 344 | Ga0265324_10097390 | 3300029957 | Unclassified | 1000 |
| 345 | Ga0316182_1284667 | 3300030745 | Bacteria | 852 |
| 346 | Ga0265320_10017108 | 3300031240 | Bacteria | 4038 |
| 347 | Ga0265340_10000496 | 3300031247 | Bacteria | 21514 |
| 348 | Ga0265331_10003063 | 3300031250 | Bacteria | 10964 |
| 349 | Ga0265327_10029297 | 3300031251 | Bacteria | 3133 |
| 350 | Ga0265316_10022181 | 3300031344 | Bacteria | 5362 |
| 351 | Ga0265316_10250679 | 3300031344 | Bacteria | 1300 |
| 352 | Ga0307408_100030877 | 3300031548 | Bacteria | 3725 |
| 353 | Ga0307408_100100038 | 3300031548 | Unclassified | 2207 |
| 354 | Ga0307408_100128545 | 3300031548 | Bacteria | 1974 |
| 355 | Ga0307408_100752092 | 3300031548 | Unclassified | 880 |
| 356 | Ga0316575_10029238 | 3300031665 | Bacteria | 2151 |
| 357 | Ga0316575_10056419 | 3300031665 | Bacteria | 1565 |
| 358 | Ga0316575_10067288 | 3300031665 | Unclassified | 1436 |
| 359 | Ga0316579_10018952 | 3300031691 | Bacteria | 3035 |
| 360 | Ga0316579_10029713 | 3300031691 | Bacteria | 2494 |
| 361 | Ga0316579_10030624 | 3300031691 | Bacteria | 2460 |
| 362 | Ga0316579_10048627 | 3300031691 | Bacteria | 1981 |
| 363 | Ga0316579_10089369 | 3300031691 | Bacteria | 1470 |
| 364 | Ga0265314_10179587 | 3300031711 | Bacteria | 1270 |
| 365 | Ga0316576_10007136 | 3300031727 | Bacteria | 7007 |
| 366 | Ga0316576_10015588 | 3300031727 | Bacteria | 5106 |
| 367 | Ga0316576_10058536 | 3300031727 | Bacteria | 2819 |
| 368 | Ga0316576_10081950 | 3300031727 | Bacteria | 2395 |
| 369 | Ga0316576_10084279 | 3300031727 | Bacteria | 2362 |
| 370 | Ga0316576_10125227 | 3300031727 | Bacteria | 1931 |
| 371 | Ga0316576_10292374 | 3300031727 | Bacteria | 1219 |
| 372 | Ga0316576_10345877 | 3300031727 | Unclassified | 1107 |
| 373 | Ga0316576_10418355 | 3300031727 | Bacteria | 992 |
| 374 | Ga0316576_10468535 | 3300031727 | Bacteria | 929 |
| 375 | Ga0316576_10791688 | 3300031727 | Bacteria | 683 |
| 376 | Ga0316576_10798224 | 3300031727 | Unclassified | 680 |
| 377 | Ga0316578_10001246 | 3300031728 | Bacteria | 10145 |
| 378 | Ga0316578_10012349 | 3300031728 | Bacteria | 4502 |
| 379 | Ga0316578_10014345 | 3300031728 | Bacteria | 4230 |
| 380 | Ga0316578_10073604 | 3300031728 | Bacteria | 2025 |
| 381 | Ga0316578_10085971 | 3300031728 | Bacteria | 1874 |
| 382 | Ga0316578_10116905 | 3300031728 | Bacteria | 1602 |
| 383 | Ga0316578_10156744 | 3300031728 | Bacteria | 1372 |
| 384 | Ga0316578_10360432 | 3300031728 | Unclassified | 865 |
| 385 | Ga0307405_10010387 | 3300031731 | Bacteria | 4821 |
| 386 | Ga0307405_10015832 | 3300031731 | Bacteria | 4095 |
| 387 | Ga0307405_10316366 | 3300031731 | Bacteria | 1190 |
| 388 | Ga0307405_10513619 | 3300031731 | Unclassified | 963 |
| 389 | Ga0316577_10005627 | 3300031733 | Bacteria | 6578 |
| 390 | Ga0316577_10007877 | 3300031733 | Bacteria | 5687 |
| 391 | Ga0316577_10008151 | 3300031733 | Bacteria | 5604 |
| 392 | Ga0316577_10017018 | 3300031733 | Bacteria | 4012 |
| 393 | Ga0316577_10022869 | 3300031733 | Bacteria | 3472 |
| 394 | Ga0316577_10029358 | 3300031733 | Bacteria | 3069 |
| 395 | Ga0316577_10220244 | 3300031733 | Bacteria | 1073 |
| 396 | Ga0316577_10285354 | 3300031733 | Unclassified | 935 |
| 397 | Ga0316577_10367095 | 3300031733 | Bacteria | 817 |
| 398 | Ga0307413_10010848 | 3300031824 | Bacteria | 4445 |
| 399 | Ga0307413_10011241 | 3300031824 | Bacteria | 4390 |
| 400 | Ga0307413_10020474 | 3300031824 | Bacteria | 3519 |
| 401 | Ga0307413_10026919 | 3300031824 | Bacteria | 3177 |
| 402 | Ga0307413_10068690 | 3300031824 | Bacteria | 2220 |
| 403 | Ga0307413_10108119 | 3300031824 | Bacteria | 1855 |
| 404 | Ga0307413_10228898 | 3300031824 | Bacteria | 1364 |
| 405 | Ga0307410_10001224 | 3300031852 | Bacteria | 11400 |
| 406 | Ga0307410_10001448 | 3300031852 | Bacteria | 10712 |
| 407 | Ga0307410_10023400 | 3300031852 | Bacteria | 3839 |
| 408 | Ga0307410_10046243 | 3300031852 | Bacteria | 2903 |
| 409 | Ga0307410_10189333 | 3300031852 | Bacteria | 1563 |
| 410 | Ga0307410_10414061 | 3300031852 | Bacteria | 1092 |
| 411 | Ga0307406_10024221 | 3300031901 | Bacteria | 3622 |
| 412 | Ga0307406_10047871 | 3300031901 | Bacteria | 2697 |
| 413 | Ga0307406_10064849 | 3300031901 | Unclassified | 2372 |
| 414 | Ga0307406_10092163 | 3300031901 | Bacteria | 2043 |
| 415 | Ga0307406_10226913 | 3300031901 | Bacteria | 1392 |
| 416 | Ga0307406_10388662 | 3300031901 | Bacteria | 1102 |
| 417 | Ga0307407_10003455 | 3300031903 | Bacteria | 6482 |
| 418 | Ga0307407_10006596 | 3300031903 | Bacteria | 5178 |
| 419 | Ga0307407_10012302 | 3300031903 | Bacteria | 4108 |
| 420 | Ga0307407_10014158 | 3300031903 | Bacteria | 3897 |
| 421 | Ga0307407_10032405 | 3300031903 | Bacteria | 2841 |
| 422 | Ga0307407_10122801 | 3300031903 | Bacteria | 1649 |
| 423 | Ga0307407_10156862 | 3300031903 | Bacteria | 1485 |
| 424 | Ga0307407_10362994 | 3300031903 | Bacteria | 1029 |
| 425 | Ga0307412_10016230 | 3300031911 | Bacteria | 4431 |
| 426 | Ga0307412_10095716 | 3300031911 | Bacteria | 2088 |
| 427 | Ga0307409_100003528 | 3300031995 | Bacteria | 8527 |
| 428 | Ga0307409_100016327 | 3300031995 | Bacteria | 4908 |
| 429 | Ga0307409_100051378 | 3300031995 | Bacteria | 3154 |
| 430 | Ga0307409_100062269 | 3300031995 | Bacteria | 2920 |
| 431 | Ga0307409_100134150 | 3300031995 | Bacteria | 2121 |
| 432 | Ga0307409_100343473 | 3300031995 | Bacteria | 1406 |
| 433 | Ga0307409_100388310 | 3300031995 | Bacteria | 1329 |
| 434 | Ga0307409_100471522 | 3300031995 | Bacteria | 1216 |
| 435 | Ga0307409_100934691 | 3300031995 | Bacteria | 882 |
| 436 | Ga0307409_101107001 | 3300031995 | Bacteria | 813 |
| 437 | Ga0307416_100000541 | 3300032002 | Bacteria | 19240 |
| 438 | Ga0307416_100007241 | 3300032002 | Bacteria | 7030 |
| 439 | Ga0307416_100343901 | 3300032002 | Bacteria | 1506 |
| 440 | Ga0307416_100474261 | 3300032002 | Unclassified | 1310 |
| 441 | Ga0307416_100635177 | 3300032002 | Bacteria | 1151 |
| 442 | Ga0307416_100935969 | 3300032002 | Viruses | 968 |
| 443 | Ga0307414_10005050 | 3300032004 | Bacteria | 7228 |
| 444 | Ga0307414_10025824 | 3300032004 | Bacteria | 3769 |
| 445 | Ga0307414_10040556 | 3300032004 | Bacteria | 3146 |
| 446 | Ga0307414_10196999 | 3300032004 | Bacteria | 1635 |
| 447 | Ga0307414_10472672 | 3300032004 | Bacteria | 1104 |
| 448 | Ga0307411_10000173 | 3300032005 | Bacteria | 20758 |
| 449 | Ga0307411_10005030 | 3300032005 | Bacteria | 6431 |
| 450 | Ga0307411_10069195 | 3300032005 | Unclassified | 2383 |
| 451 | Ga0307411_10468139 | 3300032005 | Bacteria | 1058 |
| 452 | Ga0307411_10760663 | 3300032005 | Bacteria | 849 |
| 453 | Ga0307411_10780622 | 3300032005 | Bacteria | 839 |
| 454 | Ga0307415_100000895 | 3300032126 | Bacteria | 13628 |
| 455 | Ga0307415_100067475 | 3300032126 | Bacteria | 2500 |
| 456 | Ga0307415_100141234 | 3300032126 | Bacteria | 1839 |
| 457 | Ga0307415_101180235 | 3300032126 | Bacteria | 720 |
| 458 | Ga0316583_10073276 | 3300032133 | Bacteria | 1198 |
| 459 | Ga0316585_10004967 | 3300032137 | Bacteria | 3739 |
| 460 | Ga0316585_10021498 | 3300032137 | Bacteria | 1982 |
| 461 | Ga0316585_10047429 | 3300032137 | Unclassified | 1376 |
| 462 | Ga0316585_10100968 | 3300032137 | Bacteria | 947 |
| 463 | Ga0373948_0085149 | 3300034817 | Bacteria | 727 |
| 464 | Ga0373950_0094111 | 3300034818 | Unclassified | 639 |
| 465 | Ga0373959_0042392 | 3300034820 | Bacteria | 959 |
| 466 | Ga0373940_0009626 | 3300035088 | Unclassified | 2251 |
| 467 | Ga0373940_0025053 | 3300035088 | Bacteria | 1551 |
| 468 | Ga0373944_0009412 | 3300035089 | Bacteria | 2650 |
| 469 | Ga0373949_0021585 | 3300035090 | Bacteria | 1479 |
| 470 | Ga0373941_0029835 | 3300035115 | Unclassified | 1612 |
| 471 | Ga0373960_0097004 | 3300035121 | Unclassified | 950 |
| 472 | Ga0373943_0029867 | 3300035170 | Bacteria | 2577 |
| 473 | Ga0373961_0047624 | 3300035241 | Bacteria | 1260 |
| 474 | Ga0373961_0071888 | 3300035241 | Bacteria | 1071 |
| 475 | Ga0373962_0092088 | 3300035242 | Bacteria | 935 |
| 476 | Ga0316574_0001564 | 3300035398 | Bacteria | 10935 |
| 477 | Ga0316574_0004212 | 3300035398 | Bacteria | 7503 |
| 478 | Ga0316574_0015481 | 3300035398 | Bacteria | 4426 |
| 479 | Ga0316574_0031035 | 3300035398 | Bacteria | 3240 |
| 480 | Ga0316574_0042804 | 3300035398 | Bacteria | 2796 |
| 481 | Ga0316574_0075215 | 3300035398 | Bacteria | 2138 |
| 482 | Ga0316574_0113155 | 3300035398 | Bacteria | 1740 |
| 483 | Ga0316574_0132380 | 3300035398 | Bacteria | 1605 |
| 484 | Ga0316574_0650722 | 3300035398 | Unclassified | 649 |
| 485 | Ga0373931_0013435 | 3300035691 | Bacteria | 3987 |
| 486 | Ga0373931_0032371 | 3300035691 | Bacteria | 2706 |
| 487 | Ga0373935_0029116 | 3300035692 | Bacteria | 3417 |
| 488 | Ga0316582_0008508 | 3300036647 | Bacteria | 5522 |
| 489 | Ga0316582_0015308 | 3300036647 | Bacteria | 4381 |
| 490 | Ga0316582_0019296 | 3300036647 | Bacteria | 3988 |
| 491 | Ga0316582_0027872 | 3300036647 | Bacteria | 3417 |
| 492 | Ga0316582_0036767 | 3300036647 | Bacteria | 3032 |
| 493 | Ga0316582_0040425 | 3300036647 | Bacteria | 2910 |
| 494 | Ga0316582_0055441 | 3300036647 | Bacteria | 2526 |
| 495 | Ga0316582_0094522 | 3300036647 | Bacteria | 1972 |
| 496 | Ga0316582_0116258 | 3300036647 | Bacteria | 1785 |
| 497 | Ga0316582_0183693 | 3300036647 | Bacteria | 1423 |
| 498 | Ga0316582_0197377 | 3300036647 | Bacteria | 1372 |
| 499 | Ga0316582_0210584 | 3300036647 | Unclassified | 1328 |
| 500 | Ga0316582_0406096 | 3300036647 | Unclassified | 938 |
| 501 | Ga0316582_0450969 | 3300036647 | Bacteria | 887 |
| 502 | Ga0316582_0564491 | 3300036647 | Bacteria | 784 |
| 503 | Ga0316582_0580519 | 3300036647 | Unclassified | 772 |
| 504 | Ga0316584_0002917 | 3300036712 | Bacteria | 10987 |
| 505 | Ga0316584_0004330 | 3300036712 | Bacteria | 9396 |
| 506 | Ga0316584_0004962 | 3300036712 | Bacteria | 8860 |
| 507 | Ga0316584_0015772 | 3300036712 | Bacteria | 5408 |
| 508 | Ga0316584_0022049 | 3300036712 | Bacteria | 4641 |
| 509 | Ga0316584_0049440 | 3300036712 | Bacteria | 3143 |
| 510 | Ga0316584_0228119 | 3300036712 | Bacteria | 1366 |
| 511 | Ga0316584_0247978 | 3300036712 | Bacteria | 1301 |
| 512 | Ga0316581_0003768 | 3300037588 | Unclassified | 3808 |
| 513 | Ga0316581_0015819 | 3300037588 | Bacteria | 2161 |
| 514 | Ga0316581_0027578 | 3300037588 | Bacteria | 1699 |
| 515 | Ga0316581_0033546 | 3300037588 | Bacteria | 1551 |
| 516 | Ga0316581_0033733 | 3300037588 | Bacteria | 1547 |
| 517 | Ga0436364_0918438 | 3300037853 | Unclassified | 3709 |
| 518 | Ga0400490_09994 | 3300038726 | Bacteria | 1167 |
| 519 | Ga0242420_026140 | 3300038996 | Unclassified | 1064 |
| 520 | Ga0242420_027550 | 3300038996 | Bacteria | 1042 |
| 521 | Ga0242420_035811 | 3300038996 | Bacteria | 935 |
| 522 | Ga0400483_103554 | 3300039062 | Bacteria | 2450 |
| 523 | Ga0400483_200081 | 3300039062 | Bacteria | 2188 |
| 524 | Ga0400489_30506 | 3300039093 | Bacteria | 13751 |
| 525 | Ga0400487_16533 | 3300039110 | Unclassified | 2853 |
| 526 | Ga0439436_0053281 | 3300041404 | Bacteria | 1140 |
| 527 | Ga0439439_0006898 | 3300041406 | Bacteria | 2637 |
| 528 | Ga0439439_0074907 | 3300041406 | Bacteria | 910 |
| 529 | Ga0439453_0014689 | 3300041408 | Bacteria | 1346 |
| 530 | Ga0439466_0145326 | 3300041411 | Unclassified | 727 |
| 531 | Ga0451807_0805302 | 3300041486 | Bacteria | 2780 |
| 532 | Ga0451849_1479746 | 3300041505 | Unclassified | 774 |
| 533 | Ga0439462_0024787 | 3300042015 | Bacteria | 1578 |
| 534 | Ga0450923_036877 | 3300042125 | Bacteria | 1015 |
| 535 | Ga0450895_005399 | 3300042132 | Bacteria | 1030 |
| 536 | Ga0450896_010855 | 3300042133 | Bacteria | 1280 |
| 537 | Ga0439446_0117866 | 3300042156 | Bacteria | 852 |
| 538 | Ga0439459_0011765 | 3300042438 | Bacteria | 1547 |
| 539 | Ga0439460_0121843 | 3300042461 | Unclassified | 854 |
| 540 | Ga0451577_0008058 | 3300042876 | Bacteria | 10280 |
| 541 | Ga0451577_0008331 | 3300042876 | Bacteria | 10087 |
| 542 | Ga0451577_0036429 | 3300042876 | Bacteria | 4428 |
| 543 | Ga0451577_0047073 | 3300042876 | Bacteria | 3857 |
| 544 | Ga0451577_0052120 | 3300042876 | Bacteria | 3654 |
| 545 | Ga0451577_0109387 | 3300042876 | Bacteria | 2472 |
| 546 | Ga0451577_0134782 | 3300042876 | Bacteria | 2217 |
| 547 | Ga0451577_0152166 | 3300042876 | Unclassified | 2082 |
| 548 | Ga0451577_0170318 | 3300042876 | Bacteria | 1962 |
| 549 | Ga0451577_0179660 | 3300042876 | Bacteria | 1907 |
| 550 | Ga0451577_0299396 | 3300042876 | Bacteria | 1457 |
| 551 | Ga0451577_0302080 | 3300042876 | Bacteria | 1450 |
| 552 | Ga0451577_0312850 | 3300042876 | Bacteria | 1423 |
| 553 | Ga0451577_0511297 | 3300042876 | Unclassified | 1091 |
| 554 | Ga0451577_0577950 | 3300042876 | Bacteria | 1020 |
| 555 | Ga0451577_0835150 | 3300042876 | Bacteria | 831 |
| 556 | Ga0451577_1069996 | 3300042876 | Bacteria | 723 |
| 557 | Ga0439440_0078259 | 3300042993 | Unclassified | 871 |
| 558 | Ga0453683_0000006 | 3300044673 | Bacteria | 586638 |
| 559 | Ga0453683_0001504 | 3300044673 | Bacteria | 19914 |
| 560 | Ga0453683_0004070 | 3300044673 | Bacteria | 10521 |
| 561 | Ga0453683_0034751 | 3300044673 | Bacteria | 3177 |
| 562 | Ga0453683_0037986 | 3300044673 | Bacteria | 3028 |
| 563 | Ga0453683_0038390 | 3300044673 | Bacteria | 3010 |
| 564 | Ga0453683_0101522 | 3300044673 | Bacteria | 1806 |
| 565 | Ga0453683_0119313 | 3300044673 | Bacteria | 1660 |
| 566 | Ga0453683_0152183 | 3300044673 | Bacteria | 1462 |
| 567 | Ga0453683_0178635 | 3300044673 | Bacteria | 1346 |
| 568 | Ga0453683_0502519 | 3300044673 | Bacteria | 787 |
| 569 | Ga0466963_0349824 | 3300044694 | Bacteria | 1041 |
| 570 | Ga0466964_0071734 | 3300044706 | Bacteria | 1466 |
| 571 | Ga0453684_0000023 | 3300044712 | Bacteria | 857153 |
| 572 | Ga0453684_0000035 | 3300044712 | Bacteria | 725956 |
| 573 | Ga0453684_0000047 | 3300044712 | Bacteria | 560243 |
| 574 | Ga0453684_0000128 | 3300044712 | Bacteria | 335864 |
| 575 | Ga0453684_0000752 | 3300044712 | Bacteria | 112676 |
| 576 | Ga0453684_0003360 | 3300044712 | Bacteria | 36236 |
| 577 | Ga0453684_0003688 | 3300044712 | Bacteria | 33939 |
| 578 | Ga0453684_0004409 | 3300044712 | Unclassified | 29768 |
| 579 | Ga0453684_0005202 | 3300044712 | Bacteria | 26137 |
| 580 | Ga0453684_0006103 | 3300044712 | Bacteria | 23235 |
| 581 | Ga0453684_0006177 | 3300044712 | Bacteria | 23001 |
| 582 | Ga0453684_0013654 | 3300044712 | Bacteria | 13159 |
| 583 | Ga0453684_0031253 | 3300044712 | Bacteria | 7489 |
| 584 | Ga0453684_0045211 | 3300044712 | Bacteria | 5877 |
| 585 | Ga0453684_0050605 | 3300044712 | Bacteria | 5462 |
| 586 | Ga0453684_0067960 | 3300044712 | Bacteria | 4528 |
| 587 | Ga0453684_0070158 | 3300044712 | Bacteria | 4439 |
| 588 | Ga0453684_0076068 | 3300044712 | Bacteria | 4216 |
| 589 | Ga0453684_0088924 | 3300044712 | Bacteria | 3822 |
| 590 | Ga0453684_0091086 | 3300044712 | Bacteria | 3765 |
| 591 | Ga0453684_0097350 | 3300044712 | Bacteria | 3611 |
| 592 | Ga0453684_0112808 | 3300044712 | Unclassified | 3299 |
| 593 | Ga0453684_0133603 | 3300044712 | Bacteria | 2974 |
| 594 | Ga0453684_0138328 | 3300044712 | Bacteria | 2912 |
| 595 | Ga0453684_0156563 | 3300044712 | Bacteria | 2700 |
| 596 | Ga0453684_0168390 | 3300044712 | Bacteria | 2584 |
| 597 | Ga0453684_0170627 | 3300044712 | Bacteria | 2564 |
| 598 | Ga0453684_0216052 | 3300044712 | Bacteria | 2224 |
| 599 | Ga0453684_0288899 | 3300044712 | Bacteria | 1868 |
| 600 | Ga0453684_0320875 | 3300044712 | Bacteria | 1754 |
| 601 | Ga0453684_0688720 | 3300044712 | Bacteria | 1112 |
| 602 | Ga0453684_0696353 | 3300044712 | Bacteria | 1104 |
| 603 | Ga0453684_0895593 | 3300044712 | Unclassified | 950 |
| 604 | Ga0453684_0962023 | 3300044712 | Bacteria | 910 |
| 605 | Ga0453684_1140464 | 3300044712 | Bacteria | 821 |
| 606 | Ga0453684_1525140 | 3300044712 | Bacteria | 689 |
| 607 | Ga0453684_1612015 | 3300044712 | Bacteria | 666 |
| 608 | Ga0466959_0517578 | 3300045049 | Bacteria | 806 |
| 609 | Ga0451576_0000014 | 3300045051 | Bacteria | 593082 |
| 610 | Ga0451576_0000138 | 3300045051 | Bacteria | 185167 |
| 611 | Ga0451576_0001446 | 3300045051 | Bacteria | 40410 |
| 612 | Ga0451576_0004639 | 3300045051 | Bacteria | 17731 |
| 613 | Ga0451576_0005380 | 3300045051 | Bacteria | 16092 |
| 614 | Ga0451576_0039017 | 3300045051 | Bacteria | 5026 |
| 615 | Ga0451576_0127974 | 3300045051 | Bacteria | 2646 |
| 616 | Ga0451576_0140794 | 3300045051 | Bacteria | 2515 |
| 617 | Ga0451576_0152613 | 3300045051 | Bacteria | 2409 |
| 618 | Ga0451576_0312282 | 3300045051 | Bacteria | 1645 |
| 619 | Ga0451576_0328766 | 3300045051 | Bacteria | 1600 |
| 620 | Ga0451576_0338672 | 3300045051 | Bacteria | 1574 |
| 621 | Ga0451576_0632412 | 3300045051 | Bacteria | 1124 |
| 622 | Ga0451576_0676289 | 3300045051 | Bacteria | 1084 |
| 623 | Ga0451576_0805265 | 3300045051 | Bacteria | 986 |
| 624 | Ga0451576_1101719 | 3300045051 | Unclassified | 831 |
| 625 | Ga0495603_0033578 | 3300046455 | Bacteria | 3087 |
| 626 | Ga0495603_0127260 | 3300046455 | Bacteria | 1484 |
| 627 | Ga0495639_0334731 | 3300046475 | Bacteria | 758 |
| 628 | Ga0495594_0033430 | 3300046499 | Bacteria | 2796 |
| 629 | Ga0495633_0251696 | 3300046558 | Unclassified | 806 |
| 630 | Ga0495588_0016497 | 3300046674 | Bacteria | 3571 |
| 631 | Ga0495670_0154783 | 3300046691 | Unclassified | 1203 |
| 632 | Ga0496100_0144016 | 3300048903 | Bacteria | 1693 |
| 633 | Ga0496100_0251964 | 3300048903 | Bacteria | 1306 |
| 634 | Ga0496101_0023497 | 3300048904 | Bacteria | 4260 |
| 635 | Ga0496101_0136016 | 3300048904 | Bacteria | 1870 |
| 636 | Ga0496101_0265528 | 3300048904 | Bacteria | 1339 |
| 637 | Ga0496101_0272323 | 3300048904 | Bacteria | 1322 |
| 638 | Ga0496101_0401276 | 3300048904 | Bacteria | 1080 |
| 639 | Ga0496102_0019829 | 3300048905 | Bacteria | 5927 |
| 640 | Ga0496102_0100065 | 3300048905 | Bacteria | 2692 |
| 641 | Ga0496102_0134628 | 3300048905 | Bacteria | 2315 |
| 642 | Ga0496102_0188462 | 3300048905 | Bacteria | 1944 |
| 643 | Ga0496102_0196132 | 3300048905 | Bacteria | 1903 |
| 644 | Ga0496103_0012347 | 3300048906 | Bacteria | 5067 |
| 645 | Ga0496103_0313746 | 3300048906 | Unclassified | 1009 |
| 646 | Ga0496104_0008614 | 3300048907 | Bacteria | 9072 |
| 647 | Ga0496104_0014243 | 3300048907 | Bacteria | 7178 |
| 648 | Ga0496104_0065065 | 3300048907 | Bacteria | 3459 |
| 649 | Ga0496105_0107876 | 3300048908 | Bacteria | 2299 |
| 650 | Ga0496105_0116781 | 3300048908 | Unclassified | 2201 |
| 651 | Ga0496105_0224633 | 3300048908 | Bacteria | 1528 |
| 652 | Ga0496105_0423589 | 3300048908 | Bacteria | 1054 |
| 653 | Ga0496106_0079117 | 3300048909 | Bacteria | 2524 |
| 654 | Ga0496106_0370254 | 3300048909 | Bacteria | 1151 |
| 655 | Ga0496107_0042676 | 3300048910 | Bacteria | 3258 |
| 656 | Ga0496107_0081080 | 3300048910 | Bacteria | 2367 |
| 657 | Ga0496108_0012560 | 3300048911 | Bacteria | 6898 |
| 658 | Ga0496108_0022374 | 3300048911 | Bacteria | 5196 |
| 659 | Ga0496108_0052467 | 3300048911 | Bacteria | 3417 |
| 660 | Ga0496108_0073537 | 3300048911 | Bacteria | 2885 |
| 661 | Ga0496108_0168371 | 3300048911 | Bacteria | 1895 |
| 662 | Ga0496109_0004685 | 3300048912 | Bacteria | 11416 |
| 663 | Ga0496109_0029731 | 3300048912 | Bacteria | 4895 |
| 664 | Ga0496109_0053147 | 3300048912 | Bacteria | 3693 |
| 665 | Ga0496109_0090946 | 3300048912 | Bacteria | 2822 |
| 666 | Ga0496109_0316797 | 3300048912 | Bacteria | 1472 |
| 667 | Ga0496110_0003860 | 3300048913 | Bacteria | 11550 |
| 668 | Ga0496110_0011067 | 3300048913 | Bacteria | 7366 |
| 669 | Ga0496110_0031150 | 3300048913 | Bacteria | 4600 |
| 670 | Ga0496110_0189729 | 3300048913 | Unclassified | 1867 |
| 671 | Ga0496110_0197832 | 3300048913 | Bacteria | 1826 |
| 672 | Ga0496111_0003621 | 3300048914 | Bacteria | 9579 |
| 673 | Ga0496111_0081193 | 3300048914 | Bacteria | 2367 |
| 674 | Ga0496111_0263609 | 3300048914 | Bacteria | 1278 |
| 675 | Ga0496111_0380705 | 3300048914 | Unclassified | 1043 |
| 676 | Ga0496112_0008505 | 3300048915 | Bacteria | 9195 |
| 677 | Ga0496112_0072542 | 3300048915 | Bacteria | 3403 |
| 678 | Ga0496112_0119467 | 3300048915 | Unclassified | 2606 |
| 679 | Ga0496112_0414367 | 3300048915 | Bacteria | 1286 |
| 680 | Ga0496113_0001290 | 3300048916 | Bacteria | 13845 |
| 681 | Ga0496113_0010962 | 3300048916 | Bacteria | 6021 |
| 682 | Ga0496113_0021911 | 3300048916 | Bacteria | 4512 |
| 683 | Ga0496114_1072555 | 3300048917 | Bacteria | 690 |
| 684 | Ga0496115_0044110 | 3300048918 | Bacteria | 3556 |
| 685 | Ga0496115_0159372 | 3300048918 | Bacteria | 1865 |
| 686 | Ga0501031_0003016 | 3300049568 | Bacteria | 10770 |
| 687 | Ga0501031_0091586 | 3300049568 | Bacteria | 1983 |
| 688 | Ga0501031_0203720 | 3300049568 | Bacteria | 1291 |
| 689 | Ga0501032_0064982 | 3300049569 | Bacteria | 2442 |
| 690 | Ga0501033_0049373 | 3300049570 | Bacteria | 3123 |
| 691 | Ga0501033_0106855 | 3300049570 | Bacteria | 2039 |
| 692 | Ga0501033_0413635 | 3300049570 | Unclassified | 940 |
| 693 | Ga0501033_0447619 | 3300049570 | Bacteria | 897 |
| 694 | Ga0501034_0015001 | 3300049571 | Bacteria | 7970 |
| 695 | Ga0501034_0181110 | 3300049571 | Bacteria | 2072 |
| 696 | Ga0501034_0248416 | 3300049571 | Bacteria | 1724 |
| 697 | Ga0501034_0425272 | 3300049571 | Bacteria | 1249 |
| 698 | Ga0501036_0075815 | 3300049572 | Bacteria | 2844 |
| 699 | Ga0501036_0103083 | 3300049572 | Bacteria | 2414 |
| 700 | Ga0501036_0142162 | 3300049572 | Bacteria | 2025 |
| 701 | Ga0501036_0176536 | 3300049572 | Bacteria | 1799 |
| 702 | Ga0501036_0198967 | 3300049572 | Bacteria | 1685 |
| 703 | Ga0501036_0368081 | 3300049572 | Bacteria | 1200 |
| 704 | Ga0501037_0074331 | 3300049573 | Bacteria | 2470 |
| 705 | Ga0501037_0365847 | 3300049573 | Unclassified | 993 |
| 706 | Ga0501038_0021422 | 3300049574 | Bacteria | 5802 |
| 707 | Ga0501038_0085413 | 3300049574 | Bacteria | 2654 |
| 708 | Ga0501038_0365115 | 3300049574 | Bacteria | 1122 |
| 709 | Ga0501038_0571479 | 3300049574 | Bacteria | 858 |
| 710 | Ga0501038_0599816 | 3300049574 | Bacteria | 833 |
| 711 | Ga0501039_0015901 | 3300049575 | Bacteria | 5761 |
| 712 | Ga0501039_0067424 | 3300049575 | Bacteria | 2779 |
| 713 | Ga0501039_0302051 | 3300049575 | Bacteria | 1258 |
| 714 | Ga0501040_0049355 | 3300049576 | Bacteria | 2877 |
| 715 | Ga0501040_0049708 | 3300049576 | Bacteria | 2867 |
| 716 | Ga0501040_0112023 | 3300049576 | Bacteria | 1908 |
| 717 | Ga0501040_0429170 | 3300049576 | Unclassified | 950 |
| 718 | Ga0501041_0011952 | 3300049577 | Bacteria | 5139 |
| 719 | Ga0501041_0032929 | 3300049577 | Bacteria | 3133 |
| 720 | Ga0501041_0072095 | 3300049577 | Bacteria | 2121 |
| 721 | Ga0501041_0123290 | 3300049577 | Bacteria | 1611 |
| 722 | Ga0501042_0008450 | 3300049578 | Bacteria | 6798 |
| 723 | Ga0501042_0069182 | 3300049578 | Bacteria | 2525 |
| 724 | Ga0501042_0154820 | 3300049578 | Bacteria | 1653 |
| 725 | Ga0501043_0110482 | 3300049579 | Bacteria | 2159 |
| 726 | Ga0501046_0053529 | 3300049580 | Bacteria | 3178 |
| 727 | Ga0501046_0132337 | 3300049580 | Bacteria | 1891 |
| 728 | Ga0501046_0188308 | 3300049580 | Bacteria | 1540 |
| 729 | Ga0501046_0284554 | 3300049580 | Bacteria | 1210 |
| 730 | Ga0501047_0214150 | 3300049581 | Bacteria | 1784 |
| 731 | Ga0501048_0033076 | 3300049582 | Bacteria | 3737 |
| 732 | Ga0501048_0117375 | 3300049582 | Bacteria | 1880 |
| 733 | Ga0501067_0004053 | 3300049583 | Bacteria | 8078 |
| 734 | Ga0501067_0129190 | 3300049583 | Unclassified | 1406 |
| 735 | Ga0501068_0000731 | 3300049584 | Bacteria | 16826 |
| 736 | Ga0501068_0007837 | 3300049584 | Bacteria | 5917 |
| 737 | Ga0501068_0121591 | 3300049584 | Bacteria | 1628 |
| 738 | Ga0501069_0000181 | 3300049585 | Bacteria | 28434 |
| 739 | Ga0501069_0002048 | 3300049585 | Bacteria | 10117 |
| 740 | Ga0501069_0007387 | 3300049585 | Bacteria | 5766 |
| 741 | Ga0501069_0185437 | 3300049585 | Bacteria | 1203 |
| 742 | Ga0501069_0482735 | 3300049585 | Bacteria | 738 |
| 743 | Ga0501070_0011360 | 3300049586 | Bacteria | 7525 |
| 744 | Ga0501070_0023269 | 3300049586 | Bacteria | 5189 |
| 745 | Ga0501070_0169327 | 3300049586 | Bacteria | 1799 |
| 746 | Ga0501071_0002939 | 3300049587 | Bacteria | 10526 |
| 747 | Ga0501071_0008445 | 3300049587 | Bacteria | 6808 |
| 748 | Ga0501071_0010088 | 3300049587 | Bacteria | 6315 |
| 749 | Ga0501071_0171094 | 3300049587 | Bacteria | 1626 |
| 750 | Ga0501071_0212523 | 3300049587 | Bacteria | 1455 |
| 751 | Ga0501072_0002185 | 3300049588 | Bacteria | 14619 |
| 752 | Ga0501072_0010662 | 3300049588 | Bacteria | 7000 |
| 753 | Ga0501072_0033950 | 3300049588 | Bacteria | 3997 |
| 754 | Ga0501072_0146005 | 3300049588 | Bacteria | 1886 |
| 755 | Ga0501072_0190637 | 3300049588 | Bacteria | 1635 |
| 756 | Ga0501072_0253205 | 3300049588 | Bacteria | 1402 |
| 757 | Ga0501073_0018933 | 3300049589 | Bacteria | 4975 |
| 758 | Ga0501073_0040128 | 3300049589 | Bacteria | 3314 |
| 759 | Ga0501073_0045233 | 3300049589 | Bacteria | 3101 |
| 760 | Ga0501073_0182255 | 3300049589 | Bacteria | 1453 |
| 761 | Ga0501073_0228603 | 3300049589 | Bacteria | 1285 |
| 762 | Ga0501073_0239775 | 3300049589 | Bacteria | 1252 |
| 763 | Ga0501074_0002532 | 3300049590 | Bacteria | 12755 |
| 764 | Ga0501074_0007142 | 3300049590 | Bacteria | 8066 |
| 765 | Ga0501074_0021223 | 3300049590 | Bacteria | 4717 |
| 766 | Ga0501074_0103993 | 3300049590 | Bacteria | 2033 |
| 767 | Ga0501074_0205234 | 3300049590 | Bacteria | 1404 |
| 768 | Ga0501074_0208335 | 3300049590 | Bacteria | 1393 |
| 769 | Ga0501074_0269075 | 3300049590 | Bacteria | 1211 |
| 770 | Ga0501074_0346193 | 3300049590 | Bacteria | 1055 |
| 771 | Ga0501074_0391454 | 3300049590 | Bacteria | 986 |
| 772 | Ga0501075_0005015 | 3300049591 | Bacteria | 9036 |
| 773 | Ga0501075_0005163 | 3300049591 | Bacteria | 8934 |
| 774 | Ga0501075_0006152 | 3300049591 | Bacteria | 8248 |
| 775 | Ga0501075_0480604 | 3300049591 | Unclassified | 948 |
| 776 | Ga0501076_0010660 | 3300049592 | Bacteria | 6827 |
| 777 | Ga0501076_0014150 | 3300049592 | Bacteria | 6001 |
| 778 | Ga0501076_0034669 | 3300049592 | Bacteria | 3946 |
| 779 | Ga0501076_0065852 | 3300049592 | Bacteria | 2890 |
| 780 | Ga0501076_0073596 | 3300049592 | Bacteria | 2736 |
| 781 | Ga0501076_0264329 | 3300049592 | Bacteria | 1409 |
| 782 | Ga0501076_0480006 | 3300049592 | Unclassified | 1024 |
| 783 | Ga0501076_0591082 | 3300049592 | Bacteria | 916 |
| 784 | Ga0501077_0000834 | 3300049593 | Bacteria | 18654 |
| 785 | Ga0501077_0011587 | 3300049593 | Bacteria | 5510 |
| 786 | Ga0501077_0260843 | 3300049593 | Unclassified | 1102 |
| 787 | Ga0501209_060080 | 3300049656 | Bacteria | 1059 |
| 788 | Ga0501217_040063 | 3300049661 | Bacteria | 1189 |
| 789 | Ga0501235_035235 | 3300049669 | Bacteria | 1136 |
| 790 | Ga0501243_019656 | 3300049675 | Bacteria | 1107 |
| 791 | Ga0501249_090899 | 3300049679 | Unclassified | 724 |
| 792 | Ga0501079_0017498 | 3300049741 | Bacteria | 5474 |
| 793 | Ga0501079_0028768 | 3300049741 | Bacteria | 4266 |
| 794 | Ga0501079_0031892 | 3300049741 | Bacteria | 4049 |
| 795 | Ga0501079_0039426 | 3300049741 | Bacteria | 3643 |
| 796 | Ga0501079_0048471 | 3300049741 | Bacteria | 3278 |
| 797 | Ga0501079_0121191 | 3300049741 | Bacteria | 2034 |
| 798 | Ga0501079_0144760 | 3300049741 | Bacteria | 1852 |
| 799 | Ga0501079_0201128 | 3300049741 | Bacteria | 1556 |
| 800 | Ga0501079_0259801 | 3300049741 | Bacteria | 1357 |
| 801 | Ga0501079_0493837 | 3300049741 | Bacteria | 962 |
| 802 | Ga0501080_0008681 | 3300049742 | Bacteria | 9228 |
| 803 | Ga0501080_0017058 | 3300049742 | Bacteria | 6706 |
| 804 | Ga0501080_0044347 | 3300049742 | Bacteria | 4140 |
| 805 | Ga0501080_0093193 | 3300049742 | Bacteria | 2797 |
| 806 | Ga0501080_0106422 | 3300049742 | Bacteria | 2599 |
| 807 | Ga0501080_0110178 | 3300049742 | Bacteria | 2552 |
| 808 | Ga0501080_0169409 | 3300049742 | Bacteria | 2015 |
| 809 | Ga0501080_0854687 | 3300049742 | Bacteria | 795 |
| 810 | Ga0501081_0018822 | 3300049743 | Bacteria | 4587 |
| 811 | Ga0501081_0027762 | 3300049743 | Bacteria | 3816 |
| 812 | Ga0501081_0194161 | 3300049743 | Bacteria | 1471 |
| 813 | Ga0501081_0197211 | 3300049743 | Bacteria | 1459 |
| 814 | Ga0501081_0279459 | 3300049743 | Bacteria | 1222 |
| 815 | Ga0501081_0359723 | 3300049743 | Bacteria | 1073 |
| 816 | Ga0501081_0752187 | 3300049743 | Bacteria | 732 |
| 817 | Ga0501083_0013899 | 3300049744 | Bacteria | 5628 |
| 818 | Ga0501083_0033641 | 3300049744 | Bacteria | 3508 |
| 819 | Ga0501083_0084399 | 3300049744 | Bacteria | 2103 |
| 820 | Ga0501083_0153232 | 3300049744 | Bacteria | 1509 |
| 821 | Ga0501271_009461 | 3300049768 | Bacteria | 1015 |
| 822 | Ga0501035_0009554 | 3300049822 | Bacteria | 9019 |
| 823 | Ga0501035_0226194 | 3300049822 | Bacteria | 1596 |
| 824 | Ga0501035_0763264 | 3300049822 | Unclassified | 775 |
| 825 | Ga0501045_0008967 | 3300049824 | Bacteria | 6986 |
| 826 | Ga0501045_0034289 | 3300049824 | Bacteria | 3684 |
| 827 | Ga0501045_0147488 | 3300049824 | Bacteria | 1750 |
| 828 | Ga0501045_0343120 | 3300049824 | Bacteria | 1112 |
| 829 | Ga0501045_0385216 | 3300049824 | Bacteria | 1044 |
| 830 | nmdc:mga05p37_15211_c1 | 3300050507 | Bacteria | 9241 |
| 831 | nmdc:mga05p37_172664_c1 | 3300050507 | Bacteria | 2636 |
| 832 | nmdc:mga05p37_186995_c1 | 3300050507 | Bacteria | 2518 |
| 833 | nmdc:mga05p37_378520_c1 | 3300050507 | Unclassified | 1659 |
| 834 | nmdc:mga05p37_38365_c1 | 3300050507 | Bacteria | 5876 |
| 835 | nmdc:mga05p37_508900_c1 | 3300050507 | Unclassified | 1380 |
| 836 | nmdc:mga05p37_551032_c1 | 3300050507 | Bacteria | 1313 |
| 837 | nmdc:mga05p37_77476_c1 | 3300050507 | Unclassified | 4093 |
| 838 | nmdc:mga05p37_844229_c1 | 3300050507 | Bacteria | 996 |
| 839 | nmdc:mga05p37_87209_c1 | 3300050507 | Bacteria | 3847 |
| 840 | nmdc:mga05p37_94064_c1 | 3300050507 | Bacteria | 3693 |
| 841 | nmdc:mga05p37_944916_c1 | 3300050507 | Bacteria | 923 |
| 842 | nmdc:mga09592_104656_c1 | 3300050508 | Bacteria | 2425 |
| 843 | nmdc:mga09592_111845_c1 | 3300050508 | Unclassified | 2343 |
| 844 | nmdc:mga09592_131559_c1 | 3300050508 | Unclassified | 2153 |
| 845 | nmdc:mga09592_23260_c1 | 3300050508 | Bacteria | 5118 |
| 846 | nmdc:mga09592_302873_c1 | 3300050508 | Unclassified | 1386 |
| 847 | nmdc:mga09592_5756_c1 | 3300050508 | Bacteria | 10106 |
| 848 | nmdc:mga09592_73986_c1 | 3300050508 | Unclassified | 2896 |
| 849 | nmdc:mga0qj67_90348_c1 | 3300050509 | Bacteria | 2460 |
| 850 | nmdc:mga06r32_146310_c1 | 3300050510 | Bacteria | 2340 |
| 851 | nmdc:mga06r32_37252_c1 | 3300050510 | Bacteria | 4601 |
| 852 | nmdc:mga06r32_847432_c1 | 3300050510 | Bacteria | 873 |
| 853 | nmdc:mga08y16_461826_c1 | 3300050511 | Bacteria | 1294 |
| 854 | nmdc:mga0n895_1708354_c1 | 3300050512 | Bacteria | 592 |
| 855 | nmdc:mga0n895_229995_c1 | 3300050512 | Unclassified | 1882 |
| 856 | nmdc:mga0n895_237478_c1 | 3300050512 | Bacteria | 1850 |
| 857 | nmdc:mga0n895_321481_c1 | 3300050512 | Bacteria | 1568 |
| 858 | nmdc:mga0n895_323502_c1 | 3300050512 | Bacteria | 1563 |
| 859 | nmdc:mga0rr50_219609_c1 | 3300050513 | Bacteria | 1569 |
| 860 | nmdc:mga0rr50_71479_c1 | 3300050513 | Bacteria | 2648 |
| 861 | nmdc:mga0rr50_726525_c1 | 3300050513 | Unclassified | 848 |
| 862 | nmdc:mga0a205_12549_c1 | 3300050515 | Bacteria | 7842 |
| 863 | nmdc:mga0a205_192078_c1 | 3300050515 | Bacteria | 1934 |
| 864 | nmdc:mga0a205_241057_c1 | 3300050515 | Bacteria | 1689 |
| 865 | nmdc:mga0a205_397311_c1 | 3300050515 | Bacteria | 1242 |
| 866 | nmdc:mga0a205_70962_c1 | 3300050515 | Bacteria | 3364 |
| 867 | Ga0501084_0002802 | 3300054114 | Bacteria | 14074 |
| 868 | Ga0501084_0005414 | 3300054114 | Bacteria | 10465 |
| 869 | Ga0501084_0059438 | 3300054114 | Bacteria | 3200 |
| 870 | Ga0501084_0065265 | 3300054114 | Bacteria | 3045 |
| 871 | Ga0501084_0068622 | 3300054114 | Bacteria | 2968 |
| 872 | Ga0501084_0076412 | 3300054114 | Bacteria | 2807 |
| 873 | Ga0501084_0086287 | 3300054114 | Bacteria | 2635 |
| 874 | Ga0501084_0102515 | 3300054114 | Bacteria | 2403 |
| 875 | Ga0501084_0130341 | 3300054114 | Bacteria | 2117 |
| 876 | Ga0501084_1105031 | 3300054114 | Bacteria | 666 |
| 877 | Ga0590071_000641 | 3300059421 | Bacteria | 9939 |
| 878 | Ga0590071_013948 | 3300059421 | Bacteria | 1883 |
| 879 | Ga0590071_108556 | 3300059421 | Bacteria | 703 |
| 880 | Ga0590075_003140 | 3300059424 | Bacteria | 3929 |
| 881 | Ga0590077_003991 | 3300059426 | Bacteria | 3041 |
| 882 | Ga0501082_0010117 | 3300060353 | Bacteria | 8122 |
| 883 | Ga0501082_0010983 | 3300060353 | Bacteria | 7790 |
| 884 | Ga0501082_0012220 | 3300060353 | Bacteria | 7377 |
| 885 | Ga0501082_0015371 | 3300060353 | Bacteria | 6586 |
| 886 | Ga0501082_0019229 | 3300060353 | Bacteria | 5887 |
| 887 | Ga0501082_0233859 | 3300060353 | Bacteria | 1599 |
| 888 | Ga0501082_1099916 | 3300060353 | Bacteria | 695 |
| 889 | Ga0530510_0119214 | 3300061734 | Bacteria | 1936 |
| 890 | Ga0530510_0139586 | 3300061734 | Bacteria | 1785 |
| 891 | Ga0530510_0311488 | 3300061734 | Bacteria | 1179 |
| 892 | Ga0530510_0352835 | 3300061734 | Bacteria | 1105 |
| 893 | Ga0530510_0620919 | 3300061734 | Bacteria | 822 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100212680 | Ga0070690_1002126801 | 160 |
| 2 | 3300005366 | Ga0070659_100875949 | Ga0070659_1008759492 | 160 |
| 3 | 3300050512 | nmdc:mga0n895_1708354_c1 | nmdc:mga0n895_1708354_c1_81_569 | 162 |
| 4 | 3300035398 | Ga0316574_0650722 | Ga0316574_0650722_64_579 | 171 |
| 5 | 3300036712 | Ga0316584_0004962 | Ga0316584_0004962_768_1373 | 180 |
| 6 | 3300036712 | Ga0316584_0228119 | Ga0316584_0228119_587_1192 | 180 |
| 7 | 3300044712 | Ga0453684_0070158 | Ga0453684_0070158_830_1435 | 180 |
| 8 | 3300036647 | Ga0316582_0019296 | Ga0316582_0019296_1919_2527 | 181 |
| 9 | 3300039110 | Ga0400487_16533 | Ga0400487_16533_2181_2762 | 181 |
| 10 | 3300044712 | Ga0453684_0288899 | Ga0453684_0288899_1142_1750 | 181 |
| 11 | 3300044712 | Ga0453684_0320875 | Ga0453684_0320875_950_1558 | 181 |
| 12 | 3300031665 | Ga0316575_10029238 | Ga0316575_100292382 | 182 |
| 13 | 3300031728 | Ga0316578_10014345 | Ga0316578_100143454 | 182 |
| 14 | 3300035398 | Ga0316574_0015481 | Ga0316574_0015481_963_1562 | 182 |
| 15 | 3300005329 | Ga0070683_100115483 | Ga0070683_1001154832 | 183 |
| 16 | 3300005844 | Ga0068862_100108951 | Ga0068862_1001089513 | 183 |
| 17 | 3300014326 | Ga0157380_10140187 | Ga0157380_101401872 | 183 |
| 18 | 3300028380 | Ga0268265_10073673 | Ga0268265_100736734 | 183 |
| 19 | 3300035398 | Ga0316574_0031035 | Ga0316574_0031035_1044_1649 | 184 |
| 20 | 3300005545 | Ga0070695_100893224 | Ga0070695_1008932241 | 185 |
| 21 | 3300036712 | Ga0316584_0022049 | Ga0316584_0022049_2684_3283 | 185 |
| 22 | 3300044712 | Ga0453684_0006103 | Ga0453684_0006103_16556_17164 | 185 |
| 23 | 3300044712 | Ga0453684_0000752 | Ga0453684_0000752_74839_75444 | 186 |
| 24 | 3300005336 | Ga0070680_100026468 | Ga0070680_1000264687 | 187 |
| 25 | 3300005458 | Ga0070681_10106027 | Ga0070681_101060272 | 187 |
| 26 | 3300005530 | Ga0070679_100011448 | Ga0070679_1000114483 | 187 |
| 27 | 3300005546 | Ga0070696_100255683 | Ga0070696_1002556831 | 187 |
| 28 | 3300025912 | Ga0207707_10006178 | Ga0207707_100061789 | 187 |
| 29 | 3300025917 | Ga0207660_10021979 | Ga0207660_100219793 | 187 |
| 30 | 3300025921 | Ga0207652_10048218 | Ga0207652_100482183 | 187 |
| 31 | 3300028563 | Ga0265319_1105946 | Ga0265319_11059461 | 188 |
| 32 | 3300031727 | Ga0316576_10084279 | Ga0316576_100842793 | 188 |
| 33 | 3300041505 | Ga0451849_1479746 | Ga0451849_1479746_151_717 | 188 |
| 34 | 3300031727 | Ga0316576_10292374 | Ga0316576_102923741 | 189 |
| 35 | 3300036647 | Ga0316582_0450969 | Ga0316582_0450969_87_692 | 190 |
| 36 | 3300044712 | Ga0453684_0000047 | Ga0453684_0000047_460321_460929 | 190 |
| 37 | 3300049571 | Ga0501034_0015001 | Ga0501034_0015001_2246_2833 | 190 |
| 38 | 3300049574 | Ga0501038_0365115 | Ga0501038_0365115_351_938 | 190 |
| 39 | 3300049583 | Ga0501067_0004053 | Ga0501067_0004053_4983_5570 | 190 |
| 40 | 3300049584 | Ga0501068_0007837 | Ga0501068_0007837_4762_5349 | 190 |
| 41 | 3300049585 | Ga0501069_0000181 | Ga0501069_0000181_2318_2905 | 190 |
| 42 | 3300049586 | Ga0501070_0011360 | Ga0501070_0011360_2211_2798 | 190 |
| 43 | 3300049587 | Ga0501071_0002939 | Ga0501071_0002939_4863_5450 | 190 |
| 44 | 3300049588 | Ga0501072_0002185 | Ga0501072_0002185_8753_9340 | 190 |
| 45 | 3300049590 | Ga0501074_0007142 | Ga0501074_0007142_2192_2779 | 190 |
| 46 | 3300049741 | Ga0501079_0121191 | Ga0501079_0121191_365_952 | 190 |
| 47 | 3300049742 | Ga0501080_0008681 | Ga0501080_0008681_3486_4073 | 190 |
| 48 | 3300049743 | Ga0501081_0359723 | Ga0501081_0359723_355_942 | 190 |
| 49 | 3300049744 | Ga0501083_0033641 | Ga0501083_0033641_2166_2753 | 190 |
| 50 | 3300054114 | Ga0501084_0005414 | Ga0501084_0005414_5250_5837 | 190 |
| 51 | 3300060353 | Ga0501082_0019229 | Ga0501082_0019229_4545_5132 | 190 |
| 52 | 3300061734 | Ga0530510_0620919 | Ga0530510_0620919_212_799 | 190 |
| 53 | 3300045051 | Ga0451576_1101719 | Ga0451576_1101719_20_601 | 193 |
| 54 | iso_pu_bacteria | 2501939600 | 2501941923 | 193 |
| 55 | iso_pu_bacteria | 2515154088 | 2515495350 | 193 |
| 56 | iso_pu_bacteria | 2515154129 | 2515720142 | 193 |
| 57 | iso_pu_bacteria | 2515154137 | 2515759089 | 193 |
| 58 | iso_pu_bacteria | 2515154202 | 2516086225 | 193 |
| 59 | iso_pu_bacteria | 2515154203 | 2516092204 | 193 |
| 60 | iso_pu_bacteria | 2622736626 | 2623585527 | 193 |
| 61 | iso_pu_bacteria | 2751185782 | 2753266898 | 193 |
| 62 | iso_pu_bacteria | 2772190715 | 2772645209 | 193 |
| 63 | iso_pu_bacteria | 2855683550 | 2855688199 | 193 |
| 64 | iso_pu_bacteria | 2856858025 | 2856859425 | 193 |
| 65 | iso_pu_bacteria | 2858868258 | 2858872165 | 193 |
| 66 | iso_pu_bacteria | 2858902515 | 2858908657 | 193 |
| 67 | iso_pu_bacteria | 2867507094 | 2867510467 | 193 |
| 68 | iso_pu_bacteria | 2880489317 | 2880494701 | 193 |
| 69 | iso_pu_bacteria | 2880495981 | 2880497622 | 193 |
| 70 | iso_pu_bacteria | 2902582711 | 2902585805 | 193 |
| 71 | iso_pu_bacteria | 2929219909 | 2929226178 | 193 |
| 72 | iso_pu_bacteria | 649633069 | 649812710 | 193 |
| 73 | iso_pu_bacteria | 8003830390 | 8003836502 | 193 |
| 74 | iso_pu_bacteria | 8003870546 | 8003875049 | 193 |
| 75 | iso_pu_bacteria | 8055412473 | 8055412672 | 193 |
| 76 | 3300044712 | Ga0453684_0962023 | Ga0453684_0962023_215_805 | 194 |
| 77 | 3300005548 | Ga0070665_100370835 | Ga0070665_1003708351 | 195 |
| 78 | 3300028379 | Ga0268266_10082293 | Ga0268266_100822934 | 195 |
| 79 | 3300041408 | Ga0439453_0014689 | Ga0439453_0014689_562_1149 | 195 |
| 80 | 3300041486 | Ga0451807_0805302 | Ga0451807_0805302_102_689 | 195 |
| 81 | 3300049571 | Ga0501034_0425272 | Ga0501034_0425272_461_1048 | 195 |
| 82 | 3300049581 | Ga0501047_0214150 | Ga0501047_0214150_664_1251 | 195 |
| 83 | 3300049584 | Ga0501068_0000731 | Ga0501068_0000731_13725_14312 | 195 |
| 84 | 3300049585 | Ga0501069_0002048 | Ga0501069_0002048_6356_6943 | 195 |
| 85 | 3300049585 | Ga0501069_0007387 | Ga0501069_0007387_4166_4753 | 195 |
| 86 | 3300049586 | Ga0501070_0023269 | Ga0501070_0023269_2456_3043 | 195 |
| 87 | 3300049586 | Ga0501070_0169327 | Ga0501070_0169327_235_822 | 195 |
| 88 | 3300049588 | Ga0501072_0146005 | Ga0501072_0146005_582_1169 | 195 |
| 89 | 3300049589 | Ga0501073_0040128 | Ga0501073_0040128_109_696 | 195 |
| 90 | 3300049590 | Ga0501074_0002532 | Ga0501074_0002532_11804_12391 | 195 |
| 91 | 3300049590 | Ga0501074_0269075 | Ga0501074_0269075_585_1172 | 195 |
| 92 | 3300049592 | Ga0501076_0073596 | Ga0501076_0073596_427_1014 | 195 |
| 93 | 3300049741 | Ga0501079_0048471 | Ga0501079_0048471_520_1107 | 195 |
| 94 | 3300049742 | Ga0501080_0017058 | Ga0501080_0017058_3107_3694 | 195 |
| 95 | 3300049742 | Ga0501080_0044347 | Ga0501080_0044347_1849_2436 | 195 |
| 96 | 3300049742 | Ga0501080_0106422 | Ga0501080_0106422_1778_2365 | 195 |
| 97 | 3300049744 | Ga0501083_0013899 | Ga0501083_0013899_4331_4918 | 195 |
| 98 | 3300049744 | Ga0501083_0153232 | Ga0501083_0153232_268_855 | 195 |
| 99 | 3300054114 | Ga0501084_0002802 | Ga0501084_0002802_12852_13439 | 195 |
| 100 | 3300060353 | Ga0501082_0010983 | Ga0501082_0010983_3123_3710 | 195 |
| 101 | 3300005328 | Ga0070676_10465125 | Ga0070676_104651251 | 196 |
| 102 | 3300005329 | Ga0070683_100271823 | Ga0070683_1002718233 | 196 |
| 103 | 3300005329 | Ga0070683_100505106 | Ga0070683_1005051061 | 196 |
| 104 | 3300005331 | Ga0070670_100361242 | Ga0070670_1003612423 | 196 |
| 105 | 3300005334 | Ga0068869_100322214 | Ga0068869_1003222143 | 196 |
| 106 | 3300005335 | Ga0070666_10021013 | Ga0070666_100210134 | 196 |
| 107 | 3300005336 | Ga0070680_100160301 | Ga0070680_1001603012 | 196 |
| 108 | 3300005336 | Ga0070680_100449132 | Ga0070680_1004491322 | 196 |
| 109 | 3300005337 | Ga0070682_100467703 | Ga0070682_1004677032 | 196 |
| 110 | 3300005339 | Ga0070660_100342902 | Ga0070660_1003429021 | 196 |
| 111 | 3300005340 | Ga0070689_100077762 | Ga0070689_1000777623 | 196 |
| 112 | 3300005341 | Ga0070691_10033186 | Ga0070691_100331863 | 196 |
| 113 | 3300005341 | Ga0070691_10073913 | Ga0070691_100739132 | 196 |
| 114 | 3300005347 | Ga0070668_100088259 | Ga0070668_1000882593 | 196 |
| 115 | 3300005347 | Ga0070668_100875506 | Ga0070668_1008755062 | 196 |
| 116 | 3300005353 | Ga0070669_100119875 | Ga0070669_1001198752 | 196 |
| 117 | 3300005354 | Ga0070675_100115937 | Ga0070675_1001159373 | 196 |
| 118 | 3300005356 | Ga0070674_100016428 | Ga0070674_1000164284 | 196 |
| 119 | 3300005356 | Ga0070674_100149071 | Ga0070674_1001490711 | 196 |
| 120 | 3300005364 | Ga0070673_100039952 | Ga0070673_1000399524 | 196 |
| 121 | 3300005364 | Ga0070673_100583836 | Ga0070673_1005838362 | 196 |
| 122 | 3300005366 | Ga0070659_100120242 | Ga0070659_1001202423 | 196 |
| 123 | 3300005438 | Ga0070701_10253151 | Ga0070701_102531512 | 196 |
| 124 | 3300005439 | Ga0070711_100034032 | Ga0070711_1000340323 | 196 |
| 125 | 3300005439 | Ga0070711_100670425 | Ga0070711_1006704252 | 196 |
| 126 | 3300005440 | Ga0070705_100054393 | Ga0070705_1000543933 | 196 |
| 127 | 3300005440 | Ga0070705_100178734 | Ga0070705_1001787343 | 196 |
| 128 | 3300005444 | Ga0070694_100054762 | Ga0070694_1000547623 | 196 |
| 129 | 3300005444 | Ga0070694_100281309 | Ga0070694_1002813092 | 196 |
| 130 | 3300005445 | Ga0070708_100145472 | Ga0070708_1001454724 | 196 |
| 131 | 3300005445 | Ga0070708_100354828 | Ga0070708_1003548281 | 196 |
| 132 | 3300005445 | Ga0070708_100765297 | Ga0070708_1007652972 | 196 |
| 133 | 3300005455 | Ga0070663_100325203 | Ga0070663_1003252032 | 196 |
| 134 | 3300005456 | Ga0070678_100011829 | Ga0070678_1000118293 | 196 |
| 135 | 3300005457 | Ga0070662_100000175 | Ga0070662_10000017528 | 196 |
| 136 | 3300005459 | Ga0068867_100968143 | Ga0068867_1009681432 | 196 |
| 137 | 3300005467 | Ga0070706_100607832 | Ga0070706_1006078321 | 196 |
| 138 | 3300005468 | Ga0070707_100242914 | Ga0070707_1002429141 | 196 |
| 139 | 3300005518 | Ga0070699_100386567 | Ga0070699_1003865672 | 196 |
| 140 | 3300005530 | Ga0070679_100440650 | Ga0070679_1004406501 | 196 |
| 141 | 3300005535 | Ga0070684_100342690 | Ga0070684_1003426903 | 196 |
| 142 | 3300005536 | Ga0070697_100170097 | Ga0070697_1001700973 | 196 |
| 143 | 3300005539 | Ga0068853_100199380 | Ga0068853_1001993802 | 196 |
| 144 | 3300005539 | Ga0068853_100326296 | Ga0068853_1003262962 | 196 |
| 145 | 3300005539 | Ga0068853_100514436 | Ga0068853_1005144362 | 196 |
| 146 | 3300005539 | Ga0068853_100526443 | Ga0068853_1005264432 | 196 |
| 147 | 3300005543 | Ga0070672_100174328 | Ga0070672_1001743283 | 196 |
| 148 | 3300005543 | Ga0070672_100331102 | Ga0070672_1003311022 | 196 |
| 149 | 3300005543 | Ga0070672_100776818 | Ga0070672_1007768182 | 196 |
| 150 | 3300005544 | Ga0070686_100020095 | Ga0070686_1000200955 | 196 |
| 151 | 3300005545 | Ga0070695_100023736 | Ga0070695_1000237363 | 196 |
| 152 | 3300005545 | Ga0070695_100175407 | Ga0070695_1001754073 | 196 |
| 153 | 3300005546 | Ga0070696_100041490 | Ga0070696_1000414903 | 196 |
| 154 | 3300005546 | Ga0070696_100120100 | Ga0070696_1001201003 | 196 |
| 155 | 3300005547 | Ga0070693_100093441 | Ga0070693_1000934413 | 196 |
| 156 | 3300005548 | Ga0070665_100110766 | Ga0070665_1001107662 | 196 |
| 157 | 3300005564 | Ga0070664_100003171 | Ga0070664_10000317113 | 196 |
| 158 | 3300005578 | Ga0068854_100000312 | Ga0068854_1000003129 | 196 |
| 159 | 3300005578 | Ga0068854_100271298 | Ga0068854_1002712982 | 196 |
| 160 | 3300005615 | Ga0070702_100125186 | Ga0070702_1001251861 | 196 |
| 161 | 3300005615 | Ga0070702_100349563 | Ga0070702_1003495632 | 196 |
| 162 | 3300005617 | Ga0068859_100148675 | Ga0068859_1001486752 | 196 |
| 163 | 3300005617 | Ga0068859_100267092 | Ga0068859_1002670922 | 196 |
| 164 | 3300005617 | Ga0068859_101414743 | Ga0068859_1014147431 | 196 |
| 165 | 3300005617 | Ga0068859_102019998 | Ga0068859_1020199981 | 196 |
| 166 | 3300005618 | Ga0068864_101446374 | Ga0068864_1014463741 | 196 |
| 167 | 3300005718 | Ga0068866_10001272 | Ga0068866_100012726 | 196 |
| 168 | 3300005719 | Ga0068861_100076406 | Ga0068861_1000764063 | 196 |
| 169 | 3300005719 | Ga0068861_100691690 | Ga0068861_1006916901 | 196 |
| 170 | 3300005841 | Ga0068863_100664845 | Ga0068863_1006648451 | 196 |
| 171 | 3300005842 | Ga0068858_100036613 | Ga0068858_1000366131 | 196 |
| 172 | 3300005843 | Ga0068860_100065014 | Ga0068860_1000650143 | 196 |
| 173 | 3300005844 | Ga0068862_100032711 | Ga0068862_1000327115 | 196 |
| 174 | 3300005844 | Ga0068862_100561865 | Ga0068862_1005618652 | 196 |
| 175 | 3300005844 | Ga0068862_100680186 | Ga0068862_1006801862 | 196 |
| 176 | 3300006175 | Ga0070712_100145424 | Ga0070712_1001454242 | 196 |
| 177 | 3300006237 | Ga0097621_100661874 | Ga0097621_1006618742 | 196 |
| 178 | 3300006358 | Ga0068871_100439763 | Ga0068871_1004397632 | 196 |
| 179 | 3300006844 | Ga0075428_100484481 | Ga0075428_1004844811 | 196 |
| 180 | 3300006852 | Ga0075433_10111882 | Ga0075433_101118823 | 196 |
| 181 | 3300006852 | Ga0075433_10125566 | Ga0075433_101255663 | 196 |
| 182 | 3300006852 | Ga0075433_10343770 | Ga0075433_103437703 | 196 |
| 183 | 3300006871 | Ga0075434_100183518 | Ga0075434_1001835183 | 196 |
| 184 | 3300006871 | Ga0075434_100231108 | Ga0075434_1002311083 | 196 |
| 185 | 3300006881 | Ga0068865_100003121 | Ga0068865_1000031212 | 196 |
| 186 | 3300006931 | Ga0097620_100148690 | Ga0097620_1001486902 | 196 |
| 187 | 3300006931 | Ga0097620_100267096 | Ga0097620_1002670962 | 196 |
| 188 | 3300006931 | Ga0097620_101414102 | Ga0097620_1014141021 | 196 |
| 189 | 3300006931 | Ga0097620_102020044 | Ga0097620_1020200441 | 196 |
| 190 | 3300007076 | Ga0075435_100228132 | Ga0075435_1002281323 | 196 |
| 191 | 3300009093 | Ga0105240_10137190 | Ga0105240_101371903 | 196 |
| 192 | 3300009094 | Ga0111539_10104065 | Ga0111539_101040653 | 196 |
| 193 | 3300009094 | Ga0111539_10143028 | Ga0111539_101430283 | 196 |
| 194 | 3300009098 | Ga0105245_10145200 | Ga0105245_101452002 | 196 |
| 195 | 3300009147 | Ga0114129_10029164 | Ga0114129_100291645 | 196 |
| 196 | 3300009148 | Ga0105243_10005127 | Ga0105243_100051277 | 196 |
| 197 | 3300009174 | Ga0105241_10032989 | Ga0105241_100329893 | 196 |
| 198 | 3300009176 | Ga0105242_10112499 | Ga0105242_101124992 | 196 |
| 199 | 3300009177 | Ga0105248_10201677 | Ga0105248_102016773 | 196 |
| 200 | 3300009545 | Ga0105237_10189306 | Ga0105237_101893063 | 196 |
| 201 | 3300009545 | Ga0105237_10274250 | Ga0105237_102742502 | 196 |
| 202 | 3300009551 | Ga0105238_10290619 | Ga0105238_102906193 | 196 |
| 203 | 3300009553 | Ga0105249_10142928 | Ga0105249_101429283 | 196 |
| 204 | 3300009553 | Ga0105249_10212704 | Ga0105249_102127042 | 196 |
| 205 | 3300009553 | Ga0105249_10478027 | Ga0105249_104780272 | 196 |
| 206 | 3300010375 | Ga0105239_10042512 | Ga0105239_100425126 | 196 |
| 207 | 3300010375 | Ga0105239_10135905 | Ga0105239_101359053 | 196 |
| 208 | 3300010375 | Ga0105239_10191973 | Ga0105239_101919733 | 196 |
| 209 | 3300013308 | Ga0157375_10730471 | Ga0157375_107304712 | 196 |
| 210 | 3300014326 | Ga0157380_10259749 | Ga0157380_102597493 | 196 |
| 211 | 3300014745 | Ga0157377_10238608 | Ga0157377_102386083 | 196 |
| 212 | 3300014968 | Ga0157379_10045576 | Ga0157379_100455764 | 196 |
| 213 | 3300014968 | Ga0157379_10296718 | Ga0157379_102967183 | 196 |
| 214 | 3300014968 | Ga0157379_10407418 | Ga0157379_104074183 | 196 |
| 215 | 3300014969 | Ga0157376_10198018 | Ga0157376_101980182 | 196 |
| 216 | 3300025905 | Ga0207685_10019627 | Ga0207685_100196274 | 196 |
| 217 | 3300025907 | Ga0207645_10306816 | Ga0207645_103068162 | 196 |
| 218 | 3300025910 | Ga0207684_10501854 | Ga0207684_105018542 | 196 |
| 219 | 3300025912 | Ga0207707_10011727 | Ga0207707_100117275 | 196 |
| 220 | 3300025912 | Ga0207707_10559145 | Ga0207707_105591452 | 196 |
| 221 | 3300025913 | Ga0207695_10144179 | Ga0207695_101441792 | 196 |
| 222 | 3300025916 | Ga0207663_10039433 | Ga0207663_100394333 | 196 |
| 223 | 3300025917 | Ga0207660_10553989 | Ga0207660_105539892 | 196 |
| 224 | 3300025919 | Ga0207657_10109049 | Ga0207657_101090493 | 196 |
| 225 | 3300025920 | Ga0207649_10321257 | Ga0207649_103212573 | 196 |
| 226 | 3300025921 | Ga0207652_10607046 | Ga0207652_106070461 | 196 |
| 227 | 3300025922 | Ga0207646_10228718 | Ga0207646_102287183 | 196 |
| 228 | 3300025922 | Ga0207646_10497955 | Ga0207646_104979553 | 196 |
| 229 | 3300025923 | Ga0207681_10259671 | Ga0207681_102596712 | 196 |
| 230 | 3300025923 | Ga0207681_10429921 | Ga0207681_104299212 | 196 |
| 231 | 3300025926 | Ga0207659_10160920 | Ga0207659_101609202 | 196 |
| 232 | 3300025926 | Ga0207659_10619584 | Ga0207659_106195841 | 196 |
| 233 | 3300025928 | Ga0207700_10494508 | Ga0207700_104945082 | 196 |
| 234 | 3300025933 | Ga0207706_10000848 | Ga0207706_100008483 | 196 |
| 235 | 3300025933 | Ga0207706_10269607 | Ga0207706_102696071 | 196 |
| 236 | 3300025934 | Ga0207686_10000201 | Ga0207686_1000020128 | 196 |
| 237 | 3300025935 | Ga0207709_10011036 | Ga0207709_100110364 | 196 |
| 238 | 3300025936 | Ga0207670_10065960 | Ga0207670_100659604 | 196 |
| 239 | 3300025937 | Ga0207669_10000885 | Ga0207669_1000088511 | 196 |
| 240 | 3300025937 | Ga0207669_10276102 | Ga0207669_102761022 | 196 |
| 241 | 3300025938 | Ga0207704_10002345 | Ga0207704_1000234510 | 196 |
| 242 | 3300025940 | Ga0207691_10154637 | Ga0207691_101546373 | 196 |
| 243 | 3300025940 | Ga0207691_10164759 | Ga0207691_101647593 | 196 |
| 244 | 3300025940 | Ga0207691_10288999 | Ga0207691_102889992 | 196 |
| 245 | 3300025941 | Ga0207711_10006077 | Ga0207711_100060773 | 196 |
| 246 | 3300025941 | Ga0207711_10154980 | Ga0207711_101549803 | 196 |
| 247 | 3300025942 | Ga0207689_10173239 | Ga0207689_101732393 | 196 |
| 248 | 3300025942 | Ga0207689_10359911 | Ga0207689_103599112 | 196 |
| 249 | 3300025944 | Ga0207661_10427868 | Ga0207661_104278683 | 196 |
| 250 | 3300025945 | Ga0207679_10018043 | Ga0207679_100180436 | 196 |
| 251 | 3300025945 | Ga0207679_10034422 | Ga0207679_100344223 | 196 |
| 252 | 3300025945 | Ga0207679_10083650 | Ga0207679_100836504 | 196 |
| 253 | 3300025945 | Ga0207679_10097168 | Ga0207679_100971684 | 196 |
| 254 | 3300025961 | Ga0207712_10008379 | Ga0207712_100083797 | 196 |
| 255 | 3300025961 | Ga0207712_10117842 | Ga0207712_101178423 | 196 |
| 256 | 3300025961 | Ga0207712_10435190 | Ga0207712_104351903 | 196 |
| 257 | 3300025972 | Ga0207668_10048982 | Ga0207668_100489823 | 196 |
| 258 | 3300025972 | Ga0207668_10250138 | Ga0207668_102501382 | 196 |
| 259 | 3300025981 | Ga0207640_10007499 | Ga0207640_100074993 | 196 |
| 260 | 3300025986 | Ga0207658_10057435 | Ga0207658_100574353 | 196 |
| 261 | 3300026035 | Ga0207703_10088690 | Ga0207703_100886903 | 196 |
| 262 | 3300026041 | Ga0207639_10486911 | Ga0207639_104869112 | 196 |
| 263 | 3300026041 | Ga0207639_10969204 | Ga0207639_109692042 | 196 |
| 264 | 3300026067 | Ga0207678_10145048 | Ga0207678_101450484 | 196 |
| 265 | 3300026067 | Ga0207678_10272391 | Ga0207678_102723913 | 196 |
| 266 | 3300026088 | Ga0207641_10835392 | Ga0207641_108353921 | 196 |
| 267 | 3300026089 | Ga0207648_10756722 | Ga0207648_107567221 | 196 |
| 268 | 3300026116 | Ga0207674_10316977 | Ga0207674_103169773 | 196 |
| 269 | 3300026118 | Ga0207675_100056569 | Ga0207675_1000565693 | 196 |
| 270 | 3300026118 | Ga0207675_100222674 | Ga0207675_1002226742 | 196 |
| 271 | 3300026118 | Ga0207675_100533773 | Ga0207675_1005337731 | 196 |
| 272 | 3300026121 | Ga0207683_10018893 | Ga0207683_100188933 | 196 |
| 273 | 3300027471 | Ga0209995_1010399 | Ga0209995_10103991 | 196 |
| 274 | 3300027614 | Ga0209970_1005970 | Ga0209970_10059703 | 196 |
| 275 | 3300027876 | Ga0209974_10007755 | Ga0209974_100077554 | 196 |
| 276 | 3300028380 | Ga0268265_10217107 | Ga0268265_102171074 | 196 |
| 277 | 3300028380 | Ga0268265_10339237 | Ga0268265_103392373 | 196 |
| 278 | 3300028380 | Ga0268265_10659992 | Ga0268265_106599922 | 196 |
| 279 | 3300028381 | Ga0268264_10040037 | Ga0268264_100400375 | 196 |
| 280 | 3300028381 | Ga0268264_10669913 | Ga0268264_106699132 | 196 |
| 281 | 3300030745 | Ga0316182_1284667 | Ga0316182_12846672 | 196 |
| 282 | 3300031548 | Ga0307408_100030877 | Ga0307408_1000308773 | 196 |
| 283 | 3300031548 | Ga0307408_100100038 | Ga0307408_1001000383 | 196 |
| 284 | 3300031548 | Ga0307408_100128545 | Ga0307408_1001285453 | 196 |
| 285 | 3300031548 | Ga0307408_100752092 | Ga0307408_1007520922 | 196 |
| 286 | 3300031691 | Ga0316579_10048627 | Ga0316579_100486273 | 196 |
| 287 | 3300031727 | Ga0316576_10058536 | Ga0316576_100585363 | 196 |
| 288 | 3300031728 | Ga0316578_10001246 | Ga0316578_100012465 | 196 |
| 289 | 3300031731 | Ga0307405_10010387 | Ga0307405_100103873 | 196 |
| 290 | 3300031731 | Ga0307405_10015832 | Ga0307405_100158323 | 196 |
| 291 | 3300031731 | Ga0307405_10513619 | Ga0307405_105136192 | 196 |
| 292 | 3300031733 | Ga0316577_10005627 | Ga0316577_100056273 | 196 |
| 293 | 3300031733 | Ga0316577_10008151 | Ga0316577_100081512 | 196 |
| 294 | 3300031824 | Ga0307413_10010848 | Ga0307413_100108482 | 196 |
| 295 | 3300031824 | Ga0307413_10011241 | Ga0307413_100112416 | 196 |
| 296 | 3300031824 | Ga0307413_10020474 | Ga0307413_100204746 | 196 |
| 297 | 3300031824 | Ga0307413_10026919 | Ga0307413_100269196 | 196 |
| 298 | 3300031824 | Ga0307413_10068690 | Ga0307413_100686903 | 196 |
| 299 | 3300031824 | Ga0307413_10228898 | Ga0307413_102288982 | 196 |
| 300 | 3300031852 | Ga0307410_10001224 | Ga0307410_1000122410 | 196 |
| 301 | 3300031852 | Ga0307410_10001448 | Ga0307410_100014484 | 196 |
| 302 | 3300031852 | Ga0307410_10023400 | Ga0307410_100234003 | 196 |
| 303 | 3300031852 | Ga0307410_10046243 | Ga0307410_100462435 | 196 |
| 304 | 3300031852 | Ga0307410_10189333 | Ga0307410_101893333 | 196 |
| 305 | 3300031852 | Ga0307410_10414061 | Ga0307410_104140612 | 196 |
| 306 | 3300031901 | Ga0307406_10024221 | Ga0307406_100242213 | 196 |
| 307 | 3300031901 | Ga0307406_10047871 | Ga0307406_100478714 | 196 |
| 308 | 3300031901 | Ga0307406_10064849 | Ga0307406_100648493 | 196 |
| 309 | 3300031901 | Ga0307406_10092163 | Ga0307406_100921633 | 196 |
| 310 | 3300031901 | Ga0307406_10226913 | Ga0307406_102269132 | 196 |
| 311 | 3300031901 | Ga0307406_10388662 | Ga0307406_103886622 | 196 |
| 312 | 3300031903 | Ga0307407_10003455 | Ga0307407_100034554 | 196 |
| 313 | 3300031903 | Ga0307407_10006596 | Ga0307407_100065967 | 196 |
| 314 | 3300031903 | Ga0307407_10012302 | Ga0307407_100123024 | 196 |
| 315 | 3300031903 | Ga0307407_10014158 | Ga0307407_100141586 | 196 |
| 316 | 3300031903 | Ga0307407_10122801 | Ga0307407_101228012 | 196 |
| 317 | 3300031903 | Ga0307407_10156862 | Ga0307407_101568623 | 196 |
| 318 | 3300031903 | Ga0307407_10362994 | Ga0307407_103629941 | 196 |
| 319 | 3300031911 | Ga0307412_10016230 | Ga0307412_100162307 | 196 |
| 320 | 3300031911 | Ga0307412_10095716 | Ga0307412_100957162 | 196 |
| 321 | 3300031995 | Ga0307409_100003528 | Ga0307409_1000035285 | 196 |
| 322 | 3300031995 | Ga0307409_100016327 | Ga0307409_1000163277 | 196 |
| 323 | 3300031995 | Ga0307409_100051378 | Ga0307409_1000513783 | 196 |
| 324 | 3300031995 | Ga0307409_100062269 | Ga0307409_1000622695 | 196 |
| 325 | 3300031995 | Ga0307409_100134150 | Ga0307409_1001341501 | 196 |
| 326 | 3300031995 | Ga0307409_100343473 | Ga0307409_1003434732 | 196 |
| 327 | 3300031995 | Ga0307409_100388310 | Ga0307409_1003883101 | 196 |
| 328 | 3300031995 | Ga0307409_100471522 | Ga0307409_1004715222 | 196 |
| 329 | 3300032002 | Ga0307416_100000541 | Ga0307416_10000054116 | 196 |
| 330 | 3300032002 | Ga0307416_100007241 | Ga0307416_1000072417 | 196 |
| 331 | 3300032002 | Ga0307416_100343901 | Ga0307416_1003439013 | 196 |
| 332 | 3300032002 | Ga0307416_100474261 | Ga0307416_1004742613 | 196 |
| 333 | 3300032002 | Ga0307416_100635177 | Ga0307416_1006351772 | 196 |
| 334 | 3300032004 | Ga0307414_10005050 | Ga0307414_100050504 | 196 |
| 335 | 3300032004 | Ga0307414_10025824 | Ga0307414_100258243 | 196 |
| 336 | 3300032004 | Ga0307414_10040556 | Ga0307414_100405565 | 196 |
| 337 | 3300032004 | Ga0307414_10196999 | Ga0307414_101969992 | 196 |
| 338 | 3300032004 | Ga0307414_10472672 | Ga0307414_104726722 | 196 |
| 339 | 3300032005 | Ga0307411_10000173 | Ga0307411_1000017310 | 196 |
| 340 | 3300032005 | Ga0307411_10005030 | Ga0307411_100050303 | 196 |
| 341 | 3300032005 | Ga0307411_10069195 | Ga0307411_100691953 | 196 |
| 342 | 3300032005 | Ga0307411_10468139 | Ga0307411_104681393 | 196 |
| 343 | 3300032005 | Ga0307411_10760663 | Ga0307411_107606632 | 196 |
| 344 | 3300032005 | Ga0307411_10780622 | Ga0307411_107806221 | 196 |
| 345 | 3300032126 | Ga0307415_100000895 | Ga0307415_1000008956 | 196 |
| 346 | 3300032126 | Ga0307415_100067475 | Ga0307415_1000674754 | 196 |
| 347 | 3300032126 | Ga0307415_100141234 | Ga0307415_1001412343 | 196 |
| 348 | 3300032137 | Ga0316585_10021498 | Ga0316585_100214981 | 196 |
| 349 | 3300034817 | Ga0373948_0085149 | Ga0373948_0085149_113_703 | 196 |
| 350 | 3300034818 | Ga0373950_0094111 | Ga0373950_0094111_11_601 | 196 |
| 351 | 3300034820 | Ga0373959_0042392 | Ga0373959_0042392_134_724 | 196 |
| 352 | 3300035088 | Ga0373940_0009626 | Ga0373940_0009626_1223_1813 | 196 |
| 353 | 3300035088 | Ga0373940_0025053 | Ga0373940_0025053_615_1205 | 196 |
| 354 | 3300035090 | Ga0373949_0021585 | Ga0373949_0021585_255_845 | 196 |
| 355 | 3300035115 | Ga0373941_0029835 | Ga0373941_0029835_273_863 | 196 |
| 356 | 3300035121 | Ga0373960_0097004 | Ga0373960_0097004_26_616 | 196 |
| 357 | 3300035241 | Ga0373961_0047624 | Ga0373961_0047624_229_819 | 196 |
| 358 | 3300035242 | Ga0373962_0092088 | Ga0373962_0092088_184_774 | 196 |
| 359 | 3300035691 | Ga0373931_0013435 | Ga0373931_0013435_550_1140 | 196 |
| 360 | 3300035691 | Ga0373931_0032371 | Ga0373931_0032371_2044_2634 | 196 |
| 361 | 3300036647 | Ga0316582_0015308 | Ga0316582_0015308_1082_1681 | 196 |
| 362 | 3300036647 | Ga0316582_0036767 | Ga0316582_0036767_550_1149 | 196 |
| 363 | 3300036647 | Ga0316582_0183693 | Ga0316582_0183693_348_947 | 196 |
| 364 | 3300036712 | Ga0316584_0049440 | Ga0316584_0049440_534_1133 | 196 |
| 365 | 3300038996 | Ga0242420_026140 | Ga0242420_026140_358_948 | 196 |
| 366 | 3300038996 | Ga0242420_035811 | Ga0242420_035811_311_901 | 196 |
| 367 | 3300039093 | Ga0400489_30506 | Ga0400489_30506_4883_5473 | 196 |
| 368 | 3300041404 | Ga0439436_0053281 | Ga0439436_0053281_53_643 | 196 |
| 369 | 3300041406 | Ga0439439_0006898 | Ga0439439_0006898_504_1094 | 196 |
| 370 | 3300041406 | Ga0439439_0074907 | Ga0439439_0074907_86_676 | 196 |
| 371 | 3300041411 | Ga0439466_0145326 | Ga0439466_0145326_16_606 | 196 |
| 372 | 3300042015 | Ga0439462_0024787 | Ga0439462_0024787_550_1140 | 196 |
| 373 | 3300042125 | Ga0450923_036877 | Ga0450923_036877_92_682 | 196 |
| 374 | 3300042132 | Ga0450895_005399 | Ga0450895_005399_23_613 | 196 |
| 375 | 3300042133 | Ga0450896_010855 | Ga0450896_010855_464_1054 | 196 |
| 376 | 3300042156 | Ga0439446_0117866 | Ga0439446_0117866_243_833 | 196 |
| 377 | 3300042438 | Ga0439459_0011765 | Ga0439459_0011765_638_1228 | 196 |
| 378 | 3300042461 | Ga0439460_0121843 | Ga0439460_0121843_120_710 | 196 |
| 379 | 3300042876 | Ga0451577_0008058 | Ga0451577_0008058_6939_7529 | 196 |
| 380 | 3300042876 | Ga0451577_0170318 | Ga0451577_0170318_588_1178 | 196 |
| 381 | 3300042993 | Ga0439440_0078259 | Ga0439440_0078259_159_749 | 196 |
| 382 | 3300044706 | Ga0466964_0071734 | Ga0466964_0071734_316_906 | 196 |
| 383 | 3300045049 | Ga0466959_0517578 | Ga0466959_0517578_81_692 | 196 |
| 384 | 3300045051 | Ga0451576_0127974 | Ga0451576_0127974_1468_2058 | 196 |
| 385 | 3300046455 | Ga0495603_0033578 | Ga0495603_0033578_2263_2853 | 196 |
| 386 | 3300046455 | Ga0495603_0127260 | Ga0495603_0127260_227_817 | 196 |
| 387 | 3300046475 | Ga0495639_0334731 | Ga0495639_0334731_148_738 | 196 |
| 388 | 3300046499 | Ga0495594_0033430 | Ga0495594_0033430_1661_2251 | 196 |
| 389 | 3300046558 | Ga0495633_0251696 | Ga0495633_0251696_110_700 | 196 |
| 390 | 3300048903 | Ga0496100_0144016 | Ga0496100_0144016_939_1529 | 196 |
| 391 | 3300048903 | Ga0496100_0251964 | Ga0496100_0251964_195_785 | 196 |
| 392 | 3300048904 | Ga0496101_0023497 | Ga0496101_0023497_2698_3288 | 196 |
| 393 | 3300048904 | Ga0496101_0136016 | Ga0496101_0136016_1050_1640 | 196 |
| 394 | 3300048904 | Ga0496101_0265528 | Ga0496101_0265528_546_1136 | 196 |
| 395 | 3300048904 | Ga0496101_0272323 | Ga0496101_0272323_615_1205 | 196 |
| 396 | 3300048904 | Ga0496101_0401276 | Ga0496101_0401276_231_821 | 196 |
| 397 | 3300048905 | Ga0496102_0019829 | Ga0496102_0019829_2651_3241 | 196 |
| 398 | 3300048905 | Ga0496102_0100065 | Ga0496102_0100065_2051_2641 | 196 |
| 399 | 3300048905 | Ga0496102_0134628 | Ga0496102_0134628_841_1431 | 196 |
| 400 | 3300048905 | Ga0496102_0188462 | Ga0496102_0188462_235_825 | 196 |
| 401 | 3300048905 | Ga0496102_0196132 | Ga0496102_0196132_421_1011 | 196 |
| 402 | 3300048906 | Ga0496103_0012347 | Ga0496103_0012347_532_1122 | 196 |
| 403 | 3300048906 | Ga0496103_0313746 | Ga0496103_0313746_404_994 | 196 |
| 404 | 3300048907 | Ga0496104_0008614 | Ga0496104_0008614_6312_6902 | 196 |
| 405 | 3300048907 | Ga0496104_0014243 | Ga0496104_0014243_3786_4376 | 196 |
| 406 | 3300048907 | Ga0496104_0065065 | Ga0496104_0065065_2084_2674 | 196 |
| 407 | 3300048908 | Ga0496105_0107876 | Ga0496105_0107876_979_1569 | 196 |
| 408 | 3300048908 | Ga0496105_0116781 | Ga0496105_0116781_865_1455 | 196 |
| 409 | 3300048908 | Ga0496105_0224633 | Ga0496105_0224633_86_676 | 196 |
| 410 | 3300048908 | Ga0496105_0423589 | Ga0496105_0423589_39_629 | 196 |
| 411 | 3300048909 | Ga0496106_0079117 | Ga0496106_0079117_1174_1764 | 196 |
| 412 | 3300048909 | Ga0496106_0370254 | Ga0496106_0370254_108_698 | 196 |
| 413 | 3300048910 | Ga0496107_0042676 | Ga0496107_0042676_2090_2680 | 196 |
| 414 | 3300048910 | Ga0496107_0081080 | Ga0496107_0081080_1476_2066 | 196 |
| 415 | 3300048911 | Ga0496108_0012560 | Ga0496108_0012560_4078_4668 | 196 |
| 416 | 3300048911 | Ga0496108_0022374 | Ga0496108_0022374_3083_3673 | 196 |
| 417 | 3300048911 | Ga0496108_0052467 | Ga0496108_0052467_2240_2830 | 196 |
| 418 | 3300048911 | Ga0496108_0073537 | Ga0496108_0073537_1116_1706 | 196 |
| 419 | 3300048911 | Ga0496108_0168371 | Ga0496108_0168371_409_999 | 196 |
| 420 | 3300048912 | Ga0496109_0004685 | Ga0496109_0004685_2953_3543 | 196 |
| 421 | 3300048912 | Ga0496109_0029731 | Ga0496109_0029731_3442_4032 | 196 |
| 422 | 3300048912 | Ga0496109_0053147 | Ga0496109_0053147_2162_2752 | 196 |
| 423 | 3300048912 | Ga0496109_0090946 | Ga0496109_0090946_1526_2116 | 196 |
| 424 | 3300048912 | Ga0496109_0316797 | Ga0496109_0316797_35_625 | 196 |
| 425 | 3300048913 | Ga0496110_0003860 | Ga0496110_0003860_8277_8867 | 196 |
| 426 | 3300048913 | Ga0496110_0011067 | Ga0496110_0011067_4062_4652 | 196 |
| 427 | 3300048913 | Ga0496110_0031150 | Ga0496110_0031150_903_1493 | 196 |
| 428 | 3300048913 | Ga0496110_0189729 | Ga0496110_0189729_548_1138 | 196 |
| 429 | 3300048913 | Ga0496110_0197832 | Ga0496110_0197832_754_1344 | 196 |
| 430 | 3300048914 | Ga0496111_0003621 | Ga0496111_0003621_5937_6527 | 196 |
| 431 | 3300048914 | Ga0496111_0081193 | Ga0496111_0081193_1663_2253 | 196 |
| 432 | 3300048914 | Ga0496111_0263609 | Ga0496111_0263609_102_692 | 196 |
| 433 | 3300048914 | Ga0496111_0380705 | Ga0496111_0380705_437_1027 | 196 |
| 434 | 3300048915 | Ga0496112_0008505 | Ga0496112_0008505_4379_4969 | 196 |
| 435 | 3300048915 | Ga0496112_0072542 | Ga0496112_0072542_597_1187 | 196 |
| 436 | 3300048915 | Ga0496112_0119467 | Ga0496112_0119467_643_1233 | 196 |
| 437 | 3300048916 | Ga0496113_0001290 | Ga0496113_0001290_2644_3234 | 196 |
| 438 | 3300048916 | Ga0496113_0010962 | Ga0496113_0010962_1378_1968 | 196 |
| 439 | 3300048916 | Ga0496113_0021911 | Ga0496113_0021911_2349_2939 | 196 |
| 440 | 3300048917 | Ga0496114_1072555 | Ga0496114_1072555_28_618 | 196 |
| 441 | 3300048918 | Ga0496115_0044110 | Ga0496115_0044110_2417_3007 | 196 |
| 442 | 3300048918 | Ga0496115_0159372 | Ga0496115_0159372_221_811 | 196 |
| 443 | 3300049568 | Ga0501031_0003016 | Ga0501031_0003016_6207_6797 | 196 |
| 444 | 3300049568 | Ga0501031_0091586 | Ga0501031_0091586_529_1119 | 196 |
| 445 | 3300049568 | Ga0501031_0203720 | Ga0501031_0203720_524_1114 | 196 |
| 446 | 3300049569 | Ga0501032_0064982 | Ga0501032_0064982_943_1533 | 196 |
| 447 | 3300049570 | Ga0501033_0049373 | Ga0501033_0049373_325_915 | 196 |
| 448 | 3300049570 | Ga0501033_0106855 | Ga0501033_0106855_1089_1679 | 196 |
| 449 | 3300049570 | Ga0501033_0413635 | Ga0501033_0413635_260_850 | 196 |
| 450 | 3300049570 | Ga0501033_0447619 | Ga0501033_0447619_234_824 | 196 |
| 451 | 3300049571 | Ga0501034_0248416 | Ga0501034_0248416_701_1291 | 196 |
| 452 | 3300049572 | Ga0501036_0075815 | Ga0501036_0075815_1162_1752 | 196 |
| 453 | 3300049572 | Ga0501036_0103083 | Ga0501036_0103083_772_1362 | 196 |
| 454 | 3300049572 | Ga0501036_0176536 | Ga0501036_0176536_770_1360 | 196 |
| 455 | 3300049572 | Ga0501036_0198967 | Ga0501036_0198967_365_955 | 196 |
| 456 | 3300049572 | Ga0501036_0368081 | Ga0501036_0368081_25_615 | 196 |
| 457 | 3300049573 | Ga0501037_0074331 | Ga0501037_0074331_305_895 | 196 |
| 458 | 3300049573 | Ga0501037_0365847 | Ga0501037_0365847_331_921 | 196 |
| 459 | 3300049574 | Ga0501038_0021422 | Ga0501038_0021422_1421_2011 | 196 |
| 460 | 3300049574 | Ga0501038_0085413 | Ga0501038_0085413_202_792 | 196 |
| 461 | 3300049574 | Ga0501038_0599816 | Ga0501038_0599816_188_778 | 196 |
| 462 | 3300049575 | Ga0501039_0015901 | Ga0501039_0015901_1909_2499 | 196 |
| 463 | 3300049575 | Ga0501039_0067424 | Ga0501039_0067424_604_1194 | 196 |
| 464 | 3300049575 | Ga0501039_0302051 | Ga0501039_0302051_445_1035 | 196 |
| 465 | 3300049576 | Ga0501040_0049355 | Ga0501040_0049355_806_1396 | 196 |
| 466 | 3300049576 | Ga0501040_0049708 | Ga0501040_0049708_925_1515 | 196 |
| 467 | 3300049576 | Ga0501040_0112023 | Ga0501040_0112023_1121_1711 | 196 |
| 468 | 3300049576 | Ga0501040_0429170 | Ga0501040_0429170_322_912 | 196 |
| 469 | 3300049577 | Ga0501041_0011952 | Ga0501041_0011952_1896_2486 | 196 |
| 470 | 3300049577 | Ga0501041_0032929 | Ga0501041_0032929_1320_1910 | 196 |
| 471 | 3300049577 | Ga0501041_0072095 | Ga0501041_0072095_921_1511 | 196 |
| 472 | 3300049578 | Ga0501042_0008450 | Ga0501042_0008450_744_1334 | 196 |
| 473 | 3300049578 | Ga0501042_0069182 | Ga0501042_0069182_799_1389 | 196 |
| 474 | 3300049578 | Ga0501042_0154820 | Ga0501042_0154820_40_630 | 196 |
| 475 | 3300049579 | Ga0501043_0110482 | Ga0501043_0110482_322_912 | 196 |
| 476 | 3300049580 | Ga0501046_0053529 | Ga0501046_0053529_256_846 | 196 |
| 477 | 3300049580 | Ga0501046_0132337 | Ga0501046_0132337_755_1345 | 196 |
| 478 | 3300049580 | Ga0501046_0188308 | Ga0501046_0188308_935_1525 | 196 |
| 479 | 3300049582 | Ga0501048_0033076 | Ga0501048_0033076_925_1515 | 196 |
| 480 | 3300049582 | Ga0501048_0117375 | Ga0501048_0117375_208_798 | 196 |
| 481 | 3300049583 | Ga0501067_0129190 | Ga0501067_0129190_767_1357 | 196 |
| 482 | 3300049584 | Ga0501068_0121591 | Ga0501068_0121591_872_1462 | 196 |
| 483 | 3300049585 | Ga0501069_0185437 | Ga0501069_0185437_248_838 | 196 |
| 484 | 3300049585 | Ga0501069_0482735 | Ga0501069_0482735_63_653 | 196 |
| 485 | 3300049587 | Ga0501071_0008445 | Ga0501071_0008445_2433_3023 | 196 |
| 486 | 3300049587 | Ga0501071_0010088 | Ga0501071_0010088_4504_5094 | 196 |
| 487 | 3300049587 | Ga0501071_0212523 | Ga0501071_0212523_285_875 | 196 |
| 488 | 3300049588 | Ga0501072_0010662 | Ga0501072_0010662_4360_4950 | 196 |
| 489 | 3300049588 | Ga0501072_0033950 | Ga0501072_0033950_2623_3213 | 196 |
| 490 | 3300049588 | Ga0501072_0253205 | Ga0501072_0253205_683_1273 | 196 |
| 491 | 3300049589 | Ga0501073_0228603 | Ga0501073_0228603_175_765 | 196 |
| 492 | 3300049589 | Ga0501073_0239775 | Ga0501073_0239775_107_697 | 196 |
| 493 | 3300049590 | Ga0501074_0021223 | Ga0501074_0021223_1301_1891 | 196 |
| 494 | 3300049590 | Ga0501074_0205234 | Ga0501074_0205234_285_875 | 196 |
| 495 | 3300049590 | Ga0501074_0208335 | Ga0501074_0208335_29_619 | 196 |
| 496 | 3300049591 | Ga0501075_0005163 | Ga0501075_0005163_5973_6563 | 196 |
| 497 | 3300049591 | Ga0501075_0006152 | Ga0501075_0006152_6478_7068 | 196 |
| 498 | 3300049591 | Ga0501075_0480604 | Ga0501075_0480604_282_872 | 196 |
| 499 | 3300049592 | Ga0501076_0014150 | Ga0501076_0014150_1650_2240 | 196 |
| 500 | 3300049592 | Ga0501076_0034669 | Ga0501076_0034669_2373_2963 | 196 |
| 501 | 3300049592 | Ga0501076_0065852 | Ga0501076_0065852_1312_1902 | 196 |
| 502 | 3300049592 | Ga0501076_0264329 | Ga0501076_0264329_513_1103 | 196 |
| 503 | 3300049592 | Ga0501076_0480006 | Ga0501076_0480006_28_618 | 196 |
| 504 | 3300049593 | Ga0501077_0000834 | Ga0501077_0000834_2448_3038 | 196 |
| 505 | 3300049593 | Ga0501077_0011587 | Ga0501077_0011587_1803_2393 | 196 |
| 506 | 3300049593 | Ga0501077_0260843 | Ga0501077_0260843_376_966 | 196 |
| 507 | 3300049656 | Ga0501209_060080 | Ga0501209_060080_108_698 | 196 |
| 508 | 3300049661 | Ga0501217_040063 | Ga0501217_040063_268_858 | 196 |
| 509 | 3300049669 | Ga0501235_035235 | Ga0501235_035235_437_1027 | 196 |
| 510 | 3300049675 | Ga0501243_019656 | Ga0501243_019656_56_646 | 196 |
| 511 | 3300049679 | Ga0501249_090899 | Ga0501249_090899_124_714 | 196 |
| 512 | 3300049741 | Ga0501079_0017498 | Ga0501079_0017498_2476_3066 | 196 |
| 513 | 3300049741 | Ga0501079_0031892 | Ga0501079_0031892_1012_1602 | 196 |
| 514 | 3300049741 | Ga0501079_0039426 | Ga0501079_0039426_2108_2698 | 196 |
| 515 | 3300049741 | Ga0501079_0144760 | Ga0501079_0144760_73_663 | 196 |
| 516 | 3300049741 | Ga0501079_0259801 | Ga0501079_0259801_551_1141 | 196 |
| 517 | 3300049742 | Ga0501080_0093193 | Ga0501080_0093193_1316_1906 | 196 |
| 518 | 3300049742 | Ga0501080_0169409 | Ga0501080_0169409_641_1231 | 196 |
| 519 | 3300049742 | Ga0501080_0854687 | Ga0501080_0854687_11_601 | 196 |
| 520 | 3300049743 | Ga0501081_0018822 | Ga0501081_0018822_583_1173 | 196 |
| 521 | 3300049743 | Ga0501081_0027762 | Ga0501081_0027762_207_797 | 196 |
| 522 | 3300049743 | Ga0501081_0194161 | Ga0501081_0194161_463_1053 | 196 |
| 523 | 3300049743 | Ga0501081_0197211 | Ga0501081_0197211_364_954 | 196 |
| 524 | 3300049744 | Ga0501083_0084399 | Ga0501083_0084399_621_1211 | 196 |
| 525 | 3300049768 | Ga0501271_009461 | Ga0501271_009461_311_901 | 196 |
| 526 | 3300049822 | Ga0501035_0009554 | Ga0501035_0009554_734_1324 | 196 |
| 527 | 3300049822 | Ga0501035_0763264 | Ga0501035_0763264_150_740 | 196 |
| 528 | 3300049824 | Ga0501045_0008967 | Ga0501045_0008967_5683_6273 | 196 |
| 529 | 3300049824 | Ga0501045_0034289 | Ga0501045_0034289_108_698 | 196 |
| 530 | 3300049824 | Ga0501045_0147488 | Ga0501045_0147488_770_1360 | 196 |
| 531 | 3300049824 | Ga0501045_0385216 | Ga0501045_0385216_298_888 | 196 |
| 532 | 3300050507 | nmdc:mga05p37_378520_c1 | nmdc:mga05p37_378520_c1_781_1371 | 196 |
| 533 | 3300050512 | nmdc:mga0n895_237478_c1 | nmdc:mga0n895_237478_c1_805_1395 | 196 |
| 534 | 3300050512 | nmdc:mga0n895_321481_c1 | nmdc:mga0n895_321481_c1_886_1476 | 196 |
| 535 | 3300050513 | nmdc:mga0rr50_219609_c1 | nmdc:mga0rr50_219609_c1_55_645 | 196 |
| 536 | 3300050515 | nmdc:mga0a205_12549_c1 | nmdc:mga0a205_12549_c1_2636_3226 | 196 |
| 537 | 3300050515 | nmdc:mga0a205_241057_c1 | nmdc:mga0a205_241057_c1_249_839 | 196 |
| 538 | 3300054114 | Ga0501084_0068622 | Ga0501084_0068622_186_776 | 196 |
| 539 | 3300054114 | Ga0501084_0076412 | Ga0501084_0076412_2205_2795 | 196 |
| 540 | 3300054114 | Ga0501084_0086287 | Ga0501084_0086287_1222_1812 | 196 |
| 541 | 3300054114 | Ga0501084_0102515 | Ga0501084_0102515_887_1477 | 196 |
| 542 | 3300054114 | Ga0501084_0130341 | Ga0501084_0130341_576_1166 | 196 |
| 543 | 3300054114 | Ga0501084_1105031 | Ga0501084_1105031_48_638 | 196 |
| 544 | 3300059421 | Ga0590071_000641 | Ga0590071_000641_2371_2961 | 196 |
| 545 | 3300059421 | Ga0590071_013948 | Ga0590071_013948_424_1014 | 196 |
| 546 | 3300059421 | Ga0590071_108556 | Ga0590071_108556_18_608 | 196 |
| 547 | 3300059424 | Ga0590075_003140 | Ga0590075_003140_28_618 | 196 |
| 548 | 3300059426 | Ga0590077_003991 | Ga0590077_003991_1940_2530 | 196 |
| 549 | 3300060353 | Ga0501082_0010117 | Ga0501082_0010117_2394_2984 | 196 |
| 550 | 3300060353 | Ga0501082_0012220 | Ga0501082_0012220_3231_3821 | 196 |
| 551 | 3300060353 | Ga0501082_0015371 | Ga0501082_0015371_2454_3044 | 196 |
| 552 | 3300061734 | Ga0530510_0119214 | Ga0530510_0119214_621_1211 | 196 |
| 553 | 3300061734 | Ga0530510_0139586 | Ga0530510_0139586_1022_1612 | 196 |
| 554 | 3300061734 | Ga0530510_0311488 | Ga0530510_0311488_471_1061 | 196 |
| 555 | 3300061734 | Ga0530510_0352835 | Ga0530510_0352835_396_986 | 196 |
| 556 | 3300036647 | Ga0316582_0094522 | Ga0316582_0094522_258_860 | 197 |
| 557 | 3300037588 | Ga0316581_0033546 | Ga0316581_0033546_67_669 | 197 |
| 558 | 3300042876 | Ga0451577_0152166 | Ga0451577_0152166_698_1318 | 197 |
| 559 | 3300045051 | Ga0451576_0005380 | Ga0451576_0005380_8573_9193 | 197 |
| 560 | 3300005295 | Ga0065707_10013151 | Ga0065707_100131512 | 198 |
| 561 | 3300005406 | Ga0070703_10018711 | Ga0070703_100187112 | 198 |
| 562 | 3300005435 | Ga0070714_100000067 | Ga0070714_10000006785 | 198 |
| 563 | 3300005436 | Ga0070713_100238053 | Ga0070713_1002380532 | 198 |
| 564 | 3300005440 | Ga0070705_100194168 | Ga0070705_1001941681 | 198 |
| 565 | 3300005440 | Ga0070705_100295623 | Ga0070705_1002956232 | 198 |
| 566 | 3300005444 | Ga0070694_100636319 | Ga0070694_1006363191 | 198 |
| 567 | 3300005445 | Ga0070708_100009481 | Ga0070708_1000094812 | 198 |
| 568 | 3300005445 | Ga0070708_100079412 | Ga0070708_1000794122 | 198 |
| 569 | 3300005445 | Ga0070708_100180664 | Ga0070708_1001806642 | 198 |
| 570 | 3300005445 | Ga0070708_100325341 | Ga0070708_1003253413 | 198 |
| 571 | 3300005445 | Ga0070708_100627083 | Ga0070708_1006270831 | 198 |
| 572 | 3300005467 | Ga0070706_100001060 | Ga0070706_1000010606 | 198 |
| 573 | 3300005467 | Ga0070706_100067957 | Ga0070706_1000679572 | 198 |
| 574 | 3300005467 | Ga0070706_100448758 | Ga0070706_1004487581 | 198 |
| 575 | 3300005467 | Ga0070706_100537284 | Ga0070706_1005372842 | 198 |
| 576 | 3300005468 | Ga0070707_100448094 | Ga0070707_1004480941 | 198 |
| 577 | 3300005468 | Ga0070707_100658805 | Ga0070707_1006588051 | 198 |
| 578 | 3300005468 | Ga0070707_100899774 | Ga0070707_1008997742 | 198 |
| 579 | 3300005471 | Ga0070698_100000782 | Ga0070698_1000007823 | 198 |
| 580 | 3300005471 | Ga0070698_100113587 | Ga0070698_1001135873 | 198 |
| 581 | 3300005471 | Ga0070698_100608205 | Ga0070698_1006082052 | 198 |
| 582 | 3300005518 | Ga0070699_100146642 | Ga0070699_1001466423 | 198 |
| 583 | 3300005518 | Ga0070699_100252969 | Ga0070699_1002529691 | 198 |
| 584 | 3300005518 | Ga0070699_100541860 | Ga0070699_1005418603 | 198 |
| 585 | 3300005518 | Ga0070699_100595732 | Ga0070699_1005957321 | 198 |
| 586 | 3300005536 | Ga0070697_100379975 | Ga0070697_1003799752 | 198 |
| 587 | 3300005539 | Ga0068853_100144092 | Ga0068853_1001440921 | 198 |
| 588 | 3300005546 | Ga0070696_100307424 | Ga0070696_1003074243 | 198 |
| 589 | 3300005546 | Ga0070696_101068549 | Ga0070696_1010685491 | 198 |
| 590 | 3300005548 | Ga0070665_100217308 | Ga0070665_1002173082 | 198 |
| 591 | 3300005549 | Ga0070704_100014384 | Ga0070704_1000143843 | 198 |
| 592 | 3300005563 | Ga0068855_100428231 | Ga0068855_1004282312 | 198 |
| 593 | 3300005614 | Ga0068856_100033924 | Ga0068856_1000339242 | 198 |
| 594 | 3300006028 | Ga0070717_10023259 | Ga0070717_100232593 | 198 |
| 595 | 3300006173 | Ga0070716_100036618 | Ga0070716_1000366183 | 198 |
| 596 | 3300006173 | Ga0070716_100116911 | Ga0070716_1001169112 | 198 |
| 597 | 3300006175 | Ga0070712_100009514 | Ga0070712_1000095142 | 198 |
| 598 | 3300006844 | Ga0075428_100156802 | Ga0075428_1001568023 | 198 |
| 599 | 3300006847 | Ga0075431_100010382 | Ga0075431_1000103829 | 198 |
| 600 | 3300006852 | Ga0075433_10090778 | Ga0075433_100907782 | 198 |
| 601 | 3300006871 | Ga0075434_100196783 | Ga0075434_1001967832 | 198 |
| 602 | 3300006880 | Ga0075429_100020232 | Ga0075429_1000202323 | 198 |
| 603 | 3300007076 | Ga0075435_100074302 | Ga0075435_1000743023 | 198 |
| 604 | 3300007076 | Ga0075435_100347210 | Ga0075435_1003472102 | 198 |
| 605 | 3300009147 | Ga0114129_10078848 | Ga0114129_100788483 | 198 |
| 606 | 3300009147 | Ga0114129_10239225 | Ga0114129_102392253 | 198 |
| 607 | 3300009147 | Ga0114129_10243733 | Ga0114129_102437334 | 198 |
| 608 | 3300009147 | Ga0114129_10290366 | Ga0114129_102903661 | 198 |
| 609 | 3300009147 | Ga0114129_10531447 | Ga0114129_105314472 | 198 |
| 610 | 3300009147 | Ga0114129_11707085 | Ga0114129_117070851 | 198 |
| 611 | 3300009174 | Ga0105241_10214673 | Ga0105241_102146732 | 198 |
| 612 | 3300021388 | Ga0213875_10046672 | Ga0213875_100466723 | 198 |
| 613 | 3300025885 | Ga0207653_10029888 | Ga0207653_100298882 | 198 |
| 614 | 3300025910 | Ga0207684_10000159 | Ga0207684_1000015917 | 198 |
| 615 | 3300025910 | Ga0207684_10049454 | Ga0207684_100494545 | 198 |
| 616 | 3300025910 | Ga0207684_10081808 | Ga0207684_100818082 | 198 |
| 617 | 3300025910 | Ga0207684_10635453 | Ga0207684_106354531 | 198 |
| 618 | 3300025911 | Ga0207654_10204764 | Ga0207654_102047642 | 198 |
| 619 | 3300025922 | Ga0207646_10015191 | Ga0207646_1001519111 | 198 |
| 620 | 3300025922 | Ga0207646_10088117 | Ga0207646_100881172 | 198 |
| 621 | 3300025922 | Ga0207646_10770538 | Ga0207646_107705382 | 198 |
| 622 | 3300025922 | Ga0207646_10827365 | Ga0207646_108273652 | 198 |
| 623 | 3300025928 | Ga0207700_10076419 | Ga0207700_100764192 | 198 |
| 624 | 3300025929 | Ga0207664_10000005 | Ga0207664_10000005397 | 198 |
| 625 | 3300025939 | Ga0207665_10201555 | Ga0207665_102015552 | 198 |
| 626 | 3300025939 | Ga0207665_10360195 | Ga0207665_103601952 | 198 |
| 627 | 3300025949 | Ga0207667_10432950 | Ga0207667_104329503 | 198 |
| 628 | 3300026035 | Ga0207703_11268826 | Ga0207703_112688261 | 198 |
| 629 | 3300026041 | Ga0207639_10631223 | Ga0207639_106312231 | 198 |
| 630 | 3300028800 | Ga0265338_10019132 | Ga0265338_100191324 | 198 |
| 631 | 3300031665 | Ga0316575_10067288 | Ga0316575_100672881 | 198 |
| 632 | 3300031711 | Ga0265314_10179587 | Ga0265314_101795872 | 198 |
| 633 | 3300031727 | Ga0316576_10015588 | Ga0316576_100155883 | 198 |
| 634 | 3300031727 | Ga0316576_10125227 | Ga0316576_101252273 | 198 |
| 635 | 3300031727 | Ga0316576_10418355 | Ga0316576_104183552 | 198 |
| 636 | 3300031727 | Ga0316576_10468535 | Ga0316576_104685352 | 198 |
| 637 | 3300031727 | Ga0316576_10798224 | Ga0316576_107982241 | 198 |
| 638 | 3300031728 | Ga0316578_10360432 | Ga0316578_103604322 | 198 |
| 639 | 3300031733 | Ga0316577_10017018 | Ga0316577_100170184 | 198 |
| 640 | 3300031733 | Ga0316577_10022869 | Ga0316577_100228692 | 198 |
| 641 | 3300032137 | Ga0316585_10047429 | Ga0316585_100474291 | 198 |
| 642 | 3300035089 | Ga0373944_0009412 | Ga0373944_0009412_1752_2354 | 198 |
| 643 | 3300035170 | Ga0373943_0029867 | Ga0373943_0029867_97_699 | 198 |
| 644 | 3300035398 | Ga0316574_0075215 | Ga0316574_0075215_44_643 | 198 |
| 645 | 3300035398 | Ga0316574_0113155 | Ga0316574_0113155_869_1519 | 198 |
| 646 | 3300035692 | Ga0373935_0029116 | Ga0373935_0029116_724_1326 | 198 |
| 647 | 3300036647 | Ga0316582_0055441 | Ga0316582_0055441_1331_1930 | 198 |
| 648 | 3300036647 | Ga0316582_0197377 | Ga0316582_0197377_58_657 | 198 |
| 649 | 3300036647 | Ga0316582_0564491 | Ga0316582_0564491_70_675 | 198 |
| 650 | 3300036647 | Ga0316582_0580519 | Ga0316582_0580519_154_753 | 198 |
| 651 | 3300037853 | Ga0436364_0918438 | Ga0436364_0918438_912_1526 | 198 |
| 652 | 3300038726 | Ga0400490_09994 | Ga0400490_09994_441_1040 | 198 |
| 653 | 3300039062 | Ga0400483_103554 | Ga0400483_103554_1225_1821 | 198 |
| 654 | 3300039062 | Ga0400483_200081 | Ga0400483_200081_188_784 | 198 |
| 655 | 3300042876 | Ga0451577_0302080 | Ga0451577_0302080_438_1037 | 198 |
| 656 | 3300044673 | Ga0453683_0000006 | Ga0453683_0000006_110704_111300 | 198 |
| 657 | 3300044673 | Ga0453683_0001504 | Ga0453683_0001504_4365_4988 | 198 |
| 658 | 3300044673 | Ga0453683_0502519 | Ga0453683_0502519_149_748 | 198 |
| 659 | 3300044694 | Ga0466963_0349824 | Ga0466963_0349824_287_898 | 198 |
| 660 | 3300044712 | Ga0453684_0004409 | Ga0453684_0004409_28548_29144 | 198 |
| 661 | 3300044712 | Ga0453684_0031253 | Ga0453684_0031253_2363_2986 | 198 |
| 662 | 3300044712 | Ga0453684_0170627 | Ga0453684_0170627_558_1157 | 198 |
| 663 | 3300045051 | Ga0451576_0000014 | Ga0451576_0000014_89345_89968 | 198 |
| 664 | 3300045051 | Ga0451576_0000138 | Ga0451576_0000138_134171_134770 | 198 |
| 665 | 3300046674 | Ga0495588_0016497 | Ga0495588_0016497_2954_3550 | 198 |
| 666 | 3300048915 | Ga0496112_0414367 | Ga0496112_0414367_267_869 | 198 |
| 667 | 3300049571 | Ga0501034_0181110 | Ga0501034_0181110_1036_1632 | 198 |
| 668 | 3300050507 | nmdc:mga05p37_172664_c1 | nmdc:mga05p37_172664_c1_656_1258 | 198 |
| 669 | 3300050507 | nmdc:mga05p37_38365_c1 | nmdc:mga05p37_38365_c1_3814_4416 | 198 |
| 670 | 3300050507 | nmdc:mga05p37_844229_c1 | nmdc:mga05p37_844229_c1_102_704 | 198 |
| 671 | 3300050507 | nmdc:mga05p37_87209_c1 | nmdc:mga05p37_87209_c1_2032_2634 | 198 |
| 672 | 3300050507 | nmdc:mga05p37_94064_c1 | nmdc:mga05p37_94064_c1_1582_2184 | 198 |
| 673 | 3300050508 | nmdc:mga09592_23260_c1 | nmdc:mga09592_23260_c1_618_1220 | 198 |
| 674 | 3300050510 | nmdc:mga06r32_37252_c1 | nmdc:mga06r32_37252_c1_3716_4318 | 198 |
| 675 | 3300050512 | nmdc:mga0n895_323502_c1 | nmdc:mga0n895_323502_c1_680_1282 | 198 |
| 676 | 3300050513 | nmdc:mga0rr50_71479_c1 | nmdc:mga0rr50_71479_c1_1876_2478 | 198 |
| 677 | 3300050513 | nmdc:mga0rr50_726525_c1 | nmdc:mga0rr50_726525_c1_159_761 | 198 |
| 678 | 3300050515 | nmdc:mga0a205_192078_c1 | nmdc:mga0a205_192078_c1_215_817 | 198 |
| 679 | 3300025315 | Ga0207697_10146951 | Ga0207697_101469511 | 199 |
| 680 | 3300031665 | Ga0316575_10056419 | Ga0316575_100564192 | 199 |
| 681 | 3300031691 | Ga0316579_10018952 | Ga0316579_100189522 | 199 |
| 682 | 3300031733 | Ga0316577_10029358 | Ga0316577_100293581 | 199 |
| 683 | 3300035398 | Ga0316574_0042804 | Ga0316574_0042804_1743_2348 | 199 |
| 684 | 3300035398 | Ga0316574_0132380 | Ga0316574_0132380_695_1297 | 199 |
| 685 | 3300037588 | Ga0316581_0015819 | Ga0316581_0015819_1421_2029 | 199 |
| 686 | 3300003203 | JGI25406J46586_10003441 | JGI25406J46586_100034417 | 200 |
| 687 | 3300005295 | Ga0065707_10088820 | Ga0065707_100888205 | 200 |
| 688 | 3300005295 | Ga0065707_10358976 | Ga0065707_103589762 | 200 |
| 689 | 3300005334 | Ga0068869_100646652 | Ga0068869_1006466521 | 200 |
| 690 | 3300005471 | Ga0070698_100043703 | Ga0070698_1000437034 | 200 |
| 691 | 3300005518 | Ga0070699_100013854 | Ga0070699_1000138544 | 200 |
| 692 | 3300005546 | Ga0070696_100451007 | Ga0070696_1004510072 | 200 |
| 693 | 3300005617 | Ga0068859_100485630 | Ga0068859_1004856302 | 200 |
| 694 | 3300005985 | Ga0081539_10007668 | Ga0081539_100076688 | 200 |
| 695 | 3300006844 | Ga0075428_100836756 | Ga0075428_1008367562 | 200 |
| 696 | 3300006880 | Ga0075429_100113319 | Ga0075429_1001133193 | 200 |
| 697 | 3300006931 | Ga0097620_100485633 | Ga0097620_1004856332 | 200 |
| 698 | 3300009147 | Ga0114129_10117940 | Ga0114129_101179404 | 200 |
| 699 | 3300009553 | Ga0105249_10143739 | Ga0105249_101437393 | 200 |
| 700 | 3300025961 | Ga0207712_10020882 | Ga0207712_100208825 | 200 |
| 701 | 3300027695 | Ga0209966_1006415 | Ga0209966_10064154 | 200 |
| 702 | 3300031344 | Ga0265316_10250679 | Ga0265316_102506792 | 200 |
| 703 | 3300031727 | Ga0316576_10791688 | Ga0316576_107916881 | 200 |
| 704 | 3300031731 | Ga0307405_10316366 | Ga0307405_103163662 | 200 |
| 705 | 3300031824 | Ga0307413_10108119 | Ga0307413_101081193 | 200 |
| 706 | 3300031903 | Ga0307407_10032405 | Ga0307407_100324053 | 200 |
| 707 | 3300031995 | Ga0307409_100934691 | Ga0307409_1009346911 | 200 |
| 708 | 3300032126 | Ga0307415_101180235 | Ga0307415_1011802351 | 200 |
| 709 | 3300036647 | Ga0316582_0406096 | Ga0316582_0406096_211_816 | 200 |
| 710 | 3300036712 | Ga0316584_0004330 | Ga0316584_0004330_1557_2162 | 200 |
| 711 | 3300042876 | Ga0451577_0109387 | Ga0451577_0109387_1205_1810 | 200 |
| 712 | 3300042876 | Ga0451577_0835150 | Ga0451577_0835150_60_713 | 200 |
| 713 | 3300044712 | Ga0453684_0088924 | Ga0453684_0088924_2906_3511 | 200 |
| 714 | 3300044712 | Ga0453684_1140464 | Ga0453684_1140464_209_811 | 200 |
| 715 | 3300044712 | Ga0453684_1612015 | Ga0453684_1612015_23_625 | 200 |
| 716 | 3300045051 | Ga0451576_0152613 | Ga0451576_0152613_1574_2176 | 200 |
| 717 | 3300049572 | Ga0501036_0142162 | Ga0501036_0142162_1254_1856 | 200 |
| 718 | 3300049574 | Ga0501038_0571479 | Ga0501038_0571479_85_687 | 200 |
| 719 | 3300049577 | Ga0501041_0123290 | Ga0501041_0123290_767_1369 | 200 |
| 720 | 3300049580 | Ga0501046_0284554 | Ga0501046_0284554_182_784 | 200 |
| 721 | 3300049587 | Ga0501071_0171094 | Ga0501071_0171094_396_998 | 200 |
| 722 | 3300049590 | Ga0501074_0103993 | Ga0501074_0103993_1257_1859 | 200 |
| 723 | 3300049591 | Ga0501075_0005015 | Ga0501075_0005015_5316_5918 | 200 |
| 724 | 3300049592 | Ga0501076_0010660 | Ga0501076_0010660_2776_3378 | 200 |
| 725 | 3300049741 | Ga0501079_0028768 | Ga0501079_0028768_603_1205 | 200 |
| 726 | 3300049742 | Ga0501080_0110178 | Ga0501080_0110178_972_1574 | 200 |
| 727 | 3300049743 | Ga0501081_0752187 | Ga0501081_0752187_41_643 | 200 |
| 728 | 3300049822 | Ga0501035_0226194 | Ga0501035_0226194_142_744 | 200 |
| 729 | 3300050507 | nmdc:mga05p37_551032_c1 | nmdc:mga05p37_551032_c1_590_1192 | 200 |
| 730 | 3300050508 | nmdc:mga09592_73986_c1 | nmdc:mga09592_73986_c1_584_1186 | 200 |
| 731 | 3300050510 | nmdc:mga06r32_847432_c1 | nmdc:mga06r32_847432_c1_218_820 | 200 |
| 732 | 3300054114 | Ga0501084_0059438 | Ga0501084_0059438_1448_2050 | 200 |
| 733 | 2162886007 | SwRhRL2b_contig_2348821 | SwRhRL2b_0582.00000560 | 201 |
| 734 | 3300005289 | Ga0065704_10134448 | Ga0065704_101344483 | 201 |
| 735 | 3300005295 | Ga0065707_10000534 | Ga0065707_100005343 | 201 |
| 736 | 3300005295 | Ga0065707_10084320 | Ga0065707_100843203 | 201 |
| 737 | 3300005295 | Ga0065707_10086250 | Ga0065707_100862505 | 201 |
| 738 | 3300005295 | Ga0065707_10141701 | Ga0065707_101417012 | 201 |
| 739 | 3300005337 | Ga0070682_100934053 | Ga0070682_1009340531 | 201 |
| 740 | 3300005340 | Ga0070689_100036265 | Ga0070689_1000362653 | 201 |
| 741 | 3300005406 | Ga0070703_10072110 | Ga0070703_100721101 | 201 |
| 742 | 3300005438 | Ga0070701_10072275 | Ga0070701_100722753 | 201 |
| 743 | 3300005440 | Ga0070705_100961505 | Ga0070705_1009615051 | 201 |
| 744 | 3300005444 | Ga0070694_100192983 | Ga0070694_1001929832 | 201 |
| 745 | 3300005467 | Ga0070706_100258043 | Ga0070706_1002580432 | 201 |
| 746 | 3300005468 | Ga0070707_101135074 | Ga0070707_1011350741 | 201 |
| 747 | 3300005471 | Ga0070698_100076693 | Ga0070698_1000766932 | 201 |
| 748 | 3300005518 | Ga0070699_100021018 | Ga0070699_1000210186 | 201 |
| 749 | 3300005518 | Ga0070699_100024326 | Ga0070699_1000243262 | 201 |
| 750 | 3300005618 | Ga0068864_100084812 | Ga0068864_1000848123 | 201 |
| 751 | 3300005618 | Ga0068864_100569198 | Ga0068864_1005691982 | 201 |
| 752 | 3300005618 | Ga0068864_101552906 | Ga0068864_1015529061 | 201 |
| 753 | 3300005719 | Ga0068861_100210320 | Ga0068861_1002103201 | 201 |
| 754 | 3300005844 | Ga0068862_100064965 | Ga0068862_1000649653 | 201 |
| 755 | 3300005985 | Ga0081539_10180017 | Ga0081539_101800172 | 201 |
| 756 | 3300006847 | Ga0075431_100174887 | Ga0075431_1001748873 | 201 |
| 757 | 3300006871 | Ga0075434_100160198 | Ga0075434_1001601983 | 201 |
| 758 | 3300006880 | Ga0075429_100009321 | Ga0075429_1000093218 | 201 |
| 759 | 3300006880 | Ga0075429_100122470 | Ga0075429_1001224702 | 201 |
| 760 | 3300006880 | Ga0075429_100167191 | Ga0075429_1001671913 | 201 |
| 761 | 3300006880 | Ga0075429_100249161 | Ga0075429_1002491612 | 201 |
| 762 | 3300009094 | Ga0111539_10188061 | Ga0111539_101880613 | 201 |
| 763 | 3300009147 | Ga0114129_10010107 | Ga0114129_100101074 | 201 |
| 764 | 3300009147 | Ga0114129_10021191 | Ga0114129_100211915 | 201 |
| 765 | 3300009147 | Ga0114129_10146934 | Ga0114129_101469343 | 201 |
| 766 | 3300009147 | Ga0114129_10278551 | Ga0114129_102785512 | 201 |
| 767 | 3300009147 | Ga0114129_11609996 | Ga0114129_116099961 | 201 |
| 768 | 3300009148 | Ga0105243_10065680 | Ga0105243_100656803 | 201 |
| 769 | 3300009148 | Ga0105243_10305125 | Ga0105243_103051252 | 201 |
| 770 | 3300009174 | Ga0105241_10205417 | Ga0105241_102054172 | 201 |
| 771 | 3300009553 | Ga0105249_10198590 | Ga0105249_101985903 | 201 |
| 772 | 3300009553 | Ga0105249_10283104 | Ga0105249_102831042 | 201 |
| 773 | 3300009553 | Ga0105249_11099261 | Ga0105249_110992611 | 201 |
| 774 | 3300011119 | Ga0105246_10002516 | Ga0105246_100025162 | 201 |
| 775 | 3300011119 | Ga0105246_10048892 | Ga0105246_100488923 | 201 |
| 776 | 3300011119 | Ga0105246_10741936 | Ga0105246_107419361 | 201 |
| 777 | 3300014745 | Ga0157377_10364569 | Ga0157377_103645691 | 201 |
| 778 | 3300025885 | Ga0207653_10180235 | Ga0207653_101802351 | 201 |
| 779 | 3300025910 | Ga0207684_10123993 | Ga0207684_101239932 | 201 |
| 780 | 3300025911 | Ga0207654_10146087 | Ga0207654_101460872 | 201 |
| 781 | 3300025936 | Ga0207670_10423173 | Ga0207670_104231731 | 201 |
| 782 | 3300025961 | Ga0207712_10085765 | Ga0207712_100857653 | 201 |
| 783 | 3300026075 | Ga0207708_10204179 | Ga0207708_102041792 | 201 |
| 784 | 3300026095 | Ga0207676_10131003 | Ga0207676_101310032 | 201 |
| 785 | 3300026095 | Ga0207676_10536291 | Ga0207676_105362911 | 201 |
| 786 | 3300026118 | Ga0207675_100284184 | Ga0207675_1002841841 | 201 |
| 787 | 3300028380 | Ga0268265_10089853 | Ga0268265_100898532 | 201 |
| 788 | 3300028558 | Ga0265326_10013118 | Ga0265326_100131182 | 201 |
| 789 | 3300028577 | Ga0265318_10006693 | Ga0265318_100066933 | 201 |
| 790 | 3300028800 | Ga0265338_10033218 | Ga0265338_100332184 | 201 |
| 791 | 3300029957 | Ga0265324_10097390 | Ga0265324_100973902 | 201 |
| 792 | 3300031240 | Ga0265320_10017108 | Ga0265320_100171085 | 201 |
| 793 | 3300031247 | Ga0265340_10000496 | Ga0265340_1000049623 | 201 |
| 794 | 3300031250 | Ga0265331_10003063 | Ga0265331_100030637 | 201 |
| 795 | 3300031251 | Ga0265327_10029297 | Ga0265327_100292971 | 201 |
| 796 | 3300031344 | Ga0265316_10022181 | Ga0265316_100221815 | 201 |
| 797 | 3300031691 | Ga0316579_10029713 | Ga0316579_100297133 | 201 |
| 798 | 3300031691 | Ga0316579_10030624 | Ga0316579_100306243 | 201 |
| 799 | 3300031691 | Ga0316579_10089369 | Ga0316579_100893692 | 201 |
| 800 | 3300031727 | Ga0316576_10007136 | Ga0316576_100071367 | 201 |
| 801 | 3300031727 | Ga0316576_10081950 | Ga0316576_100819503 | 201 |
| 802 | 3300031727 | Ga0316576_10345877 | Ga0316576_103458771 | 201 |
| 803 | 3300031728 | Ga0316578_10012349 | Ga0316578_100123492 | 201 |
| 804 | 3300031728 | Ga0316578_10073604 | Ga0316578_100736042 | 201 |
| 805 | 3300031728 | Ga0316578_10085971 | Ga0316578_100859712 | 201 |
| 806 | 3300031728 | Ga0316578_10116905 | Ga0316578_101169052 | 201 |
| 807 | 3300031728 | Ga0316578_10156744 | Ga0316578_101567441 | 201 |
| 808 | 3300031733 | Ga0316577_10007877 | Ga0316577_100078773 | 201 |
| 809 | 3300031733 | Ga0316577_10220244 | Ga0316577_102202442 | 201 |
| 810 | 3300031733 | Ga0316577_10285354 | Ga0316577_102853541 | 201 |
| 811 | 3300031733 | Ga0316577_10367095 | Ga0316577_103670952 | 201 |
| 812 | 3300031995 | Ga0307409_101107001 | Ga0307409_1011070011 | 201 |
| 813 | 3300032002 | Ga0307416_100935969 | Ga0307416_1009359692 | 201 |
| 814 | 3300032133 | Ga0316583_10073276 | Ga0316583_100732761 | 201 |
| 815 | 3300032137 | Ga0316585_10004967 | Ga0316585_100049675 | 201 |
| 816 | 3300032137 | Ga0316585_10100968 | Ga0316585_101009681 | 201 |
| 817 | 3300035241 | Ga0373961_0071888 | Ga0373961_0071888_29_634 | 201 |
| 818 | 3300035398 | Ga0316574_0001564 | Ga0316574_0001564_3682_4290 | 201 |
| 819 | 3300035398 | Ga0316574_0004212 | Ga0316574_0004212_5910_6515 | 201 |
| 820 | 3300036647 | Ga0316582_0008508 | Ga0316582_0008508_4272_4877 | 201 |
| 821 | 3300036647 | Ga0316582_0027872 | Ga0316582_0027872_1967_2572 | 201 |
| 822 | 3300036647 | Ga0316582_0040425 | Ga0316582_0040425_842_1447 | 201 |
| 823 | 3300036647 | Ga0316582_0116258 | Ga0316582_0116258_424_1032 | 201 |
| 824 | 3300036647 | Ga0316582_0210584 | Ga0316582_0210584_648_1253 | 201 |
| 825 | 3300036712 | Ga0316584_0002917 | Ga0316584_0002917_6843_7451 | 201 |
| 826 | 3300036712 | Ga0316584_0015772 | Ga0316584_0015772_4062_4667 | 201 |
| 827 | 3300036712 | Ga0316584_0247978 | Ga0316584_0247978_558_1163 | 201 |
| 828 | 3300037588 | Ga0316581_0003768 | Ga0316581_0003768_1782_2390 | 201 |
| 829 | 3300037588 | Ga0316581_0027578 | Ga0316581_0027578_20_625 | 201 |
| 830 | 3300037588 | Ga0316581_0033733 | Ga0316581_0033733_11_616 | 201 |
| 831 | 3300038996 | Ga0242420_027550 | Ga0242420_027550_394_999 | 201 |
| 832 | 3300042876 | Ga0451577_0008331 | Ga0451577_0008331_7175_7780 | 201 |
| 833 | 3300042876 | Ga0451577_0036429 | Ga0451577_0036429_511_1116 | 201 |
| 834 | 3300042876 | Ga0451577_0047073 | Ga0451577_0047073_2841_3446 | 201 |
| 835 | 3300042876 | Ga0451577_0052120 | Ga0451577_0052120_1847_2452 | 201 |
| 836 | 3300042876 | Ga0451577_0134782 | Ga0451577_0134782_703_1308 | 201 |
| 837 | 3300042876 | Ga0451577_0179660 | Ga0451577_0179660_138_743 | 201 |
| 838 | 3300042876 | Ga0451577_0299396 | Ga0451577_0299396_280_885 | 201 |
| 839 | 3300042876 | Ga0451577_0312850 | Ga0451577_0312850_507_1130 | 201 |
| 840 | 3300042876 | Ga0451577_0511297 | Ga0451577_0511297_454_1059 | 201 |
| 841 | 3300042876 | Ga0451577_0577950 | Ga0451577_0577950_329_937 | 201 |
| 842 | 3300042876 | Ga0451577_1069996 | Ga0451577_1069996_78_686 | 201 |
| 843 | 3300044673 | Ga0453683_0004070 | Ga0453683_0004070_8452_9057 | 201 |
| 844 | 3300044673 | Ga0453683_0034751 | Ga0453683_0034751_553_1158 | 201 |
| 845 | 3300044673 | Ga0453683_0037986 | Ga0453683_0037986_1698_2303 | 201 |
| 846 | 3300044673 | Ga0453683_0038390 | Ga0453683_0038390_1362_1967 | 201 |
| 847 | 3300044673 | Ga0453683_0101522 | Ga0453683_0101522_446_1051 | 201 |
| 848 | 3300044673 | Ga0453683_0119313 | Ga0453683_0119313_722_1327 | 201 |
| 849 | 3300044673 | Ga0453683_0152183 | Ga0453683_0152183_143_748 | 201 |
| 850 | 3300044673 | Ga0453683_0178635 | Ga0453683_0178635_191_796 | 201 |
| 851 | 3300044712 | Ga0453684_0000023 | Ga0453684_0000023_5025_5630 | 201 |
| 852 | 3300044712 | Ga0453684_0000035 | Ga0453684_0000035_568473_569078 | 201 |
| 853 | 3300044712 | Ga0453684_0000128 | Ga0453684_0000128_331450_332055 | 201 |
| 854 | 3300044712 | Ga0453684_0003360 | Ga0453684_0003360_18498_19106 | 201 |
| 855 | 3300044712 | Ga0453684_0003688 | Ga0453684_0003688_4937_5542 | 201 |
| 856 | 3300044712 | Ga0453684_0005202 | Ga0453684_0005202_23421_24026 | 201 |
| 857 | 3300044712 | Ga0453684_0006177 | Ga0453684_0006177_11832_12440 | 201 |
| 858 | 3300044712 | Ga0453684_0013654 | Ga0453684_0013654_8431_9036 | 201 |
| 859 | 3300044712 | Ga0453684_0045211 | Ga0453684_0045211_4238_4843 | 201 |
| 860 | 3300044712 | Ga0453684_0050605 | Ga0453684_0050605_1156_1803 | 201 |
| 861 | 3300044712 | Ga0453684_0067960 | Ga0453684_0067960_2600_3205 | 201 |
| 862 | 3300044712 | Ga0453684_0076068 | Ga0453684_0076068_1877_2482 | 201 |
| 863 | 3300044712 | Ga0453684_0091086 | Ga0453684_0091086_1712_2317 | 201 |
| 864 | 3300044712 | Ga0453684_0097350 | Ga0453684_0097350_793_1398 | 201 |
| 865 | 3300044712 | Ga0453684_0112808 | Ga0453684_0112808_1186_1791 | 201 |
| 866 | 3300044712 | Ga0453684_0133603 | Ga0453684_0133603_611_1216 | 201 |
| 867 | 3300044712 | Ga0453684_0138328 | Ga0453684_0138328_1132_1740 | 201 |
| 868 | 3300044712 | Ga0453684_0156563 | Ga0453684_0156563_581_1186 | 201 |
| 869 | 3300044712 | Ga0453684_0168390 | Ga0453684_0168390_1772_2377 | 201 |
| 870 | 3300044712 | Ga0453684_0216052 | Ga0453684_0216052_940_1545 | 201 |
| 871 | 3300044712 | Ga0453684_0688720 | Ga0453684_0688720_492_1097 | 201 |
| 872 | 3300044712 | Ga0453684_0696353 | Ga0453684_0696353_17_622 | 201 |
| 873 | 3300044712 | Ga0453684_0895593 | Ga0453684_0895593_138_743 | 201 |
| 874 | 3300044712 | Ga0453684_1525140 | Ga0453684_1525140_29_634 | 201 |
| 875 | 3300045051 | Ga0451576_0001446 | Ga0451576_0001446_735_1340 | 201 |
| 876 | 3300045051 | Ga0451576_0004639 | Ga0451576_0004639_1487_2092 | 201 |
| 877 | 3300045051 | Ga0451576_0039017 | Ga0451576_0039017_1818_2423 | 201 |
| 878 | 3300045051 | Ga0451576_0140794 | Ga0451576_0140794_1862_2470 | 201 |
| 879 | 3300045051 | Ga0451576_0312282 | Ga0451576_0312282_850_1458 | 201 |
| 880 | 3300045051 | Ga0451576_0328766 | Ga0451576_0328766_317_922 | 201 |
| 881 | 3300045051 | Ga0451576_0338672 | Ga0451576_0338672_79_684 | 201 |
| 882 | 3300045051 | Ga0451576_0632412 | Ga0451576_0632412_306_911 | 201 |
| 883 | 3300045051 | Ga0451576_0676289 | Ga0451576_0676289_23_628 | 201 |
| 884 | 3300045051 | Ga0451576_0805265 | Ga0451576_0805265_142_747 | 201 |
| 885 | 3300046691 | Ga0495670_0154783 | Ga0495670_0154783_30_635 | 201 |
| 886 | 3300049588 | Ga0501072_0190637 | Ga0501072_0190637_614_1219 | 201 |
| 887 | 3300049589 | Ga0501073_0018933 | Ga0501073_0018933_725_1330 | 201 |
| 888 | 3300049589 | Ga0501073_0045233 | Ga0501073_0045233_2094_2699 | 201 |
| 889 | 3300049589 | Ga0501073_0182255 | Ga0501073_0182255_349_954 | 201 |
| 890 | 3300049590 | Ga0501074_0346193 | Ga0501074_0346193_115_720 | 201 |
| 891 | 3300049590 | Ga0501074_0391454 | Ga0501074_0391454_65_670 | 201 |
| 892 | 3300049592 | Ga0501076_0591082 | Ga0501076_0591082_100_705 | 201 |
| 893 | 3300049741 | Ga0501079_0201128 | Ga0501079_0201128_850_1455 | 201 |
| 894 | 3300049741 | Ga0501079_0493837 | Ga0501079_0493837_235_840 | 201 |
| 895 | 3300049743 | Ga0501081_0279459 | Ga0501081_0279459_415_1020 | 201 |
| 896 | 3300049824 | Ga0501045_0343120 | Ga0501045_0343120_461_1066 | 201 |
| 897 | 3300050507 | nmdc:mga05p37_15211_c1 | nmdc:mga05p37_15211_c1_2984_3589 | 201 |
| 898 | 3300050507 | nmdc:mga05p37_186995_c1 | nmdc:mga05p37_186995_c1_1470_2075 | 201 |
| 899 | 3300050507 | nmdc:mga05p37_508900_c1 | nmdc:mga05p37_508900_c1_696_1301 | 201 |
| 900 | 3300050507 | nmdc:mga05p37_77476_c1 | nmdc:mga05p37_77476_c1_505_1110 | 201 |
| 901 | 3300050507 | nmdc:mga05p37_944916_c1 | nmdc:mga05p37_944916_c1_246_851 | 201 |
| 902 | 3300050508 | nmdc:mga09592_104656_c1 | nmdc:mga09592_104656_c1_1747_2352 | 201 |
| 903 | 3300050508 | nmdc:mga09592_111845_c1 | nmdc:mga09592_111845_c1_1266_1871 | 201 |
| 904 | 3300050508 | nmdc:mga09592_131559_c1 | nmdc:mga09592_131559_c1_1309_1914 | 201 |
| 905 | 3300050508 | nmdc:mga09592_302873_c1 | nmdc:mga09592_302873_c1_749_1354 | 201 |
| 906 | 3300050508 | nmdc:mga09592_5756_c1 | nmdc:mga09592_5756_c1_6731_7336 | 201 |
| 907 | 3300050509 | nmdc:mga0qj67_90348_c1 | nmdc:mga0qj67_90348_c1_499_1104 | 201 |
| 908 | 3300050510 | nmdc:mga06r32_146310_c1 | nmdc:mga06r32_146310_c1_288_893 | 201 |
| 909 | 3300050511 | nmdc:mga08y16_461826_c1 | nmdc:mga08y16_461826_c1_49_654 | 201 |
| 910 | 3300050512 | nmdc:mga0n895_229995_c1 | nmdc:mga0n895_229995_c1_1021_1626 | 201 |
| 911 | 3300050515 | nmdc:mga0a205_397311_c1 | nmdc:mga0a205_397311_c1_93_698 | 201 |
| 912 | 3300050515 | nmdc:mga0a205_70962_c1 | nmdc:mga0a205_70962_c1_1552_2157 | 201 |
| 913 | 3300054114 | Ga0501084_0065265 | Ga0501084_0065265_557_1162 | 201 |
| 914 | 3300060353 | Ga0501082_0233859 | Ga0501082_0233859_526_1131 | 201 |
| 915 | 3300060353 | Ga0501082_1099916 | Ga0501082_1099916_51_656 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.9519 | 82 | 173 |
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.9419 | 82 | 173 |
| 8ab0-assembly1.cif.gz_F | complex of reco-recr-dna from thermus thermophilus. | 0.904 | 4 | 169 |
| 8ab0-assembly1.cif.gz_F | complex of reco-recr-dna from thermus thermophilus. | 0.8875 | 4 | 169 |
| 8a93-assembly1.cif.gz_D | complex of recf-recr-dna from thermus thermophilus. | 0.8859 | 4 | 47 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ve5A03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9883 | 79 | 200 | 3.40.1360.10 |
| 3ve5A03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9803 | 79 | 200 | 3.40.1360.10 |
| 1vddB01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 | 0.9736 | 4 | 53 | 1.10.8.420 |
| af_P0A7H6_77_171_3.40.1360.10 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9724 | 79 | 172 | 3.40.1360.10 |
| 3vdpB01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 | 0.9682 | 4 | 52 | 1.10.8.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9BGG3-F1-model_v4 | Recombination protein RecR | 0.9892 | 60 | 157 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A268RH89-F1-model_v4 | Recombination protein RecR | 0.9889 | 73 | 175 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A7X3ZD69-F1-model_v4 | Recombination protein RecR | 0.9874 | 2 | 92 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A7X8Z779-F1-model_v4 | Recombination protein RecR | 0.9739 | 2 | 160 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-W1XYN8-F1-model_v4 | Recombination protein RecR | 0.9733 | 40 | 154 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar