F485602

General Info

Members Datasets Scaffolds Average Seq Length
915 720 1830 240

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0084809|Ga0495631_0084809_273_1046
Length 257
Sequence MNRLALARELNGVAAMPGVETSVHGVAAACDPLGSLYLPDAGILVVSDLHLEKGAAFARRGMMLPPYDTLATLTVLSAVISRYNPKLVVSLGDNFHDRIGSAHLPETFRTLISDMARGREWIWINGNHDPDGTVNLPGSSVDEMCYGGLTFCHAPKSGLQTGEIAGHLHPSATVRRREKSVRRPCFATDGARMLMPAFGVMSGGLDLRHKAMKGLFDHASLIAHLLGRDRIYSVRFGNLASSRPPALKERRSDRPCD

Samples

Sample ID Description Type Environment
1 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
50 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
58 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
59 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
60 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
61 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
62 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
63 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
109 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
110 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
111 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
118 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
119 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
120 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
121 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
122 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
123 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
213 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
218 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
221 2509276019 Ensifer aridi TW10 Isolate Nodule
222 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
223 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
224 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
225 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
226 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
227 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
228 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
229 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
230 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
231 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
232 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
233 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
234 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
235 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
236 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
237 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
238 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
239 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
240 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
241 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
242 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
243 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
244 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
245 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
246 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
247 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
248 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
249 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
250 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
251 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
252 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
253 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
254 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
255 2516143018 Ensifer sp. BR816 Isolate Nodule
256 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
257 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
258 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
259 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
260 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
261 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
262 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
263 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
264 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
265 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
266 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
267 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
268 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
269 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
270 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
271 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
272 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
273 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
274 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
275 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
276 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
277 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
278 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
279 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
280 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
281 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
282 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
283 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
284 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
285 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
286 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
287 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
288 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
289 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
290 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
291 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
292 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
293 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
294 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
295 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
296 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
297 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
298 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
299 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
300 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
301 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
302 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
303 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
304 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
305 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
306 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
307 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
308 2643221557 Ensifer sp. Root558 Isolate Unclassified
309 2643221558 Rhizobium sp. Root149 Isolate Unclassified
310 2643221582 Rhizobium sp. Root651 Isolate Unclassified
311 2643221599 Rhizobium sp. Root708 Isolate Unclassified
312 2643221607 Rhizobium sp. Root73 Isolate Unclassified
313 2643221610 Ensifer sp. Root74 Isolate Unclassified
314 2643221618 Ensifer sp. Root231 Isolate Unclassified
315 2643221626 Ensifer sp. Root31 Isolate Unclassified
316 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
317 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
318 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
319 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
320 2643221655 Ensifer sp. Root1252 Isolate Unclassified
321 2643221659 Ensifer sp. Root127 Isolate Unclassified
322 2643221668 Ensifer sp. Root423 Isolate Unclassified
323 2643221675 Ensifer sp. Root1298 Isolate Unclassified
324 2643221680 Ensifer sp. Root1312 Isolate Unclassified
325 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
326 2643221688 Rhizobium sp. Root482 Isolate Unclassified
327 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
328 2643221698 Ensifer sp. Root142 Isolate Unclassified
329 2643221712 Ensifer sp. Root258 Isolate Unclassified
330 2643221718 Rhizobium sp. Root268 Isolate Unclassified
331 2643221723 Ensifer sp. Root278 Isolate Unclassified
332 2643221726 Ensifer sp. Root954 Isolate Unclassified
333 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
334 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
335 2718217882 Rhizobium sp. N741 Isolate Nodule
336 2718217927 Rhizobium sp. N324 Isolate Nodule
337 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
338 2718218009 Rhizobium sp. N561 Isolate Nodule
339 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
340 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
341 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
342 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
343 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
344 2718218363 Rhizobium sp. N113 Isolate Nodule
345 2718218365 Rhizobium sp. N731 Isolate Nodule
346 2718218366 Rhizobium sp. N621 Isolate Nodule
347 2718218423 Rhizobium sp. N941 Isolate Nodule
348 2721755514 Rhizobium sp. N6212 Isolate Nodule
349 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
350 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
351 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
352 2721755809 Rhizobium sp. N541 Isolate Nodule
353 2721755810 Rhizobium sp. N871 Isolate Nodule
354 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
355 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
356 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
357 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
358 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
359 2728369365 Rhizobium sp. N1341 Isolate Nodule
360 2728369397 Rhizobium sp. N1314 Isolate Nodule
361 2738541293 Rhizobium sp. GV031 Isolate Unclassified
362 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
363 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
364 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
365 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
366 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
367 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
368 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
369 2791355256 Rhizobium sp. M10 Isolate Nodule
370 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
371 2791355260 Rhizobium sp. L9 Isolate Nodule
372 2791355261 Rhizobium sp. J15 Isolate Nodule
373 2791355262 Rhizobium sp. M1 Isolate Nodule
374 2791355263 Rhizobium chutanense C5 Isolate Nodule
375 2791355264 Rhizobium sp. S9 Isolate Nodule
376 2791355265 Rhizobium sp. H4 Isolate Nodule
377 2791355266 Rhizobium sp. L43 Isolate Nodule
378 2791355267 Rhizobium sp. L18 Isolate Nodule
379 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
380 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
381 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
382 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
383 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
384 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
385 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
386 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
387 2802429633 Rhizobium anhuiense J3 Isolate Nodule
388 2802429634 Rhizobium anhuiense S10 Isolate Nodule
389 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
390 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
391 2802429637 Rhizobium anhuiense C15 Isolate Nodule
392 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
393 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
394 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
395 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
396 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
397 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
398 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
399 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
400 2838048938 Rhizobium pisi 27/80 Isolate Nodule
401 2838061910 Rhizobium phaseoli L15 Isolate Nodule
402 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
403 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
404 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
405 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
406 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
407 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
408 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
409 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
410 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
411 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
412 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
413 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
414 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
415 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
416 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
417 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
418 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
419 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
420 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
421 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
422 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
423 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
424 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
425 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
426 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
427 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
428 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
429 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
430 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
431 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
432 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
433 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
434 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
435 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
436 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
437 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
438 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
439 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
440 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
441 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
442 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
443 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
444 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
445 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
446 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
447 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
448 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
449 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
450 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
451 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
452 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
453 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
454 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
455 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
456 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
457 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
458 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
459 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
460 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
461 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
462 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
463 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
464 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
465 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
466 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
467 2844163670 Ensifer sp. 1H6 Isolate Unclassified
468 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
469 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
470 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
471 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
472 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
473 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
474 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
475 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
476 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
477 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
478 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
479 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
480 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
481 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
482 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
483 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
484 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
485 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
486 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
487 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
488 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
489 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
490 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
491 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
492 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
493 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
494 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
495 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
496 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
497 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
498 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
499 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
500 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
501 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
502 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
503 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
504 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
505 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
506 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
507 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
508 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
509 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
510 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
511 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
512 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
513 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
514 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
515 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
516 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
517 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
518 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
519 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
520 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
521 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
522 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
523 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
524 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
525 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
526 2933599457 Rhizobium phaseoli M3 Isolate Nodule
527 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
528 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
529 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
530 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
531 2936381700 Rhizobium chutanense C16 Isolate Unclassified
532 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
533 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
534 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
535 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
536 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
537 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
538 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
539 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
540 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
541 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
542 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
543 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
544 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
545 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
546 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
547 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
548 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
549 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
550 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
551 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
552 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
553 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
554 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
555 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
556 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
557 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
558 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
559 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
560 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
561 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
562 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
563 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
564 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
565 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
566 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
567 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
568 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
569 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
570 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
571 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
572 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
573 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
574 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
575 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
576 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
577 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
578 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
579 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
580 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
581 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
582 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
583 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
584 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
585 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
586 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
587 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
588 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
589 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
590 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
591 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
592 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
593 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
594 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
595 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
596 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
597 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
598 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
599 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
600 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
601 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
602 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
603 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
604 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
605 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
606 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
607 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
608 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
609 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
610 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
611 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
612 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
613 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
614 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
615 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
616 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
617 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
618 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
619 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
620 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
621 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
622 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
623 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
624 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
625 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
626 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
627 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
628 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
629 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
630 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
631 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
632 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
633 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
634 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
635 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
636 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
637 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
638 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
639 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
640 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
641 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
642 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
643 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
644 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
645 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
646 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
647 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
648 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
649 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
650 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
651 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
652 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
653 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
654 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
655 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
656 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
657 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
658 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
659 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
660 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
661 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
662 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
663 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
664 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
665 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
666 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
667 2996887358 Rhizobium sp. R711 Isolate Nodule
668 2996893221 Rhizobium sp. R635 Isolate Nodule
669 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
670 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
671 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
672 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
673 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
674 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
675 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
676 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
677 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
678 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
679 8005258706 Rhizobium sp. R693 Isolate Nodule
680 8005275841 Rhizobium sp. N4311 Isolate Nodule
681 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
682 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
683 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
684 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
685 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
686 8005321885 Rhizobium sp. R72 Isolate Nodule
687 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
688 8005382845 Rhizobium sp. R634 Isolate Nodule
689 8005395548 Rhizobium sp. R339 Isolate Nodule
690 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
691 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
692 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
693 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
694 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
695 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
696 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
697 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
698 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
699 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
700 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
701 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
702 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
703 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
704 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
705 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
706 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
707 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
708 8018176218 Rhizobium sp. N122 Isolate Nodule
709 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
710 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
711 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
712 8024501048 Rhizobium sp. H4 Isolate Nodule
713 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
714 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
715 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
716 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
717 8056382006 Rhizobium croatiense 13T Isolate Nodule
718 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
719 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
720 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.7
Metatranscriptomes 0.22
Isolates 55.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 16.94
Nodule 44.7
Rhizoplane 1.75
Rhizosphere 19.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495631_0084809 3300046518 Bacteria 1365
2 JGI24740J21852_10000426 3300001979 Bacteria 18039
3 JGI25155J39150_1000013 3300002704 Bacteria 198215
4 JGI25156J39149_1000011 3300002705 Bacteria 198215
5 JGI25162J39368_1000169 3300002737 Bacteria 72114
6 JGI25162J39368_1000698 3300002737 Bacteria 23303
7 JGI25154J39366_1000030 3300002738 Bacteria 191444
8 JGI25158J39367_1000090 3300002739 Bacteria 21062
9 JGI25157J39369_1000013 3300002741 Bacteria 198211
10 JGI25152J39213_1000246 3300002773 Bacteria 36282
11 JGI25152J39213_1000500 3300002773 Bacteria 22005
12 JGI25152J39213_1016171 3300002773 Bacteria 1448
13 JGI25152J39213_1016174 3300002773 Bacteria 1448
14 JGI25150J39212_1000118 3300002774 Bacteria 44311
15 JGI25150J39212_1004187 3300002774 Bacteria 3249
16 JGI25150J39212_1005928 3300002774 Bacteria 2568
17 JGI25159J45721_1000003 3300002987 Bacteria 274069
18 JGI25159J45721_1000942 3300002987 Bacteria 12699
19 JGI25151J46595_10000110 3300003187 Bacteria 111972
20 JGI25151J46595_10000681 3300003187 Bacteria 28706
21 JGI25151J46595_10003279 3300003187 Bacteria 8999
22 JGI25151J46595_10008982 3300003187 Bacteria 4765
23 JGI25165J46597_1000349 3300003214 Bacteria 52229
24 JGI25165J46597_1000355 3300003214 Bacteria 51475
25 JGI25153J46596_10000482 3300003215 Bacteria 25561
26 JGI25153J46596_10035651 3300003215 Bacteria 1608
27 JGI25153J46596_10040347 3300003215 Bacteria 1448
28 JGI25153J46596_10040373 3300003215 Bacteria 1448
29 JGI25153J46596_10047850 3300003215 Bacteria 1254
30 rootH1_10043182 3300003316 Bacteria 1402
31 rootL2_10235986 3300003322 Bacteria 1381
32 rootH1_10130347 3300003323 Bacteria 2250
33 JGI25160J50197_1000003 3300003354 Bacteria 482719
34 JGI25160J50197_1000041 3300003354 Bacteria 152843
35 JGI25160J50197_1000514 3300003354 Bacteria 22846
36 JGI25160J50197_1011969 3300003354 Bacteria 3041
37 JGI25161J50226_1000002 3300003374 Bacteria 420324
38 JGI25161J50226_1000184 3300003374 Bacteria 41591
39 JGI25161J50226_1000270 3300003374 Bacteria 30355
40 JGI25161J50226_1004678 3300003374 Bacteria 2814
41 Ga0006562J51391_1024010 3300003578 Bacteria 1107
42 Ga0055526_1000725 3300003771 Bacteria 24927
43 Ga0055526_1002842 3300003771 Bacteria 11434
44 Ga0055526_1004258 3300003771 Bacteria 8668
45 Ga0055526_1017123 3300003771 Bacteria 2791
46 Ga0055524_1002851 3300003775 Bacteria 8668
47 Ga0055524_1006954 3300003775 Bacteria 4865
48 Ga0055524_1015572 3300003775 Bacteria 2765
49 Ga0055524_1018417 3300003775 Bacteria 2426
50 Ga0055536_1019078 3300003781 Bacteria 2170
51 Ga0055528_1000095 3300003790 Bacteria 70572
52 Ga0055528_1000618 3300003790 Bacteria 26522
53 Ga0055528_1015870 3300003790 Bacteria 2694
54 Ga0055528_1021492 3300003790 Bacteria 2046
55 Ga0055528_1023363 3300003790 Bacteria 1889
56 Ga0055540_1000190 3300003792 Bacteria 59767
57 Ga0055540_1007520 3300003792 Bacteria 4091
58 Ga0055531_10005539 3300003794 Bacteria 7371
59 Ga0058692_1017409 3300003856 Bacteria 1578
60 Ga0055543_1000008 3300004625 Bacteria 202062
61 Ga0055543_1000059 3300004625 Bacteria 100942
62 Ga0055543_1000299 3300004625 Bacteria 35254
63 Ga0055543_1003650 3300004625 Bacteria 4438
64 Ga0065165_1000031 3300005262 Bacteria 216330
65 Ga0065165_1000084 3300005262 Bacteria 154822
66 Ga0065165_1012356 3300005262 Bacteria 3483
67 Ga0065165_1040779 3300005262 Bacteria 1381
68 Ga0070670_100000160 3300005331 Bacteria 61135
69 Ga0070671_100027922 3300005355 Bacteria 4646
70 Ga0070667_100181766 3300005367 Bacteria 1860
71 Ga0070665_100085654 3300005548 Bacteria 3157
72 Ga0070665_100136036 3300005548 Bacteria 2460
73 Ga0068855_100086831 3300005563 Bacteria 3617
74 Ga0068856_100094550 3300005614 Bacteria 2976
75 Ga0068851_10026861 3300005834 Bacteria 2832
76 Ga0068862_100147624 3300005844 Bacteria 2091
77 Ga0075365_10003496 3300006038 Bacteria 8115
78 Ga0075365_10007830 3300006038 Bacteria 6019
79 Ga0075368_10034448 3300006042 Bacteria 1973
80 Ga0075362_10007175 3300006177 Bacteria 4203
81 Ga0075367_10033635 3300006178 Bacteria 2956
82 Ga0075369_10008457 3300006186 Bacteria 3959
83 Ga0075366_10019959 3300006195 Bacteria 3884
84 Ga0075370_10148964 3300006353 Bacteria 1371
85 Ga0105251_10057758 3300009011 Bacteria 1833
86 Ga0105244_10157911 3300009036 Bacteria 1084
87 Ga0105240_10000460 3300009093 Bacteria 74956
88 Ga0105237_10001005 3300009545 Bacteria 37989
89 Ga0123341_1000067 3300009765 Bacteria 44232
90 Ga0123341_1068588 3300009765 Bacteria 1585
91 Ga0123342_1010893 3300009766 Bacteria 10210
92 Ga0105239_10002984 3300010375 Bacteria 21103
93 Ga0157370_10000879 3300013104 Bacteria 38163
94 Ga0171463_1001 3300013249 Bacteria 1406070
95 Ga0182008_10294383 3300014497 Bacteria 848
96 Ga0182007_10003141 3300015262 Bacteria 7939
97 Ga0182005_1001666 3300015265 Bacteria 8631
98 Ga0183363_1134 3300015690 Bacteria 18899
99 Ga0214542_1001074 3300021321 Bacteria 54628
100 Ga0214542_1025837 3300021321 Bacteria 2983
101 Ga0214543_1000027 3300021327 Bacteria 215065
102 Ga0214543_1000897 3300021327 Bacteria 54534
103 Ga0228711_1000041 3300022739 Bacteria 86591
104 Ga0228710_1000024 3300022740 Bacteria 106694
105 Ga0209435_100026 3300025206 Bacteria 198295
106 Ga0209436_100006 3300025208 Bacteria 150277
107 Ga0209436_100836 3300025208 Bacteria 12445
108 Ga0209437_100056 3300025233 Bacteria 363071
109 Ga0209437_100196 3300025233 Bacteria 121199
110 Ga0207425_1000012 3300025245 Bacteria 528324
111 Ga0207425_1002717 3300025245 Bacteria 6028
112 Ga0207425_1006821 3300025245 Bacteria 3085
113 Ga0209646_1000084 3300025246 Bacteria 198295
114 Ga0209026_1000080 3300025250 Bacteria 198295
115 Ga0209677_102042 3300025253 Bacteria 7993
116 Ga0209759_1000061 3300025256 Bacteria 198295
117 Ga0209129_1000105 3300025258 Bacteria 159104
118 Ga0209129_1000110 3300025258 Bacteria 150918
119 Ga0209129_1000429 3300025258 Bacteria 31758
120 Ga0209129_1001484 3300025258 Bacteria 13035
121 Ga0209129_1001523 3300025258 Bacteria 12805
122 Ga0209129_1001602 3300025258 Bacteria 12337
123 Ga0209129_1002388 3300025258 Bacteria 9244
124 Ga0209233_1000037 3300025261 Bacteria 554620
125 Ga0209233_1000071 3300025261 Bacteria 363290
126 Ga0209233_1000243 3300025261 Bacteria 90170
127 Ga0209455_1009107 3300025272 Bacteria 2635
128 Ga0209455_1036307 3300025272 Bacteria 785
129 Ga0209673_1000015 3300025273 Bacteria 530618
130 Ga0209673_1000063 3300025273 Bacteria 256709
131 Ga0209673_1001004 3300025273 Bacteria 34285
132 Ga0209673_1002293 3300025273 Bacteria 13648
133 Ga0209673_1003895 3300025273 Bacteria 8398
134 Ga0209673_1006202 3300025273 Bacteria 5837
135 Ga0209673_1012901 3300025273 Bacteria 3332
136 Ga0209673_1056919 3300025273 Bacteria 998
137 Ga0209130_1000002 3300025284 Bacteria 722648
138 Ga0209130_1000005 3300025284 Bacteria 599620
139 Ga0209130_1000382 3300025284 Bacteria 49448
140 Ga0209676_1033105 3300025292 Bacteria 1545
141 Ga0209025_1000024 3300025294 Bacteria 528324
142 Ga0209025_1000037 3300025294 Bacteria 383429
143 Ga0209025_1000295 3300025294 Bacteria 111489
144 Ga0209025_1000638 3300025294 Bacteria 61892
145 Ga0209025_1003060 3300025294 Bacteria 16457
146 Ga0209025_1012788 3300025294 Bacteria 5340
147 Ga0209025_1013101 3300025294 Bacteria 5241
148 Ga0209025_1042695 3300025294 Bacteria 1922
149 Ga0209564_1000093 3300025295 Bacteria 245793
150 Ga0209564_1000316 3300025295 Bacteria 94849
151 Ga0209564_1004460 3300025295 Bacteria 8554
152 Ga0209564_1008398 3300025295 Bacteria 5100
153 Ga0209564_1029360 3300025295 Bacteria 1733
154 Ga0209758_1000150 3300025297 Bacteria 163494
155 Ga0209758_1000361 3300025297 Bacteria 81006
156 Ga0209758_1000499 3300025297 Bacteria 63732
157 Ga0209758_1000876 3300025297 Bacteria 41358
158 Ga0209758_1001299 3300025297 Bacteria 30604
159 Ga0209758_1002582 3300025297 Bacteria 18177
160 Ga0209758_1007691 3300025297 Bacteria 7240
161 Ga0209758_1014373 3300025297 Bacteria 4216
162 Ga0209050_1011207 3300025298 Bacteria 4289
163 Ga0209050_1019868 3300025298 Bacteria 2530
164 Ga0209256_1000027 3300025299 Bacteria 423283
165 Ga0209256_1000880 3300025299 Bacteria 37115
166 Ga0209256_1001669 3300025299 Bacteria 21569
167 Ga0209256_1002179 3300025299 Bacteria 16813
168 Ga0209256_1005310 3300025299 Bacteria 7498
169 Ga0209256_1005901 3300025299 Bacteria 6775
170 Ga0209256_1006338 3300025299 Bacteria 6314
171 Ga0209256_1016791 3300025299 Bacteria 2471
172 Ga0209256_1044286 3300025299 Bacteria 1112
173 Ga0207426_1000012 3300025302 Bacteria 730942
174 Ga0207426_1000013 3300025302 Bacteria 721897
175 Ga0207426_1000015 3300025302 Bacteria 599316
176 Ga0207426_1000070 3300025302 Bacteria 331559
177 Ga0207426_1001614 3300025302 Bacteria 17860
178 Ga0209051_1000135 3300025303 Bacteria 138142
179 Ga0209051_1006292 3300025303 Bacteria 6727
180 Ga0209051_1055969 3300025303 Bacteria 1276
181 Ga0209051_1064569 3300025303 Bacteria 1134
182 Ga0209257_1005318 3300025304 Bacteria 9131
183 Ga0209257_1029056 3300025304 Bacteria 1807
184 Ga0207656_10027931 3300025321 Bacteria 2312
185 Ga0207647_10274920 3300025904 Bacteria 962
186 Ga0207695_10000036 3300025913 Bacteria 477897
187 Ga0207671_10000153 3300025914 Bacteria 107114
188 Ga0207650_10000776 3300025925 Bacteria 24570
189 Ga0207711_10167094 3300025941 Bacteria 1995
190 Ga0207658_10277195 3300025986 Bacteria 1436
191 Ga0207702_10119215 3300026078 Bacteria 2359
192 Ga0207698_10049414 3300026142 Bacteria 3201
193 Ga0209281_1000409 3300027111 Bacteria 65132
194 Ga0209281_1000520 3300027111 Bacteria 49942
195 Ga0209371_1000009 3300027312 Bacteria 963030
196 Ga0209371_1000424 3300027312 Bacteria 43444
197 Ga0209282_1000090 3300027666 Bacteria 65132
198 Ga0209813_10115148 3300027866 Bacteria 930
199 Ga0268266_10119922 3300028379 Bacteria 2340
200 Ga0268265_10853713 3300028380 Bacteria 891
201 Ga0307515_10000674 3300028794 Bacteria 78735
202 Ga0307515_10006511 3300028794 Bacteria 23364
203 Ga0307515_10012267 3300028794 Bacteria 16136
204 Ga0307515_10148902 3300028794 Bacteria 2460
205 Ga0268256_1000010 3300030500 Bacteria 963034
206 Ga0307513_10000180 3300031456 Bacteria 91340
207 Ga0307513_10236576 3300031456 Bacteria 1635
208 Ga0307405_10000250 3300031731 Bacteria 19640
209 Ga0307406_10002749 3300031901 Bacteria 9606
210 Ga0307412_10000491 3300031911 Bacteria 23628
211 Ga0307412_10527791 3300031911 Bacteria 987
212 Ga0315914_1000167 3300031967 Bacteria 65125
213 Ga0307416_100620524 3300032002 Bacteria 1163
214 Ga0307414_10727507 3300032004 Bacteria 900
215 Ga0315913_1000038 3300033430 Bacteria 64995
216 Ga0315915_1000019 3300033464 Bacteria 129295
217 Ga0439439_0027122 3300041406 Bacteria 1446
218 Ga0439447_022451 3300041407 Bacteria 1652
219 Ga0439465_0004487 3300041413 Bacteria 4513
220 Ga0439465_0019725 3300041413 Bacteria 2109
221 Ga0451787_252007 3300041441 Bacteria 2811
222 Ga0451791_0180341 3300041451 Bacteria 2156
223 Ga0451835_0388755 3300041492 Bacteria 1025
224 Ga0451837_0526223 3300041494 Bacteria 1068
225 Ga0451839_0199143 3300041496 Bacteria 3301
226 Ga0451841_1408368 3300041498 Bacteria 1065
227 Ga0451845_0150991 3300041501 Bacteria 1336
228 Ga0451847_0236407 3300041503 Bacteria 1377
229 Ga0451851_0308271 3300041507 Bacteria 1712
230 Ga0451843_1263341 3300041509 Bacteria 1403
231 Ga0451855_2061497 3300041511 Bacteria 1653
232 Ga0451853_3650313 3300041512 Bacteria 1721
233 Ga0439462_0011595 3300042015 Bacteria 2246
234 Ga0466966_0095761 3300044684 Bacteria 1839
235 Ga0466963_0003933 3300044694 Bacteria 8589
236 Ga0466964_0085405 3300044706 Bacteria 1363
237 Ga0466970_0002858 3300044765 Bacteria 8347
238 Ga0466957_0052900 3300044842 Bacteria 2474
239 Ga0466958_0253842 3300045836 Bacteria 1125
240 Ga0466967_0214337 3300045976 Bacteria 1827
241 Ga0495592_0186801 3300046454 Bacteria 1407
242 Ga0495590_0186407 3300046457 Bacteria 760
243 Ga0495629_0012377 3300046459 Bacteria 6178
244 Ga0495638_0020006 3300046460 Bacteria 4424
245 Ga0495605_0024123 3300046474 Bacteria 3187
246 Ga0495639_0125449 3300046475 Bacteria 1227
247 Ga0495662_0012312 3300046476 Bacteria 4175
248 Ga0495585_0009240 3300046492 Bacteria 5928
249 Ga0495607_0018739 3300046501 Bacteria 4403
250 Ga0495583_0003772 3300046506 Bacteria 11259
251 Ga0495606_0001337 3300046507 Bacteria 33546
252 Ga0495606_0164468 3300046507 Bacteria 1292
253 Ga0495606_0184566 3300046507 Bacteria 1200
254 Ga0495606_0399359 3300046507 Bacteria 716
255 Ga0495610_0000461 3300046512 Bacteria 42001
256 Ga0495610_0118502 3300046512 Bacteria 1163
257 Ga0495618_0250994 3300046514 Bacteria 1110
258 Ga0495620_0067648 3300046515 Bacteria 1469
259 Ga0495620_0115391 3300046515 Bacteria 1062
260 Ga0495620_0139721 3300046515 Bacteria 947
261 Ga0495631_0019196 3300046518 Bacteria 3208
262 Ga0495632_0006289 3300046519 Bacteria 7672
263 Ga0495632_0070468 3300046519 Bacteria 1681
264 Ga0495643_0008921 3300046522 Bacteria 6302
265 Ga0495643_0050571 3300046522 Bacteria 2238
266 Ga0495648_0037751 3300046524 Bacteria 3100
267 Ga0495652_0196599 3300046529 Bacteria 1534
268 Ga0495587_0068202 3300046536 Bacteria 2072
269 Ga0495609_0047847 3300046538 Bacteria 1913
270 Ga0495633_0046861 3300046558 Bacteria 2044
271 Ga0495633_0073927 3300046558 Bacteria 1589
272 Ga0495656_0018785 3300046615 Bacteria 2661
273 Ga0495668_0097091 3300046616 Bacteria 1612
274 Ga0495668_0216647 3300046616 Bacteria 1048
275 Ga0495634_0128294 3300046642 Bacteria 1619
276 Ga0495625_0026846 3300046660 Bacteria 4343
277 Ga0495625_0250888 3300046660 Bacteria 1149
278 Ga0495635_0057071 3300046663 Bacteria 2687
279 Ga0495661_0100588 3300046665 Bacteria 1628
280 Ga0495661_0125309 3300046665 Bacteria 1414
281 Ga0495661_0201396 3300046665 Bacteria 1042
282 Ga0495661_0240021 3300046665 Bacteria 930
283 Ga0495588_0030848 3300046674 Bacteria 2696
284 Ga0495588_0031208 3300046674 Bacteria 2681
285 Ga0495623_0180036 3300046679 Bacteria 1229
286 Ga0495646_0160553 3300046680 Bacteria 1245
287 Ga0495613_0604123 3300046689 Bacteria 730
288 Ga0495624_0166998 3300046690 Bacteria 1343
289 Ga0495670_0182377 3300046691 Bacteria 1109
290 Ga0495670_0262256 3300046691 Bacteria 922
291 Ga0495649_0173544 3300046694 Bacteria 1127
292 Ga0495589_0189453 3300046794 Bacteria 974
293 Ga0495600_0016251 3300046809 Bacteria 4720
294 Ga0495660_0077835 3300046810 Bacteria 1744
295 Ga0495660_0156043 3300046810 Bacteria 1123
296 Ga0495672_0150290 3300047320 Bacteria 1208
297 Ga0495687_068328 3300047443 Bacteria 1435
298 Ga0495679_090652 3300047446 Bacteria 858
299 Ga0495681_0106643 3300047470 Bacteria 1218
300 Ga0495686_0014419 3300047472 Bacteria 5439
301 Ga0495686_0016096 3300047472 Bacteria 5083
302 Ga0495686_0040112 3300047472 Bacteria 2988
303 Ga0495686_0125744 3300047472 Bacteria 1524
304 Ga0495626_0123295 3300048091 Bacteria 1112
305 Ga0496100_0035945 3300048903 Bacteria 3120
306 Ga0496101_0576949 3300048904 Bacteria 889
307 Ga0496102_0006201 3300048905 Bacteria 10188
308 Ga0496102_0409297 3300048905 Bacteria 1274
309 Ga0496103_0015905 3300048906 Bacteria 4485
310 Ga0496104_0081774 3300048907 Bacteria 3080
311 Ga0496105_0179781 3300048908 Bacteria 1732
312 Ga0496106_0004867 3300048909 Bacteria 9942
313 Ga0496106_0409795 3300048909 Bacteria 1089
314 Ga0496111_0177519 3300048914 Bacteria 1583
315 Ga0496113_0253089 3300048916 Bacteria 1406
316 Ga0496116_0001406 3300048919 Bacteria 27038
317 Ga0496116_0002602 3300048919 Bacteria 18765
318 Ga0496116_0004126 3300048919 Bacteria 13997
319 Ga0496116_0058538 3300048919 Bacteria 2511
320 Ga0496116_0103637 3300048919 Bacteria 1692
321 Ga0496116_0194716 3300048919 Bacteria 1068
322 Ga0496116_0206798 3300048919 Bacteria 1021
323 Ga0496117_0001819 3300048920 Bacteria 28947
324 Ga0496117_0014921 3300048920 Bacteria 6660
325 Ga0496117_0018471 3300048920 Bacteria 5770
326 Ga0496117_0023539 3300048920 Bacteria 4902
327 Ga0496117_0128717 3300048920 Bacteria 1539
328 Ga0496118_0001431 3300048921 Bacteria 35926
329 Ga0496118_0008398 3300048921 Bacteria 10682
330 Ga0496118_0016889 3300048921 Bacteria 6668
331 Ga0496118_0172845 3300048921 Bacteria 1317
332 Ga0496119_0054477 3300048922 Bacteria 2434
333 Ga0496119_0130450 3300048922 Bacteria 1370
334 Ga0496120_0010487 3300048923 Bacteria 6460
335 Ga0496120_0075515 3300048923 Bacteria 1839
336 Ga0496120_0130402 3300048923 Bacteria 1288
337 Ga0496121_0002730 3300048924 Bacteria 26286
338 Ga0496121_0013386 3300048924 Bacteria 8822
339 Ga0496121_0020076 3300048924 Bacteria 6638
340 Ga0496121_0022942 3300048924 Bacteria 6030
341 Ga0496121_0082337 3300048924 Bacteria 2544
342 Ga0496121_0158392 3300048924 Bacteria 1658
343 Ga0496121_0215321 3300048924 Bacteria 1357
344 Ga0496121_0251863 3300048924 Bacteria 1224
345 Ga0496121_0252702 3300048924 Bacteria 1221
346 Ga0496121_0368336 3300048924 Bacteria 951
347 Ga0496122_0000147 3300048925 Bacteria 165589
348 Ga0496122_0008977 3300048925 Bacteria 10628
349 Ga0496122_0011942 3300048925 Bacteria 8717
350 Ga0496122_0094906 3300048925 Bacteria 2017
351 Ga0496122_0113149 3300048925 Bacteria 1774
352 Ga0496122_0113242 3300048925 Bacteria 1773
353 Ga0496122_0126887 3300048925 Bacteria 1631
354 Ga0496122_0164022 3300048925 Bacteria 1350
355 Ga0496122_0238193 3300048925 Bacteria 1028
356 Ga0496123_0000339 3300048926 Bacteria 88118
357 Ga0496123_0009204 3300048926 Bacteria 8926
358 Ga0496123_0081375 3300048926 Bacteria 1968
359 Ga0496123_0122457 3300048926 Bacteria 1459
360 Ga0496123_0265895 3300048926 Bacteria 837
361 Ga0496124_0000513 3300048927 Bacteria 66793
362 Ga0496124_0002549 3300048927 Bacteria 23643
363 Ga0496124_0025777 3300048927 Bacteria 5316
364 Ga0496124_0053734 3300048927 Bacteria 3412
365 Ga0496124_0307216 3300048927 Bacteria 1142
366 Ga0496125_0000299 3300048928 Bacteria 97532
367 Ga0496125_0001813 3300048928 Bacteria 29493
368 Ga0496125_0009396 3300048928 Bacteria 10057
369 Ga0496125_0020123 3300048928 Bacteria 6274
370 Ga0496125_0130962 3300048928 Bacteria 1766
371 Ga0496125_0239752 3300048928 Bacteria 1152
372 Ga0496125_0442100 3300048928 Bacteria 747
373 Ga0496126_0000380 3300048929 Bacteria 92061
374 Ga0496126_0018987 3300048929 Bacteria 6789
375 Ga0496126_0048725 3300048929 Bacteria 3870
376 Ga0496126_0093859 3300048929 Bacteria 2634
377 Ga0496126_0397111 3300048929 Bacteria 1119
378 Ga0496126_0434326 3300048929 Bacteria 1059
379 Ga0496126_0552677 3300048929 Bacteria 913
380 Ga0495678_048231 3300049459 Bacteria 1662
381 Ga0501032_0076997 3300049569 Bacteria 2220
382 Ga0501034_0393480 3300049571 Bacteria 1309
383 Ga0501036_0479877 3300049572 Bacteria 1035
384 Ga0501037_0017214 3300049573 Bacteria 5321
385 Ga0501037_0101909 3300049573 Bacteria 2071
386 Ga0501038_0021186 3300049574 Bacteria 5839
387 Ga0501038_0098497 3300049574 Bacteria 2438
388 Ga0501043_0025894 3300049579 Bacteria 4602
389 Ga0501047_0291556 3300049581 Bacteria 1475
390 Ga0501047_0474043 3300049581 Bacteria 1080
391 Ga0501048_0426182 3300049582 Bacteria 949
392 Ga0501083_0197816 3300049744 Bacteria 1311
393 Ga0501083_0273715 3300049744 Bacteria 1098
394 Ga0501044_0061070 3300049823 Bacteria 3857
395 nmdc:mga03683_14045_c1 3300050489 Bacteria 2957
396 nmdc:mga0sz30_153158_c1 3300050516 Bacteria 1020
397 Ga0500578_0280382 3300053086 Bacteria 994
398 Ga0500658_0001142 3300053134 Bacteria 10833
399 Ga0500568_0004265 3300053139 Bacteria 7683
400 Ga0500568_0011577 3300053139 Bacteria 4084
401 Ga0500573_0001761 3300053140 Bacteria 10530
402 Ga0500573_0028647 3300053140 Bacteria 3208
403 Ga0500590_005274 3300053148 Bacteria 6206
404 Ga0500604_0039960 3300053151 Bacteria 1412
405 Ga0500616_0014549 3300053153 Bacteria 4519
406 Ga0500616_0127806 3300053153 Bacteria 1204
407 Ga0500622_0002165 3300053156 Bacteria 14555
408 Ga0500622_0033119 3300053156 Bacteria 2709
409 Ga0500633_0030243 3300053160 Bacteria 1739
410 Ga0587068_011792 3300059641 Bacteria 1325
411 Ga0466962_0033587 3300061719 Bacteria 2455
412 2509111708 2508501122 Bacteria 6292184
413 2509375158 2509276019 Bacteria 6802256
414 2509388620 2509276021 Bacteria 7634384
415 2509444171 2509276033 Bacteria 7180565
416 2510131237 2510065019 Bacteria 6903379
417 2510303491 2510065057 Bacteria 6649661
418 2510897573 2510461076 Bacteria 8618824
419 2511134756 2510917022 Bacteria 6504556
420 2511184630 2510917028 Bacteria 6185411
421 2511197712 2510917030 Bacteria 7460662
422 2511500289 2511231052 Bacteria 6974333
423 2512972918 2512875026 Bacteria 6861065
424 2513570442 2513237084 Bacteria 7231967
425 2513574555 2513237085 Bacteria 7695351
426 2513582299 2513237086 Bacteria 7265287
427 2513597261 2513237088 Bacteria 6927906
428 2513602746 2513237089 Bacteria 6553624
429 2513616586 2513237091 Bacteria 6900273
430 2513635887 2513237093 Bacteria 7545552
431 2513707155 2513237103 Bacteria 7647401
432 2513865017 2513237138 Bacteria 7368160
433 2513885793 2513237140 Bacteria 7076289
434 2513903924 2513237143 Bacteria 6664116
435 2513914165 2513237144 Bacteria 7530820
436 2513929370 2513237146 Bacteria 7166346
437 2513985762 2513237156 Bacteria 6402557
438 2513996582 2513237159 Bacteria 6810126
439 2514005010 2513237160 Bacteria 6650282
440 2514020436 2513237162 Bacteria 7468464
441 2515110169 2515075009 Bacteria 7288508
442 2515607564 2515154107 Bacteria 6795637
443 2515637476 2515154113 Bacteria 7807172
444 2515643612 2515154114 Bacteria 7848616
445 2515657007 2515154116 Bacteria 7552979
446 2515740754 2515154134 Bacteria 7220242
447 2516204492 2516143018 Bacteria 6951533
448 2516891690 2516653046 Bacteria 6989037
449 2517038863 2516653077 Bacteria 7555578
450 2517079110 2516653085 Bacteria 7346596
451 2517093050 2517093000 Bacteria 7412387
452 2517409327 2517287029 Bacteria 6905599
453 2517568466 2517487022 Bacteria 7227575
454 2524450704 2524023207 Bacteria 6813453
455 2524458244 2524023209 Bacteria 6679728
456 2530647995 2529292951 Bacteria 6916614
457 2535514924 2534681796 Bacteria 7146037
458 2551674468 2551306084 Bacteria 8942552
459 2551686484 2551306085 Bacteria 7347181
460 2551693493 2551306086 Bacteria 6843938
461 2551700474 2551306087 Bacteria 7351905
462 2551709027 2551306089 Bacteria 7162724
463 2551712769 2551306089 Bacteria 7162724
464 2551716523 2551306090 Bacteria 7953713
465 2551720285 2551306090 Bacteria 7953713
466 2551730753 2551306091 Bacteria 7086830
467 2551736162 2551306092 Bacteria 6992595
468 2551746332 2551306093 Bacteria 7064773
469 2558866260 2558860100 Bacteria 8458965
470 2585164746 2582581283 Bacteria 6030556
471 2585205658 2582581294 Bacteria 6626667
472 2585223611 2582581298 Bacteria 7315509
473 2585229668 2582581299 Bacteria 6518058
474 2585256056 2582581304 Bacteria 5831370
475 2585265123 2582581306 Bacteria 6450535
476 2585273823 2582581307 Bacteria 6597605
477 2585280125 2582581308 Bacteria 7413247
478 2585326096 2582581315 Bacteria 7318924
479 2585330261 2582581316 Bacteria 7774528
480 2585385746 2582581865 Bacteria 6644329
481 2585392087 2582581866 Bacteria 6859583
482 2585398737 2582581867 Bacteria 7184437
483 2585523555 2585427526 Bacteria 7258840
484 2585533624 2585427527 Bacteria 7273426
485 2585542030 2585427528 Bacteria 6842387
486 2585545793 2585427529 Bacteria 7395659
487 2585553215 2585427530 Bacteria 7383882
488 2585559999 2585427531 Bacteria 6992870
489 2585819141 2585427590 Bacteria 6824633
490 2585840322 2585427593 Bacteria 7141551
491 2585844050 2585427594 Bacteria 6180594
492 2585900674 2585427608 Bacteria 6544331
493 2585905821 2585427609 Bacteria 6667127
494 2587979063 2585428125 Bacteria 6662905
495 2599332866 2599185156 Bacteria 5403036
496 2599419363 2599185170 Bacteria 7295545
497 2600191237 2599185352 Bacteria 7228948
498 2616293607 2615840624 Bacteria 6557588
499 2616310328 2615840626 Bacteria 7921970
500 2616553293 2615840698 Bacteria 7319877
501 2617380375 2617270742 Bacteria 6808054
502 2643806125 2643221557 Bacteria 7184309
503 2643812771 2643221558 Bacteria 5460675
504 2643918296 2643221582 Bacteria 5804683
505 2644004743 2643221599 Bacteria 6292121
506 2644047384 2643221607 Bacteria 6314006
507 2644070321 2643221610 Bacteria 7480339
508 2644103456 2643221618 Bacteria 7717186
509 2644144335 2643221626 Bacteria 8069654
510 2644190406 2643221634 Bacteria 6705461
511 2644199802 2643221636 Bacteria 6583769
512 2644206930 2643221637 Bacteria 5345260
513 2644237330 2643221643 Bacteria 5749658
514 2644306386 2643221655 Bacteria 7722067
515 2644330576 2643221659 Bacteria 7890716
516 2644377387 2643221668 Bacteria 7306521
517 2644421083 2643221675 Bacteria 7473456
518 2644454606 2643221680 Bacteria 7473610
519 2644480173 2643221686 Bacteria 6310811
520 2644492695 2643221688 Bacteria 5260751
521 2644496972 2643221689 Bacteria 6042950
522 2644542620 2643221698 Bacteria 7756764
523 2644611997 2643221712 Bacteria 7729434
524 2644650578 2643221718 Bacteria 5345506
525 2644671812 2643221723 Bacteria 7095460
526 2644692545 2643221726 Bacteria 7455827
527 2671113777 2667528174 Bacteria 6435400
528 2692317449 2690316117 Bacteria 6800650
529 2719179374 2718217882 Bacteria 6556348
530 2719383946 2718217927 Bacteria 6972593
531 2719663735 2718217997 Bacteria 6740740
532 2719730044 2718218009 Bacteria 6478651
533 2720490154 2718218199 Bacteria 6740745
534 2720611535 2718218232 Bacteria 6720332
535 2720618384 2718218233 Bacteria 6662049
536 2720629791 2718218235 Bacteria 6630699
537 2720773486 2718218269 Bacteria 6906114
538 2721145467 2718218363 Bacteria 6524337
539 2721157001 2718218365 Bacteria 6274507
540 2721162362 2718218366 Bacteria 6425255
541 2721397716 2718218423 Bacteria 6438183
542 2722838532 2721755514 Bacteria 6424414
543 2723025159 2721755556 Bacteria 6745503
544 2723558744 2721755684 Bacteria 6859907
545 2723565312 2721755685 Bacteria 6704835
546 2724036526 2721755809 Bacteria 6438790
547 2724042800 2721755810 Bacteria 6479005
548 2724088093 2721755819 Bacteria 6906405
549 2724102577 2721755822 Bacteria 6726041
550 2724108474 2721755823 Bacteria 6752556
551 2725945501 2724679232 Bacteria 7646494
552 2730106095 2728369352 Bacteria 6745171
553 2730162611 2728369365 Bacteria 6555560
554 2730296633 2728369397 Bacteria 6274511
555 2738801393 2738541293 Bacteria 7065685
556 2739036734 2738541333 Bacteria 7106503
557 2753462604 2751185821 Bacteria 6189929
558 2766062727 2765235942 Bacteria 7445910
559 2778179601 2775507266 Bacteria 7392367
560 2792621255 2791355091 Bacteria 6135441
561 2792625470 2791355092 Bacteria 6248105
562 2792637904 2791355094 Bacteria 7011481
563 2793295384 2791355256 Bacteria 6798008
564 2793317981 2791355259 Bacteria 7254731
565 2793325100 2791355260 Bacteria 6598818
566 2793326328 2791355261 Bacteria 6661293
567 2793334412 2791355262 Bacteria 6774204
568 2793344704 2791355263 Bacteria 6872478
569 2793348325 2791355264 Bacteria 6429314
570 2793355627 2791355265 Bacteria 6539969
571 2793363800 2791355266 Bacteria 7116587
572 2793365702 2791355267 Bacteria 7222458
573 2802718487 2802428858 Bacteria 6636079
574 2802726310 2802428859 Bacteria 6667919
575 2802731536 2802428860 Bacteria 6525526
576 2802740834 2802428861 Bacteria 6534206
577 2802742430 2802428862 Bacteria 6633353
578 2802749136 2802428863 Bacteria 6410669
579 2805931977 2802429605 Bacteria 6875453
580 2805932530 2802429606 Bacteria 6346811
581 2806048434 2802429633 Bacteria 7341974
582 2806055915 2802429634 Bacteria 7083200
583 2806062757 2802429635 Bacteria 7650140
584 2806066435 2802429636 Bacteria 7597525
585 2806073490 2802429637 Bacteria 7067217
586 2819556598 2818991439 Bacteria 6907412
587 2819608524 2818991448 Bacteria 6772224
588 2819640632 2818991453 Bacteria 7181617
589 2838020103 2838016132 Bacteria 6577831
590 2838027657 2838022645 Bacteria 6494267
591 2838029407 2838029111 Bacteria 6603031
592 2838040104 2838035591 Bacteria 7166484
593 2838048673 2838042994 Bacteria 6046894
594 2838051683 2838048938 Bacteria 6044578
595 2838064247 2838061910 Bacteria 6794874
596 2838070930 2838068647 Bacteria 6208656
597 2838075188 2838074704 Bacteria 6785777
598 2838665964 2838661181 Bacteria 7385261
599 2838673369 2838668709 Bacteria 6671819
600 2838680411 2838680041 Bacteria 6545511
601 2838691792 2838686498 Bacteria 7807632
602 2838695556 2838694306 Bacteria 6853137
603 2838706116 2838701080 Bacteria 6669771
604 2838708933 2838707686 Bacteria 6619912
605 2838733724 2838729681 Bacteria 7400765
606 2838749582 2838742623 Bacteria 7396178
607 2841846917 2841846520 Bacteria 5345850
608 2841856353 2841851746 Bacteria 7532261
609 2841866994 2841864319 Bacteria 6742987
610 2842079832 2842077413 Bacteria 6508645
611 2842112012 2842110456 Bacteria 7656360
612 2842120450 2842118031 Bacteria 7033875
613 2842127054 2842124991 Bacteria 5346824
614 2842150541 2842146304 Bacteria 5957337
615 2842162142 2842156927 Bacteria 6894975
616 2842165356 2842163707 Bacteria 6916235
617 2842185983 2842180545 Bacteria 6888678
618 2842192727 2842192696 Bacteria 6147454
619 2842204214 2842198810 Bacteria 6608673
620 2842207119 2842205361 Bacteria 6340321
621 2842219023 2842217011 Bacteria 7497767
622 2842236225 2842229732 Bacteria 7475766
623 2842238344 2842237096 Bacteria 6620661
624 2842248034 2842243621 Bacteria 7421798
625 2842255580 2842250916 Bacteria 6579627
626 2842262372 2842257432 Bacteria 7401195
627 2842270471 2842264693 Bacteria 6472963
628 2842276765 2842271015 Bacteria 7807131
629 2842280188 2842278818 Bacteria 6340002
630 2842286645 2842285085 Bacteria 6011953
631 2842293493 2842291075 Bacteria 7076806
632 2842299570 2842298080 Bacteria 6123127
633 2842311098 2842304105 Bacteria 7023636
634 2842312804 2842311132 Bacteria 6616990
635 2842323891 2842317721 Bacteria 6793725
636 2842343258 2842341865 Bacteria 7003929
637 2842360998 2842357229 Bacteria 6485165
638 2842367017 2842363717 Bacteria 6844742
639 2842370874 2842370503 Bacteria 7038661
640 2842379890 2842377471 Bacteria 7140707
641 2842386961 2842384541 Bacteria 7057858
642 2842399044 2842395702 Bacteria 6780583
643 2842403802 2842402390 Bacteria 6681310
644 2842410496 2842409023 Bacteria 6687331
645 2842417143 2842415677 Bacteria 6596907
646 2842424545 2842422224 Bacteria 6239196
647 2842434293 2842428310 Bacteria 6767288
648 2842440600 2842434925 Bacteria 6502746
649 2842447252 2842441272 Bacteria 6769273
650 2842452030 2842447887 Bacteria 6754142
651 2842468686 2842462802 Bacteria 6588055
652 2842475231 2842469257 Bacteria 6752936
653 2842476163 2842475841 Bacteria 6603183
654 2842487629 2842482326 Bacteria 7212537
655 2842492622 2842489311 Bacteria 6620893
656 2842500213 2842495871 Bacteria 6820686
657 2842502935 2842502639 Bacteria 6604161
658 2842512786 2842509118 Bacteria 6850950
659 2842521511 2842521101 Bacteria 6569494
660 2842923157 2842922631 Bacteria 5824079
661 2844165094 2844163670 Bacteria 7266046
662 2844456201 2844454524 Bacteria 7952546
663 2847417483 2847417321 Bacteria 6913799
664 2848992318 2848992105 Bacteria 6810864
665 2850079820 2850079185 Bacteria 6848280
666 2852388356 2852387548 Bacteria 8025568
667 2855828059 2855825444 Bacteria 6785811
668 2855839830 2855839649 Bacteria 7135830
669 2855873543 2855872281 Bacteria 6964271
670 2857521869 2857516855 Bacteria 7787325
671 2858803804 2858800743 Bacteria 6603254
672 2891375118 2891373044 Bacteria 5202277
673 2915984016 2915980308 Bacteria 6624279
674 2915990688 2915986958 Bacteria 6739310
675 2915997164 2915993759 Bacteria 7016183
676 2916000930 2916000859 Bacteria 6865702
677 2916011175 2916007675 Bacteria 6898660
678 2916021291 2916014648 Bacteria 6946486
679 2916021986 2916021584 Bacteria 6854472
680 2916034079 2916028427 Bacteria 6748433
681 2916036347 2916035215 Bacteria 6755766
682 2916048410 2916041962 Bacteria 6820487
683 2916053662 2916048683 Bacteria 6543552
684 2916056938 2916055098 Bacteria 6758838
685 2916064784 2916061851 Bacteria 6737736
686 2916071305 2916068649 Bacteria 6943657
687 2916080767 2916076590 Bacteria 6596108
688 2919101506 2919100787 Bacteria 7710546
689 2919116419 2919114240 Bacteria 5700270
690 2919408684 2919408235 Bacteria 6149349
691 2920763557 2920760137 Bacteria 7427611
692 2920823216 2920822456 Bacteria 6897201
693 2921205543 2921201388 Bacteria 6926299
694 2921213697 2921208531 Bacteria 6745326
695 2921241523 2921237296 Bacteria 6876710
696 2921247102 2921244191 Bacteria 6568419
697 2921254456 2921250672 Bacteria 6677771
698 2921262835 2921257292 Bacteria 6808382
699 2921268684 2921263974 Bacteria 6864552
700 2921288230 2921282425 Bacteria 6826397
701 2921291757 2921289301 Bacteria 7316391
702 2921297327 2921296804 Bacteria 7176999
703 2923556549 2923556063 Bacteria 6793593
704 2924150766 2924144063 Bacteria 6883928
705 2924156669 2924150972 Bacteria 7169444
706 2924160319 2924158325 Bacteria 7188855
707 2924170729 2924165586 Bacteria 7260590
708 2924176846 2924172951 Bacteria 6749356
709 2924183643 2924179722 Bacteria 6843264
710 2924187498 2924186466 Bacteria 6876637
711 2924198993 2924193448 Bacteria 6955718
712 2924200861 2924200457 Bacteria 6757188
713 2924209215 2924207177 Bacteria 6917007
714 2924216116 2924214083 Bacteria 7080103
715 2924226559 2924221636 Bacteria 7113495
716 2924232753 2924228884 Bacteria 6633132
717 2933023545 2933016740 Bacteria 6355406
718 2933577002 2933570622 Bacteria 7023390
719 2933587341 2933586486 Bacteria 7667493
720 2933601729 2933599457 Bacteria 5858799
721 2935896080 2935894831 Bacteria 6620579
722 2935902724 2935901341 Bacteria 7341747
723 2936369130 2936367885 Bacteria 7324495
724 2936377527 2936375103 Bacteria 6652732
725 2936383575 2936381700 Bacteria 7006523
726 2937001848 2936996657 Bacteria 6298727
727 2937007702 2937002841 Bacteria 6934057
728 2937014951 2937009748 Bacteria 6746052
729 2937022305 2937016420 Bacteria 6782579
730 2937023371 2937023124 Bacteria 6815156
731 2937034418 2937029754 Bacteria 6424026
732 2937039728 2937036028 Bacteria 6846469
733 2937044861 2937042894 Bacteria 6741576
734 2937053369 2937049772 Bacteria 6757901
735 2937062729 2937056579 Bacteria 7107896
736 2937064235 2937063883 Bacteria 7199456
737 2937074887 2937071275 Bacteria 6984483
738 2937078906 2937078374 Bacteria 6610289
739 2937087641 2937084907 Bacteria 6618516
740 2937092044 2937091812 Bacteria 6979387
741 2937099880 2937098957 Bacteria 7249374
742 2937106411 2937106411 Bacteria 6947143
743 2937119477 2937113482 Bacteria 6505872
744 2937126185 2937119839 Bacteria 6597547
745 2937131608 2937126314 Bacteria 6771275
746 2941500881 2941499720 Bacteria 7599444
747 2957379860 2957375807 Bacteria 6425588
748 2957388671 2957382221 Bacteria 6737050
749 2957393385 2957388812 Bacteria 6778072
750 2957400274 2957395598 Bacteria 6822399
751 2957403886 2957402308 Bacteria 6741770
752 2957413764 2957408893 Bacteria 6558585
753 2957417670 2957415311 Bacteria 6991633
754 2957423330 2957422303 Bacteria 7172205
755 2957436893 2957430029 Bacteria 7022557
756 2957443668 2957437181 Bacteria 6568994
757 2957447291 2957443900 Bacteria 6869977
758 2957451214 2957450854 Bacteria 6765715
759 2957460186 2957457609 Bacteria 6967680
760 2957469581 2957464669 Bacteria 6568877
761 2957473529 2957471148 Bacteria 6797643
762 2957482011 2957478035 Bacteria 6756658
763 2957484836 2957484790 Bacteria 6703082
764 2957492111 2957491536 Bacteria 6695180
765 2957500662 2957498199 Bacteria 7126688
766 2957508130 2957505466 Bacteria 7253085
767 2960586153 2960584000 Bacteria 6864594
768 2960594601 2960591022 Bacteria 6622873
769 2960603389 2960597568 Bacteria 6550735
770 2960607803 2960603979 Bacteria 6898737
771 2960611730 2960610863 Bacteria 6691244
772 2960621533 2960617483 Bacteria 6727748
773 2960626777 2960624210 Bacteria 6875384
774 2960634982 2960631154 Bacteria 6732508
775 2960641540 2960637947 Bacteria 7296468
776 2960648080 2960645483 Bacteria 7211087
777 2960658306 2960652885 Bacteria 7083688
778 2960660575 2960660292 Bacteria 7041660
779 2960672189 2960667422 Bacteria 6763020
780 2960679599 2960674078 Bacteria 6609048
781 2960684711 2960680706 Bacteria 6624464
782 2960687510 2960687367 Bacteria 6535474
783 2960694516 2960693952 Bacteria 6749742
784 2964610539 2964607997 Bacteria 7101408
785 2964618431 2964615318 Bacteria 6809089
786 2964625434 2964621998 Bacteria 6834995
787 2964633790 2964628898 Bacteria 7083044
788 2964639461 2964636051 Bacteria 7091832
789 2964649378 2964643177 Bacteria 6820887
790 2964650168 2964649959 Bacteria 6675118
791 2964663076 2964656573 Bacteria 7100150
792 2964668098 2964663802 Bacteria 7019362
793 2964671862 2964670856 Bacteria 6851364
794 2964679839 2964678106 Bacteria 6792020
795 2964691669 2964685014 Bacteria 6839111
796 2964697713 2964691889 Bacteria 6802758
797 2964703353 2964698721 Bacteria 6765331
798 2964710200 2964705432 Bacteria 7114648
799 2964717224 2964712639 Bacteria 6695970
800 2964722036 2964719344 Bacteria 7286602
801 2967670528 2967664464 Bacteria 6948836
802 2967671860 2967671571 Bacteria 7021409
803 2967680929 2967678726 Bacteria 7264382
804 2967689604 2967686174 Bacteria 6678622
805 2967694906 2967693043 Bacteria 6804451
806 2967703532 2967699805 Bacteria 6854538
807 2967712297 2967706974 Bacteria 7186053
808 2967714500 2967714385 Bacteria 7000047
809 2967723448 2967721400 Bacteria 7073753
810 2967730393 2967728569 Bacteria 6641507
811 2967739250 2967735183 Bacteria 6827012
812 2967744837 2967742019 Bacteria 6794534
813 2967754888 2967748971 Bacteria 6733771
814 2967761170 2967755722 Bacteria 6814706
815 2967766553 2967762386 Bacteria 6923502
816 2967769942 2967769361 Bacteria 6587838
817 2967778067 2967775926 Bacteria 6738189
818 2970023289 2970019648 Bacteria 7072033
819 2970030894 2970026789 Bacteria 6785236
820 2970037109 2970033650 Bacteria 7118744
821 2970041117 2970040964 Bacteria 6731123
822 2970050696 2970047711 Bacteria 7088379
823 2970056847 2970054988 Bacteria 6611507
824 2970062737 2970061556 Bacteria 7099761
825 2970075392 2970068827 Bacteria 7123112
826 2970081781 2970076120 Bacteria 6697332
827 2970088386 2970082768 Bacteria 6183754
828 2970089503 2970088815 Bacteria 6933825
829 2970101912 2970095765 Bacteria 6936963
830 2970105982 2970102677 Bacteria 6812532
831 2970115755 2970109326 Bacteria 6863976
832 2970117620 2970116247 Bacteria 6501857
833 2970124225 2970122695 Bacteria 6625855
834 2970131404 2970129317 Bacteria 6806560
835 2970138970 2970136068 Bacteria 7207982
836 2970144283 2970143518 Bacteria 6446480
837 2970154470 2970149975 Bacteria 6779706
838 2970161314 2970156795 Bacteria 7168044
839 2970170115 2970164137 Bacteria 6861252
840 2970175823 2970170962 Bacteria 6876229
841 2970183683 2970177841 Bacteria 6768001
842 2970190831 2970184632 Bacteria 7054431
843 2970197451 2970191845 Bacteria 7032787
844 2977521118 2977516862 Bacteria 6940108
845 2977528548 2977523885 Bacteria 6960446
846 2977532612 2977530762 Bacteria 6951399
847 2977543802 2977537788 Bacteria 6929320
848 2977550366 2977544691 Bacteria 6875412
849 2977553459 2977551784 Bacteria 7125765
850 2977563724 2977558990 Bacteria 6863948
851 2977571738 2977565890 Bacteria 6901543
852 2977574681 2977572785 Bacteria 6763888
853 2977584441 2977579622 Bacteria 6772100
854 2979105089 2979100975 Bacteria 5423623
855 2984513097 2984509177 Bacteria 5274802
856 2984520538 2984518228 Bacteria 5277463
857 2984539832 2984537506 Bacteria 5277481
858 2984602067 2984601300 Bacteria 5455244
859 2989351639 2989349275 Bacteria 6349068
860 2989772644 2989771324 Bacteria 5605128
861 2996888349 2996887358 Bacteria 5795980
862 2996893268 2996893221 Bacteria 5823108
863 3003931777 3003930520 Bacteria 5667563
864 3005411003 3005409236 Bacteria 7188837
865 3005422924 3005416602 Bacteria 7064308
866 3005446029 3005445848 Bacteria 6906074
867 3005452680 3005452660 Bacteria 5889319
868 3005456701 3005452660 Bacteria 5889319
869 639646458 639633055 Bacteria 7751309
870 643824382 643692032 Bacteria 6891900
871 648738454 648276728 Bacteria 6968865
872 8003992284 8003992118 Bacteria 7266902
873 8003999548 8003999396 Bacteria 7063185
874 8005261095 8005258706 Bacteria 6184835
875 8005278656 8005275841 Bacteria 6929066
876 8005289190 8005282627 Bacteria 6675747
877 8005291261 8005289223 Bacteria 6634003
878 8005301365 8005301065 Bacteria 6614431
879 8005310651 8005307578 Bacteria 7395396
880 8005321540 8005314921 Bacteria 7072929
881 8005322876 8005321885 Bacteria 5795980
882 8005377622 8005376324 Bacteria 6590079
883 8005387469 8005382845 Bacteria 6732062
884 8005399951 8005395548 Bacteria 6806915
885 8005432750 8005430974 Bacteria 6689030
886 8005460806 8005460587 Bacteria 7157962
887 8005484831 8005484373 Bacteria 6297373
888 8005498480 8005497431 Bacteria 6477605
889 8005543597 8005542996 Bacteria 7077758
890 8005560418 8005556819 Bacteria 6908598
891 8005564122 8005563573 Bacteria 7153261
892 8005573688 8005570704 Bacteria 6957481
893 8005619671 8005619151 Bacteria 7030230
894 8005628244 8005626139 Bacteria 6534237
895 8005649525 8005645114 Bacteria 6950293
896 8005669890 8005668836 Bacteria 6953162
897 8005685232 8005682033 Bacteria 6726518
898 8005692427 8005688590 Bacteria 6610080
899 8005699462 8005695170 Bacteria 6912330
900 8018132913 8018127388 Bacteria 7351159
901 8018152965 8018150411 Bacteria 5549903
902 8018165407 8018163183 Bacteria 7277977
903 8018181018 8018176218 Bacteria 6896178
904 8023684437 8023680758 Bacteria 7729763
905 8024480096 8024479707 Bacteria 6954785
906 8024491528 8024486573 Bacteria 6540512
907 8024501764 8024501048 Bacteria 6427847
908 8046770821 8046767195 Bacteria 7547379
909 8054563027 8054558443 Bacteria 5204801
910 8055433554 8055431914 Bacteria 4551896
911 8056378595 8056375014 Bacteria 7006639
912 8056385779 8056382006 Bacteria 6408074
913 8056877128 8056875544 Bacteria 4355797
914 8057580575 8057575449 Bacteria 7367519
915 8057875842 8057874678 Bacteria 7494653
916 Ga0495631_0084809
917 JGI24740J21852_10000426
918 JGI25155J39150_1000013
919 JGI25156J39149_1000011
920 JGI25162J39368_1000169
921 JGI25162J39368_1000698
922 JGI25154J39366_1000030
923 JGI25158J39367_1000090
924 JGI25157J39369_1000013
925 JGI25152J39213_1000246
926 JGI25152J39213_1000500
927 JGI25152J39213_1016171
928 JGI25152J39213_1016174
929 JGI25150J39212_1000118
930 JGI25150J39212_1004187
931 JGI25150J39212_1005928
932 JGI25159J45721_1000003
933 JGI25159J45721_1000942
934 JGI25151J46595_10000110
935 JGI25151J46595_10000681
936 JGI25151J46595_10003279
937 JGI25151J46595_10008982
938 JGI25165J46597_1000349
939 JGI25165J46597_1000355
940 JGI25153J46596_10000482
941 JGI25153J46596_10035651
942 JGI25153J46596_10040347
943 JGI25153J46596_10040373
944 JGI25153J46596_10047850
945 rootH1_10043182
946 rootL2_10235986
947 rootH1_10130347
948 JGI25160J50197_1000003
949 JGI25160J50197_1000041
950 JGI25160J50197_1000514
951 JGI25160J50197_1011969
952 JGI25161J50226_1000002
953 JGI25161J50226_1000184
954 JGI25161J50226_1000270
955 JGI25161J50226_1004678
956 Ga0006562J51391_1024010
957 Ga0055526_1000725
958 Ga0055526_1002842
959 Ga0055526_1004258
960 Ga0055526_1017123
961 Ga0055524_1002851
962 Ga0055524_1006954
963 Ga0055524_1015572
964 Ga0055524_1018417
965 Ga0055536_1019078
966 Ga0055528_1000095
967 Ga0055528_1000618
968 Ga0055528_1015870
969 Ga0055528_1021492
970 Ga0055528_1023363
971 Ga0055540_1000190
972 Ga0055540_1007520
973 Ga0055531_10005539
974 Ga0058692_1017409
975 Ga0055543_1000008
976 Ga0055543_1000059
977 Ga0055543_1000299
978 Ga0055543_1003650
979 Ga0065165_1000031
980 Ga0065165_1000084
981 Ga0065165_1012356
982 Ga0065165_1040779
983 Ga0070670_100000160
984 Ga0070671_100027922
985 Ga0070667_100181766
986 Ga0070665_100085654
987 Ga0070665_100136036
988 Ga0068855_100086831
989 Ga0068856_100094550
990 Ga0068851_10026861
991 Ga0068862_100147624
992 Ga0075365_10003496
993 Ga0075365_10007830
994 Ga0075368_10034448
995 Ga0075362_10007175
996 Ga0075367_10033635
997 Ga0075369_10008457
998 Ga0075366_10019959
999 Ga0075370_10148964
1000 Ga0105251_10057758
1001 Ga0105244_10157911
1002 Ga0105240_10000460
1003 Ga0105237_10001005
1004 Ga0123341_1000067
1005 Ga0123341_1068588
1006 Ga0123342_1010893
1007 Ga0105239_10002984
1008 Ga0157370_10000879
1009 Ga0171463_1001
1010 Ga0182008_10294383
1011 Ga0182007_10003141
1012 Ga0182005_1001666
1013 Ga0183363_1134
1014 Ga0214542_1001074
1015 Ga0214542_1025837
1016 Ga0214543_1000027
1017 Ga0214543_1000897
1018 Ga0228711_1000041
1019 Ga0228710_1000024
1020 Ga0209435_100026
1021 Ga0209436_100006
1022 Ga0209436_100836
1023 Ga0209437_100056
1024 Ga0209437_100196
1025 Ga0207425_1000012
1026 Ga0207425_1002717
1027 Ga0207425_1006821
1028 Ga0209646_1000084
1029 Ga0209026_1000080
1030 Ga0209677_102042
1031 Ga0209759_1000061
1032 Ga0209129_1000105
1033 Ga0209129_1000110
1034 Ga0209129_1000429
1035 Ga0209129_1001484
1036 Ga0209129_1001523
1037 Ga0209129_1001602
1038 Ga0209129_1002388
1039 Ga0209233_1000037
1040 Ga0209233_1000071
1041 Ga0209233_1000243
1042 Ga0209455_1009107
1043 Ga0209455_1036307
1044 Ga0209673_1000015
1045 Ga0209673_1000063
1046 Ga0209673_1001004
1047 Ga0209673_1002293
1048 Ga0209673_1003895
1049 Ga0209673_1006202
1050 Ga0209673_1012901
1051 Ga0209673_1056919
1052 Ga0209130_1000002
1053 Ga0209130_1000005
1054 Ga0209130_1000382
1055 Ga0209676_1033105
1056 Ga0209025_1000024
1057 Ga0209025_1000037
1058 Ga0209025_1000295
1059 Ga0209025_1000638
1060 Ga0209025_1003060
1061 Ga0209025_1012788
1062 Ga0209025_1013101
1063 Ga0209025_1042695
1064 Ga0209564_1000093
1065 Ga0209564_1000316
1066 Ga0209564_1004460
1067 Ga0209564_1008398
1068 Ga0209564_1029360
1069 Ga0209758_1000150
1070 Ga0209758_1000361
1071 Ga0209758_1000499
1072 Ga0209758_1000876
1073 Ga0209758_1001299
1074 Ga0209758_1002582
1075 Ga0209758_1007691
1076 Ga0209758_1014373
1077 Ga0209050_1011207
1078 Ga0209050_1019868
1079 Ga0209256_1000027
1080 Ga0209256_1000880
1081 Ga0209256_1001669
1082 Ga0209256_1002179
1083 Ga0209256_1005310
1084 Ga0209256_1005901
1085 Ga0209256_1006338
1086 Ga0209256_1016791
1087 Ga0209256_1044286
1088 Ga0207426_1000012
1089 Ga0207426_1000013
1090 Ga0207426_1000015
1091 Ga0207426_1000070
1092 Ga0207426_1001614
1093 Ga0209051_1000135
1094 Ga0209051_1006292
1095 Ga0209051_1055969
1096 Ga0209051_1064569
1097 Ga0209257_1005318
1098 Ga0209257_1029056
1099 Ga0207656_10027931
1100 Ga0207647_10274920
1101 Ga0207695_10000036
1102 Ga0207671_10000153
1103 Ga0207650_10000776
1104 Ga0207711_10167094
1105 Ga0207658_10277195
1106 Ga0207702_10119215
1107 Ga0207698_10049414
1108 Ga0209281_1000409
1109 Ga0209281_1000520
1110 Ga0209371_1000009
1111 Ga0209371_1000424
1112 Ga0209282_1000090
1113 Ga0209813_10115148
1114 Ga0268266_10119922
1115 Ga0268265_10853713
1116 Ga0307515_10000674
1117 Ga0307515_10006511
1118 Ga0307515_10012267
1119 Ga0307515_10148902
1120 Ga0268256_1000010
1121 Ga0307513_10000180
1122 Ga0307513_10236576
1123 Ga0307405_10000250
1124 Ga0307406_10002749
1125 Ga0307412_10000491
1126 Ga0307412_10527791
1127 Ga0315914_1000167
1128 Ga0307416_100620524
1129 Ga0307414_10727507
1130 Ga0315913_1000038
1131 Ga0315915_1000019
1132 Ga0439439_0027122
1133 Ga0439447_022451
1134 Ga0439465_0004487
1135 Ga0439465_0019725
1136 Ga0451787_252007
1137 Ga0451791_0180341
1138 Ga0451835_0388755
1139 Ga0451837_0526223
1140 Ga0451839_0199143
1141 Ga0451841_1408368
1142 Ga0451845_0150991
1143 Ga0451847_0236407
1144 Ga0451851_0308271
1145 Ga0451843_1263341
1146 Ga0451855_2061497
1147 Ga0451853_3650313
1148 Ga0439462_0011595
1149 Ga0466966_0095761
1150 Ga0466963_0003933
1151 Ga0466964_0085405
1152 Ga0466970_0002858
1153 Ga0466957_0052900
1154 Ga0466958_0253842
1155 Ga0466967_0214337
1156 Ga0495592_0186801
1157 Ga0495590_0186407
1158 Ga0495629_0012377
1159 Ga0495638_0020006
1160 Ga0495605_0024123
1161 Ga0495639_0125449
1162 Ga0495662_0012312
1163 Ga0495585_0009240
1164 Ga0495607_0018739
1165 Ga0495583_0003772
1166 Ga0495606_0001337
1167 Ga0495606_0164468
1168 Ga0495606_0184566
1169 Ga0495606_0399359
1170 Ga0495610_0000461
1171 Ga0495610_0118502
1172 Ga0495618_0250994
1173 Ga0495620_0067648
1174 Ga0495620_0115391
1175 Ga0495620_0139721
1176 Ga0495631_0019196
1177 Ga0495632_0006289
1178 Ga0495632_0070468
1179 Ga0495643_0008921
1180 Ga0495643_0050571
1181 Ga0495648_0037751
1182 Ga0495652_0196599
1183 Ga0495587_0068202
1184 Ga0495609_0047847
1185 Ga0495633_0046861
1186 Ga0495633_0073927
1187 Ga0495656_0018785
1188 Ga0495668_0097091
1189 Ga0495668_0216647
1190 Ga0495634_0128294
1191 Ga0495625_0026846
1192 Ga0495625_0250888
1193 Ga0495635_0057071
1194 Ga0495661_0100588
1195 Ga0495661_0125309
1196 Ga0495661_0201396
1197 Ga0495661_0240021
1198 Ga0495588_0030848
1199 Ga0495588_0031208
1200 Ga0495623_0180036
1201 Ga0495646_0160553
1202 Ga0495613_0604123
1203 Ga0495624_0166998
1204 Ga0495670_0182377
1205 Ga0495670_0262256
1206 Ga0495649_0173544
1207 Ga0495589_0189453
1208 Ga0495600_0016251
1209 Ga0495660_0077835
1210 Ga0495660_0156043
1211 Ga0495672_0150290
1212 Ga0495687_068328
1213 Ga0495679_090652
1214 Ga0495681_0106643
1215 Ga0495686_0014419
1216 Ga0495686_0016096
1217 Ga0495686_0040112
1218 Ga0495686_0125744
1219 Ga0495626_0123295
1220 Ga0496100_0035945
1221 Ga0496101_0576949
1222 Ga0496102_0006201
1223 Ga0496102_0409297
1224 Ga0496103_0015905
1225 Ga0496104_0081774
1226 Ga0496105_0179781
1227 Ga0496106_0004867
1228 Ga0496106_0409795
1229 Ga0496111_0177519
1230 Ga0496113_0253089
1231 Ga0496116_0001406
1232 Ga0496116_0002602
1233 Ga0496116_0004126
1234 Ga0496116_0058538
1235 Ga0496116_0103637
1236 Ga0496116_0194716
1237 Ga0496116_0206798
1238 Ga0496117_0001819
1239 Ga0496117_0014921
1240 Ga0496117_0018471
1241 Ga0496117_0023539
1242 Ga0496117_0128717
1243 Ga0496118_0001431
1244 Ga0496118_0008398
1245 Ga0496118_0016889
1246 Ga0496118_0172845
1247 Ga0496119_0054477
1248 Ga0496119_0130450
1249 Ga0496120_0010487
1250 Ga0496120_0075515
1251 Ga0496120_0130402
1252 Ga0496121_0002730
1253 Ga0496121_0013386
1254 Ga0496121_0020076
1255 Ga0496121_0022942
1256 Ga0496121_0082337
1257 Ga0496121_0158392
1258 Ga0496121_0215321
1259 Ga0496121_0251863
1260 Ga0496121_0252702
1261 Ga0496121_0368336
1262 Ga0496122_0000147
1263 Ga0496122_0008977
1264 Ga0496122_0011942
1265 Ga0496122_0094906
1266 Ga0496122_0113149
1267 Ga0496122_0113242
1268 Ga0496122_0126887
1269 Ga0496122_0164022
1270 Ga0496122_0238193
1271 Ga0496123_0000339
1272 Ga0496123_0009204
1273 Ga0496123_0081375
1274 Ga0496123_0122457
1275 Ga0496123_0265895
1276 Ga0496124_0000513
1277 Ga0496124_0002549
1278 Ga0496124_0025777
1279 Ga0496124_0053734
1280 Ga0496124_0307216
1281 Ga0496125_0000299
1282 Ga0496125_0001813
1283 Ga0496125_0009396
1284 Ga0496125_0020123
1285 Ga0496125_0130962
1286 Ga0496125_0239752
1287 Ga0496125_0442100
1288 Ga0496126_0000380
1289 Ga0496126_0018987
1290 Ga0496126_0048725
1291 Ga0496126_0093859
1292 Ga0496126_0397111
1293 Ga0496126_0434326
1294 Ga0496126_0552677
1295 Ga0495678_048231
1296 Ga0501032_0076997
1297 Ga0501034_0393480
1298 Ga0501036_0479877
1299 Ga0501037_0017214
1300 Ga0501037_0101909
1301 Ga0501038_0021186
1302 Ga0501038_0098497
1303 Ga0501043_0025894
1304 Ga0501047_0291556
1305 Ga0501047_0474043
1306 Ga0501048_0426182
1307 Ga0501083_0197816
1308 Ga0501083_0273715
1309 Ga0501044_0061070
1310 nmdc:mga03683_14045_c1
1311 nmdc:mga0sz30_153158_c1
1312 Ga0500578_0280382
1313 Ga0500658_0001142
1314 Ga0500568_0004265
1315 Ga0500568_0011577
1316 Ga0500573_0001761
1317 Ga0500573_0028647
1318 Ga0500590_005274
1319 Ga0500604_0039960
1320 Ga0500616_0014549
1321 Ga0500616_0127806
1322 Ga0500622_0002165
1323 Ga0500622_0033119
1324 Ga0500633_0030243
1325 Ga0587068_011792
1326 Ga0466962_0033587
1327 2509111708
1328 2509375158
1329 2509388620
1330 2509444171
1331 2510131237
1332 2510303491
1333 2510897573
1334 2511134756
1335 2511184630
1336 2511197712
1337 2511500289
1338 2512972918
1339 2513570442
1340 2513574555
1341 2513582299
1342 2513597261
1343 2513602746
1344 2513616586
1345 2513635887
1346 2513707155
1347 2513865017
1348 2513885793
1349 2513903924
1350 2513914165
1351 2513929370
1352 2513985762
1353 2513996582
1354 2514005010
1355 2514020436
1356 2515110169
1357 2515607564
1358 2515637476
1359 2515643612
1360 2515657007
1361 2515740754
1362 2516204492
1363 2516891690
1364 2517038863
1365 2517079110
1366 2517093050
1367 2517409327
1368 2517568466
1369 2524450704
1370 2524458244
1371 2530647995
1372 2535514924
1373 2551674468
1374 2551686484
1375 2551693493
1376 2551700474
1377 2551709027
1378 2551712769
1379 2551716523
1380 2551720285
1381 2551730753
1382 2551736162
1383 2551746332
1384 2558866260
1385 2585164746
1386 2585205658
1387 2585223611
1388 2585229668
1389 2585256056
1390 2585265123
1391 2585273823
1392 2585280125
1393 2585326096
1394 2585330261
1395 2585385746
1396 2585392087
1397 2585398737
1398 2585523555
1399 2585533624
1400 2585542030
1401 2585545793
1402 2585553215
1403 2585559999
1404 2585819141
1405 2585840322
1406 2585844050
1407 2585900674
1408 2585905821
1409 2587979063
1410 2599332866
1411 2599419363
1412 2600191237
1413 2616293607
1414 2616310328
1415 2616553293
1416 2617380375
1417 2643806125
1418 2643812771
1419 2643918296
1420 2644004743
1421 2644047384
1422 2644070321
1423 2644103456
1424 2644144335
1425 2644190406
1426 2644199802
1427 2644206930
1428 2644237330
1429 2644306386
1430 2644330576
1431 2644377387
1432 2644421083
1433 2644454606
1434 2644480173
1435 2644492695
1436 2644496972
1437 2644542620
1438 2644611997
1439 2644650578
1440 2644671812
1441 2644692545
1442 2671113777
1443 2692317449
1444 2719179374
1445 2719383946
1446 2719663735
1447 2719730044
1448 2720490154
1449 2720611535
1450 2720618384
1451 2720629791
1452 2720773486
1453 2721145467
1454 2721157001
1455 2721162362
1456 2721397716
1457 2722838532
1458 2723025159
1459 2723558744
1460 2723565312
1461 2724036526
1462 2724042800
1463 2724088093
1464 2724102577
1465 2724108474
1466 2725945501
1467 2730106095
1468 2730162611
1469 2730296633
1470 2738801393
1471 2739036734
1472 2753462604
1473 2766062727
1474 2778179601
1475 2792621255
1476 2792625470
1477 2792637904
1478 2793295384
1479 2793317981
1480 2793325100
1481 2793326328
1482 2793334412
1483 2793344704
1484 2793348325
1485 2793355627
1486 2793363800
1487 2793365702
1488 2802718487
1489 2802726310
1490 2802731536
1491 2802740834
1492 2802742430
1493 2802749136
1494 2805931977
1495 2805932530
1496 2806048434
1497 2806055915
1498 2806062757
1499 2806066435
1500 2806073490
1501 2819556598
1502 2819608524
1503 2819640632
1504 2838020103
1505 2838027657
1506 2838029407
1507 2838040104
1508 2838048673
1509 2838051683
1510 2838064247
1511 2838070930
1512 2838075188
1513 2838665964
1514 2838673369
1515 2838680411
1516 2838691792
1517 2838695556
1518 2838706116
1519 2838708933
1520 2838733724
1521 2838749582
1522 2841846917
1523 2841856353
1524 2841866994
1525 2842079832
1526 2842112012
1527 2842120450
1528 2842127054
1529 2842150541
1530 2842162142
1531 2842165356
1532 2842185983
1533 2842192727
1534 2842204214
1535 2842207119
1536 2842219023
1537 2842236225
1538 2842238344
1539 2842248034
1540 2842255580
1541 2842262372
1542 2842270471
1543 2842276765
1544 2842280188
1545 2842286645
1546 2842293493
1547 2842299570
1548 2842311098
1549 2842312804
1550 2842323891
1551 2842343258
1552 2842360998
1553 2842367017
1554 2842370874
1555 2842379890
1556 2842386961
1557 2842399044
1558 2842403802
1559 2842410496
1560 2842417143
1561 2842424545
1562 2842434293
1563 2842440600
1564 2842447252
1565 2842452030
1566 2842468686
1567 2842475231
1568 2842476163
1569 2842487629
1570 2842492622
1571 2842500213
1572 2842502935
1573 2842512786
1574 2842521511
1575 2842923157
1576 2844165094
1577 2844456201
1578 2847417483
1579 2848992318
1580 2850079820
1581 2852388356
1582 2855828059
1583 2855839830
1584 2855873543
1585 2857521869
1586 2858803804
1587 2891375118
1588 2915984016
1589 2915990688
1590 2915997164
1591 2916000930
1592 2916011175
1593 2916021291
1594 2916021986
1595 2916034079
1596 2916036347
1597 2916048410
1598 2916053662
1599 2916056938
1600 2916064784
1601 2916071305
1602 2916080767
1603 2919101506
1604 2919116419
1605 2919408684
1606 2920763557
1607 2920823216
1608 2921205543
1609 2921213697
1610 2921241523
1611 2921247102
1612 2921254456
1613 2921262835
1614 2921268684
1615 2921288230
1616 2921291757
1617 2921297327
1618 2923556549
1619 2924150766
1620 2924156669
1621 2924160319
1622 2924170729
1623 2924176846
1624 2924183643
1625 2924187498
1626 2924198993
1627 2924200861
1628 2924209215
1629 2924216116
1630 2924226559
1631 2924232753
1632 2933023545
1633 2933577002
1634 2933587341
1635 2933601729
1636 2935896080
1637 2935902724
1638 2936369130
1639 2936377527
1640 2936383575
1641 2937001848
1642 2937007702
1643 2937014951
1644 2937022305
1645 2937023371
1646 2937034418
1647 2937039728
1648 2937044861
1649 2937053369
1650 2937062729
1651 2937064235
1652 2937074887
1653 2937078906
1654 2937087641
1655 2937092044
1656 2937099880
1657 2937106411
1658 2937119477
1659 2937126185
1660 2937131608
1661 2941500881
1662 2957379860
1663 2957388671
1664 2957393385
1665 2957400274
1666 2957403886
1667 2957413764
1668 2957417670
1669 2957423330
1670 2957436893
1671 2957443668
1672 2957447291
1673 2957451214
1674 2957460186
1675 2957469581
1676 2957473529
1677 2957482011
1678 2957484836
1679 2957492111
1680 2957500662
1681 2957508130
1682 2960586153
1683 2960594601
1684 2960603389
1685 2960607803
1686 2960611730
1687 2960621533
1688 2960626777
1689 2960634982
1690 2960641540
1691 2960648080
1692 2960658306
1693 2960660575
1694 2960672189
1695 2960679599
1696 2960684711
1697 2960687510
1698 2960694516
1699 2964610539
1700 2964618431
1701 2964625434
1702 2964633790
1703 2964639461
1704 2964649378
1705 2964650168
1706 2964663076
1707 2964668098
1708 2964671862
1709 2964679839
1710 2964691669
1711 2964697713
1712 2964703353
1713 2964710200
1714 2964717224
1715 2964722036
1716 2967670528
1717 2967671860
1718 2967680929
1719 2967689604
1720 2967694906
1721 2967703532
1722 2967712297
1723 2967714500
1724 2967723448
1725 2967730393
1726 2967739250
1727 2967744837
1728 2967754888
1729 2967761170
1730 2967766553
1731 2967769942
1732 2967778067
1733 2970023289
1734 2970030894
1735 2970037109
1736 2970041117
1737 2970050696
1738 2970056847
1739 2970062737
1740 2970075392
1741 2970081781
1742 2970088386
1743 2970089503
1744 2970101912
1745 2970105982
1746 2970115755
1747 2970117620
1748 2970124225
1749 2970131404
1750 2970138970
1751 2970144283
1752 2970154470
1753 2970161314
1754 2970170115
1755 2970175823
1756 2970183683
1757 2970190831
1758 2970197451
1759 2977521118
1760 2977528548
1761 2977532612
1762 2977543802
1763 2977550366
1764 2977553459
1765 2977563724
1766 2977571738
1767 2977574681
1768 2977584441
1769 2979105089
1770 2984513097
1771 2984520538
1772 2984539832
1773 2984602067
1774 2989351639
1775 2989772644
1776 2996888349
1777 2996893268
1778 3003931777
1779 3005411003
1780 3005422924
1781 3005446029
1782 3005452680
1783 3005456701
1784 639646458
1785 643824382
1786 648738454
1787 8003992284
1788 8003999548
1789 8005261095
1790 8005278656
1791 8005289190
1792 8005291261
1793 8005301365
1794 8005310651
1795 8005321540
1796 8005322876
1797 8005377622
1798 8005387469
1799 8005399951
1800 8005432750
1801 8005460806
1802 8005484831
1803 8005498480
1804 8005543597
1805 8005560418
1806 8005564122
1807 8005573688
1808 8005619671
1809 8005628244
1810 8005649525
1811 8005669890
1812 8005685232
1813 8005692427
1814 8005699462
1815 8018132913
1816 8018152965
1817 8018165407
1818 8018181018
1819 8023684437
1820 8024480096
1821 8024491528
1822 8024501764
1823 8046770821
1824 8054563027
1825 8055433554
1826 8056378595
1827 8056385779
1828 8056877128
1829 8057580575
1830 8057875842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

41

178

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dfm-assembly1.cif.gz_A the crystal structure of the zinc inhibited form of teicoplanin deacetylase orf2 0.7381 69 97
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.7069 21 238
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.7039 21 238
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.6953 21 238
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.6928 21 238
ID Description Score Start End Superfamily
3dfmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7381 69 97 3.40.50.10320
af_Q7XA67_1_254_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.7061 72 96 3.40.50.1580
af_Q60344_23_147_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6646 49 160 3.60.21.10
af_Q2G290_1_180_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.664 74 131 3.40.50.2000
af_A0A0R0JB13_452_710_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6576 71 128 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A258KG66-F1-model_v4 Phosphoesterase 0.9341 32 101
AF-A0A3S1QVR4-F1-model_v4 Metallophosphatase 0.8956 17 160 GO:0016787
AF-A0A4Q3SJX5-F1-model_v4 Ligase-associated DNA damage response endonuclease PdeM (EC 3.1.-.-) 0.8901 21 174 GO:0004519
GO:0016874
AF-A0A259M2T5-F1-model_v4 Metallophosphoesterase 0.8901 21 160 GO:0016787
AF-A0A4Q5TWE3-F1-model_v4 Metallophosphoesterase 0.8901 21 101

Map