F485606

General Info

Members Datasets Scaffolds Average Seq Length
915 472 800 250

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0036607|Ga0501034_0036607_1351_2238
Length 295
Sequence LACSAAEVGSQEHLNCGDVAPQKPAPSNVPVTTNNGSASSLAGGMKIVVPVKRVVDYNVKIRVKPDGSGIDLANVKMSMNPFDEIAVEEAVRLKEKSGAQEVVVVSIGPAKAQETLRTALAIGADRAILIETPDGAIVEPLAVAKLLKNVVDAEKPDLVILGKQAIDDDSNQTGQMLASLLDWPQGTFASKVVTESGSVTVTREVDGGLETIKLKLPAVVTTDLRLNEPRYPSLPNIMKAKKKPLDVKRPEDLGVDISPRLKVLKTTEPPTRKAGVKVGSVAELVQKLKTEAGVF

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
12 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
13 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
14 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
15 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
16 2519103095 Burkholderia sp. KJ006 Isolate Nodule
17 2547132374 Acidovorax radicis N35 Isolate Unclassified
18 2547132512 Azospira oryzae 6a3 Isolate Unclassified
19 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
20 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
21 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
22 2643221556 Massilia sp. Root1485 Isolate Unclassified
23 2643221570 Acidovorax sp. Root568 Isolate Unclassified
24 2643221645 Massilia sp. Root351 Isolate Unclassified
25 2643221684 Massilia sp. Root133 Isolate Unclassified
26 2643221717 Acidovorax sp. Root267 Isolate Unclassified
27 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
28 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
29 2738543012 Acidovorax sp. CF301 Isolate Unclassified
30 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
31 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
32 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
33 2816332133 Acidovorax radicis 2721A Isolate Unclassified
34 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
35 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
36 2818991452 Burkholderia cepacia 561 Isolate Unclassified
37 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
38 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
39 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
40 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
41 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
42 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
43 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
44 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
45 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
46 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
47 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
48 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
49 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
50 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
51 2904564687 Burkholderia sp. 571 Isolate Unclassified
52 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
53 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
54 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
55 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
56 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
57 2928170801 Burkholderia sp. 572 Isolate Unclassified
58 2928536128 Burkholderia sola 565 Isolate Unclassified
59 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
60 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
61 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
62 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
63 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
64 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
65 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
66 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
67 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
68 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
69 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
70 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
71 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
72 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
75 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
76 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
77 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
80 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
81 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
82 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
83 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
84 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
85 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
86 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
87 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
88 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
89 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
90 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
91 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
92 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
93 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
94 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
97 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
102 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
103 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
104 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
105 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
106 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
107 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
108 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
109 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
110 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
113 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
114 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
115 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
120 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
121 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
124 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
125 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
133 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
134 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
135 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
136 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
140 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
141 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
142 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
143 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
144 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
145 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
149 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
154 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
158 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
161 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
162 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
239 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
241 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
264 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
265 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
266 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
267 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
268 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
269 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
270 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
271 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
281 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
282 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
283 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
293 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
294 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
298 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
299 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
300 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
301 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
302 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
308 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
323 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
324 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
325 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
326 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
327 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
328 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
329 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
330 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
331 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
345 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
346 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
347 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
353 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
354 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
357 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
358 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
359 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
360 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
361 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
362 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
370 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
371 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
375 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
376 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
377 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
378 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
379 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
380 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
381 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
382 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
383 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
384 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
385 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
386 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
396 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
397 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
398 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
399 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
400 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
401 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
402 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
403 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
404 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
405 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
408 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
409 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
419 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
420 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
421 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
422 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
423 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
424 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
425 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
426 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
427 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
428 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
429 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
432 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
433 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
434 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
435 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
436 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
437 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
438 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
439 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
440 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
441 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
442 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
443 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
444 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
445 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
446 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
447 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
448 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
449 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
462 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
463 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
464 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
465 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
466 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
467 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
468 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
469 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
470 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
471 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
472 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.03
Metatranscriptomes 2.4
Isolates 12.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.07
Nodule 3.61
Rhizoplane 6.12
Rhizosphere 72.13
Stem 0
Stem Tuber 0
Unclassified 9.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10010847 3300002067 Bacteria 2895
2 JGI25162J39368_1008694 3300002737 Bacteria 1428
3 JGI25162J39368_1010030 3300002737 Bacteria 1224
4 rootH2_10317752 3300003320 Bacteria 2011
5 rootH2_10326619 3300003320 Unclassified 1297
6 rootH1_10003933 3300003323 Bacteria 11650
7 JGI25160J50197_1000037 3300003354 Bacteria 162757
8 Ga0006556J51387_1026944 3300003479 Bacteria 2361
9 Ga0006554J51385_1021980 3300003567 Bacteria 1955
10 Ga0007410J51695_1010366 3300003574 Bacteria 1376
11 Ga0007409J51694_1003842 3300003575 Bacteria 2149
12 Ga0006562J51391_1036800 3300003578 Bacteria 1288
13 JGI25404J52841_10001526 3300003659 Bacteria 4103
14 Ga0032354_1028144 3300003693 Bacteria 3403
15 Ga0006780_1031982 3300003735 Bacteria 1245
16 Ga0055532_1017360 3300003758 Bacteria 779
17 Ga0055525_1000074 3300003759 Bacteria 178058
18 Ga0055527_1000493 3300003760 Bacteria 14159
19 Ga0055535_1001248 3300003761 Bacteria 14159
20 Ga0055535_1001250 3300003761 Bacteria 14103
21 Ga0055542_1001239 3300003762 Bacteria 14176
22 Ga0055542_1005066 3300003762 Bacteria 3043
23 Ga0055542_1018213 3300003762 Bacteria 1069
24 Ga0055529_1000492 3300003763 Bacteria 36023
25 Ga0055528_1007588 3300003790 Bacteria 4777
26 Ga0058692_1003292 3300003856 Bacteria 5038
27 Ga0065165_1000811 3300005262 Bacteria 41608
28 Ga0065165_1002556 3300005262 Bacteria 15066
29 Ga0065165_1003857 3300005262 Bacteria 9959
30 Ga0065165_1040275 3300005262 Bacteria 1395
31 Ga0065714_10111349 3300005288 Bacteria 1456
32 Ga0065715_10145757 3300005293 Bacteria 1757
33 Ga0070658_10543376 3300005327 Bacteria 1005
34 Ga0070670_100061666 3300005331 Bacteria 3218
35 Ga0070666_10116312 3300005335 Bacteria 1852
36 Ga0070666_10201103 3300005335 Bacteria 1402
37 Ga0070680_100014065 3300005336 Bacteria 6248
38 Ga0070680_100021694 3300005336 Bacteria 5107
39 Ga0070682_100003799 3300005337 Bacteria 8392
40 Ga0070691_10036010 3300005341 Bacteria 2332
41 Ga0070687_100033200 3300005343 Bacteria 2545
42 Ga0070687_100386433 3300005343 Bacteria 914
43 Ga0070668_100035691 3300005347 Bacteria 3792
44 Ga0070668_100118459 3300005347 Bacteria 2114
45 Ga0070675_100064176 3300005354 Bacteria 3036
46 Ga0070675_100421886 3300005354 Bacteria 1193
47 Ga0070671_100038479 3300005355 Bacteria 3970
48 Ga0070674_100017276 3300005356 Bacteria 4534
49 Ga0070659_100034835 3300005366 Bacteria 3918
50 Ga0070667_100032586 3300005367 Bacteria 4346
51 Ga0070667_100037246 3300005367 Bacteria 4078
52 Ga0070667_100276878 3300005367 Bacteria 1506
53 Ga0070703_10004073 3300005406 Bacteria 4125
54 Ga0070713_100049055 3300005436 Bacteria 3481
55 Ga0070705_100000751 3300005440 Bacteria 18407
56 Ga0070705_100014535 3300005440 Bacteria 4053
57 Ga0070700_100016215 3300005441 Bacteria 4242
58 Ga0070694_100014968 3300005444 Bacteria 4860
59 Ga0070694_100041992 3300005444 Bacteria 3053
60 Ga0070663_100001331 3300005455 Bacteria 13505
61 Ga0070663_100030279 3300005455 Bacteria 3707
62 Ga0070663_100163147 3300005455 Bacteria 1717
63 Ga0070662_100010146 3300005457 Bacteria 6172
64 Ga0070662_100096794 3300005457 Bacteria 2227
65 Ga0070681_10006501 3300005458 Bacteria 11376
66 Ga0068867_100039933 3300005459 Bacteria 3422
67 Ga0068867_100166221 3300005459 Bacteria 1743
68 Ga0070685_10134598 3300005466 Bacteria 1549
69 Ga0070706_100132861 3300005467 Bacteria 2323
70 Ga0070699_100005628 3300005518 Bacteria 10986
71 Ga0070679_100068940 3300005530 Bacteria 3528
72 Ga0070679_100634625 3300005530 Bacteria 1011
73 Ga0068853_100003695 3300005539 Bacteria 11745
74 Ga0070695_100000339 3300005545 Bacteria 24039
75 Ga0070696_100001139 3300005546 Bacteria 17242
76 Ga0070696_100005852 3300005546 Bacteria 8206
77 Ga0070693_100019364 3300005547 Bacteria 3566
78 Ga0070665_100239774 3300005548 Bacteria 1814
79 Ga0070704_100003545 3300005549 Bacteria 8968
80 Ga0070704_100410740 3300005549 Bacteria 1157
81 Ga0068855_100073014 3300005563 Bacteria 3987
82 Ga0068857_100011253 3300005577 Bacteria 7779
83 Ga0068857_100165273 3300005577 Bacteria 2009
84 Ga0068857_100510652 3300005577 Bacteria 1129
85 Ga0068856_100179162 3300005614 Bacteria 2132
86 Ga0070702_100089069 3300005615 Bacteria 1867
87 Ga0070702_100415041 3300005615 Bacteria 967
88 Ga0068852_100428726 3300005616 Bacteria 1306
89 Ga0068859_100004644 3300005617 Bacteria 13994
90 Ga0068859_100020274 3300005617 Bacteria 6674
91 Ga0068864_100004875 3300005618 Bacteria 10984
92 Ga0068864_100284240 3300005618 Bacteria 1545
93 Ga0068866_10116871 3300005718 Bacteria 1497
94 Ga0068861_100054369 3300005719 Bacteria 3050
95 Ga0068861_100068717 3300005719 Bacteria 2739
96 Ga0068870_10017842 3300005840 Bacteria 3416
97 Ga0068870_10060216 3300005840 Bacteria 2038
98 Ga0068870_10366413 3300005840 Bacteria 929
99 Ga0068863_100665126 3300005841 Bacteria 1034
100 Ga0068858_100082864 3300005842 Bacteria 2982
101 Ga0068858_100516443 3300005842 Bacteria 1155
102 Ga0068860_100010922 3300005843 Bacteria 8952
103 Ga0068860_100214317 3300005843 Bacteria 1868
104 Ga0068860_100373744 3300005843 Bacteria 1406
105 Ga0068860_100489534 3300005843 Bacteria 1227
106 Ga0068860_100594314 3300005843 Bacteria 1112
107 Ga0068862_100005698 3300005844 Bacteria 10394
108 Ga0068862_100155542 3300005844 Bacteria 2038
109 Ga0081540_1000050 3300005983 Bacteria 126528
110 Ga0081540_1030601 3300005983 Bacteria 2978
111 Ga0070717_10533709 3300006028 Bacteria 1062
112 Ga0075365_10018004 3300006038 Bacteria 4336
113 Ga0075365_10072439 3300006038 Bacteria 2321
114 Ga0075368_10000312 3300006042 Bacteria 14157
115 Ga0075368_10004890 3300006042 Bacteria 4570
116 Ga0075368_10007111 3300006042 Bacteria 3941
117 Ga0075363_100002154 3300006048 Bacteria 7923
118 Ga0075363_100002994 3300006048 Bacteria 7061
119 Ga0075367_10000480 3300006178 Bacteria 14936
120 Ga0075367_10004476 3300006178 Bacteria 6830
121 Ga0075367_10017865 3300006178 Bacteria 3901
122 Ga0097621_100060405 3300006237 Bacteria 3107
123 Ga0068871_100091533 3300006358 Bacteria 2535
124 Ga0075428_100064681 3300006844 Bacteria 4006
125 Ga0075428_100523856 3300006844 Bacteria 1268
126 Ga0075430_100025541 3300006846 Bacteria 5026
127 Ga0075431_100000648 3300006847 Bacteria 29516
128 Ga0075431_100055669 3300006847 Bacteria 4080
129 Ga0075431_100093901 3300006847 Bacteria 3096
130 Ga0075433_10372540 3300006852 Bacteria 1261
131 Ga0075433_10399008 3300006852 Bacteria 1213
132 Ga0075434_100001044 3300006871 Bacteria 22598
133 Ga0075434_100228654 3300006871 Bacteria 1879
134 Ga0075429_100167889 3300006880 Bacteria 1922
135 Ga0068865_100169068 3300006881 Bacteria 1674
136 Ga0097620_100004644 3300006931 Bacteria 13994
137 Ga0097620_100020274 3300006931 Bacteria 6674
138 Ga0099826_10000004 3300006948 Bacteria 802669
139 Ga0075435_100199514 3300007076 Bacteria 1695
140 Ga0105240_10249232 3300009093 Bacteria 2055
141 Ga0111539_10007102 3300009094 Bacteria 14352
142 Ga0111539_10011351 3300009094 Bacteria 11187
143 Ga0111539_10325771 3300009094 Bacteria 1788
144 Ga0111539_10430824 3300009094 Bacteria 1536
145 Ga0111539_10808039 3300009094 Bacteria 1091
146 Ga0105245_10068732 3300009098 Bacteria 3210
147 Ga0105245_10171208 3300009098 Bacteria 2068
148 Ga0105247_10146703 3300009101 Bacteria 1551
149 Ga0114129_10012579 3300009147 Bacteria 12051
150 Ga0114129_10250544 3300009147 Bacteria 2377
151 Ga0114129_10280166 3300009147 Bacteria 2228
152 Ga0105243_10045849 3300009148 Bacteria 3437
153 Ga0105243_10865017 3300009148 Bacteria 896
154 Ga0105241_10006171 3300009174 Bacteria 8841
155 Ga0105241_10178208 3300009174 Bacteria 1761
156 Ga0105242_10027705 3300009176 Bacteria 4503
157 Ga0105248_10024204 3300009177 Bacteria 6749
158 Ga0105248_10577991 3300009177 Bacteria 1268
159 Ga0105238_10056347 3300009551 Bacteria 3944
160 Ga0105238_10078874 3300009551 Bacteria 3283
161 Ga0105238_10366111 3300009551 Bacteria 1431
162 Ga0105249_10014651 3300009553 Bacteria 6930
163 Ga0105249_10177035 3300009553 Bacteria 2072
164 Ga0105249_10237654 3300009553 Bacteria 1800
165 Ga0105249_10323308 3300009553 Bacteria 1554
166 Ga0105239_10222204 3300010375 Bacteria 2118
167 Ga0105239_10272896 3300010375 Bacteria 1902
168 Ga0105239_10372217 3300010375 Bacteria 1614
169 Ga0105246_10005577 3300011119 Bacteria 7675
170 Ga0105246_10034614 3300011119 Bacteria 3368
171 Ga0105246_10108859 3300011119 Bacteria 2032
172 Ga0105246_10340371 3300011119 Bacteria 1226
173 Ga0157371_10000014 3300013102 Bacteria 347490
174 Ga0157371_10080725 3300013102 Bacteria 2303
175 Ga0157369_10108086 3300013105 Bacteria 2959
176 Ga0157378_10241750 3300013297 Bacteria 1725
177 Ga0163162_10038670 3300013306 Bacteria 4761
178 Ga0163162_10311174 3300013306 Bacteria 1707
179 Ga0163162_10430789 3300013306 Bacteria 1451
180 Ga0163162_10820446 3300013306 Bacteria 1047
181 Ga0157375_10023864 3300013308 Bacteria 5650
182 Ga0157375_10025181 3300013308 Bacteria 5522
183 Ga0182008_10000751 3300014497 Bacteria 22816
184 Ga0182008_10114336 3300014497 Bacteria 1338
185 Ga0157379_10103984 3300014968 Bacteria 2549
186 Ga0157379_10118031 3300014968 Bacteria 2386
187 Ga0157379_10235210 3300014968 Bacteria 1661
188 Ga0157379_10479019 3300014968 Bacteria 1151
189 Ga0157376_10009986 3300014969 Bacteria 6925
190 Ga0182006_1000004 3300015261 Bacteria 622190
191 Ga0182006_1015508 3300015261 Bacteria 3266
192 Ga0182006_1049420 3300015261 Bacteria 1623
193 Ga0182007_10000018 3300015262 Bacteria 198916
194 Ga0182007_10028432 3300015262 Bacteria 1921
195 Ga0182005_1000011 3300015265 Bacteria 420605
196 Ga0163161_10106576 3300017792 Bacteria 2091
197 Ga0163161_10168137 3300017792 Bacteria 1675
198 Ga0206354_10132401 3300020081 Bacteria 2082
199 Ga0209674_100013 3300025226 Bacteria 813140
200 Ga0209674_100020 3300025226 Bacteria 672397
201 Ga0209672_100010 3300025228 Bacteria 873151
202 Ga0209672_100013 3300025228 Bacteria 740693
203 Ga0209672_100019 3300025228 Bacteria 432215
204 Ga0209672_100051 3300025228 Bacteria 234414
205 Ga0209672_100062 3300025228 Bacteria 204912
206 Ga0209147_100006 3300025229 Bacteria 873276
207 Ga0209147_100013 3300025229 Bacteria 660057
208 Ga0209147_100026 3300025229 Bacteria 421622
209 Ga0209147_100078 3300025229 Bacteria 204912
210 Ga0209147_100192 3300025229 Bacteria 70162
211 Ga0209147_100544 3300025229 Bacteria 21444
212 Ga0209563_100003 3300025230 Bacteria 1932942
213 Ga0209563_100778 3300025230 Bacteria 9641
214 Ga0207427_100964 3300025231 Bacteria 12229
215 Ga0209437_100045 3300025233 Bacteria 429809
216 Ga0209437_100268 3300025233 Bacteria 79327
217 Ga0209258_100010 3300025242 Bacteria 873276
218 Ga0209258_100016 3300025242 Bacteria 668622
219 Ga0209258_100031 3300025242 Bacteria 463572
220 Ga0209258_100108 3300025242 Bacteria 204912
221 Ga0209258_100358 3300025242 Bacteria 61852
222 Ga0209677_105954 3300025253 Bacteria 3028
223 Ga0209148_1000018 3300025254 Bacteria 756247
224 Ga0209148_1000020 3300025254 Bacteria 740693
225 Ga0209148_1000027 3300025254 Bacteria 616374
226 Ga0209148_1000400 3300025254 Bacteria 50569
227 Ga0209148_1000720 3300025254 Bacteria 26145
228 Ga0209148_1001175 3300025254 Bacteria 15065
229 Ga0209148_1004660 3300025254 Bacteria 3314
230 Ga0209759_1001703 3300025256 Bacteria 11393
231 Ga0209233_1000229 3300025261 Bacteria 100048
232 Ga0209233_1029194 3300025261 Bacteria 1315
233 Ga0209565_1018257 3300025263 Bacteria 1520
234 Ga0209455_1000015 3300025272 Bacteria 756128
235 Ga0209455_1000017 3300025272 Bacteria 740693
236 Ga0209455_1000213 3300025272 Bacteria 82040
237 Ga0209455_1000487 3300025272 Bacteria 29136
238 Ga0209455_1000746 3300025272 Bacteria 18598
239 Ga0209673_1000201 3300025273 Bacteria 120059
240 Ga0209130_1006042 3300025284 Bacteria 4025
241 Ga0209130_1007295 3300025284 Bacteria 3432
242 Ga0209676_1026771 3300025292 Bacteria 1825
243 Ga0209025_1015446 3300025294 Bacteria 4603
244 Ga0209564_1002172 3300025295 Bacteria 16506
245 Ga0207426_1000004 3300025302 Bacteria 1047900
246 Ga0207426_1000183 3300025302 Bacteria 154449
247 Ga0207655_1104886 3300025728 Bacteria 966
248 Ga0207713_1031600 3300025735 Bacteria 2337
249 Ga0207653_10004668 3300025885 Bacteria 4293
250 Ga0207682_10018139 3300025893 Bacteria 2749
251 Ga0207642_10054237 3300025899 Bacteria 1828
252 Ga0207710_10117873 3300025900 Bacteria 1265
253 Ga0207688_10035016 3300025901 Bacteria 2781
254 Ga0207647_10222908 3300025904 Bacteria 1086
255 Ga0207643_10028095 3300025908 Bacteria 3122
256 Ga0207643_10186723 3300025908 Bacteria 1257
257 Ga0207705_10017544 3300025909 Bacteria 5125
258 Ga0207660_10016006 3300025917 Bacteria 4958
259 Ga0207660_10064811 3300025917 Bacteria 2638
260 Ga0207652_10023480 3300025921 Bacteria 5110
261 Ga0207652_10234588 3300025921 Bacteria 1653
262 Ga0207681_10044185 3300025923 Bacteria 2985
263 Ga0207694_10080930 3300025924 Bacteria 2550
264 Ga0207694_10363702 3300025924 Bacteria 1199
265 Ga0207694_10381406 3300025924 Bacteria 1170
266 Ga0207650_10096308 3300025925 Bacteria 2270
267 Ga0207659_10130561 3300025926 Bacteria 1938
268 Ga0207687_10120665 3300025927 Bacteria 1960
269 Ga0207687_10129196 3300025927 Bacteria 1901
270 Ga0207687_10477495 3300025927 Bacteria 1038
271 Ga0207700_10330135 3300025928 Bacteria 1324
272 Ga0207690_10026365 3300025932 Bacteria 3659
273 Ga0207706_10150139 3300025933 Bacteria 2049
274 Ga0207706_10419113 3300025933 Bacteria 1160
275 Ga0207709_10110706 3300025935 Bacteria 1835
276 Ga0207669_10100831 3300025937 Bacteria 1908
277 Ga0207669_10108046 3300025937 Bacteria 1857
278 Ga0207669_10268638 3300025937 Bacteria 1280
279 Ga0207704_10156638 3300025938 Bacteria 1615
280 Ga0207711_10066035 3300025941 Bacteria 3128
281 Ga0207689_10001119 3300025942 Bacteria 25868
282 Ga0207689_10059743 3300025942 Bacteria 3135
283 Ga0207667_10012486 3300025949 Bacteria 9782
284 Ga0207667_10230752 3300025949 Bacteria 1895
285 Ga0207651_10506303 3300025960 Bacteria 1044
286 Ga0207712_10336778 3300025961 Bacteria 1250
287 Ga0207640_10688107 3300025981 Bacteria 875
288 Ga0207658_10280331 3300025986 Bacteria 1428
289 Ga0207658_10470392 3300025986 Bacteria 1115
290 Ga0207703_10043722 3300026035 Bacteria 3597
291 Ga0207703_10083844 3300026035 Bacteria 2664
292 Ga0207639_10136721 3300026041 Bacteria 2036
293 Ga0207678_10002715 3300026067 Bacteria 16044
294 Ga0207678_10003650 3300026067 Bacteria 13834
295 Ga0207678_10225099 3300026067 Bacteria 1606
296 Ga0207708_10000535 3300026075 Bacteria 29316
297 Ga0207708_10095786 3300026075 Bacteria 2293
298 Ga0207708_10107926 3300026075 Bacteria 2159
299 Ga0207702_10089672 3300026078 Bacteria 2689
300 Ga0207641_10036260 3300026088 Bacteria 4116
301 Ga0207648_10059461 3300026089 Bacteria 3333
302 Ga0207676_10040508 3300026095 Bacteria 3570
303 Ga0207674_10001583 3300026116 Bacteria 29309
304 Ga0207674_10183930 3300026116 Bacteria 2040
305 Ga0207675_100063555 3300026118 Bacteria 3449
306 Ga0207675_100218688 3300026118 Bacteria 1835
307 Ga0207683_10018574 3300026121 Bacteria 5934
308 Ga0207683_10026089 3300026121 Bacteria 5045
309 Ga0207698_10679491 3300026142 Bacteria 1023
310 Ga0209371_1000202 3300027312 Bacteria 85989
311 Ga0209371_1005347 3300027312 Bacteria 5143
312 Ga0209282_1000051 3300027666 Bacteria 107809
313 Ga0209998_10010151 3300027717 Bacteria 1950
314 Ga0209813_10000327 3300027866 Bacteria 12478
315 Ga0209813_10017251 3300027866 Bacteria 1980
316 Ga0209974_10007613 3300027876 Bacteria 3729
317 Ga0209974_10035485 3300027876 Bacteria 1656
318 Ga0207428_10004815 3300027907 Bacteria 12744
319 Ga0207428_10276820 3300027907 Bacteria 1246
320 Ga0268265_10003906 3300028380 Bacteria 10506
321 Ga0268265_10138774 3300028380 Bacteria 2032
322 Ga0268265_10164877 3300028380 Bacteria 1887
323 Ga0268264_10042388 3300028381 Bacteria 3768
324 Ga0268264_10122252 3300028381 Bacteria 2296
325 Ga0268264_10364185 3300028381 Bacteria 1380
326 Ga0268264_10451380 3300028381 Bacteria 1246
327 Ga0307515_10002783 3300028794 Bacteria 37292
328 Ga0265338_10000183 3300028800 Bacteria 117272
329 Ga0268256_1000189 3300030500 Bacteria 72206
330 Ga0268256_1005360 3300030500 Bacteria 5050
331 Ga0265332_10000021 3300031238 Bacteria 217090
332 Ga0265328_10004865 3300031239 Bacteria 5786
333 Ga0265340_10069272 3300031247 Bacteria 1674
334 Ga0265316_10164498 3300031344 Bacteria 1658
335 Ga0307513_10463293 3300031456 Bacteria 990
336 Ga0307408_100000684 3300031548 Bacteria 27854
337 Ga0307408_100001704 3300031548 Bacteria 16152
338 Ga0307514_10001537 3300031649 Bacteria 27450
339 Ga0307405_10016716 3300031731 Bacteria 4008
340 Ga0307413_10140855 3300031824 Bacteria 1666
341 Ga0307410_10053272 3300031852 Bacteria 2737
342 Ga0307410_10082145 3300031852 Bacteria 2266
343 Ga0307406_10055068 3300031901 Bacteria 2541
344 Ga0307407_10240447 3300031903 Bacteria 1235
345 Ga0307412_10010634 3300031911 Bacteria 5303
346 Ga0307409_100010364 3300031995 Bacteria 5791
347 Ga0307416_100340087 3300032002 Bacteria 1513
348 Ga0307411_10176049 3300032005 Bacteria 1619
349 Ga0307411_10176102 3300032005 Bacteria 1619
350 Ga0373958_0025096 3300034819 Bacteria 1132
351 Ga0373959_0033213 3300034820 Bacteria 1052
352 Ga0373940_0007291 3300035088 Bacteria 2490
353 Ga0373939_0004807 3300035114 Bacteria 3201
354 Ga0373955_0028453 3300035172 Bacteria 2897
355 Ga0373942_0006881 3300035207 Bacteria 2628
356 Ga0373962_0005558 3300035242 Bacteria 3047
357 Ga0373924_0078806 3300035410 Bacteria 1399
358 Ga0373931_0001346 3300035691 Bacteria 10513
359 Ga0373931_0002117 3300035691 Bacteria 8744
360 Ga0373925_0083523 3300037068 Bacteria 2433
361 Ga0373925_0220772 3300037068 Bacteria 1513
362 Ga0373925_0223826 3300037068 Bacteria 1502
363 Ga0395899_0001326 3300037312 Bacteria 21253
364 Ga0395899_0037376 3300037312 Bacteria 3639
365 Ga0395899_0063316 3300037312 Bacteria 2721
366 Ga0395900_0000338 3300037418 Bacteria 69123
367 Ga0395900_0000389 3300037418 Bacteria 63583
368 Ga0395900_0013029 3300037418 Bacteria 8497
369 Ga0395900_0052055 3300037418 Bacteria 4215
370 Ga0395900_0060971 3300037418 Bacteria 3880
371 Ga0395898_0000359 3300037466 Bacteria 100304
372 Ga0395898_0002067 3300037466 Bacteria 25000
373 Ga0395898_0175303 3300037466 Bacteria 2049
374 Ga0395898_0827868 3300037466 Bacteria 865
375 Ga0395905_0000020 3300037471 Bacteria 337672
376 Ga0395905_0000029 3300037471 Bacteria 293016
377 Ga0395905_0000185 3300037471 Bacteria 99394
378 Ga0395905_0154939 3300037471 Bacteria 2155
379 Ga0395905_0170793 3300037471 Bacteria 2042
380 Ga0395905_0225637 3300037471 Bacteria 1752
381 Ga0395905_0242416 3300037471 Bacteria 1684
382 Ga0395901_0000011 3300038443 Bacteria 400724
383 Ga0395901_0000164 3300038443 Bacteria 86884
384 Ga0395901_0000303 3300038443 Bacteria 60672
385 Ga0395901_0025396 3300038443 Bacteria 6081
386 Ga0395901_0074581 3300038443 Bacteria 3539
387 Ga0395901_0087180 3300038443 Bacteria 3263
388 Ga0395901_0563041 3300038443 Bacteria 1154
389 Ga0436361_0000881 3300039447 Bacteria 4496
390 Ga0436361_0892653 3300039447 Bacteria 2615
391 Ga0436361_0903849 3300039447 Bacteria 2104
392 Ga0439448_0000438 3300042005 Bacteria 9566
393 Ga0439457_019495 3300042014 Bacteria 1507
394 Ga0439458_0011753 3300042157 Bacteria 1960
395 Ga0466969_0054038 3300044656 Bacteria 1968
396 Ga0466972_0005944 3300044658 Bacteria 6128
397 Ga0466982_0185859 3300044672 Bacteria 1254
398 Ga0466965_0097136 3300044683 Bacteria 1503
399 Ga0466965_0241237 3300044683 Bacteria 967
400 Ga0466966_0016748 3300044684 Bacteria 4842
401 Ga0466966_0210626 3300044684 Bacteria 1174
402 Ga0466966_0272375 3300044684 Bacteria 1018
403 Ga0466961_0053288 3300044693 Bacteria 2582
404 Ga0466961_0054982 3300044693 Bacteria 2539
405 Ga0466963_0099855 3300044694 Bacteria 1986
406 Ga0466971_0070805 3300044719 Bacteria 1583
407 Ga0466971_0314793 3300044719 Bacteria 753
408 Ga0466957_0429396 3300044842 Bacteria 907
409 Ga0466959_0079875 3300045049 Bacteria 2358
410 Ga0466959_0192796 3300045049 Bacteria 1421
411 Ga0466958_0169201 3300045836 Bacteria 1383
412 Ga0466958_0176549 3300045836 Bacteria 1354
413 Ga0466967_0089735 3300045976 Bacteria 2791
414 Ga0466967_0194884 3300045976 Bacteria 1916
415 Ga0495592_0168909 3300046454 Bacteria 1499
416 Ga0495592_0201189 3300046454 Bacteria 1344
417 Ga0495592_0267185 3300046454 Bacteria 1124
418 Ga0495603_0004638 3300046455 Bacteria 8212
419 Ga0495603_0067541 3300046455 Bacteria 2104
420 Ga0495590_0000059 3300046457 Bacteria 92114
421 Ga0495590_0000504 3300046457 Bacteria 19134
422 Ga0495590_0001062 3300046457 Bacteria 12096
423 Ga0495590_0004283 3300046457 Bacteria 5769
424 Ga0495591_000440 3300046458 Bacteria 33847
425 Ga0495629_0000586 3300046459 Bacteria 29559
426 Ga0495629_0011507 3300046459 Bacteria 6427
427 Ga0495629_0043567 3300046459 Bacteria 3151
428 Ga0495638_0165640 3300046460 Bacteria 1272
429 Ga0495641_0048930 3300046461 Bacteria 1937
430 Ga0495641_0050410 3300046461 Bacteria 1903
431 Ga0495651_0188269 3300046462 Bacteria 1454
432 Ga0495653_0001720 3300046463 Bacteria 17247
433 Ga0495653_0005296 3300046463 Bacteria 10491
434 Ga0495650_0036470 3300046471 Bacteria 2151
435 Ga0495580_0000024 3300046472 Bacteria 87183
436 Ga0495580_0001675 3300046472 Bacteria 19455
437 Ga0495580_0005138 3300046472 Bacteria 10884
438 Ga0495580_0008547 3300046472 Bacteria 8125
439 Ga0495580_0011969 3300046472 Bacteria 6685
440 Ga0495580_0012709 3300046472 Bacteria 6453
441 Ga0495580_0015089 3300046472 Bacteria 5846
442 Ga0495580_0075288 3300046472 Bacteria 2355
443 Ga0495580_0429340 3300046472 Bacteria 888
444 Ga0495582_0008966 3300046473 Bacteria 5519
445 Ga0495582_0149759 3300046473 Bacteria 1324
446 Ga0495605_0000065 3300046474 Bacteria 139441
447 Ga0495605_0001793 3300046474 Bacteria 13779
448 Ga0495605_0038037 3300046474 Bacteria 2416
449 Ga0495605_0066530 3300046474 Bacteria 1712
450 Ga0495664_0003059 3300046477 Bacteria 9063
451 Ga0495584_0002310 3300046491 Bacteria 10887
452 Ga0495584_0008711 3300046491 Bacteria 5246
453 Ga0495584_0009170 3300046491 Bacteria 5102
454 Ga0495584_0047831 3300046491 Bacteria 2157
455 Ga0495585_0006738 3300046492 Bacteria 7087
456 Ga0495585_0018936 3300046492 Bacteria 3971
457 Ga0495594_0002743 3300046499 Bacteria 9138
458 Ga0495596_0001024 3300046500 Bacteria 16602
459 Ga0495596_0012813 3300046500 Bacteria 3576
460 Ga0495607_0007104 3300046501 Bacteria 7782
461 Ga0495607_0008921 3300046501 Bacteria 6829
462 Ga0495607_0034745 3300046501 Bacteria 3056
463 Ga0495607_0052486 3300046501 Bacteria 2361
464 Ga0495583_0000450 3300046506 Bacteria 61547
465 Ga0495583_0000665 3300046506 Bacteria 45049
466 Ga0495583_0013954 3300046506 Bacteria 4452
467 Ga0495583_0017061 3300046506 Bacteria 3870
468 Ga0495583_0019574 3300046506 Bacteria 3530
469 Ga0495606_0000190 3300046507 Bacteria 107709
470 Ga0495606_0004747 3300046507 Bacteria 13388
471 Ga0495606_0048769 3300046507 Bacteria 2782
472 Ga0495606_0058029 3300046507 Bacteria 2490
473 Ga0495606_0090799 3300046507 Bacteria 1879
474 Ga0495608_0209599 3300046511 Bacteria 1225
475 Ga0495610_0000607 3300046512 Bacteria 35451
476 Ga0495610_0028967 3300046512 Bacteria 2922
477 Ga0495616_0001112 3300046513 Bacteria 19104
478 Ga0495616_0006171 3300046513 Bacteria 7295
479 Ga0495616_0006327 3300046513 Bacteria 7179
480 Ga0495618_0003931 3300046514 Bacteria 9171
481 Ga0495618_0336674 3300046514 Bacteria 932
482 Ga0495628_0085500 3300046516 Bacteria 2446
483 Ga0495628_0288613 3300046516 Bacteria 1217
484 Ga0495630_0005743 3300046517 Bacteria 8773
485 Ga0495630_0013246 3300046517 Bacteria 5998
486 Ga0495630_0132055 3300046517 Bacteria 1896
487 Ga0495630_0174855 3300046517 Bacteria 1636
488 Ga0495631_0005022 3300046518 Bacteria 6966
489 Ga0495632_0001075 3300046519 Bacteria 23448
490 Ga0495637_0000011 3300046520 Bacteria 337279
491 Ga0495643_0016054 3300046522 Bacteria 4407
492 Ga0495644_0018596 3300046523 Bacteria 2654
493 Ga0495648_0005758 3300046524 Bacteria 10223
494 Ga0495648_0021247 3300046524 Bacteria 4500
495 Ga0495648_0035535 3300046524 Bacteria 3230
496 Ga0495666_0000911 3300046526 Bacteria 13860
497 Ga0495666_0006150 3300046526 Bacteria 6040
498 Ga0495666_0087115 3300046526 Bacteria 1475
499 Ga0495642_0000046 3300046528 Bacteria 74298
500 Ga0495642_0004948 3300046528 Bacteria 5137
501 Ga0495642_0030765 3300046528 Bacteria 2149
502 Ga0495652_0049156 3300046529 Bacteria 3611
503 Ga0495654_0017613 3300046530 Bacteria 3751
504 Ga0495654_0019753 3300046530 Bacteria 3519
505 Ga0495665_0009989 3300046531 Bacteria 5141
506 Ga0495640_0042270 3300046533 Bacteria 3181
507 Ga0495640_0135425 3300046533 Bacteria 1591
508 Ga0495586_0001962 3300046535 Bacteria 11218
509 Ga0495586_0050354 3300046535 Bacteria 2254
510 Ga0495586_0326580 3300046535 Bacteria 880
511 Ga0495587_0089918 3300046536 Bacteria 1774
512 Ga0495609_0000026 3300046538 Bacteria 251973
513 Ga0495609_0019476 3300046538 Bacteria 3140
514 Ga0495609_0036418 3300046538 Bacteria 2221
515 Ga0495597_0000153 3300046542 Bacteria 61233
516 Ga0495597_0008121 3300046542 Bacteria 5278
517 Ga0495597_0032896 3300046542 Bacteria 2351
518 Ga0495645_0075894 3300046543 Bacteria 2419
519 Ga0495622_0013822 3300046557 Bacteria 3745
520 Ga0495622_0067334 3300046557 Bacteria 1654
521 Ga0495633_0001276 3300046558 Bacteria 20000
522 Ga0495633_0030783 3300046558 Bacteria 2605
523 Ga0495667_0422429 3300046559 Bacteria 839
524 Ga0495668_0010451 3300046616 Bacteria 5616
525 Ga0495668_0056118 3300046616 Bacteria 2174
526 Ga0495668_0057908 3300046616 Bacteria 2139
527 Ga0495668_0210222 3300046616 Bacteria 1065
528 Ga0495634_0031557 3300046642 Bacteria 3649
529 Ga0495625_0000656 3300046660 Bacteria 49427
530 Ga0495635_0002476 3300046663 Bacteria 12606
531 Ga0495635_0003612 3300046663 Bacteria 10713
532 Ga0495635_0224256 3300046663 Bacteria 1271
533 Ga0495659_0003566 3300046664 Bacteria 4955
534 Ga0495661_0000671 3300046665 Bacteria 34227
535 Ga0495661_0000677 3300046665 Bacteria 34020
536 Ga0495661_0001935 3300046665 Bacteria 16465
537 Ga0495661_0005291 3300046665 Bacteria 9175
538 Ga0495661_0023236 3300046665 Bacteria 4024
539 Ga0495661_0036748 3300046665 Bacteria 3063
540 Ga0495661_0038791 3300046665 Bacteria 2964
541 Ga0495661_0060028 3300046665 Bacteria 2260
542 Ga0495588_0000140 3300046674 Bacteria 107766
543 Ga0495588_0165215 3300046674 Bacteria 1170
544 Ga0495599_0000952 3300046678 Bacteria 16186
545 Ga0495599_0033553 3300046678 Bacteria 3225
546 Ga0495623_0142584 3300046679 Bacteria 1423
547 Ga0495646_0017763 3300046680 Bacteria 4509
548 Ga0495646_0101846 3300046680 Bacteria 1645
549 Ga0495669_0002519 3300046684 Bacteria 7481
550 Ga0495613_0001905 3300046689 Bacteria 15814
551 Ga0495624_0000067 3300046690 Bacteria 66836
552 Ga0495624_0000416 3300046690 Bacteria 33753
553 Ga0495624_0002637 3300046690 Bacteria 13538
554 Ga0495624_0008044 3300046690 Bacteria 7385
555 Ga0495670_0005745 3300046691 Bacteria 6082
556 Ga0495671_0014712 3300046692 Bacteria 4205
557 Ga0495671_0029757 3300046692 Bacteria 2801
558 Ga0495649_0000141 3300046694 Bacteria 62853
559 Ga0495649_0024049 3300046694 Bacteria 3400
560 Ga0495649_0029355 3300046694 Bacteria 3042
561 Ga0495649_0083147 3300046694 Bacteria 1710
562 Ga0495589_0000073 3300046794 Bacteria 94125
563 Ga0495589_0000142 3300046794 Bacteria 66439
564 Ga0495589_0010024 3300046794 Bacteria 4922
565 Ga0495589_0212096 3300046794 Bacteria 911
566 Ga0495660_0000085 3300046810 Bacteria 100369
567 Ga0495660_0009633 3300046810 Bacteria 5631
568 Ga0495660_0047347 3300046810 Bacteria 2355
569 Ga0495660_0062033 3300046810 Bacteria 2004
570 Ga0495581_0036265 3300047315 Bacteria 2853
571 Ga0495581_0043954 3300047315 Bacteria 2583
572 Ga0495604_0261726 3300047317 Bacteria 1175
573 Ga0495604_0427439 3300047317 Bacteria 868
574 Ga0495636_0001633 3300047318 Bacteria 8545
575 Ga0495636_0053943 3300047318 Bacteria 1688
576 Ga0495674_0000035 3300047319 Bacteria 104643
577 Ga0495674_0014141 3300047319 Bacteria 7476
578 Ga0495674_0281415 3300047319 Bacteria 1362
579 Ga0495672_0000094 3300047320 Bacteria 144774
580 Ga0495672_0000623 3300047320 Bacteria 39591
581 Ga0495672_0000850 3300047320 Bacteria 32446
582 Ga0495672_0139954 3300047320 Bacteria 1265
583 Ga0495676_0034932 3300047321 Bacteria 4211
584 Ga0495676_0400703 3300047321 Bacteria 910
585 Ga0495680_0001059 3300047322 Bacteria 30455
586 Ga0495680_0005882 3300047322 Bacteria 11476
587 Ga0495680_0011225 3300047322 Bacteria 7954
588 Ga0495680_0402999 3300047322 Bacteria 944
589 Ga0495683_0000467 3300047323 Bacteria 31587
590 Ga0495683_0020581 3300047323 Bacteria 3402
591 Ga0495683_0036510 3300047323 Bacteria 2493
592 Ga0495683_0083298 3300047323 Bacteria 1557
593 Ga0495687_000037 3300047443 Bacteria 252363
594 Ga0495687_000069 3300047443 Bacteria 159852
595 Ga0495687_000108 3300047443 Bacteria 126739
596 Ga0495687_001956 3300047443 Bacteria 17607
597 Ga0495687_037638 3300047443 Bacteria 2153
598 Ga0495687_046273 3300047443 Bacteria 1879
599 Ga0495687_059524 3300047443 Bacteria 1579
600 Ga0495677_0000090 3300047445 Bacteria 46693
601 Ga0495677_0005679 3300047445 Bacteria 4727
602 Ga0495679_001340 3300047446 Bacteria 14236
603 Ga0495679_003010 3300047446 Bacteria 8290
604 Ga0495679_006457 3300047446 Bacteria 5041
605 Ga0495679_010100 3300047446 Bacteria 3730
606 Ga0495673_0008568 3300047469 Bacteria 5731
607 Ga0495681_0010632 3300047470 Bacteria 5560
608 Ga0495686_0000047 3300047472 Bacteria 280086
609 Ga0495686_0000142 3300047472 Bacteria 143655
610 Ga0495686_0000391 3300047472 Bacteria 69897
611 Ga0495593_0001558 3300047673 Bacteria 13525
612 Ga0495593_0002189 3300047673 Bacteria 11689
613 Ga0495593_0031987 3300047673 Bacteria 2870
614 Ga0495593_0041491 3300047673 Bacteria 2473
615 Ga0495602_0026274 3300048088 Bacteria 5617
616 Ga0495602_0065907 3300048088 Bacteria 3123
617 Ga0495614_0003980 3300048089 Bacteria 6630
618 Ga0495614_0005056 3300048089 Bacteria 5951
619 Ga0495615_0046895 3300048090 Bacteria 1099
620 Ga0495626_0000009 3300048091 Bacteria 270596
621 Ga0495626_0000078 3300048091 Bacteria 130020
622 Ga0495626_0012079 3300048091 Bacteria 4542
623 Ga0495626_0023542 3300048091 Bacteria 3031
624 Ga0495626_0043750 3300048091 Bacteria 2099
625 Ga0495626_0072310 3300048091 Bacteria 1547
626 Ga0496100_0000137 3300048903 Bacteria 40757
627 Ga0496101_0000044 3300048904 Bacteria 161295
628 Ga0496101_0056581 3300048904 Bacteria 2835
629 Ga0496102_0000379 3300048905 Bacteria 53037
630 Ga0496102_0014500 3300048905 Bacteria 6847
631 Ga0496102_0057144 3300048905 Bacteria 3561
632 Ga0496102_0109808 3300048905 Bacteria 2570
633 Ga0496103_0000724 3300048906 Bacteria 24379
634 Ga0496103_0016511 3300048906 Bacteria 4405
635 Ga0496103_0203257 3300048906 Bacteria 1274
636 Ga0496104_0000175 3300048907 Bacteria 56916
637 Ga0496104_0032624 3300048907 Bacteria 4848
638 Ga0496104_0039574 3300048907 Bacteria 4414
639 Ga0496104_0076235 3300048907 Bacteria 3194
640 Ga0496104_0132243 3300048907 Bacteria 2397
641 Ga0496104_0139177 3300048907 Bacteria 2333
642 Ga0496104_0175396 3300048907 Bacteria 2054
643 Ga0496105_0103676 3300048908 Bacteria 2349
644 Ga0496105_0149946 3300048908 Bacteria 1917
645 Ga0496105_0258395 3300048908 Bacteria 1409
646 Ga0496105_0277494 3300048908 Bacteria 1352
647 Ga0496105_0325909 3300048908 Bacteria 1230
648 Ga0496106_0007877 3300048909 Bacteria 7875
649 Ga0496106_0012041 3300048909 Bacteria 6383
650 Ga0496107_0001574 3300048910 Bacteria 14192
651 Ga0496108_0012905 3300048911 Bacteria 6808
652 Ga0496108_0038317 3300048911 Bacteria 3993
653 Ga0496108_0256131 3300048911 Bacteria 1523
654 Ga0496109_0003143 3300048912 Bacteria 13775
655 Ga0496109_0151564 3300048912 Bacteria 2171
656 Ga0496109_0153086 3300048912 Bacteria 2159
657 Ga0496109_0168436 3300048912 Bacteria 2054
658 Ga0496109_0336097 3300048912 Bacteria 1426
659 Ga0496109_0498110 3300048912 Bacteria 1150
660 Ga0496110_0000549 3300048913 Bacteria 25571
661 Ga0496110_0045437 3300048913 Bacteria 3839
662 Ga0496110_0063662 3300048913 Bacteria 3259
663 Ga0496111_0006678 3300048914 Bacteria 7505
664 Ga0496111_0059860 3300048914 Bacteria 2760
665 Ga0496111_0190577 3300048914 Bacteria 1524
666 Ga0496112_0015256 3300048915 Bacteria 7163
667 Ga0496112_0027125 3300048915 Bacteria 5521
668 Ga0496112_0036759 3300048915 Bacteria 4778
669 Ga0496112_0251321 3300048915 Bacteria 1719
670 Ga0496113_0016692 3300048916 Bacteria 5077
671 Ga0496113_0021275 3300048916 Bacteria 4573
672 Ga0496113_0194467 3300048916 Bacteria 1611
673 Ga0496113_0197973 3300048916 Bacteria 1596
674 Ga0496114_0100760 3300048917 Bacteria 2465
675 Ga0496114_0134410 3300048917 Bacteria 2138
676 Ga0496115_0008977 3300048918 Bacteria 7411
677 Ga0496115_0033370 3300048918 Bacteria 4064
678 Ga0496115_0098071 3300048918 Bacteria 2400
679 Ga0496116_0016282 3300048919 Bacteria 5825
680 Ga0496116_0116906 3300048919 Bacteria 1553
681 Ga0496117_0000011 3300048920 Bacteria 610930
682 Ga0496117_0000098 3300048920 Bacteria 196331
683 Ga0496118_0000010 3300048921 Bacteria 610930
684 Ga0496118_0000533 3300048921 Bacteria 62461
685 Ga0496121_0024039 3300048924 Bacteria 5840
686 Ga0496121_0057644 3300048924 Bacteria 3217
687 Ga0496121_0488002 3300048924 Bacteria 785
688 Ga0496122_0001169 3300048925 Bacteria 44889
689 Ga0496122_0020283 3300048925 Bacteria 6016
690 Ga0496122_0105884 3300048925 Bacteria 1863
691 Ga0496123_0015008 3300048926 Bacteria 6382
692 Ga0496123_0058934 3300048926 Bacteria 2486
693 Ga0496124_0009714 3300048927 Bacteria 9848
694 Ga0496124_0328367 3300048927 Bacteria 1092
695 Ga0496125_0031788 3300048928 Bacteria 4698
696 Ga0496125_0122587 3300048928 Bacteria 1850
697 Ga0496125_0135960 3300048928 Bacteria 1719
698 Ga0496126_0000024 3300048929 Bacteria 462877
699 Ga0496126_0001889 3300048929 Bacteria 30291
700 Ga0496126_0183991 3300048929 Bacteria 1773
701 Ga0466983_0231750 3300048986 Bacteria 1449
702 Ga0501308_000122 3300049128 Bacteria 3837
703 Ga0501304_000093 3300049160 Bacteria 3290
704 Ga0495678_003893 3300049459 Bacteria 8956
705 Ga0495682_0042276 3300049460 Bacteria 1670
706 Ga0495682_0155712 3300049460 Bacteria 814
707 Ga0501034_0000166 3300049571 Bacteria 122782
708 Ga0501034_0036607 3300049571 Bacteria 4970
709 Ga0501038_0066359 3300049574 Bacteria 3073
710 Ga0501039_0000452 3300049575 Bacteria 29793
711 Ga0501040_0174532 3300049576 Bacteria 1523
712 Ga0501040_0383779 3300049576 Bacteria 1008
713 Ga0501041_0096326 3300049577 Bacteria 1829
714 Ga0501042_0143809 3300049578 Bacteria 1720
715 Ga0501046_0000224 3300049580 Bacteria 58986
716 Ga0501046_0001372 3300049580 Bacteria 23445
717 Ga0501046_0040933 3300049580 Bacteria 3700
718 Ga0501046_0070174 3300049580 Bacteria 2725
719 Ga0501046_0122388 3300049580 Bacteria 1979
720 Ga0501046_0145330 3300049580 Bacteria 1791
721 Ga0501047_0000283 3300049581 Bacteria 58613
722 Ga0501047_0120837 3300049581 Bacteria 2502
723 Ga0501047_0254397 3300049581 Bacteria 1605
724 Ga0501048_0000649 3300049582 Bacteria 25020
725 Ga0501067_0007840 3300049583 Bacteria 5936
726 Ga0501068_0001931 3300049584 Bacteria 11016
727 Ga0501070_0018569 3300049586 Bacteria 5833
728 Ga0501072_0309467 3300049588 Bacteria 1256
729 Ga0501072_0322343 3300049588 Bacteria 1228
730 Ga0501073_0001305 3300049589 Bacteria 18325
731 Ga0501073_0067678 3300049589 Bacteria 2490
732 Ga0501073_0072285 3300049589 Bacteria 2402
733 Ga0501074_0178932 3300049590 Bacteria 1513
734 Ga0501076_0002771 3300049592 Bacteria 12131
735 Ga0501076_0166793 3300049592 Bacteria 1795
736 Ga0501077_0034960 3300049593 Bacteria 3199
737 Ga0501077_0072405 3300049593 Bacteria 2184
738 Ga0501079_0011229 3300049741 Bacteria 6832
739 Ga0501079_0071919 3300049741 Bacteria 2672
740 Ga0501079_0288924 3300049741 Bacteria 1282
741 Ga0501080_0000315 3300049742 Bacteria 37063
742 Ga0501080_0034087 3300049742 Bacteria 4752
743 Ga0501080_0263910 3300049742 Bacteria 1568
744 Ga0501081_0024303 3300049743 Bacteria 4068
745 Ga0501035_0000084 3300049822 Bacteria 116222
746 Ga0501035_0003361 3300049822 Bacteria 15324
747 Ga0501035_0034636 3300049822 Bacteria 4587
748 Ga0501044_0000073 3300049823 Bacteria 122507
749 Ga0501045_0050371 3300049824 Bacteria 3038
750 Ga0501045_0408060 3300049824 Bacteria 1011
751 nmdc:mga03n38_10013_c1 3300050490 Bacteria 3471
752 nmdc:mga03n38_1086_c1 3300050490 Bacteria 7498
753 nmdc:mga0yw44_205689_c1 3300050492 Bacteria 1301
754 nmdc:mga06z11_1379_c1 3300050494 Bacteria 9000
755 nmdc:mga04h51_10604_c1 3300050495 Bacteria 2536
756 nmdc:mga04h51_230_c1 3300050495 Bacteria 14875
757 nmdc:mga05p37_108238_c1 3300050507 Bacteria 3419
758 nmdc:mga05p37_414316_c1 3300050507 Bacteria 1570
759 nmdc:mga05p37_41510_c1 3300050507 Bacteria 5648
760 nmdc:mga09592_166028_c1 3300050508 Bacteria 1908
761 nmdc:mga09592_19535_c1 3300050508 Bacteria 5565
762 nmdc:mga0qj67_66121_c1 3300050509 Bacteria 2879
763 nmdc:mga0qj67_83168_c1 3300050509 Bacteria 2566
764 nmdc:mga06r32_14451_c1 3300050510 Bacteria 7166
765 nmdc:mga06r32_220725_c1 3300050510 Bacteria 1884
766 nmdc:mga08y16_104351_c1 3300050511 Bacteria 2951
767 nmdc:mga08y16_50357_c1 3300050511 Bacteria 4359
768 nmdc:mga08y16_51928_c1 3300050511 Bacteria 4290
769 nmdc:mga08y16_54194_c1 3300050511 Bacteria 4191
770 nmdc:mga08y16_580379_c1 3300050511 Bacteria 1132
771 nmdc:mga0n895_6848_c1 3300050512 Bacteria 9735
772 nmdc:mga0rr50_13712_c1 3300050513 Bacteria 3577
773 nmdc:mga0a205_3040_c1 3300050515 Bacteria 14873
774 nmdc:mga0a205_312118_c1 3300050515 Bacteria 1444
775 nmdc:mga0a205_602544_c1 3300050515 Bacteria 952
776 Ga0495612_0057056 3300053078 Bacteria 1612
777 Ga0495595_0040639 3300053084 Bacteria 2126
778 Ga0495619_0237275 3300053085 Bacteria 1263
779 Ga0495619_0290824 3300053085 Bacteria 1132
780 Ga0500616_0027989 3300053153 Bacteria 3110
781 Ga0501084_0011118 3300054114 Bacteria 7454
782 Ga0501084_0208436 3300054114 Bacteria 1649
783 Ga0501084_0743084 3300054114 Bacteria 827
784 Ga0587073_0051204 3300059492 Bacteria 936
785 Ga0587077_008846 3300059493 Bacteria 1511
786 Ga0587080_004252 3300059503 Bacteria 1846
787 Ga0587090_003325 3300059510 Bacteria 1860
788 Ga0587106_004319 3300059605 Bacteria 1556
789 Ga0587106_005514 3300059605 Bacteria 1450
790 Ga0587125_001661 3300059607 Bacteria 1658
791 Ga0587067_008240 3300059640 Bacteria 1517
792 Ga0587068_005304 3300059641 Bacteria 1754
793 Ga0587069_004560 3300059642 Bacteria 1567
794 Ga0587079_003676 3300059647 Bacteria 2018
795 Ga0587111_0024871 3300060346 Bacteria 1182
796 Ga0501082_0019419 3300060353 Bacteria 5858
797 Ga0501082_0062612 3300060353 Bacteria 3203
798 Ga0501082_0443416 3300060353 Bacteria 1134
799 Ga0530510_0032731 3300061734 Bacteria 3742
800 Ga0530510_0332816 3300061734 Bacteria 1139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044719 Ga0466971_0314793 Ga0466971_0314793_17_670 217
2 3300059510 Ga0587090_003325 Ga0587090_003325_342_998 218
3 3300048924 Ga0496121_0488002 Ga0496121_0488002_67_747 224
4 iso_pu_bacteria 2816332286 2817455082 227
5 iso_pu_bacteria 2501025504 2501406952 236
6 iso_pu_bacteria 2902682994 2902690851 236
7 3300046557 Ga0495622_0067334 Ga0495622_0067334_898_1644 239
8 3300039447 Ga0436361_0000881 Ga0436361_0000881_3751_4479 240
9 3300044683 Ga0466965_0241237 Ga0466965_0241237_234_956 240
10 3300045049 Ga0466959_0192796 Ga0466959_0192796_12_734 240
11 3300046461 Ga0495641_0050410 Ga0495641_0050410_45_767 240
12 3300046472 Ga0495580_0075288 Ga0495580_0075288_303_1025 240
13 3300046794 Ga0495589_0212096 Ga0495589_0212096_27_749 240
14 3300047323 Ga0495683_0000467 Ga0495683_0000467_30847_31569 240
15 3300048916 Ga0496113_0197973 Ga0496113_0197973_864_1586 240
16 3300049460 Ga0495682_0155712 Ga0495682_0155712_19_741 240
17 iso_pu_bacteria 2599185239 2599739489 240
18 iso_pu_bacteria 2599185354 2600201417 244
19 iso_pu_bacteria 2919138771 2919140865 244
20 3300003320 rootH2_10317752 rootH2_103177522 245
21 3300009551 Ga0105238_10366111 Ga0105238_103661111 245
22 3300025924 Ga0207694_10381406 Ga0207694_103814061 245
23 3300046472 Ga0495580_0011969 Ga0495580_0011969_3549_4322 245
24 3300048929 Ga0496126_0000024 Ga0496126_0000024_311069_311827 245
25 iso_pu_bacteria 2501025501 2501071496 245
26 iso_pu_bacteria 2501025502 2501077432 245
27 iso_pu_bacteria 2501025504 2501408346 245
28 iso_pu_bacteria 2508501125 2509131449 245
29 iso_pu_bacteria 2510917013 2511086185 245
30 iso_pu_bacteria 2510917013 2511087297 245
31 iso_pu_bacteria 2510917013 2511091518 245
32 iso_pu_bacteria 2510917013 2511092569 245
33 iso_pu_bacteria 2510917014 2511096086 245
34 iso_pu_bacteria 2510917014 2511097854 245
35 iso_pu_bacteria 2510917015 2511103190 245
36 iso_pu_bacteria 2512047030 2512345175 245
37 iso_pu_bacteria 2512047030 2512350781 245
38 iso_pu_bacteria 2513237082 2513557864 245
39 iso_pu_bacteria 2513237083 2513561613 245
40 iso_pu_bacteria 2513237083 2513564660 245
41 iso_pu_bacteria 2513237083 2513565331 245
42 iso_pu_bacteria 2513237151 2513963719 245
43 iso_pu_bacteria 2513237166 2514047898 245
44 iso_pu_bacteria 2513237166 2514049881 245
45 iso_pu_bacteria 2513237166 2514054864 245
46 iso_pu_bacteria 2515154122 2515681986 245
47 iso_pu_bacteria 2515154122 2515682174 245
48 iso_pu_bacteria 2515154123 2515686919 245
49 iso_pu_bacteria 2515154123 2515687466 245
50 iso_pu_bacteria 2515154123 2515690650 245
51 iso_pu_bacteria 2515154123 2515691390 245
52 iso_pu_bacteria 2515154189 2516022189 245
53 iso_pu_bacteria 2519103095 2519458196 245
54 iso_pu_bacteria 2547132374 2548498045 245
55 iso_pu_bacteria 2547132512 2548848438 245
56 iso_pu_bacteria 2600255292 2601669424 245
57 iso_pu_bacteria 2643221556 2643801415 245
58 iso_pu_bacteria 2643221570 2643866003 245
59 iso_pu_bacteria 2643221645 2644250154 245
60 iso_pu_bacteria 2643221684 2644472623 245
61 iso_pu_bacteria 2643221717 2644646003 245
62 iso_pu_bacteria 2711768613 2713480145 245
63 iso_pu_bacteria 2738541276 2738715854 245
64 iso_pu_bacteria 2738543012 2739243695 245
65 iso_pu_bacteria 2751185846 2753566841 245
66 iso_pu_bacteria 2791355137 2792833853 245
67 iso_pu_bacteria 2791355137 2792837859 245
68 iso_pu_bacteria 2791355137 2792838792 245
69 iso_pu_bacteria 2791355137 2792839146 245
70 iso_pu_bacteria 2791355137 2792839197 245
71 iso_pu_bacteria 2808606418 2809142206 245
72 iso_pu_bacteria 2816332133 2816470320 245
73 iso_pu_bacteria 2816332133 2816473224 245
74 iso_pu_bacteria 2816332253 2817258804 245
75 iso_pu_bacteria 2816332253 2817260348 245
76 iso_pu_bacteria 2818991452 2819632873 245
77 iso_pu_bacteria 2834641062 2834641553 245
78 iso_pu_bacteria 2842324504 2842325037 245
79 iso_pu_bacteria 2842348783 2842349315 245
80 iso_pu_bacteria 2857547612 2857549545 245
81 iso_pu_bacteria 2857576091 2857579938 245
82 iso_pu_bacteria 2863421361 2863421885 245
83 iso_pu_bacteria 2870068957 2870072173 245
84 iso_pu_bacteria 2881101125 2881105381 245
85 iso_pu_bacteria 2883087390 2883088080 245
86 iso_pu_bacteria 2883087390 2883092412 245
87 iso_pu_bacteria 2885080285 2885085330 245
88 iso_pu_bacteria 2885270888 2885280004 245
89 iso_pu_bacteria 2900634093 2900637761 245
90 iso_pu_bacteria 2900634093 2900641449 245
91 iso_pu_bacteria 2904483920 2904487459 245
92 iso_pu_bacteria 2904483920 2904488792 245
93 iso_pu_bacteria 2904564687 2904566050 245
94 iso_pu_bacteria 2904571731 2904573094 245
95 iso_pu_bacteria 2904615490 2904622007 245
96 iso_pu_bacteria 2904615490 2904622201 245
97 iso_pu_bacteria 2919527303 2919528766 245
98 iso_pu_bacteria 2919527303 2919529402 245
99 iso_pu_bacteria 2928157003 2928162211 245
100 iso_pu_bacteria 2928170801 2928173004 245
101 iso_pu_bacteria 2928536128 2928538384 245
102 iso_pu_bacteria 2932410948 2932414692 245
103 iso_pu_bacteria 2932416698 2932420788 245
104 iso_pu_bacteria 2981990288 2981990509 245
105 iso_pu_bacteria 2981990288 2981993968 245
106 iso_pu_bacteria 2981990288 2981997014 245
107 iso_pu_bacteria 641736154 642416541 245
108 iso_pu_bacteria 642555112 642592530 245
109 iso_pu_bacteria 642555112 642596574 245
110 iso_pu_bacteria 642555113 642615287 245
111 iso_pu_bacteria 642555113 642622555 245
112 iso_pu_bacteria 8003955200 8003957763 245
113 iso_pu_bacteria 8003955200 8003960016 245
114 iso_pu_bacteria 8003955200 8003961071 245
115 iso_pu_bacteria 8018845410 8018848330 245
116 iso_pu_bacteria 8020938398 8020939345 245
117 iso_pu_bacteria 8020938398 8020940560 245
118 iso_pu_bacteria 8020953355 8020954431 245
119 iso_pu_bacteria 8020953355 8020956447 245
120 iso_pu_bacteria 8021120328 8021122780 245
121 iso_pu_bacteria 8021120328 8021123176 245
122 iso_pu_bacteria 8047673197 8047675089 245
123 iso_pu_bacteria 8055266321 8055267013 245
124 iso_pu_bacteria 8055266321 8055271954 245
125 iso_pu_bacteria 8055266321 8055272866 245
126 iso_pu_bacteria 8055266321 8055273624 245
127 iso_pu_bacteria 8055301274 8055301673 245
128 iso_pu_bacteria 8055301274 8055301912 245
129 3300050507 nmdc:mga05p37_414316_c1 nmdc:mga05p37_414316_c1_573_1322 246
130 iso_pu_bacteria 2883087390 2883089732 246
131 3300005436 Ga0070713_100049055 Ga0070713_1000490552 247
132 3300025928 Ga0207700_10330135 Ga0207700_103301352 247
133 3300046516 Ga0495628_0288613 Ga0495628_0288613_56_826 247
134 3300003659 JGI25404J52841_10001526 JGI25404J52841_100015263 248
135 3300005336 Ga0070680_100021694 Ga0070680_1000216941 248
136 3300005341 Ga0070691_10036010 Ga0070691_100360102 248
137 3300005343 Ga0070687_100386433 Ga0070687_1003864331 248
138 3300005354 Ga0070675_100421886 Ga0070675_1004218861 248
139 3300005367 Ga0070667_100276878 Ga0070667_1002768782 248
140 3300005406 Ga0070703_10004073 Ga0070703_100040734 248
141 3300005440 Ga0070705_100000751 Ga0070705_10000075115 248
142 3300005441 Ga0070700_100016215 Ga0070700_1000162152 248
143 3300005444 Ga0070694_100014968 Ga0070694_1000149684 248
144 3300005455 Ga0070663_100030279 Ga0070663_1000302793 248
145 3300005457 Ga0070662_100010146 Ga0070662_1000101463 248
146 3300005467 Ga0070706_100132861 Ga0070706_1001328613 248
147 3300005518 Ga0070699_100005628 Ga0070699_1000056286 248
148 3300005530 Ga0070679_100068940 Ga0070679_1000689402 248
149 3300005545 Ga0070695_100000339 Ga0070695_1000003396 248
150 3300005546 Ga0070696_100001139 Ga0070696_10000113914 248
151 3300005547 Ga0070693_100019364 Ga0070693_1000193642 248
152 3300005549 Ga0070704_100003545 Ga0070704_1000035452 248
153 3300005577 Ga0068857_100011253 Ga0068857_1000112536 248
154 3300005617 Ga0068859_100004644 Ga0068859_10000464412 248
155 3300005618 Ga0068864_100004875 Ga0068864_1000048754 248
156 3300005719 Ga0068861_100068717 Ga0068861_1000687171 248
157 3300005841 Ga0068863_100665126 Ga0068863_1006651261 248
158 3300005842 Ga0068858_100516443 Ga0068858_1005164432 248
159 3300005843 Ga0068860_100010922 Ga0068860_1000109226 248
160 3300005843 Ga0068860_100373744 Ga0068860_1003737441 248
161 3300005843 Ga0068860_100489534 Ga0068860_1004895342 248
162 3300005843 Ga0068860_100594314 Ga0068860_1005943141 248
163 3300005844 Ga0068862_100005698 Ga0068862_1000056987 248
164 3300005983 Ga0081540_1000050 Ga0081540_100005046 248
165 3300006038 Ga0075365_10018004 Ga0075365_100180044 248
166 3300006042 Ga0075368_10000312 Ga0075368_1000031210 248
167 3300006042 Ga0075368_10004890 Ga0075368_100048905 248
168 3300006042 Ga0075368_10007111 Ga0075368_100071112 248
169 3300006048 Ga0075363_100002154 Ga0075363_1000021542 248
170 3300006048 Ga0075363_100002994 Ga0075363_1000029941 248
171 3300006178 Ga0075367_10000480 Ga0075367_100004806 248
172 3300006178 Ga0075367_10004476 Ga0075367_100044763 248
173 3300006178 Ga0075367_10017865 Ga0075367_100178652 248
174 3300006844 Ga0075428_100064681 Ga0075428_1000646811 248
175 3300006844 Ga0075428_100523856 Ga0075428_1005238562 248
176 3300006846 Ga0075430_100025541 Ga0075430_1000255414 248
177 3300006847 Ga0075431_100000648 Ga0075431_10000064826 248
178 3300006847 Ga0075431_100055669 Ga0075431_1000556694 248
179 3300006847 Ga0075431_100093901 Ga0075431_1000939015 248
180 3300006852 Ga0075433_10372540 Ga0075433_103725401 248
181 3300006852 Ga0075433_10399008 Ga0075433_103990082 248
182 3300006871 Ga0075434_100001044 Ga0075434_10000104418 248
183 3300006871 Ga0075434_100228654 Ga0075434_1002286541 248
184 3300006880 Ga0075429_100167889 Ga0075429_1001678893 248
185 3300006931 Ga0097620_100004644 Ga0097620_1000046445 248
186 3300007076 Ga0075435_100199514 Ga0075435_1001995141 248
187 3300009094 Ga0111539_10007102 Ga0111539_100071028 248
188 3300009094 Ga0111539_10011351 Ga0111539_1001135112 248
189 3300009094 Ga0111539_10430824 Ga0111539_104308242 248
190 3300009094 Ga0111539_10808039 Ga0111539_108080392 248
191 3300009098 Ga0105245_10171208 Ga0105245_101712082 248
192 3300009101 Ga0105247_10146703 Ga0105247_101467032 248
193 3300009147 Ga0114129_10012579 Ga0114129_1001257912 248
194 3300009147 Ga0114129_10250544 Ga0114129_102505442 248
195 3300009147 Ga0114129_10280166 Ga0114129_102801662 248
196 3300009177 Ga0105248_10577991 Ga0105248_105779911 248
197 3300009553 Ga0105249_10014651 Ga0105249_100146515 248
198 3300009553 Ga0105249_10237654 Ga0105249_102376542 248
199 3300009553 Ga0105249_10323308 Ga0105249_103233082 248
200 3300013306 Ga0163162_10820446 Ga0163162_108204462 248
201 3300013308 Ga0157375_10023864 Ga0157375_100238646 248
202 3300014968 Ga0157379_10103984 Ga0157379_101039842 248
203 3300014968 Ga0157379_10479019 Ga0157379_104790192 248
204 3300025885 Ga0207653_10004668 Ga0207653_100046684 248
205 3300025900 Ga0207710_10117873 Ga0207710_101178732 248
206 3300025917 Ga0207660_10016006 Ga0207660_100160061 248
207 3300025921 Ga0207652_10023480 Ga0207652_100234802 248
208 3300025927 Ga0207687_10477495 Ga0207687_104774951 248
209 3300025942 Ga0207689_10059743 Ga0207689_100597432 248
210 3300025961 Ga0207712_10336778 Ga0207712_103367781 248
211 3300025986 Ga0207658_10280331 Ga0207658_102803312 248
212 3300026067 Ga0207678_10002715 Ga0207678_100027154 248
213 3300026075 Ga0207708_10000535 Ga0207708_100005355 248
214 3300026075 Ga0207708_10095786 Ga0207708_100957862 248
215 3300026095 Ga0207676_10040508 Ga0207676_100405083 248
216 3300026116 Ga0207674_10001583 Ga0207674_1000158326 248
217 3300026118 Ga0207675_100063555 Ga0207675_1000635552 248
218 3300027866 Ga0209813_10000327 Ga0209813_100003276 248
219 3300027866 Ga0209813_10017251 Ga0209813_100172513 248
220 3300027907 Ga0207428_10004815 Ga0207428_1000481511 248
221 3300027907 Ga0207428_10276820 Ga0207428_102768202 248
222 3300028380 Ga0268265_10003906 Ga0268265_100039066 248
223 3300028381 Ga0268264_10042388 Ga0268264_100423883 248
224 3300028381 Ga0268264_10122252 Ga0268264_101222522 248
225 3300028381 Ga0268264_10364185 Ga0268264_103641852 248
226 3300028381 Ga0268264_10451380 Ga0268264_104513801 248
227 3300031239 Ga0265328_10004865 Ga0265328_100048653 248
228 3300032002 Ga0307416_100340087 Ga0307416_1003400872 248
229 3300034819 Ga0373958_0025096 Ga0373958_0025096_113_868 248
230 3300034820 Ga0373959_0033213 Ga0373959_0033213_231_986 248
231 3300035088 Ga0373940_0007291 Ga0373940_0007291_1186_1941 248
232 3300035114 Ga0373939_0004807 Ga0373939_0004807_2040_2795 248
233 3300035207 Ga0373942_0006881 Ga0373942_0006881_1679_2434 248
234 3300035242 Ga0373962_0005558 Ga0373962_0005558_1141_1896 248
235 3300035410 Ga0373924_0078806 Ga0373924_0078806_521_1276 248
236 3300035691 Ga0373931_0001346 Ga0373931_0001346_4228_4983 248
237 3300035691 Ga0373931_0002117 Ga0373931_0002117_4721_5476 248
238 3300037068 Ga0373925_0083523 Ga0373925_0083523_1549_2304 248
239 3300037068 Ga0373925_0220772 Ga0373925_0220772_688_1443 248
240 3300046616 Ga0495668_0210222 Ga0495668_0210222_143_898 248
241 3300046663 Ga0495635_0224256 Ga0495635_0224256_458_1213 248
242 3300048905 Ga0496102_0014500 Ga0496102_0014500_2164_2919 248
243 3300048907 Ga0496104_0000175 Ga0496104_0000175_54726_55481 248
244 3300048907 Ga0496104_0076235 Ga0496104_0076235_53_808 248
245 3300048907 Ga0496104_0175396 Ga0496104_0175396_658_1413 248
246 3300048908 Ga0496105_0277494 Ga0496105_0277494_350_1105 248
247 3300048909 Ga0496106_0012041 Ga0496106_0012041_3447_4202 248
248 3300048911 Ga0496108_0012905 Ga0496108_0012905_4766_5521 248
249 3300048911 Ga0496108_0038317 Ga0496108_0038317_2011_2766 248
250 3300048912 Ga0496109_0003143 Ga0496109_0003143_10710_11465 248
251 3300048912 Ga0496109_0151564 Ga0496109_0151564_992_1747 248
252 3300048912 Ga0496109_0168436 Ga0496109_0168436_1151_1906 248
253 3300048912 Ga0496109_0336097 Ga0496109_0336097_591_1346 248
254 3300048913 Ga0496110_0000549 Ga0496110_0000549_10238_10993 248
255 3300048913 Ga0496110_0063662 Ga0496110_0063662_1395_2150 248
256 3300048914 Ga0496111_0006678 Ga0496111_0006678_1687_2442 248
257 3300048914 Ga0496111_0190577 Ga0496111_0190577_88_843 248
258 3300048915 Ga0496112_0015256 Ga0496112_0015256_2360_3115 248
259 3300048915 Ga0496112_0027125 Ga0496112_0027125_1345_2100 248
260 3300048916 Ga0496113_0016692 Ga0496113_0016692_486_1241 248
261 3300048916 Ga0496113_0194467 Ga0496113_0194467_328_1083 248
262 3300048917 Ga0496114_0134410 Ga0496114_0134410_1183_1938 248
263 3300048918 Ga0496115_0008977 Ga0496115_0008977_3966_4721 248
264 3300048918 Ga0496115_0098071 Ga0496115_0098071_1562_2317 248
265 3300048927 Ga0496124_0328367 Ga0496124_0328367_60_812 248
266 3300049576 Ga0501040_0174532 Ga0501040_0174532_227_982 248
267 3300049576 Ga0501040_0383779 Ga0501040_0383779_188_943 248
268 3300049577 Ga0501041_0096326 Ga0501041_0096326_12_767 248
269 3300049578 Ga0501042_0143809 Ga0501042_0143809_919_1674 248
270 3300049580 Ga0501046_0070174 Ga0501046_0070174_281_1036 248
271 3300049580 Ga0501046_0122388 Ga0501046_0122388_906_1661 248
272 3300049580 Ga0501046_0145330 Ga0501046_0145330_1003_1758 248
273 3300049588 Ga0501072_0309467 Ga0501072_0309467_375_1127 248
274 3300049588 Ga0501072_0322343 Ga0501072_0322343_452_1207 248
275 3300049589 Ga0501073_0067678 Ga0501073_0067678_535_1290 248
276 3300049590 Ga0501074_0178932 Ga0501074_0178932_98_853 248
277 3300049592 Ga0501076_0002771 Ga0501076_0002771_6352_7107 248
278 3300049592 Ga0501076_0166793 Ga0501076_0166793_614_1369 248
279 3300049593 Ga0501077_0034960 Ga0501077_0034960_546_1301 248
280 3300049593 Ga0501077_0072405 Ga0501077_0072405_993_1748 248
281 3300049741 Ga0501079_0011229 Ga0501079_0011229_43_798 248
282 3300049741 Ga0501079_0071919 Ga0501079_0071919_961_1788 248
283 3300049741 Ga0501079_0288924 Ga0501079_0288924_393_1148 248
284 3300049742 Ga0501080_0263910 Ga0501080_0263910_797_1552 248
285 3300049743 Ga0501081_0024303 Ga0501081_0024303_1851_2606 248
286 3300049824 Ga0501045_0408060 Ga0501045_0408060_75_830 248
287 3300050490 nmdc:mga03n38_10013_c1 nmdc:mga03n38_10013_c1_1688_2443 248
288 3300050490 nmdc:mga03n38_1086_c1 nmdc:mga03n38_1086_c1_5073_5828 248
289 3300050494 nmdc:mga06z11_1379_c1 nmdc:mga06z11_1379_c1_980_1735 248
290 3300050495 nmdc:mga04h51_10604_c1 nmdc:mga04h51_10604_c1_1205_1960 248
291 3300050495 nmdc:mga04h51_230_c1 nmdc:mga04h51_230_c1_9980_10735 248
292 3300050507 nmdc:mga05p37_108238_c1 nmdc:mga05p37_108238_c1_556_1311 248
293 3300050507 nmdc:mga05p37_41510_c1 nmdc:mga05p37_41510_c1_1974_2729 248
294 3300050508 nmdc:mga09592_166028_c1 nmdc:mga09592_166028_c1_589_1335 248
295 3300050508 nmdc:mga09592_19535_c1 nmdc:mga09592_19535_c1_4214_4969 248
296 3300050509 nmdc:mga0qj67_66121_c1 nmdc:mga0qj67_66121_c1_2105_2860 248
297 3300050509 nmdc:mga0qj67_83168_c1 nmdc:mga0qj67_83168_c1_1326_2081 248
298 3300050510 nmdc:mga06r32_14451_c1 nmdc:mga06r32_14451_c1_1400_2155 248
299 3300050510 nmdc:mga06r32_220725_c1 nmdc:mga06r32_220725_c1_418_1173 248
300 3300050511 nmdc:mga08y16_104351_c1 nmdc:mga08y16_104351_c1_1577_2332 248
301 3300050511 nmdc:mga08y16_50357_c1 nmdc:mga08y16_50357_c1_679_1434 248
302 3300050511 nmdc:mga08y16_51928_c1 nmdc:mga08y16_51928_c1_1854_2609 248
303 3300050511 nmdc:mga08y16_54194_c1 nmdc:mga08y16_54194_c1_3033_3788 248
304 3300050512 nmdc:mga0n895_6848_c1 nmdc:mga0n895_6848_c1_7040_7795 248
305 3300050513 nmdc:mga0rr50_13712_c1 nmdc:mga0rr50_13712_c1_1928_2683 248
306 3300050515 nmdc:mga0a205_3040_c1 nmdc:mga0a205_3040_c1_7787_8542 248
307 3300050515 nmdc:mga0a205_312118_c1 nmdc:mga0a205_312118_c1_590_1345 248
308 3300050515 nmdc:mga0a205_602544_c1 nmdc:mga0a205_602544_c1_46_801 248
309 3300053153 Ga0500616_0027989 Ga0500616_0027989_565_1320 248
310 3300054114 Ga0501084_0011118 Ga0501084_0011118_6493_7248 248
311 3300054114 Ga0501084_0208436 Ga0501084_0208436_816_1571 248
312 3300054114 Ga0501084_0743084 Ga0501084_0743084_43_798 248
313 3300060353 Ga0501082_0019419 Ga0501082_0019419_2006_2761 248
314 3300060353 Ga0501082_0443416 Ga0501082_0443416_222_977 248
315 3300061734 Ga0530510_0032731 Ga0530510_0032731_1957_2784 248
316 3300061734 Ga0530510_0332816 Ga0530510_0332816_315_1070 248
317 3300002067 JGI24735J21928_10010847 JGI24735J21928_100108473 249
318 3300002737 JGI25162J39368_1008694 JGI25162J39368_10086942 249
319 3300002737 JGI25162J39368_1010030 JGI25162J39368_10100301 249
320 3300003320 rootH2_10326619 rootH2_103266193 249
321 3300003323 rootH1_10003933 rootH1_100039337 249
322 3300003354 JGI25160J50197_1000037 JGI25160J50197_100003716 249
323 3300003479 Ga0006556J51387_1026944 Ga0006556J51387_10269441 249
324 3300003567 Ga0006554J51385_1021980 Ga0006554J51385_10219801 249
325 3300003574 Ga0007410J51695_1010366 Ga0007410J51695_10103662 249
326 3300003575 Ga0007409J51694_1003842 Ga0007409J51694_10038422 249
327 3300003578 Ga0006562J51391_1036800 Ga0006562J51391_10368001 249
328 3300003693 Ga0032354_1028144 Ga0032354_10281442 249
329 3300003735 Ga0006780_1031982 Ga0006780_10319822 249
330 3300003758 Ga0055532_1017360 Ga0055532_10173601 249
331 3300003759 Ga0055525_1000074 Ga0055525_100007427 249
332 3300003760 Ga0055527_1000493 Ga0055527_100049316 249
333 3300003761 Ga0055535_1001248 Ga0055535_100124816 249
334 3300003761 Ga0055535_1001250 Ga0055535_10012501 249
335 3300003762 Ga0055542_1001239 Ga0055542_10012391 249
336 3300003762 Ga0055542_1005066 Ga0055542_10050663 249
337 3300003762 Ga0055542_1018213 Ga0055542_10182131 249
338 3300003763 Ga0055529_1000492 Ga0055529_100049220 249
339 3300003790 Ga0055528_1007588 Ga0055528_10075882 249
340 3300003856 Ga0058692_1003292 Ga0058692_10032925 249
341 3300005262 Ga0065165_1000811 Ga0065165_10008113 249
342 3300005262 Ga0065165_1002556 Ga0065165_10025562 249
343 3300005262 Ga0065165_1003857 Ga0065165_100385710 249
344 3300005262 Ga0065165_1040275 Ga0065165_10402752 249
345 3300005288 Ga0065714_10111349 Ga0065714_101113492 249
346 3300005293 Ga0065715_10145757 Ga0065715_101457572 249
347 3300005327 Ga0070658_10543376 Ga0070658_105433761 249
348 3300005331 Ga0070670_100061666 Ga0070670_1000616662 249
349 3300005335 Ga0070666_10116312 Ga0070666_101163122 249
350 3300005335 Ga0070666_10201103 Ga0070666_102011032 249
351 3300005336 Ga0070680_100014065 Ga0070680_1000140655 249
352 3300005337 Ga0070682_100003799 Ga0070682_10000379910 249
353 3300005343 Ga0070687_100033200 Ga0070687_1000332002 249
354 3300005347 Ga0070668_100035691 Ga0070668_1000356912 249
355 3300005347 Ga0070668_100118459 Ga0070668_1001184592 249
356 3300005354 Ga0070675_100064176 Ga0070675_1000641763 249
357 3300005355 Ga0070671_100038479 Ga0070671_1000384792 249
358 3300005356 Ga0070674_100017276 Ga0070674_1000172766 249
359 3300005366 Ga0070659_100034835 Ga0070659_1000348354 249
360 3300005367 Ga0070667_100032586 Ga0070667_1000325862 249
361 3300005367 Ga0070667_100037246 Ga0070667_1000372463 249
362 3300005440 Ga0070705_100014535 Ga0070705_1000145353 249
363 3300005444 Ga0070694_100041992 Ga0070694_1000419922 249
364 3300005455 Ga0070663_100001331 Ga0070663_1000013315 249
365 3300005455 Ga0070663_100163147 Ga0070663_1001631472 249
366 3300005457 Ga0070662_100096794 Ga0070662_1000967942 249
367 3300005458 Ga0070681_10006501 Ga0070681_1000650113 249
368 3300005459 Ga0068867_100039933 Ga0068867_1000399331 249
369 3300005459 Ga0068867_100166221 Ga0068867_1001662212 249
370 3300005466 Ga0070685_10134598 Ga0070685_101345982 249
371 3300005530 Ga0070679_100634625 Ga0070679_1006346251 249
372 3300005539 Ga0068853_100003695 Ga0068853_10000369512 249
373 3300005546 Ga0070696_100005852 Ga0070696_1000058526 249
374 3300005548 Ga0070665_100239774 Ga0070665_1002397742 249
375 3300005549 Ga0070704_100410740 Ga0070704_1004107401 249
376 3300005563 Ga0068855_100073014 Ga0068855_1000730144 249
377 3300005577 Ga0068857_100165273 Ga0068857_1001652732 249
378 3300005577 Ga0068857_100510652 Ga0068857_1005106521 249
379 3300005614 Ga0068856_100179162 Ga0068856_1001791623 249
380 3300005615 Ga0070702_100089069 Ga0070702_1000890692 249
381 3300005615 Ga0070702_100415041 Ga0070702_1004150411 249
382 3300005616 Ga0068852_100428726 Ga0068852_1004287262 249
383 3300005617 Ga0068859_100020274 Ga0068859_1000202744 249
384 3300005618 Ga0068864_100284240 Ga0068864_1002842401 249
385 3300005718 Ga0068866_10116871 Ga0068866_101168712 249
386 3300005719 Ga0068861_100054369 Ga0068861_1000543691 249
387 3300005840 Ga0068870_10017842 Ga0068870_100178424 249
388 3300005840 Ga0068870_10060216 Ga0068870_100602162 249
389 3300005840 Ga0068870_10366413 Ga0068870_103664131 249
390 3300005842 Ga0068858_100082864 Ga0068858_1000828642 249
391 3300005843 Ga0068860_100214317 Ga0068860_1002143172 249
392 3300005844 Ga0068862_100155542 Ga0068862_1001555422 249
393 3300005983 Ga0081540_1030601 Ga0081540_10306014 249
394 3300006028 Ga0070717_10533709 Ga0070717_105337092 249
395 3300006038 Ga0075365_10072439 Ga0075365_100724392 249
396 3300006237 Ga0097621_100060405 Ga0097621_1000604053 249
397 3300006358 Ga0068871_100091533 Ga0068871_1000915333 249
398 3300006881 Ga0068865_100169068 Ga0068865_1001690682 249
399 3300006931 Ga0097620_100020274 Ga0097620_1000202744 249
400 3300006948 Ga0099826_10000004 Ga0099826_10000004745 249
401 3300009093 Ga0105240_10249232 Ga0105240_102492323 249
402 3300009094 Ga0111539_10325771 Ga0111539_103257712 249
403 3300009098 Ga0105245_10068732 Ga0105245_100687322 249
404 3300009148 Ga0105243_10045849 Ga0105243_100458494 249
405 3300009148 Ga0105243_10865017 Ga0105243_108650171 249
406 3300009174 Ga0105241_10006171 Ga0105241_100061714 249
407 3300009174 Ga0105241_10178208 Ga0105241_101782082 249
408 3300009176 Ga0105242_10027705 Ga0105242_100277053 249
409 3300009177 Ga0105248_10024204 Ga0105248_100242044 249
410 3300009551 Ga0105238_10056347 Ga0105238_100563474 249
411 3300009551 Ga0105238_10078874 Ga0105238_100788742 249
412 3300009553 Ga0105249_10177035 Ga0105249_101770352 249
413 3300010375 Ga0105239_10222204 Ga0105239_102222042 249
414 3300010375 Ga0105239_10272896 Ga0105239_102728962 249
415 3300010375 Ga0105239_10372217 Ga0105239_103722172 249
416 3300011119 Ga0105246_10005577 Ga0105246_100055779 249
417 3300011119 Ga0105246_10034614 Ga0105246_100346142 249
418 3300011119 Ga0105246_10108859 Ga0105246_101088592 249
419 3300011119 Ga0105246_10340371 Ga0105246_103403712 249
420 3300013102 Ga0157371_10000014 Ga0157371_10000014186 249
421 3300013102 Ga0157371_10080725 Ga0157371_100807252 249
422 3300013105 Ga0157369_10108086 Ga0157369_101080861 249
423 3300013297 Ga0157378_10241750 Ga0157378_102417501 249
424 3300013306 Ga0163162_10038670 Ga0163162_100386702 249
425 3300013306 Ga0163162_10311174 Ga0163162_103111742 249
426 3300013306 Ga0163162_10430789 Ga0163162_104307891 249
427 3300013308 Ga0157375_10025181 Ga0157375_100251813 249
428 3300014497 Ga0182008_10000751 Ga0182008_1000075121 249
429 3300014497 Ga0182008_10114336 Ga0182008_101143362 249
430 3300014968 Ga0157379_10118031 Ga0157379_101180313 249
431 3300014968 Ga0157379_10235210 Ga0157379_102352102 249
432 3300014969 Ga0157376_10009986 Ga0157376_100099863 249
433 3300015261 Ga0182006_1000004 Ga0182006_1000004258 249
434 3300015261 Ga0182006_1015508 Ga0182006_10155082 249
435 3300015261 Ga0182006_1049420 Ga0182006_10494202 249
436 3300015262 Ga0182007_10000018 Ga0182007_10000018113 249
437 3300015262 Ga0182007_10028432 Ga0182007_100284322 249
438 3300015265 Ga0182005_1000011 Ga0182005_1000011123 249
439 3300017792 Ga0163161_10106576 Ga0163161_101065763 249
440 3300017792 Ga0163161_10168137 Ga0163161_101681372 249
441 3300020081 Ga0206354_10132401 Ga0206354_101324012 249
442 3300025226 Ga0209674_100013 Ga0209674_100013292 249
443 3300025226 Ga0209674_100020 Ga0209674_100020147 249
444 3300025228 Ga0209672_100010 Ga0209672_100010337 249
445 3300025228 Ga0209672_100013 Ga0209672_100013261 249
446 3300025228 Ga0209672_100019 Ga0209672_100019377 249
447 3300025228 Ga0209672_100051 Ga0209672_10005176 249
448 3300025228 Ga0209672_100062 Ga0209672_100062119 249
449 3300025229 Ga0209147_100006 Ga0209147_100006337 249
450 3300025229 Ga0209147_100013 Ga0209147_100013137 249
451 3300025229 Ga0209147_100026 Ga0209147_100026377 249
452 3300025229 Ga0209147_100078 Ga0209147_100078119 249
453 3300025229 Ga0209147_100192 Ga0209147_10019223 249
454 3300025229 Ga0209147_100544 Ga0209147_10054413 249
455 3300025230 Ga0209563_100003 Ga0209563_10000327 249
456 3300025230 Ga0209563_100778 Ga0209563_1007784 249
457 3300025231 Ga0207427_100964 Ga0207427_1009643 249
458 3300025233 Ga0209437_100045 Ga0209437_100045132 249
459 3300025233 Ga0209437_100268 Ga0209437_1002682 249
460 3300025242 Ga0209258_100010 Ga0209258_100010337 249
461 3300025242 Ga0209258_100016 Ga0209258_100016261 249
462 3300025242 Ga0209258_100031 Ga0209258_100031420 249
463 3300025242 Ga0209258_100108 Ga0209258_100108119 249
464 3300025242 Ga0209258_100358 Ga0209258_10035816 249
465 3300025253 Ga0209677_105954 Ga0209677_1059542 249
466 3300025254 Ga0209148_1000018 Ga0209148_1000018337 249
467 3300025254 Ga0209148_1000020 Ga0209148_1000020261 249
468 3300025254 Ga0209148_1000027 Ga0209148_1000027420 249
469 3300025254 Ga0209148_1000400 Ga0209148_100040054 249
470 3300025254 Ga0209148_1000720 Ga0209148_100072015 249
471 3300025254 Ga0209148_1001175 Ga0209148_100117515 249
472 3300025254 Ga0209148_1004660 Ga0209148_10046603 249
473 3300025256 Ga0209759_1001703 Ga0209759_10017033 249
474 3300025261 Ga0209233_1000229 Ga0209233_10002292 249
475 3300025261 Ga0209233_1029194 Ga0209233_10291942 249
476 3300025263 Ga0209565_1018257 Ga0209565_10182572 249
477 3300025272 Ga0209455_1000015 Ga0209455_1000015337 249
478 3300025272 Ga0209455_1000017 Ga0209455_1000017261 249
479 3300025272 Ga0209455_1000213 Ga0209455_100021372 249
480 3300025272 Ga0209455_1000487 Ga0209455_100048724 249
481 3300025272 Ga0209455_1000746 Ga0209455_10007465 249
482 3300025273 Ga0209673_1000201 Ga0209673_1000201127 249
483 3300025284 Ga0209130_1006042 Ga0209130_10060424 249
484 3300025284 Ga0209130_1007295 Ga0209130_10072952 249
485 3300025292 Ga0209676_1026771 Ga0209676_10267712 249
486 3300025294 Ga0209025_1015446 Ga0209025_10154462 249
487 3300025295 Ga0209564_1002172 Ga0209564_10021724 249
488 3300025302 Ga0207426_1000004 Ga0207426_1000004523 249
489 3300025302 Ga0207426_1000183 Ga0207426_1000183129 249
490 3300025728 Ga0207655_1104886 Ga0207655_11048862 249
491 3300025735 Ga0207713_1031600 Ga0207713_10316003 249
492 3300025893 Ga0207682_10018139 Ga0207682_100181392 249
493 3300025899 Ga0207642_10054237 Ga0207642_100542372 249
494 3300025901 Ga0207688_10035016 Ga0207688_100350162 249
495 3300025904 Ga0207647_10222908 Ga0207647_102229081 249
496 3300025908 Ga0207643_10028095 Ga0207643_100280952 249
497 3300025908 Ga0207643_10186723 Ga0207643_101867231 249
498 3300025909 Ga0207705_10017544 Ga0207705_100175443 249
499 3300025917 Ga0207660_10064811 Ga0207660_100648111 249
500 3300025921 Ga0207652_10234588 Ga0207652_102345881 249
501 3300025923 Ga0207681_10044185 Ga0207681_100441852 249
502 3300025924 Ga0207694_10080930 Ga0207694_100809301 249
503 3300025924 Ga0207694_10363702 Ga0207694_103637022 249
504 3300025925 Ga0207650_10096308 Ga0207650_100963081 249
505 3300025926 Ga0207659_10130561 Ga0207659_101305611 249
506 3300025927 Ga0207687_10120665 Ga0207687_101206652 249
507 3300025927 Ga0207687_10129196 Ga0207687_101291962 249
508 3300025932 Ga0207690_10026365 Ga0207690_100263654 249
509 3300025933 Ga0207706_10150139 Ga0207706_101501392 249
510 3300025933 Ga0207706_10419113 Ga0207706_104191132 249
511 3300025935 Ga0207709_10110706 Ga0207709_101107062 249
512 3300025937 Ga0207669_10100831 Ga0207669_101008312 249
513 3300025937 Ga0207669_10108046 Ga0207669_101080461 249
514 3300025937 Ga0207669_10268638 Ga0207669_102686381 249
515 3300025938 Ga0207704_10156638 Ga0207704_101566382 249
516 3300025941 Ga0207711_10066035 Ga0207711_100660353 249
517 3300025942 Ga0207689_10001119 Ga0207689_1000111917 249
518 3300025949 Ga0207667_10012486 Ga0207667_1001248611 249
519 3300025949 Ga0207667_10230752 Ga0207667_102307522 249
520 3300025960 Ga0207651_10506303 Ga0207651_105063032 249
521 3300025981 Ga0207640_10688107 Ga0207640_106881071 249
522 3300025986 Ga0207658_10470392 Ga0207658_104703922 249
523 3300026035 Ga0207703_10043722 Ga0207703_100437223 249
524 3300026035 Ga0207703_10083844 Ga0207703_100838441 249
525 3300026041 Ga0207639_10136721 Ga0207639_101367211 249
526 3300026067 Ga0207678_10003650 Ga0207678_100036505 249
527 3300026067 Ga0207678_10225099 Ga0207678_102250992 249
528 3300026075 Ga0207708_10107926 Ga0207708_101079262 249
529 3300026078 Ga0207702_10089672 Ga0207702_100896722 249
530 3300026088 Ga0207641_10036260 Ga0207641_100362602 249
531 3300026089 Ga0207648_10059461 Ga0207648_100594613 249
532 3300026116 Ga0207674_10183930 Ga0207674_101839303 249
533 3300026118 Ga0207675_100218688 Ga0207675_1002186882 249
534 3300026121 Ga0207683_10018574 Ga0207683_100185742 249
535 3300026121 Ga0207683_10026089 Ga0207683_100260894 249
536 3300026142 Ga0207698_10679491 Ga0207698_106794911 249
537 3300027312 Ga0209371_1000202 Ga0209371_100020247 249
538 3300027312 Ga0209371_1005347 Ga0209371_10053472 249
539 3300027666 Ga0209282_1000051 Ga0209282_100005148 249
540 3300027717 Ga0209998_10010151 Ga0209998_100101512 249
541 3300027876 Ga0209974_10007613 Ga0209974_100076132 249
542 3300027876 Ga0209974_10035485 Ga0209974_100354852 249
543 3300028380 Ga0268265_10138774 Ga0268265_101387742 249
544 3300028380 Ga0268265_10164877 Ga0268265_101648771 249
545 3300028794 Ga0307515_10002783 Ga0307515_1000278323 249
546 3300028800 Ga0265338_10000183 Ga0265338_1000018343 249
547 3300030500 Ga0268256_1000189 Ga0268256_100018932 249
548 3300030500 Ga0268256_1005360 Ga0268256_10053605 249
549 3300031238 Ga0265332_10000021 Ga0265332_1000002172 249
550 3300031247 Ga0265340_10069272 Ga0265340_100692722 249
551 3300031344 Ga0265316_10164498 Ga0265316_101644982 249
552 3300031456 Ga0307513_10463293 Ga0307513_104632931 249
553 3300031548 Ga0307408_100000684 Ga0307408_1000006846 249
554 3300031548 Ga0307408_100001704 Ga0307408_10000170414 249
555 3300031649 Ga0307514_10001537 Ga0307514_1000153723 249
556 3300031731 Ga0307405_10016716 Ga0307405_100167163 249
557 3300031824 Ga0307413_10140855 Ga0307413_101408552 249
558 3300031852 Ga0307410_10053272 Ga0307410_100532723 249
559 3300031852 Ga0307410_10082145 Ga0307410_100821452 249
560 3300031901 Ga0307406_10055068 Ga0307406_100550682 249
561 3300031903 Ga0307407_10240447 Ga0307407_102404472 249
562 3300031911 Ga0307412_10010634 Ga0307412_100106346 249
563 3300031995 Ga0307409_100010364 Ga0307409_1000103644 249
564 3300032005 Ga0307411_10176049 Ga0307411_101760492 249
565 3300032005 Ga0307411_10176102 Ga0307411_101761022 249
566 3300035172 Ga0373955_0028453 Ga0373955_0028453_273_1028 249
567 3300037068 Ga0373925_0223826 Ga0373925_0223826_432_1184 249
568 3300037312 Ga0395899_0001326 Ga0395899_0001326_16381_17130 249
569 3300037312 Ga0395899_0037376 Ga0395899_0037376_2611_3360 249
570 3300037312 Ga0395899_0063316 Ga0395899_0063316_470_1219 249
571 3300037418 Ga0395900_0000338 Ga0395900_0000338_59462_60211 249
572 3300037418 Ga0395900_0000389 Ga0395900_0000389_46454_47203 249
573 3300037418 Ga0395900_0013029 Ga0395900_0013029_5497_6252 249
574 3300037418 Ga0395900_0052055 Ga0395900_0052055_1356_2105 249
575 3300037418 Ga0395900_0060971 Ga0395900_0060971_1646_2395 249
576 3300037466 Ga0395898_0000359 Ga0395898_0000359_76869_77618 249
577 3300037466 Ga0395898_0002067 Ga0395898_0002067_1785_2534 249
578 3300037466 Ga0395898_0175303 Ga0395898_0175303_806_1555 249
579 3300037466 Ga0395898_0827868 Ga0395898_0827868_23_778 249
580 3300037471 Ga0395905_0000020 Ga0395905_0000020_306593_307342 249
581 3300037471 Ga0395905_0000029 Ga0395905_0000029_271492_272241 249
582 3300037471 Ga0395905_0000185 Ga0395905_0000185_29527_30276 249
583 3300037471 Ga0395905_0154939 Ga0395905_0154939_787_1536 249
584 3300037471 Ga0395905_0170793 Ga0395905_0170793_1225_1974 249
585 3300037471 Ga0395905_0225637 Ga0395905_0225637_800_1549 249
586 3300037471 Ga0395905_0242416 Ga0395905_0242416_751_1500 249
587 3300038443 Ga0395901_0000011 Ga0395901_0000011_139302_140051 249
588 3300038443 Ga0395901_0000164 Ga0395901_0000164_65421_66170 249
589 3300038443 Ga0395901_0000303 Ga0395901_0000303_50986_51735 249
590 3300038443 Ga0395901_0025396 Ga0395901_0025396_4810_5559 249
591 3300038443 Ga0395901_0074581 Ga0395901_0074581_401_1150 249
592 3300038443 Ga0395901_0087180 Ga0395901_0087180_439_1188 249
593 3300038443 Ga0395901_0563041 Ga0395901_0563041_359_1114 249
594 3300039447 Ga0436361_0892653 Ga0436361_0892653_1541_2290 249
595 3300039447 Ga0436361_0903849 Ga0436361_0903849_719_1468 249
596 3300042005 Ga0439448_0000438 Ga0439448_0000438_5939_6688 249
597 3300042014 Ga0439457_019495 Ga0439457_019495_482_1231 249
598 3300042157 Ga0439458_0011753 Ga0439458_0011753_801_1550 249
599 3300044656 Ga0466969_0054038 Ga0466969_0054038_83_844 249
600 3300044658 Ga0466972_0005944 Ga0466972_0005944_842_1591 249
601 3300044672 Ga0466982_0185859 Ga0466982_0185859_22_771 249
602 3300044683 Ga0466965_0097136 Ga0466965_0097136_272_1021 249
603 3300044684 Ga0466966_0016748 Ga0466966_0016748_2450_3211 249
604 3300044684 Ga0466966_0210626 Ga0466966_0210626_71_820 249
605 3300044684 Ga0466966_0272375 Ga0466966_0272375_95_844 249
606 3300044693 Ga0466961_0053288 Ga0466961_0053288_1803_2564 249
607 3300044693 Ga0466961_0054982 Ga0466961_0054982_881_1630 249
608 3300044694 Ga0466963_0099855 Ga0466963_0099855_1209_1958 249
609 3300044719 Ga0466971_0070805 Ga0466971_0070805_257_1006 249
610 3300044842 Ga0466957_0429396 Ga0466957_0429396_64_813 249
611 3300045049 Ga0466959_0079875 Ga0466959_0079875_237_986 249
612 3300045836 Ga0466958_0169201 Ga0466958_0169201_526_1275 249
613 3300045836 Ga0466958_0176549 Ga0466958_0176549_305_1054 249
614 3300045976 Ga0466967_0089735 Ga0466967_0089735_1728_2477 249
615 3300045976 Ga0466967_0194884 Ga0466967_0194884_199_948 249
616 3300046454 Ga0495592_0168909 Ga0495592_0168909_299_1048 249
617 3300046454 Ga0495592_0201189 Ga0495592_0201189_543_1292 249
618 3300046454 Ga0495592_0267185 Ga0495592_0267185_158_913 249
619 3300046455 Ga0495603_0004638 Ga0495603_0004638_5010_5759 249
620 3300046455 Ga0495603_0067541 Ga0495603_0067541_288_1043 249
621 3300046457 Ga0495590_0000059 Ga0495590_0000059_30844_31593 249
622 3300046457 Ga0495590_0000504 Ga0495590_0000504_604_1353 249
623 3300046457 Ga0495590_0001062 Ga0495590_0001062_10781_11530 249
624 3300046457 Ga0495590_0004283 Ga0495590_0004283_4909_5658 249
625 3300046458 Ga0495591_000440 Ga0495591_000440_904_1653 249
626 3300046459 Ga0495629_0000586 Ga0495629_0000586_22509_23258 249
627 3300046459 Ga0495629_0011507 Ga0495629_0011507_2482_3231 249
628 3300046459 Ga0495629_0043567 Ga0495629_0043567_1918_2667 249
629 3300046460 Ga0495638_0165640 Ga0495638_0165640_159_914 249
630 3300046461 Ga0495641_0048930 Ga0495641_0048930_695_1444 249
631 3300046462 Ga0495651_0188269 Ga0495651_0188269_362_1111 249
632 3300046463 Ga0495653_0001720 Ga0495653_0001720_775_1524 249
633 3300046463 Ga0495653_0005296 Ga0495653_0005296_3559_4308 249
634 3300046471 Ga0495650_0036470 Ga0495650_0036470_52_801 249
635 3300046472 Ga0495580_0000024 Ga0495580_0000024_79235_79984 249
636 3300046472 Ga0495580_0001675 Ga0495580_0001675_12917_13693 249
637 3300046472 Ga0495580_0005138 Ga0495580_0005138_8751_9500 249
638 3300046472 Ga0495580_0008547 Ga0495580_0008547_1553_2302 249
639 3300046472 Ga0495580_0012709 Ga0495580_0012709_2840_3595 249
640 3300046472 Ga0495580_0015089 Ga0495580_0015089_2474_3223 249
641 3300046472 Ga0495580_0429340 Ga0495580_0429340_87_836 249
642 3300046473 Ga0495582_0008966 Ga0495582_0008966_2028_2777 249
643 3300046473 Ga0495582_0149759 Ga0495582_0149759_562_1311 249
644 3300046474 Ga0495605_0000065 Ga0495605_0000065_132254_133003 249
645 3300046474 Ga0495605_0001793 Ga0495605_0001793_1512_2312 249
646 3300046474 Ga0495605_0038037 Ga0495605_0038037_824_1573 249
647 3300046474 Ga0495605_0066530 Ga0495605_0066530_925_1674 249
648 3300046477 Ga0495664_0003059 Ga0495664_0003059_7515_8264 249
649 3300046491 Ga0495584_0002310 Ga0495584_0002310_7764_8513 249
650 3300046491 Ga0495584_0008711 Ga0495584_0008711_2125_2874 249
651 3300046491 Ga0495584_0009170 Ga0495584_0009170_1226_1975 249
652 3300046491 Ga0495584_0047831 Ga0495584_0047831_898_1647 249
653 3300046492 Ga0495585_0006738 Ga0495585_0006738_4596_5345 249
654 3300046492 Ga0495585_0018936 Ga0495585_0018936_363_1112 249
655 3300046499 Ga0495594_0002743 Ga0495594_0002743_2826_3575 249
656 3300046500 Ga0495596_0001024 Ga0495596_0001024_673_1473 249
657 3300046500 Ga0495596_0012813 Ga0495596_0012813_2531_3280 249
658 3300046501 Ga0495607_0007104 Ga0495607_0007104_5603_6352 249
659 3300046501 Ga0495607_0008921 Ga0495607_0008921_3137_3886 249
660 3300046501 Ga0495607_0034745 Ga0495607_0034745_2003_2752 249
661 3300046501 Ga0495607_0052486 Ga0495607_0052486_52_801 249
662 3300046506 Ga0495583_0000450 Ga0495583_0000450_55287_56036 249
663 3300046506 Ga0495583_0000665 Ga0495583_0000665_37097_37846 249
664 3300046506 Ga0495583_0013954 Ga0495583_0013954_1983_2732 249
665 3300046506 Ga0495583_0017061 Ga0495583_0017061_230_979 249
666 3300046506 Ga0495583_0019574 Ga0495583_0019574_292_1041 249
667 3300046507 Ga0495606_0000190 Ga0495606_0000190_34156_34905 249
668 3300046507 Ga0495606_0004747 Ga0495606_0004747_1843_2592 249
669 3300046507 Ga0495606_0048769 Ga0495606_0048769_554_1303 249
670 3300046507 Ga0495606_0058029 Ga0495606_0058029_67_816 249
671 3300046507 Ga0495606_0090799 Ga0495606_0090799_987_1736 249
672 3300046511 Ga0495608_0209599 Ga0495608_0209599_53_802 249
673 3300046512 Ga0495610_0000607 Ga0495610_0000607_29662_30411 249
674 3300046512 Ga0495610_0028967 Ga0495610_0028967_1433_2233 249
675 3300046513 Ga0495616_0001112 Ga0495616_0001112_3891_4640 249
676 3300046513 Ga0495616_0006171 Ga0495616_0006171_2900_3649 249
677 3300046513 Ga0495616_0006327 Ga0495616_0006327_1837_2586 249
678 3300046514 Ga0495618_0003931 Ga0495618_0003931_75_824 249
679 3300046514 Ga0495618_0336674 Ga0495618_0336674_100_849 249
680 3300046516 Ga0495628_0085500 Ga0495628_0085500_145_894 249
681 3300046517 Ga0495630_0005743 Ga0495630_0005743_265_1014 249
682 3300046517 Ga0495630_0013246 Ga0495630_0013246_1318_2067 249
683 3300046517 Ga0495630_0132055 Ga0495630_0132055_828_1604 249
684 3300046517 Ga0495630_0174855 Ga0495630_0174855_235_984 249
685 3300046518 Ga0495631_0005022 Ga0495631_0005022_1236_1985 249
686 3300046519 Ga0495632_0001075 Ga0495632_0001075_19971_20720 249
687 3300046520 Ga0495637_0000011 Ga0495637_0000011_21010_21759 249
688 3300046522 Ga0495643_0016054 Ga0495643_0016054_1773_2522 249
689 3300046523 Ga0495644_0018596 Ga0495644_0018596_61_810 249
690 3300046524 Ga0495648_0005758 Ga0495648_0005758_3834_4583 249
691 3300046524 Ga0495648_0021247 Ga0495648_0021247_2124_2873 249
692 3300046524 Ga0495648_0035535 Ga0495648_0035535_915_1664 249
693 3300046526 Ga0495666_0000911 Ga0495666_0000911_10556_11305 249
694 3300046526 Ga0495666_0006150 Ga0495666_0006150_2533_3282 249
695 3300046526 Ga0495666_0087115 Ga0495666_0087115_217_966 249
696 3300046528 Ga0495642_0000046 Ga0495642_0000046_73496_74245 249
697 3300046528 Ga0495642_0004948 Ga0495642_0004948_2445_3194 249
698 3300046528 Ga0495642_0030765 Ga0495642_0030765_304_1053 249
699 3300046529 Ga0495652_0049156 Ga0495652_0049156_2454_3203 249
700 3300046530 Ga0495654_0017613 Ga0495654_0017613_1573_2322 249
701 3300046530 Ga0495654_0019753 Ga0495654_0019753_2132_2881 249
702 3300046531 Ga0495665_0009989 Ga0495665_0009989_3877_4626 249
703 3300046533 Ga0495640_0042270 Ga0495640_0042270_461_1210 249
704 3300046533 Ga0495640_0135425 Ga0495640_0135425_675_1424 249
705 3300046535 Ga0495586_0001962 Ga0495586_0001962_9696_10445 249
706 3300046535 Ga0495586_0050354 Ga0495586_0050354_25_774 249
707 3300046535 Ga0495586_0326580 Ga0495586_0326580_34_783 249
708 3300046536 Ga0495587_0089918 Ga0495587_0089918_46_801 249
709 3300046538 Ga0495609_0000026 Ga0495609_0000026_168724_169473 249
710 3300046538 Ga0495609_0019476 Ga0495609_0019476_970_1719 249
711 3300046538 Ga0495609_0036418 Ga0495609_0036418_375_1124 249
712 3300046542 Ga0495597_0000153 Ga0495597_0000153_52337_53092 249
713 3300046542 Ga0495597_0008121 Ga0495597_0008121_2531_3280 249
714 3300046542 Ga0495597_0032896 Ga0495597_0032896_463_1212 249
715 3300046543 Ga0495645_0075894 Ga0495645_0075894_1246_1995 249
716 3300046557 Ga0495622_0013822 Ga0495622_0013822_397_1146 249
717 3300046558 Ga0495633_0001276 Ga0495633_0001276_17507_18256 249
718 3300046558 Ga0495633_0030783 Ga0495633_0030783_170_919 249
719 3300046559 Ga0495667_0422429 Ga0495667_0422429_47_796 249
720 3300046616 Ga0495668_0010451 Ga0495668_0010451_4339_5088 249
721 3300046616 Ga0495668_0056118 Ga0495668_0056118_255_1004 249
722 3300046616 Ga0495668_0057908 Ga0495668_0057908_567_1316 249
723 3300046642 Ga0495634_0031557 Ga0495634_0031557_414_1163 249
724 3300046660 Ga0495625_0000656 Ga0495625_0000656_17132_17881 249
725 3300046663 Ga0495635_0002476 Ga0495635_0002476_8303_9052 249
726 3300046663 Ga0495635_0003612 Ga0495635_0003612_9588_10337 249
727 3300046664 Ga0495659_0003566 Ga0495659_0003566_1154_1903 249
728 3300046665 Ga0495661_0000671 Ga0495661_0000671_33392_34153 249
729 3300046665 Ga0495661_0000677 Ga0495661_0000677_29365_30114 249
730 3300046665 Ga0495661_0001935 Ga0495661_0001935_6159_6908 249
731 3300046665 Ga0495661_0005291 Ga0495661_0005291_7771_8520 249
732 3300046665 Ga0495661_0023236 Ga0495661_0023236_3178_3927 249
733 3300046665 Ga0495661_0036748 Ga0495661_0036748_772_1521 249
734 3300046665 Ga0495661_0038791 Ga0495661_0038791_1542_2342 249
735 3300046665 Ga0495661_0060028 Ga0495661_0060028_932_1681 249
736 3300046674 Ga0495588_0000140 Ga0495588_0000140_34171_34920 249
737 3300046674 Ga0495588_0165215 Ga0495588_0165215_381_1130 249
738 3300046678 Ga0495599_0000952 Ga0495599_0000952_15177_15926 249
739 3300046678 Ga0495599_0033553 Ga0495599_0033553_2361_3137 249
740 3300046679 Ga0495623_0142584 Ga0495623_0142584_126_875 249
741 3300046680 Ga0495646_0017763 Ga0495646_0017763_3203_3952 249
742 3300046680 Ga0495646_0101846 Ga0495646_0101846_147_896 249
743 3300046684 Ga0495669_0002519 Ga0495669_0002519_4724_5473 249
744 3300046689 Ga0495613_0001905 Ga0495613_0001905_4159_4908 249
745 3300046690 Ga0495624_0000067 Ga0495624_0000067_19959_20708 249
746 3300046690 Ga0495624_0000416 Ga0495624_0000416_6302_7051 249
747 3300046690 Ga0495624_0002637 Ga0495624_0002637_12459_13235 249
748 3300046690 Ga0495624_0008044 Ga0495624_0008044_3428_4177 249
749 3300046691 Ga0495670_0005745 Ga0495670_0005745_1539_2288 249
750 3300046692 Ga0495671_0014712 Ga0495671_0014712_1716_2465 249
751 3300046692 Ga0495671_0029757 Ga0495671_0029757_683_1483 249
752 3300046694 Ga0495649_0000141 Ga0495649_0000141_6947_7696 249
753 3300046694 Ga0495649_0024049 Ga0495649_0024049_1343_2092 249
754 3300046694 Ga0495649_0029355 Ga0495649_0029355_1706_2455 249
755 3300046694 Ga0495649_0083147 Ga0495649_0083147_688_1437 249
756 3300046794 Ga0495589_0000073 Ga0495589_0000073_6929_7678 249
757 3300046794 Ga0495589_0000142 Ga0495589_0000142_36898_37647 249
758 3300046794 Ga0495589_0010024 Ga0495589_0010024_2460_3209 249
759 3300046810 Ga0495660_0000085 Ga0495660_0000085_67594_68343 249
760 3300046810 Ga0495660_0009633 Ga0495660_0009633_3139_3888 249
761 3300046810 Ga0495660_0047347 Ga0495660_0047347_553_1302 249
762 3300046810 Ga0495660_0062033 Ga0495660_0062033_785_1534 249
763 3300047315 Ga0495581_0036265 Ga0495581_0036265_1742_2491 249
764 3300047315 Ga0495581_0043954 Ga0495581_0043954_1636_2385 249
765 3300047317 Ga0495604_0261726 Ga0495604_0261726_19_768 249
766 3300047317 Ga0495604_0427439 Ga0495604_0427439_64_813 249
767 3300047318 Ga0495636_0001633 Ga0495636_0001633_6770_7519 249
768 3300047318 Ga0495636_0053943 Ga0495636_0053943_326_1075 249
769 3300047319 Ga0495674_0000035 Ga0495674_0000035_20090_20839 249
770 3300047319 Ga0495674_0014141 Ga0495674_0014141_441_1190 249
771 3300047319 Ga0495674_0281415 Ga0495674_0281415_250_999 249
772 3300047320 Ga0495672_0000094 Ga0495672_0000094_142687_143436 249
773 3300047320 Ga0495672_0000623 Ga0495672_0000623_32494_33243 249
774 3300047320 Ga0495672_0000850 Ga0495672_0000850_30878_31627 249
775 3300047320 Ga0495672_0139954 Ga0495672_0139954_80_829 249
776 3300047321 Ga0495676_0034932 Ga0495676_0034932_2709_3458 249
777 3300047321 Ga0495676_0400703 Ga0495676_0400703_27_776 249
778 3300047322 Ga0495680_0001059 Ga0495680_0001059_22038_22787 249
779 3300047322 Ga0495680_0005882 Ga0495680_0005882_10268_11017 249
780 3300047322 Ga0495680_0011225 Ga0495680_0011225_736_1512 249
781 3300047322 Ga0495680_0402999 Ga0495680_0402999_117_866 249
782 3300047323 Ga0495683_0020581 Ga0495683_0020581_106_855 249
783 3300047323 Ga0495683_0036510 Ga0495683_0036510_1222_1977 249
784 3300047323 Ga0495683_0083298 Ga0495683_0083298_442_1191 249
785 3300047443 Ga0495687_000037 Ga0495687_000037_168724_169473 249
786 3300047443 Ga0495687_000069 Ga0495687_000069_83081_83830 249
787 3300047443 Ga0495687_000108 Ga0495687_000108_89768_90517 249
788 3300047443 Ga0495687_001956 Ga0495687_001956_3176_3925 249
789 3300047443 Ga0495687_037638 Ga0495687_037638_62_811 249
790 3300047443 Ga0495687_046273 Ga0495687_046273_132_881 249
791 3300047443 Ga0495687_059524 Ga0495687_059524_819_1568 249
792 3300047445 Ga0495677_0000090 Ga0495677_0000090_45932_46681 249
793 3300047445 Ga0495677_0005679 Ga0495677_0005679_61_810 249
794 3300047446 Ga0495679_001340 Ga0495679_001340_8314_9063 249
795 3300047446 Ga0495679_003010 Ga0495679_003010_4375_5124 249
796 3300047446 Ga0495679_006457 Ga0495679_006457_720_1469 249
797 3300047446 Ga0495679_010100 Ga0495679_010100_2197_2946 249
798 3300047469 Ga0495673_0008568 Ga0495673_0008568_1557_2306 249
799 3300047470 Ga0495681_0010632 Ga0495681_0010632_1911_2660 249
800 3300047472 Ga0495686_0000047 Ga0495686_0000047_170265_171014 249
801 3300047472 Ga0495686_0000142 Ga0495686_0000142_117168_117917 249
802 3300047472 Ga0495686_0000391 Ga0495686_0000391_53326_54075 249
803 3300047673 Ga0495593_0001558 Ga0495593_0001558_12317_13066 249
804 3300047673 Ga0495593_0002189 Ga0495593_0002189_9781_10530 249
805 3300047673 Ga0495593_0031987 Ga0495593_0031987_1239_1988 249
806 3300047673 Ga0495593_0041491 Ga0495593_0041491_88_837 249
807 3300048088 Ga0495602_0026274 Ga0495602_0026274_717_1466 249
808 3300048088 Ga0495602_0065907 Ga0495602_0065907_707_1462 249
809 3300048089 Ga0495614_0003980 Ga0495614_0003980_3428_4177 249
810 3300048089 Ga0495614_0005056 Ga0495614_0005056_5000_5749 249
811 3300048090 Ga0495615_0046895 Ga0495615_0046895_216_965 249
812 3300048091 Ga0495626_0000009 Ga0495626_0000009_170590_171339 249
813 3300048091 Ga0495626_0000078 Ga0495626_0000078_63932_64681 249
814 3300048091 Ga0495626_0012079 Ga0495626_0012079_2105_2854 249
815 3300048091 Ga0495626_0023542 Ga0495626_0023542_489_1238 249
816 3300048091 Ga0495626_0043750 Ga0495626_0043750_914_1663 249
817 3300048091 Ga0495626_0072310 Ga0495626_0072310_39_788 249
818 3300048903 Ga0496100_0000137 Ga0496100_0000137_14159_14908 249
819 3300048904 Ga0496101_0000044 Ga0496101_0000044_146347_147096 249
820 3300048904 Ga0496101_0056581 Ga0496101_0056581_235_984 249
821 3300048905 Ga0496102_0000379 Ga0496102_0000379_44042_44791 249
822 3300048905 Ga0496102_0057144 Ga0496102_0057144_2023_2778 249
823 3300048905 Ga0496102_0109808 Ga0496102_0109808_544_1293 249
824 3300048906 Ga0496103_0000724 Ga0496103_0000724_13760_14509 249
825 3300048906 Ga0496103_0016511 Ga0496103_0016511_1753_2508 249
826 3300048906 Ga0496103_0203257 Ga0496103_0203257_68_823 249
827 3300048907 Ga0496104_0032624 Ga0496104_0032624_3042_3797 249
828 3300048907 Ga0496104_0039574 Ga0496104_0039574_3354_4103 249
829 3300048907 Ga0496104_0132243 Ga0496104_0132243_228_977 249
830 3300048907 Ga0496104_0139177 Ga0496104_0139177_1281_2036 249
831 3300048908 Ga0496105_0103676 Ga0496105_0103676_29_778 249
832 3300048908 Ga0496105_0149946 Ga0496105_0149946_666_1421 249
833 3300048908 Ga0496105_0258395 Ga0496105_0258395_45_800 249
834 3300048908 Ga0496105_0325909 Ga0496105_0325909_244_993 249
835 3300048909 Ga0496106_0007877 Ga0496106_0007877_5020_5775 249
836 3300048910 Ga0496107_0001574 Ga0496107_0001574_7002_7757 249
837 3300048911 Ga0496108_0256131 Ga0496108_0256131_320_1069 249
838 3300048912 Ga0496109_0153086 Ga0496109_0153086_1383_2144 249
839 3300048912 Ga0496109_0498110 Ga0496109_0498110_287_1036 249
840 3300048913 Ga0496110_0045437 Ga0496110_0045437_1811_2560 249
841 3300048914 Ga0496111_0059860 Ga0496111_0059860_344_1093 249
842 3300048915 Ga0496112_0036759 Ga0496112_0036759_3488_4249 249
843 3300048915 Ga0496112_0251321 Ga0496112_0251321_490_1239 249
844 3300048916 Ga0496113_0021275 Ga0496113_0021275_3305_4054 249
845 3300048917 Ga0496114_0100760 Ga0496114_0100760_253_1008 249
846 3300048918 Ga0496115_0033370 Ga0496115_0033370_2957_3712 249
847 3300048919 Ga0496116_0016282 Ga0496116_0016282_1855_2655 249
848 3300048919 Ga0496116_0116906 Ga0496116_0116906_60_809 249
849 3300048920 Ga0496117_0000011 Ga0496117_0000011_304932_305681 249
850 3300048920 Ga0496117_0000098 Ga0496117_0000098_181383_182132 249
851 3300048921 Ga0496118_0000010 Ga0496118_0000010_305250_305999 249
852 3300048921 Ga0496118_0000533 Ga0496118_0000533_47690_48439 249
853 3300048924 Ga0496121_0024039 Ga0496121_0024039_4454_5203 249
854 3300048924 Ga0496121_0057644 Ga0496121_0057644_2300_3049 249
855 3300048925 Ga0496122_0001169 Ga0496122_0001169_2505_3254 249
856 3300048925 Ga0496122_0020283 Ga0496122_0020283_3290_4039 249
857 3300048925 Ga0496122_0105884 Ga0496122_0105884_240_989 249
858 3300048926 Ga0496123_0015008 Ga0496123_0015008_2558_3307 249
859 3300048926 Ga0496123_0058934 Ga0496123_0058934_1719_2468 249
860 3300048927 Ga0496124_0009714 Ga0496124_0009714_7861_8610 249
861 3300048928 Ga0496125_0031788 Ga0496125_0031788_1407_2156 249
862 3300048928 Ga0496125_0122587 Ga0496125_0122587_321_1070 249
863 3300048928 Ga0496125_0135960 Ga0496125_0135960_263_1012 249
864 3300048929 Ga0496126_0001889 Ga0496126_0001889_28141_28890 249
865 3300048929 Ga0496126_0183991 Ga0496126_0183991_799_1548 249
866 3300048986 Ga0466983_0231750 Ga0466983_0231750_231_980 249
867 3300049128 Ga0501308_000122 Ga0501308_000122_2263_3012 249
868 3300049160 Ga0501304_000093 Ga0501304_000093_819_1568 249
869 3300049459 Ga0495678_003893 Ga0495678_003893_5249_5998 249
870 3300049460 Ga0495682_0042276 Ga0495682_0042276_635_1384 249
871 3300049571 Ga0501034_0000166 Ga0501034_0000166_21610_22365 249
872 3300049571 Ga0501034_0036607 Ga0501034_0036607_1351_2238 249
873 3300049574 Ga0501038_0066359 Ga0501038_0066359_1069_1824 249
874 3300049575 Ga0501039_0000452 Ga0501039_0000452_21888_22643 249
875 3300049580 Ga0501046_0000224 Ga0501046_0000224_11415_12170 249
876 3300049580 Ga0501046_0001372 Ga0501046_0001372_21677_22432 249
877 3300049580 Ga0501046_0040933 Ga0501046_0040933_2155_3042 249
878 3300049581 Ga0501047_0000283 Ga0501047_0000283_21675_22430 249
879 3300049581 Ga0501047_0120837 Ga0501047_0120837_990_1877 249
880 3300049581 Ga0501047_0254397 Ga0501047_0254397_14_769 249
881 3300049582 Ga0501048_0000649 Ga0501048_0000649_14971_15726 249
882 3300049583 Ga0501067_0007840 Ga0501067_0007840_2955_3710 249
883 3300049584 Ga0501068_0001931 Ga0501068_0001931_2401_3150 249
884 3300049586 Ga0501070_0018569 Ga0501070_0018569_3484_4233 249
885 3300049589 Ga0501073_0001305 Ga0501073_0001305_6658_7407 249
886 3300049589 Ga0501073_0072285 Ga0501073_0072285_14_769 249
887 3300049742 Ga0501080_0000315 Ga0501080_0000315_21738_22493 249
888 3300049742 Ga0501080_0034087 Ga0501080_0034087_3757_4506 249
889 3300049822 Ga0501035_0000084 Ga0501035_0000084_15293_16048 249
890 3300049822 Ga0501035_0003361 Ga0501035_0003361_611_1360 249
891 3300049822 Ga0501035_0034636 Ga0501035_0034636_1148_1903 249
892 3300049823 Ga0501044_0000073 Ga0501044_0000073_100143_100898 249
893 3300049824 Ga0501045_0050371 Ga0501045_0050371_996_1751 249
894 3300050492 nmdc:mga0yw44_205689_c1 nmdc:mga0yw44_205689_c1_250_1005 249
895 3300050511 nmdc:mga08y16_580379_c1 nmdc:mga08y16_580379_c1_285_1034 249
896 3300053078 Ga0495612_0057056 Ga0495612_0057056_501_1256 249
897 3300053084 Ga0495595_0040639 Ga0495595_0040639_256_1011 249
898 3300053085 Ga0495619_0237275 Ga0495619_0237275_318_1073 249
899 3300053085 Ga0495619_0290824 Ga0495619_0290824_188_1030 249
900 3300059492 Ga0587073_0051204 Ga0587073_0051204_100_849 249
901 3300059493 Ga0587077_008846 Ga0587077_008846_481_1230 249
902 3300059503 Ga0587080_004252 Ga0587080_004252_162_911 249
903 3300059605 Ga0587106_004319 Ga0587106_004319_570_1319 249
904 3300059605 Ga0587106_005514 Ga0587106_005514_230_979 249
905 3300059607 Ga0587125_001661 Ga0587125_001661_60_809 249
906 3300059640 Ga0587067_008240 Ga0587067_008240_416_1165 249
907 3300059641 Ga0587068_005304 Ga0587068_005304_166_915 249
908 3300059642 Ga0587069_004560 Ga0587069_004560_87_836 249
909 3300059647 Ga0587079_003676 Ga0587079_003676_823_1572 249
910 3300060346 Ga0587111_0024871 Ga0587111_0024871_407_1156 249
911 3300060353 Ga0501082_0062612 Ga0501082_0062612_1702_2451 249
912 iso_pu_bacteria 2510917013 2511094225 249
913 iso_pu_bacteria 2510917013 2511094284 249
914 iso_pu_bacteria 2981990288 2981995540 249
915 iso_pu_bacteria 641736154 642420701 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

69

253

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9716 1 224
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9507 1 224
1efp-assembly2.cif.gz_D electron transfer flavoprotein (etf) from paracoccus denitrificans 0.9312 1 242
2a1t-assembly1.cif.gz_S structure of the human mcad:etf e165betaa complex 0.9283 2 242
2a1u-assembly1.cif.gz_B crystal structure of the human etf e165betaa mutant 0.9281 1 248
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9716 1 224 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9507 1 224 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9369 2 248 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.926 2 248 3.40.50.620
af_A4I154_9_258_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9253 1 249 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2T0QHW5-F1-model_v4 Electron transfer flavoprotein beta subunit 0.9991 1 86 GO:0009055
AF-A0A3D5N4G0-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9978 1 100 GO:0009055
AF-A0A4S8F3U0-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9975 2 116 GO:0009055
AF-A0A2N7TSA7-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9965 1 91 GO:0009055
AF-A0A1H2PLR8-F1-model_v4 Electron transfer flavoprotein beta subunit 0.9964 1 113 GO:0009055

Feature Viewer

pLDDT pTM Quality
92.24 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map