F485644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 917 | 483 | 1832 | 422 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0143841|Ga0436365_0143841_37_1512 |
| Length | 491 |
| Sequence | MSEPTGTRPFSRFEWMLSLRYLGARRKDGFISVIAIFSFIGIWLGVMTLIIVMAVMNGFRQELLTKILGLNGHLLIQPLEQPLTDFAAVADRISKVPGVKLAAPVVEGQALASSPFSSSGVLVRGWRGSDLAKLPSIADNLRQGTLEGFDEGQGVLIGRRLADQLTVHAGEPVTLVAPRGAVTPMGTMPRIKTYKVAGVFEIGMSEYDLGFVFMPLPEAQAYFNRAGDVTAIEVYVDNPDQIDFYRKAITDAAGRPIFIVDWRQRNATFFSALQVERNVMFLILTLIVLVAVLNIVSGLIMLVKDKGPDIGIMRTMGASQGSVMRIFLIDWRQRNRTFFGALQVERNVMFLILTLILVVAALNIISGLIMLVKDKGHDIAILRTMGATQGAVMRVFLIAGSSIGVLGTVAGFILGLLICMNVESIRQFLSWATGSHIFPEELYFLSHLPAEMDPAETIAVVVMALTLSFLATLYPSWRAARLDPVEALRYE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 118 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 119 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 120 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 121 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 122 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 123 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 126 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 332 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 369 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 372 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 388 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 390 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 391 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 393 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 394 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 395 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 397 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 398 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 399 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 400 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 401 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 402 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 404 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 405 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 406 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 408 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 412 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 413 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 414 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 415 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 416 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 417 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 418 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 419 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 420 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 421 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 422 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 423 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 424 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 425 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 426 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 427 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 428 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 429 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 430 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 431 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 432 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 433 | 2791355199 | |||
| 434 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 435 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 436 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 437 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 438 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 439 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 440 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 441 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 442 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 443 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 444 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 445 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 446 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 447 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 448 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 449 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 450 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 451 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 452 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 453 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 454 | 2904699407 | |||
| 455 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 456 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 457 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 458 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 459 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 460 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 461 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 462 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 463 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 464 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 465 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 466 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 467 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 468 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 469 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 470 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 471 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 472 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 473 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 474 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 475 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 476 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 477 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 478 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 479 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 480 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 481 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 482 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 483 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.02 |
| Metatranscriptomes | 0.11 |
| Isolates | 7.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.29 |
| Nodule | 4.36 |
| Rhizoplane | 4.25 |
| Rhizosphere | 74.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436365_0143841 | 3300039437 | Bacteria | 1853 |
| 2 | JGI24746J21847_1009646 | 3300001977 | Bacteria | 1439 |
| 3 | JGI24743J22301_10001131 | 3300001991 | Bacteria | 3577 |
| 4 | JGI24748J21848_1000838 | 3300002074 | Bacteria | 3324 |
| 5 | JGI24744J21845_10000785 | 3300002077 | Bacteria | 5947 |
| 6 | JGI25156J39149_1003138 | 3300002705 | Bacteria | 5562 |
| 7 | JGI25406J46586_10005795 | 3300003203 | Bacteria | 5713 |
| 8 | JGI25165J46597_1000003 | 3300003214 | Bacteria | 694080 |
| 9 | rootH2_10023059 | 3300003320 | Bacteria | 2926 |
| 10 | rootL2_10059231 | 3300003322 | Bacteria | 6339 |
| 11 | JGI25405J52794_10009494 | 3300003911 | Bacteria | 1838 |
| 12 | Ga0065165_1014273 | 3300005262 | Bacteria | 3094 |
| 13 | Ga0070658_10000351 | 3300005327 | Bacteria | 39857 |
| 14 | Ga0070658_10008885 | 3300005327 | Bacteria | 8076 |
| 15 | Ga0070658_10175010 | 3300005327 | Bacteria | 1804 |
| 16 | Ga0070676_10067725 | 3300005328 | Bacteria | 2135 |
| 17 | Ga0070683_100177210 | 3300005329 | Bacteria | 2024 |
| 18 | Ga0070690_100065156 | 3300005330 | Bacteria | 2355 |
| 19 | Ga0070670_100032008 | 3300005331 | Bacteria | 4529 |
| 20 | Ga0068869_100020011 | 3300005334 | Bacteria | 4584 |
| 21 | Ga0068869_100226981 | 3300005334 | Bacteria | 1482 |
| 22 | Ga0070680_100100240 | 3300005336 | Bacteria | 2404 |
| 23 | Ga0068868_100059313 | 3300005338 | Bacteria | 3027 |
| 24 | Ga0070660_100017700 | 3300005339 | Bacteria | 5196 |
| 25 | Ga0070660_100023813 | 3300005339 | Bacteria | 4538 |
| 26 | Ga0070660_100054928 | 3300005339 | Bacteria | 3076 |
| 27 | Ga0070691_10000026 | 3300005341 | Bacteria | 40701 |
| 28 | Ga0070687_100073037 | 3300005343 | Bacteria | 1848 |
| 29 | Ga0070661_100001119 | 3300005344 | Bacteria | 18814 |
| 30 | Ga0070692_10014598 | 3300005345 | Bacteria | 3695 |
| 31 | Ga0070669_100033359 | 3300005353 | Bacteria | 3723 |
| 32 | Ga0070675_100041650 | 3300005354 | Bacteria | 3751 |
| 33 | Ga0070671_100002638 | 3300005355 | Bacteria | 13889 |
| 34 | Ga0070671_100070267 | 3300005355 | Bacteria | 2921 |
| 35 | Ga0070674_100010253 | 3300005356 | Bacteria | 5655 |
| 36 | Ga0070659_100043240 | 3300005366 | Bacteria | 3523 |
| 37 | Ga0070703_10032672 | 3300005406 | Bacteria | 1582 |
| 38 | Ga0070709_10000310 | 3300005434 | Bacteria | 30908 |
| 39 | Ga0070709_10000739 | 3300005434 | Bacteria | 18465 |
| 40 | Ga0070709_10008569 | 3300005434 | Bacteria | 5620 |
| 41 | Ga0070709_10040728 | 3300005434 | Bacteria | 2858 |
| 42 | Ga0070714_100001250 | 3300005435 | Bacteria | 18349 |
| 43 | Ga0070714_100012169 | 3300005435 | Bacteria | 6857 |
| 44 | Ga0070713_100000008 | 3300005436 | Bacteria | 160153 |
| 45 | Ga0070713_100000522 | 3300005436 | Bacteria | 24346 |
| 46 | Ga0070713_100024863 | 3300005436 | Bacteria | 4674 |
| 47 | Ga0070713_100127594 | 3300005436 | Bacteria | 2240 |
| 48 | Ga0070713_100264608 | 3300005436 | Bacteria | 1572 |
| 49 | Ga0070710_10000543 | 3300005437 | Bacteria | 17852 |
| 50 | Ga0070710_10002534 | 3300005437 | Bacteria | 8671 |
| 51 | Ga0070711_100001947 | 3300005439 | Bacteria | 11576 |
| 52 | Ga0070711_100002225 | 3300005439 | Bacteria | 11000 |
| 53 | Ga0070705_100009562 | 3300005440 | Bacteria | 4825 |
| 54 | Ga0070694_100137370 | 3300005444 | Bacteria | 1772 |
| 55 | Ga0070663_100017486 | 3300005455 | Bacteria | 4681 |
| 56 | Ga0070663_100037815 | 3300005455 | Bacteria | 3362 |
| 57 | Ga0070699_100035800 | 3300005518 | Bacteria | 4292 |
| 58 | Ga0070679_100093559 | 3300005530 | Bacteria | 2993 |
| 59 | Ga0070684_100158634 | 3300005535 | Bacteria | 2051 |
| 60 | Ga0068853_100005373 | 3300005539 | Bacteria | 10031 |
| 61 | Ga0068853_100006184 | 3300005539 | Bacteria | 9480 |
| 62 | Ga0068853_100015125 | 3300005539 | Bacteria | 6344 |
| 63 | Ga0068853_100080394 | 3300005539 | Bacteria | 2852 |
| 64 | Ga0068853_100127873 | 3300005539 | Bacteria | 2271 |
| 65 | Ga0070686_100006493 | 3300005544 | Bacteria | 6503 |
| 66 | Ga0070665_100000377 | 3300005548 | Bacteria | 66234 |
| 67 | Ga0070665_100012096 | 3300005548 | Bacteria | 8707 |
| 68 | Ga0070665_100034898 | 3300005548 | Bacteria | 5060 |
| 69 | Ga0070665_100065580 | 3300005548 | Bacteria | 3642 |
| 70 | Ga0070665_100103296 | 3300005548 | Bacteria | 2853 |
| 71 | Ga0068855_100013342 | 3300005563 | Bacteria | 9911 |
| 72 | Ga0068855_100031633 | 3300005563 | Bacteria | 6318 |
| 73 | Ga0068855_100142420 | 3300005563 | Bacteria | 2731 |
| 74 | Ga0070664_100018970 | 3300005564 | Bacteria | 5655 |
| 75 | Ga0070664_100156385 | 3300005564 | Bacteria | 2014 |
| 76 | Ga0068857_100026875 | 3300005577 | Bacteria | 5075 |
| 77 | Ga0068857_100069357 | 3300005577 | Bacteria | 3139 |
| 78 | Ga0068854_100005459 | 3300005578 | Bacteria | 8031 |
| 79 | Ga0068854_100088901 | 3300005578 | Bacteria | 2295 |
| 80 | Ga0068856_100000362 | 3300005614 | Bacteria | 49802 |
| 81 | Ga0068856_100000870 | 3300005614 | Bacteria | 32355 |
| 82 | Ga0068856_100076616 | 3300005614 | Bacteria | 3313 |
| 83 | Ga0070702_100047408 | 3300005615 | Bacteria | 2440 |
| 84 | Ga0068852_100000075 | 3300005616 | Bacteria | 69379 |
| 85 | Ga0068852_100023190 | 3300005616 | Bacteria | 4990 |
| 86 | Ga0068852_100025004 | 3300005616 | Bacteria | 4833 |
| 87 | Ga0068852_100032917 | 3300005616 | Bacteria | 4298 |
| 88 | Ga0068852_100038546 | 3300005616 | Bacteria | 4017 |
| 89 | Ga0068859_100149326 | 3300005617 | Bacteria | 2413 |
| 90 | Ga0068864_100002778 | 3300005618 | Bacteria | 14462 |
| 91 | Ga0068861_100047107 | 3300005719 | Bacteria | 3253 |
| 92 | Ga0068851_10040291 | 3300005834 | Bacteria | 2348 |
| 93 | Ga0068870_10001735 | 3300005840 | Bacteria | 8925 |
| 94 | Ga0068863_100001004 | 3300005841 | Bacteria | 28270 |
| 95 | Ga0068860_100000258 | 3300005843 | Bacteria | 77761 |
| 96 | Ga0068860_100019841 | 3300005843 | Bacteria | 6519 |
| 97 | Ga0068862_100040727 | 3300005844 | Bacteria | 3949 |
| 98 | Ga0081455_10002974 | 3300005937 | Bacteria | 19816 |
| 99 | Ga0081455_10007544 | 3300005937 | Bacteria | 11439 |
| 100 | Ga0081455_10009585 | 3300005937 | Bacteria | 9946 |
| 101 | Ga0081455_10010629 | 3300005937 | Bacteria | 9315 |
| 102 | Ga0081455_10010846 | 3300005937 | Bacteria | 9202 |
| 103 | Ga0081455_10030415 | 3300005937 | Bacteria | 4904 |
| 104 | Ga0081455_10047855 | 3300005937 | Bacteria | 3699 |
| 105 | Ga0081455_10117456 | 3300005937 | Bacteria | 2102 |
| 106 | Ga0081538_10013903 | 3300005981 | Bacteria | 6342 |
| 107 | Ga0081538_10040597 | 3300005981 | Bacteria | 2965 |
| 108 | Ga0081540_1000194 | 3300005983 | Bacteria | 62934 |
| 109 | Ga0081540_1001759 | 3300005983 | Bacteria | 18225 |
| 110 | Ga0081540_1001861 | 3300005983 | Bacteria | 17661 |
| 111 | Ga0081540_1004924 | 3300005983 | Bacteria | 10056 |
| 112 | Ga0081540_1014066 | 3300005983 | Bacteria | 5156 |
| 113 | Ga0081540_1034596 | 3300005983 | Bacteria | 2721 |
| 114 | Ga0081539_10034606 | 3300005985 | Bacteria | 3051 |
| 115 | Ga0070717_10000447 | 3300006028 | Bacteria | 26109 |
| 116 | Ga0070717_10103218 | 3300006028 | Bacteria | 2424 |
| 117 | Ga0075365_10053925 | 3300006038 | Bacteria | 2665 |
| 118 | Ga0075365_10080968 | 3300006038 | Bacteria | 2199 |
| 119 | Ga0075365_10163517 | 3300006038 | Bacteria | 1552 |
| 120 | Ga0075365_10166393 | 3300006038 | Bacteria | 1538 |
| 121 | Ga0075363_100000277 | 3300006048 | Bacteria | 14859 |
| 122 | Ga0075364_10023673 | 3300006051 | Bacteria | 3890 |
| 123 | Ga0075364_10077019 | 3300006051 | Bacteria | 2201 |
| 124 | Ga0075432_10000765 | 3300006058 | Bacteria | 9994 |
| 125 | Ga0070715_10001232 | 3300006163 | Bacteria | 7364 |
| 126 | Ga0070716_100015222 | 3300006173 | Bacteria | 3948 |
| 127 | Ga0070712_100000435 | 3300006175 | Bacteria | 23865 |
| 128 | Ga0070712_100009926 | 3300006175 | Bacteria | 6002 |
| 129 | Ga0070712_100013554 | 3300006175 | Bacteria | 5212 |
| 130 | Ga0070712_100031189 | 3300006175 | Bacteria | 3589 |
| 131 | Ga0070712_100069673 | 3300006175 | Bacteria | 2510 |
| 132 | Ga0070712_100097845 | 3300006175 | Bacteria | 2163 |
| 133 | Ga0075362_10003250 | 3300006177 | Bacteria | 5642 |
| 134 | Ga0075362_10017502 | 3300006177 | Bacteria | 2953 |
| 135 | Ga0075362_10033274 | 3300006177 | Bacteria | 2242 |
| 136 | Ga0075362_10047352 | 3300006177 | Bacteria | 1915 |
| 137 | Ga0075362_10071535 | 3300006177 | Bacteria | 1585 |
| 138 | Ga0075367_10003094 | 3300006178 | Bacteria | 7816 |
| 139 | Ga0075367_10003260 | 3300006178 | Bacteria | 7679 |
| 140 | Ga0075369_10009418 | 3300006186 | Bacteria | 3793 |
| 141 | Ga0075427_10000083 | 3300006194 | Bacteria | 7551 |
| 142 | Ga0075366_10085159 | 3300006195 | Bacteria | 1890 |
| 143 | Ga0075370_10002012 | 3300006353 | Bacteria | 9214 |
| 144 | Ga0075370_10027740 | 3300006353 | Bacteria | 3144 |
| 145 | Ga0068871_100013243 | 3300006358 | Bacteria | 6116 |
| 146 | Ga0075428_100013683 | 3300006844 | Bacteria | 9033 |
| 147 | Ga0075428_100016545 | 3300006844 | Bacteria | 8143 |
| 148 | Ga0075428_100043912 | 3300006844 | Bacteria | 4913 |
| 149 | Ga0075428_100061386 | 3300006844 | Bacteria | 4116 |
| 150 | Ga0075430_100000026 | 3300006846 | Bacteria | 78833 |
| 151 | Ga0075430_100120227 | 3300006846 | Bacteria | 2190 |
| 152 | Ga0075431_100000451 | 3300006847 | Bacteria | 33773 |
| 153 | Ga0075431_100001409 | 3300006847 | Bacteria | 22063 |
| 154 | Ga0075431_100019078 | 3300006847 | Bacteria | 6986 |
| 155 | Ga0075431_100168458 | 3300006847 | Bacteria | 2251 |
| 156 | Ga0075431_100204815 | 3300006847 | Bacteria | 2017 |
| 157 | Ga0075433_10002991 | 3300006852 | Bacteria | 12983 |
| 158 | Ga0075434_100000110 | 3300006871 | Bacteria | 46873 |
| 159 | Ga0075429_100000247 | 3300006880 | Bacteria | 37266 |
| 160 | Ga0075429_100009412 | 3300006880 | Bacteria | 8482 |
| 161 | Ga0068865_100005919 | 3300006881 | Bacteria | 7440 |
| 162 | Ga0068865_100006113 | 3300006881 | Bacteria | 7342 |
| 163 | Ga0075436_100000099 | 3300006914 | Bacteria | 51125 |
| 164 | Ga0075435_100155992 | 3300007076 | Bacteria | 1921 |
| 165 | Ga0099794_10003348 | 3300007265 | Bacteria | 6099 |
| 166 | Ga0099794_10003823 | 3300007265 | Bacteria | 5816 |
| 167 | Ga0099795_10020770 | 3300007788 | Bacteria | 2144 |
| 168 | Ga0105251_10024950 | 3300009011 | Bacteria | 3064 |
| 169 | Ga0105250_10027657 | 3300009092 | Bacteria | 2286 |
| 170 | Ga0105240_10002582 | 3300009093 | Bacteria | 29015 |
| 171 | Ga0105240_10013140 | 3300009093 | Bacteria | 11392 |
| 172 | Ga0105240_10049609 | 3300009093 | Bacteria | 5297 |
| 173 | Ga0105240_10080254 | 3300009093 | Bacteria | 4013 |
| 174 | Ga0105240_10176069 | 3300009093 | Bacteria | 2529 |
| 175 | Ga0111539_10011184 | 3300009094 | Bacteria | 11279 |
| 176 | Ga0111539_10115103 | 3300009094 | Bacteria | 3154 |
| 177 | Ga0105245_10018686 | 3300009098 | Bacteria | 6064 |
| 178 | Ga0105245_10060256 | 3300009098 | Bacteria | 3418 |
| 179 | Ga0105245_10092135 | 3300009098 | Bacteria | 2791 |
| 180 | Ga0105247_10014924 | 3300009101 | Bacteria | 4656 |
| 181 | Ga0105247_10016598 | 3300009101 | Bacteria | 4415 |
| 182 | Ga0105247_10081824 | 3300009101 | Bacteria | 2037 |
| 183 | Ga0114129_10004371 | 3300009147 | Bacteria | 19940 |
| 184 | Ga0114129_10008830 | 3300009147 | Bacteria | 14378 |
| 185 | Ga0114129_10016344 | 3300009147 | Bacteria | 10565 |
| 186 | Ga0114129_10063995 | 3300009147 | Bacteria | 5133 |
| 187 | Ga0114129_10385561 | 3300009147 | Bacteria | 1850 |
| 188 | Ga0105243_10015059 | 3300009148 | Bacteria | 5853 |
| 189 | Ga0105241_10040753 | 3300009174 | Bacteria | 3506 |
| 190 | Ga0105241_10158401 | 3300009174 | Bacteria | 1859 |
| 191 | Ga0105241_10255250 | 3300009174 | Bacteria | 1488 |
| 192 | Ga0105237_10000821 | 3300009545 | Bacteria | 42486 |
| 193 | Ga0105237_10015554 | 3300009545 | Bacteria | 7914 |
| 194 | Ga0105237_10103646 | 3300009545 | Bacteria | 2837 |
| 195 | Ga0105237_10351600 | 3300009545 | Bacteria | 1478 |
| 196 | Ga0105238_10041357 | 3300009551 | Bacteria | 4668 |
| 197 | Ga0105238_10087423 | 3300009551 | Bacteria | 3104 |
| 198 | Ga0105238_10204252 | 3300009551 | Bacteria | 1952 |
| 199 | Ga0105238_10215860 | 3300009551 | Bacteria | 1894 |
| 200 | Ga0105238_10267093 | 3300009551 | Bacteria | 1691 |
| 201 | Ga0099796_10008753 | 3300010159 | Bacteria | 2709 |
| 202 | Ga0099796_10030027 | 3300010159 | Bacteria | 1759 |
| 203 | Ga0105239_10073728 | 3300010375 | Bacteria | 3753 |
| 204 | Ga0105239_10122337 | 3300010375 | Bacteria | 2891 |
| 205 | Ga0105239_10150135 | 3300010375 | Bacteria | 2600 |
| 206 | Ga0105239_10178740 | 3300010375 | Bacteria | 2374 |
| 207 | Ga0105246_10014170 | 3300011119 | Bacteria | 5010 |
| 208 | Ga0105246_10248344 | 3300011119 | Bacteria | 1411 |
| 209 | Ga0157373_10153941 | 3300013100 | Bacteria | 1618 |
| 210 | Ga0157371_10017806 | 3300013102 | Bacteria | 5268 |
| 211 | Ga0157370_10015443 | 3300013104 | Bacteria | 7762 |
| 212 | Ga0157370_10187418 | 3300013104 | Bacteria | 1920 |
| 213 | Ga0157370_10247322 | 3300013104 | Bacteria | 1650 |
| 214 | Ga0157370_10315583 | 3300013104 | Bacteria | 1442 |
| 215 | Ga0157369_10022874 | 3300013105 | Bacteria | 6970 |
| 216 | Ga0157378_10153594 | 3300013297 | Bacteria | 2146 |
| 217 | Ga0157378_10231739 | 3300013297 | Bacteria | 1760 |
| 218 | Ga0157372_10307561 | 3300013307 | Bacteria | 1844 |
| 219 | Ga0157375_10349374 | 3300013308 | Bacteria | 1645 |
| 220 | Ga0163163_10000491 | 3300014325 | Bacteria | 35805 |
| 221 | Ga0163163_10034357 | 3300014325 | Bacteria | 4909 |
| 222 | Ga0157380_10010728 | 3300014326 | Bacteria | 6602 |
| 223 | Ga0157377_10014115 | 3300014745 | Bacteria | 4059 |
| 224 | Ga0157379_10002383 | 3300014968 | Bacteria | 15713 |
| 225 | Ga0157376_10192907 | 3300014969 | Bacteria | 1869 |
| 226 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 227 | Ga0214544_1017682 | 3300021320 | Bacteria | 6272 |
| 228 | Ga0214542_1018937 | 3300021321 | Bacteria | 5631 |
| 229 | Ga0214545_1018591 | 3300021324 | Bacteria | 6270 |
| 230 | Ga0214543_1017937 | 3300021327 | Bacteria | 6717 |
| 231 | Ga0213873_10014678 | 3300021358 | Bacteria | 1740 |
| 232 | Ga0213872_10015829 | 3300021361 | Bacteria | 3504 |
| 233 | Ga0213876_10000908 | 3300021384 | Bacteria | 19682 |
| 234 | Ga0213871_10003652 | 3300021441 | Bacteria | 2994 |
| 235 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 236 | Ga0209233_1000408 | 3300025261 | Bacteria | 34052 |
| 237 | Ga0209455_1002034 | 3300025272 | Bacteria | 8225 |
| 238 | Ga0209564_1000943 | 3300025295 | Bacteria | 37519 |
| 239 | Ga0209758_1000808 | 3300025297 | Bacteria | 44084 |
| 240 | Ga0209758_1001790 | 3300025297 | Bacteria | 23719 |
| 241 | Ga0209758_1001948 | 3300025297 | Bacteria | 22345 |
| 242 | Ga0209758_1008526 | 3300025297 | Bacteria | 6609 |
| 243 | Ga0209256_1005139 | 3300025299 | Bacteria | 7734 |
| 244 | Ga0207426_1003018 | 3300025302 | Bacteria | 9757 |
| 245 | Ga0207653_10028725 | 3300025885 | Bacteria | 1790 |
| 246 | Ga0207682_10001151 | 3300025893 | Bacteria | 12259 |
| 247 | Ga0207692_10006382 | 3300025898 | Bacteria | 4781 |
| 248 | Ga0207692_10020782 | 3300025898 | Bacteria | 2993 |
| 249 | Ga0207710_10019075 | 3300025900 | Bacteria | 2924 |
| 250 | Ga0207680_10085364 | 3300025903 | Bacteria | 1994 |
| 251 | Ga0207685_10009223 | 3300025905 | Bacteria | 2856 |
| 252 | Ga0207699_10000140 | 3300025906 | Bacteria | 48523 |
| 253 | Ga0207699_10013924 | 3300025906 | Bacteria | 4131 |
| 254 | Ga0207645_10014613 | 3300025907 | Bacteria | 5247 |
| 255 | Ga0207643_10000431 | 3300025908 | Bacteria | 27730 |
| 256 | Ga0207705_10000075 | 3300025909 | Bacteria | 123551 |
| 257 | Ga0207705_10015279 | 3300025909 | Bacteria | 5512 |
| 258 | Ga0207705_10016993 | 3300025909 | Bacteria | 5211 |
| 259 | Ga0207654_10098316 | 3300025911 | Bacteria | 1798 |
| 260 | Ga0207654_10115582 | 3300025911 | Bacteria | 1676 |
| 261 | Ga0207695_10041879 | 3300025913 | Bacteria | 4898 |
| 262 | Ga0207695_10106086 | 3300025913 | Bacteria | 2796 |
| 263 | Ga0207695_10114018 | 3300025913 | Bacteria | 2679 |
| 264 | Ga0207695_10136440 | 3300025913 | Bacteria | 2406 |
| 265 | Ga0207695_10353832 | 3300025913 | Bacteria | 1355 |
| 266 | Ga0207671_10000227 | 3300025914 | Bacteria | 84794 |
| 267 | Ga0207671_10018286 | 3300025914 | Bacteria | 5380 |
| 268 | Ga0207671_10198089 | 3300025914 | Bacteria | 1568 |
| 269 | Ga0207693_10001130 | 3300025915 | Bacteria | 23920 |
| 270 | Ga0207693_10003998 | 3300025915 | Bacteria | 12535 |
| 271 | Ga0207693_10006061 | 3300025915 | Bacteria | 10015 |
| 272 | Ga0207693_10010291 | 3300025915 | Bacteria | 7591 |
| 273 | Ga0207693_10064897 | 3300025915 | Bacteria | 2860 |
| 274 | Ga0207693_10075861 | 3300025915 | Bacteria | 2633 |
| 275 | Ga0207663_10001749 | 3300025916 | Bacteria | 10222 |
| 276 | Ga0207663_10002943 | 3300025916 | Bacteria | 8232 |
| 277 | Ga0207663_10015808 | 3300025916 | Bacteria | 4172 |
| 278 | Ga0207663_10088641 | 3300025916 | Bacteria | 2047 |
| 279 | Ga0207657_10008772 | 3300025919 | Bacteria | 10235 |
| 280 | Ga0207657_10017207 | 3300025919 | Bacteria | 6944 |
| 281 | Ga0207657_10025197 | 3300025919 | Bacteria | 5489 |
| 282 | Ga0207657_10025318 | 3300025919 | Bacteria | 5473 |
| 283 | Ga0207657_10048737 | 3300025919 | Bacteria | 3697 |
| 284 | Ga0207649_10046672 | 3300025920 | Bacteria | 2662 |
| 285 | Ga0207646_10247524 | 3300025922 | Bacteria | 1610 |
| 286 | Ga0207694_10021178 | 3300025924 | Bacteria | 4924 |
| 287 | Ga0207694_10113051 | 3300025924 | Bacteria | 2161 |
| 288 | Ga0207650_10019594 | 3300025925 | Bacteria | 4756 |
| 289 | Ga0207650_10100874 | 3300025925 | Bacteria | 2221 |
| 290 | Ga0207659_10155066 | 3300025926 | Bacteria | 1792 |
| 291 | Ga0207687_10004916 | 3300025927 | Bacteria | 8875 |
| 292 | Ga0207687_10247019 | 3300025927 | Bacteria | 1417 |
| 293 | Ga0207700_10000011 | 3300025928 | Bacteria | 266323 |
| 294 | Ga0207700_10000580 | 3300025928 | Bacteria | 21372 |
| 295 | Ga0207700_10010413 | 3300025928 | Bacteria | 5867 |
| 296 | Ga0207700_10024061 | 3300025928 | Bacteria | 4211 |
| 297 | Ga0207700_10030319 | 3300025928 | Bacteria | 3829 |
| 298 | Ga0207700_10040436 | 3300025928 | Bacteria | 3404 |
| 299 | Ga0207664_10003476 | 3300025929 | Bacteria | 10509 |
| 300 | Ga0207664_10307366 | 3300025929 | Bacteria | 1396 |
| 301 | Ga0207644_10007189 | 3300025931 | Bacteria | 7246 |
| 302 | Ga0207690_10131151 | 3300025932 | Bacteria | 1834 |
| 303 | Ga0207706_10012680 | 3300025933 | Bacteria | 7671 |
| 304 | Ga0207686_10059722 | 3300025934 | Bacteria | 2410 |
| 305 | Ga0207670_10132165 | 3300025936 | Bacteria | 1830 |
| 306 | Ga0207669_10012368 | 3300025937 | Bacteria | 4193 |
| 307 | Ga0207704_10215714 | 3300025938 | Bacteria | 1416 |
| 308 | Ga0207665_10008900 | 3300025939 | Bacteria | 6593 |
| 309 | Ga0207691_10000977 | 3300025940 | Bacteria | 28402 |
| 310 | Ga0207691_10061074 | 3300025940 | Bacteria | 3424 |
| 311 | Ga0207691_10195302 | 3300025940 | Bacteria | 1763 |
| 312 | Ga0207711_10008479 | 3300025941 | Bacteria | 8599 |
| 313 | Ga0207711_10113524 | 3300025941 | Bacteria | 2412 |
| 314 | Ga0207689_10009633 | 3300025942 | Bacteria | 8328 |
| 315 | Ga0207689_10028141 | 3300025942 | Bacteria | 4701 |
| 316 | Ga0207661_10025870 | 3300025944 | Bacteria | 4466 |
| 317 | Ga0207679_10026629 | 3300025945 | Bacteria | 3989 |
| 318 | Ga0207667_10012235 | 3300025949 | Bacteria | 9911 |
| 319 | Ga0207667_10019312 | 3300025949 | Bacteria | 7613 |
| 320 | Ga0207667_10028571 | 3300025949 | Bacteria | 6056 |
| 321 | Ga0207667_10073041 | 3300025949 | Bacteria | 3565 |
| 322 | Ga0207667_10226843 | 3300025949 | Bacteria | 1913 |
| 323 | Ga0207651_10071351 | 3300025960 | Bacteria | 2461 |
| 324 | Ga0207712_10162224 | 3300025961 | Bacteria | 1739 |
| 325 | Ga0207668_10127859 | 3300025972 | Bacteria | 1935 |
| 326 | Ga0207640_10000996 | 3300025981 | Bacteria | 15684 |
| 327 | Ga0207658_10027942 | 3300025986 | Bacteria | 3969 |
| 328 | Ga0207703_10111931 | 3300026035 | Bacteria | 2331 |
| 329 | Ga0207639_10004126 | 3300026041 | Bacteria | 9786 |
| 330 | Ga0207639_10045949 | 3300026041 | Bacteria | 3292 |
| 331 | Ga0207678_10007632 | 3300026067 | Bacteria | 9557 |
| 332 | Ga0207678_10011088 | 3300026067 | Bacteria | 7918 |
| 333 | Ga0207678_10022619 | 3300026067 | Bacteria | 5505 |
| 334 | Ga0207678_10026945 | 3300026067 | Bacteria | 5013 |
| 335 | Ga0207678_10033440 | 3300026067 | Bacteria | 4479 |
| 336 | Ga0207678_10038638 | 3300026067 | Bacteria | 4146 |
| 337 | Ga0207708_10012687 | 3300026075 | Bacteria | 6283 |
| 338 | Ga0207708_10042582 | 3300026075 | Bacteria | 3460 |
| 339 | Ga0207702_10000162 | 3300026078 | Bacteria | 79378 |
| 340 | Ga0207702_10011446 | 3300026078 | Bacteria | 7396 |
| 341 | Ga0207702_10065053 | 3300026078 | Bacteria | 3122 |
| 342 | Ga0207702_10119146 | 3300026078 | Bacteria | 2359 |
| 343 | Ga0207641_10206087 | 3300026088 | Bacteria | 1816 |
| 344 | Ga0207641_10313168 | 3300026088 | Bacteria | 1486 |
| 345 | Ga0207648_10000825 | 3300026089 | Bacteria | 34995 |
| 346 | Ga0207648_10135498 | 3300026089 | Bacteria | 2169 |
| 347 | Ga0207676_10016634 | 3300026095 | Bacteria | 5327 |
| 348 | Ga0207674_10014539 | 3300026116 | Bacteria | 8690 |
| 349 | Ga0207674_10031587 | 3300026116 | Bacteria | 5561 |
| 350 | Ga0207674_10274086 | 3300026116 | Bacteria | 1635 |
| 351 | Ga0207675_100000366 | 3300026118 | Bacteria | 43270 |
| 352 | Ga0207675_100020640 | 3300026118 | Bacteria | 6140 |
| 353 | Ga0207683_10028078 | 3300026121 | Bacteria | 4865 |
| 354 | Ga0207683_10082337 | 3300026121 | Bacteria | 2859 |
| 355 | Ga0207683_10123150 | 3300026121 | Bacteria | 2329 |
| 356 | Ga0207698_10000005 | 3300026142 | Bacteria | 295687 |
| 357 | Ga0207698_10004789 | 3300026142 | Bacteria | 8285 |
| 358 | Ga0207698_10012030 | 3300026142 | Bacteria | 5641 |
| 359 | Ga0207698_10077032 | 3300026142 | Bacteria | 2672 |
| 360 | Ga0207698_10251692 | 3300026142 | Bacteria | 1617 |
| 361 | Ga0209588_1009148 | 3300027671 | Bacteria | 2954 |
| 362 | Ga0209974_10002714 | 3300027876 | Bacteria | 6420 |
| 363 | Ga0207428_10000140 | 3300027907 | Bacteria | 97818 |
| 364 | Ga0207428_10010573 | 3300027907 | Bacteria | 8234 |
| 365 | Ga0268266_10000677 | 3300028379 | Bacteria | 46024 |
| 366 | Ga0268266_10000727 | 3300028379 | Bacteria | 44221 |
| 367 | Ga0268266_10001826 | 3300028379 | Bacteria | 24057 |
| 368 | Ga0268266_10003534 | 3300028379 | Bacteria | 15519 |
| 369 | Ga0268266_10096334 | 3300028379 | Bacteria | 2600 |
| 370 | Ga0268265_10008971 | 3300028380 | Bacteria | 6763 |
| 371 | Ga0268265_10024352 | 3300028380 | Bacteria | 4281 |
| 372 | Ga0268264_10000245 | 3300028381 | Bacteria | 102529 |
| 373 | Ga0268264_10025692 | 3300028381 | Bacteria | 4811 |
| 374 | Ga0265318_10000015 | 3300028577 | Bacteria | 187234 |
| 375 | Ga0265318_10033968 | 3300028577 | Bacteria | 1967 |
| 376 | Ga0307517_10000111 | 3300028786 | Bacteria | 120304 |
| 377 | Ga0307515_10197518 | 3300028794 | Bacteria | 1899 |
| 378 | Ga0307515_10258980 | 3300028794 | Bacteria | 1479 |
| 379 | Ga0265338_10000005 | 3300028800 | Bacteria | 571137 |
| 380 | Ga0265338_10017352 | 3300028800 | Bacteria | 7766 |
| 381 | Ga0265338_10017836 | 3300028800 | Bacteria | 7632 |
| 382 | Ga0265760_10007492 | 3300031090 | Bacteria | 3117 |
| 383 | Ga0265330_10037738 | 3300031235 | Bacteria | 2150 |
| 384 | Ga0265332_10003973 | 3300031238 | Bacteria | 7048 |
| 385 | Ga0265320_10000561 | 3300031240 | Bacteria | 28649 |
| 386 | Ga0265325_10000005 | 3300031241 | Bacteria | 321343 |
| 387 | Ga0265325_10006286 | 3300031241 | Bacteria | 7229 |
| 388 | Ga0265325_10015648 | 3300031241 | Bacteria | 4260 |
| 389 | Ga0265340_10006415 | 3300031247 | Bacteria | 6476 |
| 390 | Ga0265340_10032893 | 3300031247 | Bacteria | 2585 |
| 391 | Ga0265339_10000088 | 3300031249 | Bacteria | 78106 |
| 392 | Ga0265339_10000622 | 3300031249 | Bacteria | 27479 |
| 393 | Ga0265339_10000822 | 3300031249 | Bacteria | 23914 |
| 394 | Ga0265339_10001947 | 3300031249 | Bacteria | 15168 |
| 395 | Ga0265331_10003530 | 3300031250 | Bacteria | 10045 |
| 396 | Ga0265331_10008230 | 3300031250 | Bacteria | 5947 |
| 397 | Ga0265331_10050878 | 3300031250 | Bacteria | 1985 |
| 398 | Ga0265313_10000032 | 3300031595 | Bacteria | 128964 |
| 399 | Ga0265313_10000173 | 3300031595 | Bacteria | 68499 |
| 400 | Ga0265313_10000482 | 3300031595 | Bacteria | 41863 |
| 401 | Ga0307508_10001153 | 3300031616 | Bacteria | 30369 |
| 402 | Ga0265314_10015573 | 3300031711 | Bacteria | 6029 |
| 403 | Ga0265314_10028710 | 3300031711 | Bacteria | 4144 |
| 404 | Ga0265314_10047199 | 3300031711 | Bacteria | 3033 |
| 405 | Ga0265342_10000233 | 3300031712 | Bacteria | 62514 |
| 406 | Ga0307409_100135333 | 3300031995 | Bacteria | 2113 |
| 407 | Ga0307416_100110690 | 3300032002 | Bacteria | 2419 |
| 408 | Ga0307414_10059243 | 3300032004 | Bacteria | 2703 |
| 409 | Ga0307510_10003330 | 3300033180 | Bacteria | 18721 |
| 410 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 411 | Ga0373934_0012522 | 3300035086 | Bacteria | 3202 |
| 412 | Ga0373923_0041645 | 3300035111 | Bacteria | 1894 |
| 413 | Ga0373936_0008905 | 3300035113 | Bacteria | 3783 |
| 414 | Ga0373936_0041875 | 3300035113 | Bacteria | 1837 |
| 415 | Ga0373945_0008371 | 3300035116 | Bacteria | 3367 |
| 416 | Ga0373953_0004147 | 3300035117 | Bacteria | 4597 |
| 417 | Ga0373954_0076886 | 3300035118 | Bacteria | 1591 |
| 418 | Ga0373956_0061559 | 3300035119 | Bacteria | 1700 |
| 419 | Ga0373943_0000440 | 3300035170 | Bacteria | 17560 |
| 420 | Ga0373943_0001594 | 3300035170 | Bacteria | 10274 |
| 421 | Ga0373943_0009544 | 3300035170 | Bacteria | 4350 |
| 422 | Ga0373943_0041344 | 3300035170 | Bacteria | 2229 |
| 423 | Ga0373946_0003168 | 3300035171 | Bacteria | 5828 |
| 424 | Ga0373946_0005763 | 3300035171 | Bacteria | 4482 |
| 425 | Ga0373955_0013231 | 3300035172 | Bacteria | 3983 |
| 426 | Ga0373955_0033656 | 3300035172 | Bacteria | 2701 |
| 427 | Ga0373924_0017653 | 3300035410 | Bacteria | 2740 |
| 428 | Ga0373924_0037002 | 3300035410 | Bacteria | 1985 |
| 429 | Ga0373931_0021073 | 3300035691 | Bacteria | 3268 |
| 430 | Ga0373935_0034322 | 3300035692 | Bacteria | 3161 |
| 431 | Ga0373935_0044142 | 3300035692 | Bacteria | 2808 |
| 432 | Ga0373935_0128891 | 3300035692 | Bacteria | 1698 |
| 433 | Ga0373927_0000829 | 3300035695 | Bacteria | 23662 |
| 434 | Ga0373927_0006747 | 3300035695 | Bacteria | 7811 |
| 435 | Ga0373927_0102460 | 3300035695 | Bacteria | 1862 |
| 436 | Ga0373933_0009315 | 3300035724 | Bacteria | 5363 |
| 437 | Ga0373933_0121048 | 3300035724 | Bacteria | 1639 |
| 438 | Ga0373947_0000393 | 3300035725 | Bacteria | 24647 |
| 439 | Ga0373947_0015918 | 3300035725 | Bacteria | 4320 |
| 440 | Ga0373937_0002968 | 3300036401 | Bacteria | 14200 |
| 441 | Ga0373937_0050943 | 3300036401 | Bacteria | 3794 |
| 442 | Ga0373937_0113539 | 3300036401 | Bacteria | 2521 |
| 443 | Ga0373937_0137423 | 3300036401 | Bacteria | 2285 |
| 444 | Ga0373925_0002574 | 3300037068 | Bacteria | 14441 |
| 445 | Ga0373925_0048709 | 3300037068 | Bacteria | 3158 |
| 446 | Ga0373925_0066546 | 3300037068 | Bacteria | 2716 |
| 447 | Ga0395899_0000151 | 3300037312 | Bacteria | 105368 |
| 448 | Ga0395900_0058167 | 3300037418 | Bacteria | 3979 |
| 449 | Ga0395900_0098004 | 3300037418 | Bacteria | 3012 |
| 450 | Ga0395900_0351562 | 3300037418 | Bacteria | 1447 |
| 451 | Ga0395905_0008572 | 3300037471 | Bacteria | 10078 |
| 452 | Ga0436364_0056841 | 3300037853 | Bacteria | 4059 |
| 453 | Ga0436364_0344786 | 3300037853 | Bacteria | 1431 |
| 454 | Ga0436364_0883805 | 3300037853 | Bacteria | 1635 |
| 455 | Ga0436364_1010630 | 3300037853 | Bacteria | 1445 |
| 456 | Ga0395901_0113052 | 3300038443 | Bacteria | 2851 |
| 457 | Ga0436365_0300465 | 3300039437 | Bacteria | 2513 |
| 458 | Ga0436365_0599448 | 3300039437 | Bacteria | 39042 |
| 459 | Ga0436365_1236061 | 3300039437 | Bacteria | 1952 |
| 460 | Ga0436365_1340575 | 3300039437 | Bacteria | 4079 |
| 461 | Ga0436365_1578866 | 3300039437 | Bacteria | 1940 |
| 462 | Ga0436365_1822707 | 3300039437 | Bacteria | 2602 |
| 463 | Ga0436360_0762773 | 3300039438 | Bacteria | 7862 |
| 464 | Ga0436361_0099990 | 3300039447 | Bacteria | 26378 |
| 465 | Ga0436362_0044370 | 3300039453 | Bacteria | 1926 |
| 466 | Ga0439445_0007388 | 3300042004 | Bacteria | 2548 |
| 467 | Ga0466966_0155289 | 3300044684 | Bacteria | 1394 |
| 468 | Ga0466963_0045862 | 3300044694 | Bacteria | 2880 |
| 469 | Ga0466957_0115147 | 3300044842 | Bacteria | 1709 |
| 470 | Ga0466959_0028565 | 3300045049 | Bacteria | 4136 |
| 471 | Ga0466958_0035636 | 3300045836 | Bacteria | 2973 |
| 472 | Ga0466967_0230529 | 3300045976 | Bacteria | 1763 |
| 473 | Ga0495617_039501 | 3300046452 | Bacteria | 1578 |
| 474 | Ga0495592_0030516 | 3300046454 | Bacteria | 4077 |
| 475 | Ga0495590_0025611 | 3300046457 | Bacteria | 2073 |
| 476 | Ga0495629_0018296 | 3300046459 | Bacteria | 5017 |
| 477 | Ga0495629_0026350 | 3300046459 | Bacteria | 4130 |
| 478 | Ga0495638_0028797 | 3300046460 | Bacteria | 3584 |
| 479 | Ga0495651_0002898 | 3300046462 | Bacteria | 13282 |
| 480 | Ga0495651_0053124 | 3300046462 | Bacteria | 3120 |
| 481 | Ga0495653_0004703 | 3300046463 | Bacteria | 11050 |
| 482 | Ga0495650_0049588 | 3300046471 | Bacteria | 1743 |
| 483 | Ga0495580_0053797 | 3300046472 | Bacteria | 2840 |
| 484 | Ga0495580_0063181 | 3300046472 | Bacteria | 2597 |
| 485 | Ga0495639_0020683 | 3300046475 | Bacteria | 2876 |
| 486 | Ga0495639_0055033 | 3300046475 | Bacteria | 1814 |
| 487 | Ga0495662_0001821 | 3300046476 | Bacteria | 10677 |
| 488 | Ga0495664_0000147 | 3300046477 | Bacteria | 35346 |
| 489 | Ga0495584_0002124 | 3300046491 | Bacteria | 11352 |
| 490 | Ga0495585_0052560 | 3300046492 | Bacteria | 2255 |
| 491 | Ga0495594_0028286 | 3300046499 | Bacteria | 3024 |
| 492 | Ga0495594_0063898 | 3300046499 | Bacteria | 2040 |
| 493 | Ga0495607_0052549 | 3300046501 | Bacteria | 2360 |
| 494 | Ga0495606_0015801 | 3300046507 | Bacteria | 5793 |
| 495 | Ga0495608_0030981 | 3300046511 | Bacteria | 3617 |
| 496 | Ga0495610_0024380 | 3300046512 | Bacteria | 3266 |
| 497 | Ga0495610_0046336 | 3300046512 | Bacteria | 2145 |
| 498 | Ga0495616_0024868 | 3300046513 | Bacteria | 3206 |
| 499 | Ga0495616_0084039 | 3300046513 | Bacteria | 1518 |
| 500 | Ga0495618_0001877 | 3300046514 | Bacteria | 13850 |
| 501 | Ga0495618_0052262 | 3300046514 | Bacteria | 2582 |
| 502 | Ga0495620_0042192 | 3300046515 | Bacteria | 1995 |
| 503 | Ga0495628_0117871 | 3300046516 | Bacteria | 2039 |
| 504 | Ga0495630_0001952 | 3300046517 | Bacteria | 14333 |
| 505 | Ga0495630_0036955 | 3300046517 | Bacteria | 3651 |
| 506 | Ga0495631_0031506 | 3300046518 | Bacteria | 2397 |
| 507 | Ga0495632_0048220 | 3300046519 | Bacteria | 2110 |
| 508 | Ga0495648_0055384 | 3300046524 | Bacteria | 2391 |
| 509 | Ga0495648_0070035 | 3300046524 | Bacteria | 2039 |
| 510 | Ga0495663_0011031 | 3300046525 | Bacteria | 2516 |
| 511 | Ga0495663_0018223 | 3300046525 | Bacteria | 1998 |
| 512 | Ga0495663_0026301 | 3300046525 | Bacteria | 1703 |
| 513 | Ga0495642_0035680 | 3300046528 | Bacteria | 2007 |
| 514 | Ga0495652_0038908 | 3300046529 | Bacteria | 4115 |
| 515 | Ga0495665_0026023 | 3300046531 | Bacteria | 3142 |
| 516 | Ga0495640_0003988 | 3300046533 | Bacteria | 11811 |
| 517 | Ga0495640_0016016 | 3300046533 | Bacteria | 5622 |
| 518 | Ga0495640_0018616 | 3300046533 | Bacteria | 5144 |
| 519 | Ga0495640_0076083 | 3300046533 | Bacteria | 2240 |
| 520 | Ga0495587_0005767 | 3300046536 | Bacteria | 8069 |
| 521 | Ga0495587_0080216 | 3300046536 | Bacteria | 1891 |
| 522 | Ga0495598_0009785 | 3300046537 | Bacteria | 2277 |
| 523 | Ga0495598_0012176 | 3300046537 | Bacteria | 2103 |
| 524 | Ga0495598_0012522 | 3300046537 | Bacteria | 2084 |
| 525 | Ga0495598_0019139 | 3300046537 | Bacteria | 1790 |
| 526 | Ga0495609_0043291 | 3300046538 | Bacteria | 2021 |
| 527 | Ga0495645_0000695 | 3300046543 | Bacteria | 23113 |
| 528 | Ga0495645_0020278 | 3300046543 | Bacteria | 4793 |
| 529 | Ga0495645_0046620 | 3300046543 | Bacteria | 3159 |
| 530 | Ga0495667_0046423 | 3300046559 | Bacteria | 2872 |
| 531 | Ga0495667_0093862 | 3300046559 | Bacteria | 1943 |
| 532 | Ga0495656_0004791 | 3300046615 | Bacteria | 4656 |
| 533 | Ga0495656_0004869 | 3300046615 | Bacteria | 4621 |
| 534 | Ga0495656_0011721 | 3300046615 | Bacteria | 3220 |
| 535 | Ga0495656_0043463 | 3300046615 | Bacteria | 1887 |
| 536 | Ga0495634_0003638 | 3300046642 | Bacteria | 12297 |
| 537 | Ga0495634_0022313 | 3300046642 | Bacteria | 4461 |
| 538 | Ga0495634_0028582 | 3300046642 | Bacteria | 3869 |
| 539 | Ga0495634_0030570 | 3300046642 | Bacteria | 3719 |
| 540 | Ga0495634_0051752 | 3300046642 | Bacteria | 2755 |
| 541 | Ga0495611_0029288 | 3300046648 | Bacteria | 2414 |
| 542 | Ga0495635_0001303 | 3300046663 | Bacteria | 16659 |
| 543 | Ga0495635_0024452 | 3300046663 | Bacteria | 4210 |
| 544 | Ga0495635_0082082 | 3300046663 | Bacteria | 2206 |
| 545 | Ga0495661_0134686 | 3300046665 | Bacteria | 1350 |
| 546 | Ga0495588_0001989 | 3300046674 | Bacteria | 8739 |
| 547 | Ga0495657_0015784 | 3300046675 | Bacteria | 5518 |
| 548 | Ga0495657_0058062 | 3300046675 | Bacteria | 2571 |
| 549 | Ga0495599_0015104 | 3300046678 | Bacteria | 4786 |
| 550 | Ga0495623_0047760 | 3300046679 | Bacteria | 2717 |
| 551 | Ga0495646_0027762 | 3300046680 | Bacteria | 3548 |
| 552 | Ga0495646_0036024 | 3300046680 | Bacteria | 3067 |
| 553 | Ga0495647_0070743 | 3300046681 | Bacteria | 1396 |
| 554 | Ga0495613_0020414 | 3300046689 | Bacteria | 4938 |
| 555 | Ga0495624_0005355 | 3300046690 | Bacteria | 9256 |
| 556 | Ga0495624_0007520 | 3300046690 | Bacteria | 7644 |
| 557 | Ga0495624_0046918 | 3300046690 | Bacteria | 2746 |
| 558 | Ga0495624_0066900 | 3300046690 | Bacteria | 2243 |
| 559 | Ga0495670_0011468 | 3300046691 | Bacteria | 4360 |
| 560 | Ga0495670_0052910 | 3300046691 | Bacteria | 2033 |
| 561 | Ga0495670_0068679 | 3300046691 | Bacteria | 1791 |
| 562 | Ga0495649_0007881 | 3300046694 | Bacteria | 6444 |
| 563 | Ga0495649_0039226 | 3300046694 | Bacteria | 2597 |
| 564 | Ga0495649_0069132 | 3300046694 | Bacteria | 1894 |
| 565 | Ga0495589_0037484 | 3300046794 | Bacteria | 2429 |
| 566 | Ga0495600_0013812 | 3300046809 | Bacteria | 5086 |
| 567 | Ga0495604_0000643 | 3300047317 | Bacteria | 29876 |
| 568 | Ga0495604_0066980 | 3300047317 | Bacteria | 2729 |
| 569 | Ga0495604_0113211 | 3300047317 | Bacteria | 1975 |
| 570 | Ga0495674_0002888 | 3300047319 | Bacteria | 16717 |
| 571 | Ga0495674_0032807 | 3300047319 | Bacteria | 4706 |
| 572 | Ga0495674_0053632 | 3300047319 | Bacteria | 3543 |
| 573 | Ga0495674_0087934 | 3300047319 | Bacteria | 2658 |
| 574 | Ga0495672_0015830 | 3300047320 | Bacteria | 5105 |
| 575 | Ga0495672_0023135 | 3300047320 | Bacteria | 4028 |
| 576 | Ga0495676_0111851 | 3300047321 | Bacteria | 2002 |
| 577 | Ga0495680_0002277 | 3300047322 | Bacteria | 19762 |
| 578 | Ga0495680_0033115 | 3300047322 | Bacteria | 4187 |
| 579 | Ga0495680_0125717 | 3300047322 | Bacteria | 1889 |
| 580 | Ga0495677_0049378 | 3300047445 | Bacteria | 1546 |
| 581 | Ga0495684_0002109 | 3300047471 | Bacteria | 15957 |
| 582 | Ga0495684_0003387 | 3300047471 | Bacteria | 12515 |
| 583 | Ga0495684_0010675 | 3300047471 | Bacteria | 7101 |
| 584 | Ga0495684_0038567 | 3300047471 | Bacteria | 3662 |
| 585 | Ga0495686_0106874 | 3300047472 | Bacteria | 1682 |
| 586 | Ga0495593_0015087 | 3300047673 | Bacteria | 4387 |
| 587 | Ga0495602_0116017 | 3300048088 | Bacteria | 2164 |
| 588 | Ga0495615_0030541 | 3300048090 | Bacteria | 1287 |
| 589 | Ga0496100_0019308 | 3300048903 | Bacteria | 4063 |
| 590 | Ga0496100_0097807 | 3300048903 | Bacteria | 2016 |
| 591 | Ga0496101_0004879 | 3300048904 | Bacteria | 8513 |
| 592 | Ga0496101_0026770 | 3300048904 | Bacteria | 4010 |
| 593 | Ga0496101_0247270 | 3300048904 | Bacteria | 1389 |
| 594 | Ga0496102_0003387 | 3300048905 | Bacteria | 13517 |
| 595 | Ga0496102_0072275 | 3300048905 | Bacteria | 3169 |
| 596 | Ga0496102_0076352 | 3300048905 | Bacteria | 3082 |
| 597 | Ga0496102_0201928 | 3300048905 | Bacteria | 1874 |
| 598 | Ga0496103_0001033 | 3300048906 | Bacteria | 19490 |
| 599 | Ga0496104_0005340 | 3300048907 | Bacteria | 11240 |
| 600 | Ga0496104_0007801 | 3300048907 | Bacteria | 9488 |
| 601 | Ga0496104_0013744 | 3300048907 | Bacteria | 7301 |
| 602 | Ga0496104_0047965 | 3300048907 | Bacteria | 4027 |
| 603 | Ga0496104_0072489 | 3300048907 | Bacteria | 3275 |
| 604 | Ga0496105_0006335 | 3300048908 | Bacteria | 9088 |
| 605 | Ga0496105_0025501 | 3300048908 | Bacteria | 4813 |
| 606 | Ga0496106_0166262 | 3300048909 | Bacteria | 1746 |
| 607 | Ga0496106_0171011 | 3300048909 | Bacteria | 1722 |
| 608 | Ga0496107_0075248 | 3300048910 | Bacteria | 2458 |
| 609 | Ga0496107_0292237 | 3300048910 | Bacteria | 1213 |
| 610 | Ga0496108_0004005 | 3300048911 | Bacteria | 11815 |
| 611 | Ga0496108_0012723 | 3300048911 | Bacteria | 6853 |
| 612 | Ga0496108_0111899 | 3300048911 | Bacteria | 2336 |
| 613 | Ga0496108_0141917 | 3300048911 | Bacteria | 2069 |
| 614 | Ga0496109_0059073 | 3300048912 | Bacteria | 3503 |
| 615 | Ga0496109_0071325 | 3300048912 | Bacteria | 3189 |
| 616 | Ga0496110_0015820 | 3300048913 | Bacteria | 6289 |
| 617 | Ga0496110_0025176 | 3300048913 | Bacteria | 5082 |
| 618 | Ga0496111_0034923 | 3300048914 | Bacteria | 3591 |
| 619 | Ga0496111_0044803 | 3300048914 | Bacteria | 3180 |
| 620 | Ga0496111_0064581 | 3300048914 | Bacteria | 2655 |
| 621 | Ga0496112_0016711 | 3300048915 | Bacteria | 6880 |
| 622 | Ga0496112_0065913 | 3300048915 | Bacteria | 3573 |
| 623 | Ga0496113_0009665 | 3300048916 | Bacteria | 6334 |
| 624 | Ga0496113_0039825 | 3300048916 | Bacteria | 3460 |
| 625 | Ga0496114_0261513 | 3300048917 | Bacteria | 1524 |
| 626 | Ga0496115_0152394 | 3300048918 | Bacteria | 1909 |
| 627 | Ga0496116_0000092 | 3300048919 | Bacteria | 206620 |
| 628 | Ga0496116_0004967 | 3300048919 | Bacteria | 12531 |
| 629 | Ga0496117_0025927 | 3300048920 | Bacteria | 4597 |
| 630 | Ga0496117_0131036 | 3300048920 | Bacteria | 1520 |
| 631 | Ga0496118_0003713 | 3300048921 | Bacteria | 18913 |
| 632 | Ga0496118_0140762 | 3300048921 | Bacteria | 1530 |
| 633 | Ga0496119_0046060 | 3300048922 | Bacteria | 2728 |
| 634 | Ga0496120_0062526 | 3300048923 | Bacteria | 2074 |
| 635 | Ga0496121_0001453 | 3300048924 | Bacteria | 40007 |
| 636 | Ga0496121_0076249 | 3300048924 | Bacteria | 2674 |
| 637 | Ga0496121_0149551 | 3300048924 | Bacteria | 1720 |
| 638 | Ga0496123_0010093 | 3300048926 | Bacteria | 8399 |
| 639 | Ga0496124_0087263 | 3300048927 | Bacteria | 2552 |
| 640 | Ga0496124_0223949 | 3300048927 | Bacteria | 1412 |
| 641 | Ga0496125_0000600 | 3300048928 | Bacteria | 61362 |
| 642 | Ga0496125_0003378 | 3300048928 | Bacteria | 19439 |
| 643 | Ga0496125_0012349 | 3300048928 | Bacteria | 8486 |
| 644 | Ga0496125_0016087 | 3300048928 | Bacteria | 7200 |
| 645 | Ga0496126_0005363 | 3300048929 | Bacteria | 14654 |
| 646 | Ga0496126_0006357 | 3300048929 | Bacteria | 13172 |
| 647 | Ga0496126_0012601 | 3300048929 | Bacteria | 8655 |
| 648 | Ga0496126_0013331 | 3300048929 | Bacteria | 8369 |
| 649 | Ga0496126_0030143 | 3300048929 | Bacteria | 5144 |
| 650 | Ga0496126_0040376 | 3300048929 | Bacteria | 4325 |
| 651 | Ga0496126_0044205 | 3300048929 | Bacteria | 4104 |
| 652 | Ga0496126_0052280 | 3300048929 | Bacteria | 3714 |
| 653 | Ga0496126_0091007 | 3300048929 | Bacteria | 2683 |
| 654 | Ga0496126_0102827 | 3300048929 | Bacteria | 2497 |
| 655 | Ga0496126_0168034 | 3300048929 | Bacteria | 1871 |
| 656 | Ga0496126_0182215 | 3300048929 | Bacteria | 1783 |
| 657 | Ga0496126_0190562 | 3300048929 | Bacteria | 1737 |
| 658 | Ga0495682_0025804 | 3300049460 | Bacteria | 2185 |
| 659 | Ga0501031_0004551 | 3300049568 | Bacteria | 8991 |
| 660 | Ga0501031_0005519 | 3300049568 | Bacteria | 8236 |
| 661 | Ga0501031_0007975 | 3300049568 | Bacteria | 6893 |
| 662 | Ga0501031_0015856 | 3300049568 | Bacteria | 4892 |
| 663 | Ga0501031_0122119 | 3300049568 | Bacteria | 1702 |
| 664 | Ga0501032_0017717 | 3300049569 | Bacteria | 4999 |
| 665 | Ga0501032_0029614 | 3300049569 | Bacteria | 3755 |
| 666 | Ga0501032_0058391 | 3300049569 | Bacteria | 2590 |
| 667 | Ga0501032_0176984 | 3300049569 | Bacteria | 1397 |
| 668 | Ga0501033_0002357 | 3300049570 | Bacteria | 16112 |
| 669 | Ga0501033_0003960 | 3300049570 | Bacteria | 12004 |
| 670 | Ga0501033_0012332 | 3300049570 | Bacteria | 6523 |
| 671 | Ga0501033_0020067 | 3300049570 | Bacteria | 5052 |
| 672 | Ga0501033_0049959 | 3300049570 | Bacteria | 3104 |
| 673 | Ga0501033_0097648 | 3300049570 | Bacteria | 2146 |
| 674 | Ga0501033_0106597 | 3300049570 | Bacteria | 2041 |
| 675 | Ga0501034_0001188 | 3300049571 | Bacteria | 35870 |
| 676 | Ga0501034_0005818 | 3300049571 | Bacteria | 13410 |
| 677 | Ga0501034_0007444 | 3300049571 | Bacteria | 11652 |
| 678 | Ga0501034_0049402 | 3300049571 | Bacteria | 4244 |
| 679 | Ga0501034_0067987 | 3300049571 | Bacteria | 3574 |
| 680 | Ga0501034_0079596 | 3300049571 | Bacteria | 3280 |
| 681 | Ga0501034_0087883 | 3300049571 | Bacteria | 3107 |
| 682 | Ga0501034_0101821 | 3300049571 | Bacteria | 2866 |
| 683 | Ga0501034_0196613 | 3300049571 | Bacteria | 1976 |
| 684 | Ga0501036_0000992 | 3300049572 | Bacteria | 21425 |
| 685 | Ga0501036_0002298 | 3300049572 | Bacteria | 14945 |
| 686 | Ga0501036_0162233 | 3300049572 | Bacteria | 1884 |
| 687 | Ga0501037_0001908 | 3300049573 | Bacteria | 15140 |
| 688 | Ga0501037_0026075 | 3300049573 | Bacteria | 4319 |
| 689 | Ga0501037_0028885 | 3300049573 | Bacteria | 4097 |
| 690 | Ga0501037_0046474 | 3300049573 | Bacteria | 3183 |
| 691 | Ga0501038_0000319 | 3300049574 | Bacteria | 41269 |
| 692 | Ga0501038_0017132 | 3300049574 | Bacteria | 6552 |
| 693 | Ga0501038_0019199 | 3300049574 | Bacteria | 6164 |
| 694 | Ga0501038_0030908 | 3300049574 | Bacteria | 4734 |
| 695 | Ga0501038_0076882 | 3300049574 | Bacteria | 2819 |
| 696 | Ga0501039_0018593 | 3300049575 | Bacteria | 5334 |
| 697 | Ga0501039_0019245 | 3300049575 | Bacteria | 5236 |
| 698 | Ga0501039_0020632 | 3300049575 | Bacteria | 5049 |
| 699 | Ga0501039_0037800 | 3300049575 | Bacteria | 3727 |
| 700 | Ga0501039_0047031 | 3300049575 | Bacteria | 3334 |
| 701 | Ga0501040_0021621 | 3300049576 | Bacteria | 4299 |
| 702 | Ga0501042_0032025 | 3300049578 | Bacteria | 3721 |
| 703 | Ga0501043_0022088 | 3300049579 | Bacteria | 4993 |
| 704 | Ga0501046_0013563 | 3300049580 | Bacteria | 6894 |
| 705 | Ga0501046_0021773 | 3300049580 | Bacteria | 5284 |
| 706 | Ga0501046_0032910 | 3300049580 | Bacteria | 4194 |
| 707 | Ga0501046_0085755 | 3300049580 | Bacteria | 2428 |
| 708 | Ga0501046_0098415 | 3300049580 | Bacteria | 2246 |
| 709 | Ga0501046_0101309 | 3300049580 | Bacteria | 2209 |
| 710 | Ga0501047_0005396 | 3300049581 | Bacteria | 12020 |
| 711 | Ga0501047_0017866 | 3300049581 | Bacteria | 6794 |
| 712 | Ga0501047_0047369 | 3300049581 | Bacteria | 4154 |
| 713 | Ga0501047_0057254 | 3300049581 | Bacteria | 3769 |
| 714 | Ga0501047_0066167 | 3300049581 | Bacteria | 3483 |
| 715 | Ga0501047_0114884 | 3300049581 | Bacteria | 2574 |
| 716 | Ga0501048_0011226 | 3300049582 | Bacteria | 6679 |
| 717 | Ga0501048_0012479 | 3300049582 | Bacteria | 6321 |
| 718 | Ga0501068_0008709 | 3300049584 | Bacteria | 5657 |
| 719 | Ga0501068_0098618 | 3300049584 | Bacteria | 1809 |
| 720 | Ga0501069_0007703 | 3300049585 | Bacteria | 5650 |
| 721 | Ga0501069_0049752 | 3300049585 | Bacteria | 2330 |
| 722 | Ga0501070_0002559 | 3300049586 | Bacteria | 15917 |
| 723 | Ga0501070_0009673 | 3300049586 | Bacteria | 8152 |
| 724 | Ga0501070_0019935 | 3300049586 | Bacteria | 5623 |
| 725 | Ga0501071_0067076 | 3300049587 | Bacteria | 2609 |
| 726 | Ga0501072_0081943 | 3300049588 | Bacteria | 2558 |
| 727 | Ga0501072_0113619 | 3300049588 | Bacteria | 2156 |
| 728 | Ga0501073_0000802 | 3300049589 | Bacteria | 22364 |
| 729 | Ga0501073_0014281 | 3300049589 | Bacteria | 5767 |
| 730 | Ga0501073_0076193 | 3300049589 | Bacteria | 2334 |
| 731 | Ga0501073_0081044 | 3300049589 | Bacteria | 2257 |
| 732 | Ga0501073_0180223 | 3300049589 | Bacteria | 1462 |
| 733 | Ga0501074_0000138 | 3300049590 | Bacteria | 37896 |
| 734 | Ga0501074_0023846 | 3300049590 | Bacteria | 4447 |
| 735 | Ga0501077_0144320 | 3300049593 | Bacteria | 1510 |
| 736 | Ga0501079_0002710 | 3300049741 | Bacteria | 12905 |
| 737 | Ga0501080_0025164 | 3300049742 | Bacteria | 5524 |
| 738 | Ga0501083_0015481 | 3300049744 | Bacteria | 5342 |
| 739 | Ga0501083_0031844 | 3300049744 | Bacteria | 3618 |
| 740 | Ga0501035_0001024 | 3300049822 | Bacteria | 29439 |
| 741 | Ga0501035_0011540 | 3300049822 | Bacteria | 8188 |
| 742 | Ga0501035_0019433 | 3300049822 | Bacteria | 6247 |
| 743 | Ga0501035_0024254 | 3300049822 | Bacteria | 5563 |
| 744 | Ga0501035_0027006 | 3300049822 | Bacteria | 5250 |
| 745 | Ga0501035_0082971 | 3300049822 | Bacteria | 2828 |
| 746 | Ga0501035_0089302 | 3300049822 | Bacteria | 2714 |
| 747 | Ga0501035_0126136 | 3300049822 | Bacteria | 2234 |
| 748 | Ga0501044_0001970 | 3300049823 | Bacteria | 23744 |
| 749 | Ga0501044_0008807 | 3300049823 | Bacteria | 11038 |
| 750 | Ga0501044_0023213 | 3300049823 | Bacteria | 6601 |
| 751 | Ga0501044_0044972 | 3300049823 | Bacteria | 4578 |
| 752 | Ga0501044_0064394 | 3300049823 | Bacteria | 3743 |
| 753 | Ga0501044_0105644 | 3300049823 | Bacteria | 2828 |
| 754 | Ga0501044_0111682 | 3300049823 | Bacteria | 2740 |
| 755 | Ga0501044_0138195 | 3300049823 | Bacteria | 2426 |
| 756 | Ga0501045_0011643 | 3300049824 | Bacteria | 6176 |
| 757 | nmdc:mga03683_22010_c1 | 3300050489 | Bacteria | 2466 |
| 758 | nmdc:mga03683_5346_c1 | 3300050489 | Bacteria | 4333 |
| 759 | nmdc:mga03n38_159_c1 | 3300050490 | Bacteria | 12744 |
| 760 | nmdc:mga00v17_106199_c1 | 3300050491 | Bacteria | 1777 |
| 761 | nmdc:mga00v17_56888_c1 | 3300050491 | Bacteria | 2391 |
| 762 | nmdc:mga00v17_61162_c1 | 3300050491 | Bacteria | 2314 |
| 763 | nmdc:mga0yw44_100628_c1 | 3300050492 | Bacteria | 1841 |
| 764 | nmdc:mga0yw44_3790_c1 | 3300050492 | Bacteria | 6784 |
| 765 | nmdc:mga0k408_90708_c1 | 3300050493 | Bacteria | 1795 |
| 766 | nmdc:mga04h51_8174_c1 | 3300050495 | Bacteria | 2792 |
| 767 | nmdc:mga07m45_15508_c1 | 3300050496 | Bacteria | 4070 |
| 768 | nmdc:mga07m45_27984_c1 | 3300050496 | Bacteria | 3110 |
| 769 | nmdc:mga05p37_18514_c1 | 3300050507 | Bacteria | 8414 |
| 770 | nmdc:mga05p37_23888_c1 | 3300050507 | Bacteria | 7422 |
| 771 | nmdc:mga05p37_285554_c1 | 3300050507 | Bacteria | 1966 |
| 772 | nmdc:mga05p37_853_c1 | 3300050507 | Bacteria | 34336 |
| 773 | nmdc:mga09592_12918_c1 | 3300050508 | Bacteria | 6810 |
| 774 | nmdc:mga09592_19678_c1 | 3300050508 | Bacteria | 5544 |
| 775 | nmdc:mga0qj67_360891_c1 | 3300050509 | Bacteria | 1174 |
| 776 | nmdc:mga0qj67_37662_c1 | 3300050509 | Bacteria | 3790 |
| 777 | nmdc:mga06r32_146745_c1 | 3300050510 | Bacteria | 2336 |
| 778 | nmdc:mga06r32_205414_c1 | 3300050510 | Bacteria | 1958 |
| 779 | nmdc:mga06r32_557_c1 | 3300050510 | Bacteria | 32361 |
| 780 | nmdc:mga06r32_61387_c1 | 3300050510 | Bacteria | 3618 |
| 781 | nmdc:mga06r32_77538_c1 | 3300050510 | Bacteria | 3229 |
| 782 | nmdc:mga08y16_202602_c1 | 3300050511 | Bacteria | 2056 |
| 783 | nmdc:mga08y16_22775_c1 | 3300050511 | Bacteria | 6612 |
| 784 | nmdc:mga0n895_186339_c1 | 3300050512 | Bacteria | 2106 |
| 785 | nmdc:mga0n895_221558_c1 | 3300050512 | Bacteria | 1920 |
| 786 | nmdc:mga0rr50_87676_c1 | 3300050513 | Bacteria | 2416 |
| 787 | nmdc:mga08x19_15383_c1 | 3300050514 | Bacteria | 4655 |
| 788 | nmdc:mga08x19_394_c1 | 3300050514 | Bacteria | 30675 |
| 789 | nmdc:mga0sz30_7308_c1 | 3300050516 | Bacteria | 4138 |
| 790 | nmdc:mga0sz30_82403_c1 | 3300050516 | Bacteria | 1393 |
| 791 | Ga0495601_0000763 | 3300053077 | Bacteria | 17371 |
| 792 | Ga0495601_0004531 | 3300053077 | Bacteria | 8030 |
| 793 | Ga0495601_0024258 | 3300053077 | Bacteria | 3736 |
| 794 | Ga0495601_0040295 | 3300053077 | Bacteria | 2925 |
| 795 | Ga0495601_0068715 | 3300053077 | Bacteria | 2258 |
| 796 | Ga0495601_0120394 | 3300053077 | Bacteria | 1704 |
| 797 | Ga0495612_0011755 | 3300053078 | Bacteria | 3528 |
| 798 | Ga0495612_0015550 | 3300053078 | Bacteria | 3050 |
| 799 | Ga0495612_0024602 | 3300053078 | Bacteria | 2417 |
| 800 | Ga0495595_0004091 | 3300053084 | Bacteria | 5846 |
| 801 | Ga0495619_0000374 | 3300053085 | Bacteria | 30825 |
| 802 | Ga0495619_0001194 | 3300053085 | Bacteria | 17106 |
| 803 | Ga0495619_0047806 | 3300053085 | Bacteria | 2818 |
| 804 | Ga0495619_0048814 | 3300053085 | Bacteria | 2790 |
| 805 | Ga0495619_0093243 | 3300053085 | Bacteria | 2041 |
| 806 | Ga0500578_0094412 | 3300053086 | Bacteria | 1898 |
| 807 | Ga0500578_0155114 | 3300053086 | Bacteria | 1424 |
| 808 | Ga0500566_0000082 | 3300053094 | Bacteria | 47150 |
| 809 | Ga0500641_0006634 | 3300053096 | Bacteria | 4110 |
| 810 | Ga0500555_029892 | 3300053103 | Bacteria | 1548 |
| 811 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 812 | Ga0500572_000521 | 3300053111 | Bacteria | 13138 |
| 813 | Ga0500592_001387 | 3300053116 | Bacteria | 3920 |
| 814 | Ga0500595_000890 | 3300053119 | Bacteria | 17032 |
| 815 | Ga0500595_001314 | 3300053119 | Bacteria | 13488 |
| 816 | Ga0500595_006225 | 3300053119 | Bacteria | 5095 |
| 817 | Ga0500595_023161 | 3300053119 | Bacteria | 2187 |
| 818 | Ga0500608_000450 | 3300053122 | Bacteria | 15389 |
| 819 | Ga0500642_0000115 | 3300053130 | Bacteria | 37207 |
| 820 | Ga0500559_0000282 | 3300053136 | Bacteria | 39282 |
| 821 | Ga0500559_0000574 | 3300053136 | Bacteria | 25178 |
| 822 | Ga0500559_0046470 | 3300053136 | Bacteria | 1904 |
| 823 | Ga0500568_0002196 | 3300053139 | Bacteria | 11744 |
| 824 | Ga0500577_0000716 | 3300053142 | Bacteria | 8476 |
| 825 | Ga0500589_049180 | 3300053147 | Bacteria | 1959 |
| 826 | Ga0500604_0006158 | 3300053151 | Bacteria | 3169 |
| 827 | Ga0500604_0007717 | 3300053151 | Bacteria | 2850 |
| 828 | Ga0500616_0000069 | 3300053153 | Bacteria | 234334 |
| 829 | Ga0500616_0028455 | 3300053153 | Bacteria | 3079 |
| 830 | Ga0500622_0036772 | 3300053156 | Bacteria | 2559 |
| 831 | Ga0500634_0000517 | 3300053161 | Bacteria | 12583 |
| 832 | Ga0500634_0073233 | 3300053161 | Bacteria | 1786 |
| 833 | Ga0500639_011094 | 3300053163 | Bacteria | 4726 |
| 834 | Ga0500639_039988 | 3300053163 | Bacteria | 2468 |
| 835 | Ga0500636_0003738 | 3300053177 | Bacteria | 8587 |
| 836 | Ga0500637_0094081 | 3300053178 | Bacteria | 1736 |
| 837 | Ga0500609_006233 | 3300053731 | Bacteria | 1626 |
| 838 | Ga0501084_0027346 | 3300054114 | Bacteria | 4766 |
| 839 | Ga0501082_0000084 | 3300060353 | Bacteria | 70644 |
| 840 | Ga0501082_0005189 | 3300060353 | Bacteria | 11329 |
| 841 | Ga0501082_0092963 | 3300060353 | Bacteria | 2605 |
| 842 | Ga0530510_0053026 | 3300061734 | Bacteria | 2930 |
| 843 | 2508698851 | 2508501042 | Bacteria | 8719808 |
| 844 | 2509144716 | 2508501127 | Bacteria | 7037543 |
| 845 | 2509396503 | 2509276022 | Bacteria | 6200534 |
| 846 | 2513638954 | 2513237094 | Bacteria | 8789602 |
| 847 | 2513694437 | 2513237101 | Bacteria | 7952346 |
| 848 | 2513718655 | 2513237104 | Bacteria | 10034502 |
| 849 | 2524534115 | 2524023228 | Bacteria | 10118060 |
| 850 | 2545679365 | 2545555834 | Bacteria | 8130841 |
| 851 | 2596375124 | 2595698237 | Bacteria | 6712432 |
| 852 | 2597813552 | 2597489875 | Bacteria | 7010078 |
| 853 | 2603858889 | 2602042107 | Bacteria | 6226103 |
| 854 | 2643773087 | 2643221550 | Bacteria | 4619371 |
| 855 | 2643775927 | 2643221551 | Bacteria | 3750538 |
| 856 | 2643912255 | 2643221580 | Bacteria | 3816678 |
| 857 | 2643963449 | 2643221591 | Bacteria | 4397626 |
| 858 | 2644167499 | 2643221629 | Bacteria | 5850260 |
| 859 | 2644167500 | 2643221629 | Bacteria | 5850260 |
| 860 | 2644347262 | 2643221662 | Bacteria | 5851492 |
| 861 | 2644347263 | 2643221662 | Bacteria | 5851492 |
| 862 | 2644410568 | 2643221674 | Bacteria | 3919126 |
| 863 | 2738744551 | 2738541281 | Bacteria | 5112672 |
| 864 | 2739353781 | 2738543032 | Bacteria | 5115625 |
| 865 | 2739612834 | 2739367655 | Bacteria | 4051151 |
| 866 | 2793079789 | |||
| 867 | 2829748923 | 2829745981 | Bacteria | 5406054 |
| 868 | 2841739473 | 2841734538 | Bacteria | 6784580 |
| 869 | 2842701408 | 2842698319 | Bacteria | 5190321 |
| 870 | 2856347445 | 2856342000 | Bacteria | 7176905 |
| 871 | 2861694959 | 2861691609 | Bacteria | 5628931 |
| 872 | 2871479635 | 2871474448 | Bacteria | 6806570 |
| 873 | 2874607026 | 2874604998 | Bacteria | 7834745 |
| 874 | 2876817979 | 2876808645 | Bacteria | 8824342 |
| 875 | 2878794749 | 2878788777 | Bacteria | 6567085 |
| 876 | 2879117142 | 2879110137 | Bacteria | 8907982 |
| 877 | 2881366734 | 2881364244 | Bacteria | 7710352 |
| 878 | 2885317797 | 2885312484 | Bacteria | 6415165 |
| 879 | 2885371799 | 2885366525 | Bacteria | 8326213 |
| 880 | 2888347002 | 2888343758 | Bacteria | 6611049 |
| 881 | 2889034875 | 2889033259 | Bacteria | 9099371 |
| 882 | 2889311795 | 2889306138 | Bacteria | 6358934 |
| 883 | 2891050974 | 2891048133 | Bacteria | 4447501 |
| 884 | 2902335374 | 2902330777 | Bacteria | 6395352 |
| 885 | 2902409465 | 2902405164 | Bacteria | 6784948 |
| 886 | 2903728964 | 2903727486 | Bacteria | 8281579 |
| 887 | 2904702139 | |||
| 888 | 2908779444 | 2908775508 | Bacteria | 8092255 |
| 889 | 2919453915 | 2919450847 | Bacteria | 5631160 |
| 890 | 2922364696 | 2922361189 | Bacteria | 7436256 |
| 891 | 2924755070 | 2924754689 | Bacteria | 6774424 |
| 892 | 2928126474 | 2928125067 | Bacteria | 5937560 |
| 893 | 2932403311 | 2932401849 | Bacteria | 4262978 |
| 894 | 2932797443 | 2932794094 | Bacteria | 7915132 |
| 895 | 2935989574 | 2935984226 | Bacteria | 8302647 |
| 896 | 2937839044 | 2937836603 | Bacteria | 6811263 |
| 897 | 2958078014 | 2958071322 | Bacteria | 6815895 |
| 898 | 2970530523 | 2970524798 | Bacteria | 6840927 |
| 899 | 2970544169 | 2970540015 | Bacteria | 6977556 |
| 900 | 2995393177 | 2995392953 | Bacteria | 4539380 |
| 901 | 3003670801 | 3003665799 | Bacteria | 7279786 |
| 902 | 3005599260 | 3005594810 | Bacteria | 8716512 |
| 903 | 641644550 | 641522639 | Bacteria | 7737025 |
| 904 | 643601799 | 643348564 | Bacteria | 8839022 |
| 905 | 8004400175 | 8004395343 | Bacteria | 6620908 |
| 906 | 8004637217 | 8004633249 | Bacteria | 6723080 |
| 907 | 8006940197 | 8006933436 | Bacteria | 10410654 |
| 908 | 8006972493 | 8006964411 | Bacteria | 8966052 |
| 909 | 8006979976 | 8006973647 | Bacteria | 10679141 |
| 910 | 8006988520 | 8006984368 | Bacteria | 9651211 |
| 911 | 8006995272 | 8006994254 | Bacteria | 8309700 |
| 912 | 8016553335 | 8016548790 | Bacteria | 8155074 |
| 913 | 8048747687 | 8048746797 | Bacteria | 3557226 |
| 914 | 8055620968 | 8055617313 | Bacteria | 7548464 |
| 915 | 8056679233 | 8056673599 | Bacteria | 7871253 |
| 916 | 8056968059 | 8056967851 | Bacteria | 9038162 |
| 917 | Ga0436365_0143841 | |||
| 918 | JGI24746J21847_1009646 | |||
| 919 | JGI24743J22301_10001131 | |||
| 920 | JGI24748J21848_1000838 | |||
| 921 | JGI24744J21845_10000785 | |||
| 922 | JGI25156J39149_1003138 | |||
| 923 | JGI25406J46586_10005795 | |||
| 924 | JGI25165J46597_1000003 | |||
| 925 | rootH2_10023059 | |||
| 926 | rootL2_10059231 | |||
| 927 | JGI25405J52794_10009494 | |||
| 928 | Ga0065165_1014273 | |||
| 929 | Ga0070658_10000351 | |||
| 930 | Ga0070658_10008885 | |||
| 931 | Ga0070658_10175010 | |||
| 932 | Ga0070676_10067725 | |||
| 933 | Ga0070683_100177210 | |||
| 934 | Ga0070690_100065156 | |||
| 935 | Ga0070670_100032008 | |||
| 936 | Ga0068869_100020011 | |||
| 937 | Ga0068869_100226981 | |||
| 938 | Ga0070680_100100240 | |||
| 939 | Ga0068868_100059313 | |||
| 940 | Ga0070660_100017700 | |||
| 941 | Ga0070660_100023813 | |||
| 942 | Ga0070660_100054928 | |||
| 943 | Ga0070691_10000026 | |||
| 944 | Ga0070687_100073037 | |||
| 945 | Ga0070661_100001119 | |||
| 946 | Ga0070692_10014598 | |||
| 947 | Ga0070669_100033359 | |||
| 948 | Ga0070675_100041650 | |||
| 949 | Ga0070671_100002638 | |||
| 950 | Ga0070671_100070267 | |||
| 951 | Ga0070674_100010253 | |||
| 952 | Ga0070659_100043240 | |||
| 953 | Ga0070703_10032672 | |||
| 954 | Ga0070709_10000310 | |||
| 955 | Ga0070709_10000739 | |||
| 956 | Ga0070709_10008569 | |||
| 957 | Ga0070709_10040728 | |||
| 958 | Ga0070714_100001250 | |||
| 959 | Ga0070714_100012169 | |||
| 960 | Ga0070713_100000008 | |||
| 961 | Ga0070713_100000522 | |||
| 962 | Ga0070713_100024863 | |||
| 963 | Ga0070713_100127594 | |||
| 964 | Ga0070713_100264608 | |||
| 965 | Ga0070710_10000543 | |||
| 966 | Ga0070710_10002534 | |||
| 967 | Ga0070711_100001947 | |||
| 968 | Ga0070711_100002225 | |||
| 969 | Ga0070705_100009562 | |||
| 970 | Ga0070694_100137370 | |||
| 971 | Ga0070663_100017486 | |||
| 972 | Ga0070663_100037815 | |||
| 973 | Ga0070699_100035800 | |||
| 974 | Ga0070679_100093559 | |||
| 975 | Ga0070684_100158634 | |||
| 976 | Ga0068853_100005373 | |||
| 977 | Ga0068853_100006184 | |||
| 978 | Ga0068853_100015125 | |||
| 979 | Ga0068853_100080394 | |||
| 980 | Ga0068853_100127873 | |||
| 981 | Ga0070686_100006493 | |||
| 982 | Ga0070665_100000377 | |||
| 983 | Ga0070665_100012096 | |||
| 984 | Ga0070665_100034898 | |||
| 985 | Ga0070665_100065580 | |||
| 986 | Ga0070665_100103296 | |||
| 987 | Ga0068855_100013342 | |||
| 988 | Ga0068855_100031633 | |||
| 989 | Ga0068855_100142420 | |||
| 990 | Ga0070664_100018970 | |||
| 991 | Ga0070664_100156385 | |||
| 992 | Ga0068857_100026875 | |||
| 993 | Ga0068857_100069357 | |||
| 994 | Ga0068854_100005459 | |||
| 995 | Ga0068854_100088901 | |||
| 996 | Ga0068856_100000362 | |||
| 997 | Ga0068856_100000870 | |||
| 998 | Ga0068856_100076616 | |||
| 999 | Ga0070702_100047408 | |||
| 1000 | Ga0068852_100000075 | |||
| 1001 | Ga0068852_100023190 | |||
| 1002 | Ga0068852_100025004 | |||
| 1003 | Ga0068852_100032917 | |||
| 1004 | Ga0068852_100038546 | |||
| 1005 | Ga0068859_100149326 | |||
| 1006 | Ga0068864_100002778 | |||
| 1007 | Ga0068861_100047107 | |||
| 1008 | Ga0068851_10040291 | |||
| 1009 | Ga0068870_10001735 | |||
| 1010 | Ga0068863_100001004 | |||
| 1011 | Ga0068860_100000258 | |||
| 1012 | Ga0068860_100019841 | |||
| 1013 | Ga0068862_100040727 | |||
| 1014 | Ga0081455_10002974 | |||
| 1015 | Ga0081455_10007544 | |||
| 1016 | Ga0081455_10009585 | |||
| 1017 | Ga0081455_10010629 | |||
| 1018 | Ga0081455_10010846 | |||
| 1019 | Ga0081455_10030415 | |||
| 1020 | Ga0081455_10047855 | |||
| 1021 | Ga0081455_10117456 | |||
| 1022 | Ga0081538_10013903 | |||
| 1023 | Ga0081538_10040597 | |||
| 1024 | Ga0081540_1000194 | |||
| 1025 | Ga0081540_1001759 | |||
| 1026 | Ga0081540_1001861 | |||
| 1027 | Ga0081540_1004924 | |||
| 1028 | Ga0081540_1014066 | |||
| 1029 | Ga0081540_1034596 | |||
| 1030 | Ga0081539_10034606 | |||
| 1031 | Ga0070717_10000447 | |||
| 1032 | Ga0070717_10103218 | |||
| 1033 | Ga0075365_10053925 | |||
| 1034 | Ga0075365_10080968 | |||
| 1035 | Ga0075365_10163517 | |||
| 1036 | Ga0075365_10166393 | |||
| 1037 | Ga0075363_100000277 | |||
| 1038 | Ga0075364_10023673 | |||
| 1039 | Ga0075364_10077019 | |||
| 1040 | Ga0075432_10000765 | |||
| 1041 | Ga0070715_10001232 | |||
| 1042 | Ga0070716_100015222 | |||
| 1043 | Ga0070712_100000435 | |||
| 1044 | Ga0070712_100009926 | |||
| 1045 | Ga0070712_100013554 | |||
| 1046 | Ga0070712_100031189 | |||
| 1047 | Ga0070712_100069673 | |||
| 1048 | Ga0070712_100097845 | |||
| 1049 | Ga0075362_10003250 | |||
| 1050 | Ga0075362_10017502 | |||
| 1051 | Ga0075362_10033274 | |||
| 1052 | Ga0075362_10047352 | |||
| 1053 | Ga0075362_10071535 | |||
| 1054 | Ga0075367_10003094 | |||
| 1055 | Ga0075367_10003260 | |||
| 1056 | Ga0075369_10009418 | |||
| 1057 | Ga0075427_10000083 | |||
| 1058 | Ga0075366_10085159 | |||
| 1059 | Ga0075370_10002012 | |||
| 1060 | Ga0075370_10027740 | |||
| 1061 | Ga0068871_100013243 | |||
| 1062 | Ga0075428_100013683 | |||
| 1063 | Ga0075428_100016545 | |||
| 1064 | Ga0075428_100043912 | |||
| 1065 | Ga0075428_100061386 | |||
| 1066 | Ga0075430_100000026 | |||
| 1067 | Ga0075430_100120227 | |||
| 1068 | Ga0075431_100000451 | |||
| 1069 | Ga0075431_100001409 | |||
| 1070 | Ga0075431_100019078 | |||
| 1071 | Ga0075431_100168458 | |||
| 1072 | Ga0075431_100204815 | |||
| 1073 | Ga0075433_10002991 | |||
| 1074 | Ga0075434_100000110 | |||
| 1075 | Ga0075429_100000247 | |||
| 1076 | Ga0075429_100009412 | |||
| 1077 | Ga0068865_100005919 | |||
| 1078 | Ga0068865_100006113 | |||
| 1079 | Ga0075436_100000099 | |||
| 1080 | Ga0075435_100155992 | |||
| 1081 | Ga0099794_10003348 | |||
| 1082 | Ga0099794_10003823 | |||
| 1083 | Ga0099795_10020770 | |||
| 1084 | Ga0105251_10024950 | |||
| 1085 | Ga0105250_10027657 | |||
| 1086 | Ga0105240_10002582 | |||
| 1087 | Ga0105240_10013140 | |||
| 1088 | Ga0105240_10049609 | |||
| 1089 | Ga0105240_10080254 | |||
| 1090 | Ga0105240_10176069 | |||
| 1091 | Ga0111539_10011184 | |||
| 1092 | Ga0111539_10115103 | |||
| 1093 | Ga0105245_10018686 | |||
| 1094 | Ga0105245_10060256 | |||
| 1095 | Ga0105245_10092135 | |||
| 1096 | Ga0105247_10014924 | |||
| 1097 | Ga0105247_10016598 | |||
| 1098 | Ga0105247_10081824 | |||
| 1099 | Ga0114129_10004371 | |||
| 1100 | Ga0114129_10008830 | |||
| 1101 | Ga0114129_10016344 | |||
| 1102 | Ga0114129_10063995 | |||
| 1103 | Ga0114129_10385561 | |||
| 1104 | Ga0105243_10015059 | |||
| 1105 | Ga0105241_10040753 | |||
| 1106 | Ga0105241_10158401 | |||
| 1107 | Ga0105241_10255250 | |||
| 1108 | Ga0105237_10000821 | |||
| 1109 | Ga0105237_10015554 | |||
| 1110 | Ga0105237_10103646 | |||
| 1111 | Ga0105237_10351600 | |||
| 1112 | Ga0105238_10041357 | |||
| 1113 | Ga0105238_10087423 | |||
| 1114 | Ga0105238_10204252 | |||
| 1115 | Ga0105238_10215860 | |||
| 1116 | Ga0105238_10267093 | |||
| 1117 | Ga0099796_10008753 | |||
| 1118 | Ga0099796_10030027 | |||
| 1119 | Ga0105239_10073728 | |||
| 1120 | Ga0105239_10122337 | |||
| 1121 | Ga0105239_10150135 | |||
| 1122 | Ga0105239_10178740 | |||
| 1123 | Ga0105246_10014170 | |||
| 1124 | Ga0105246_10248344 | |||
| 1125 | Ga0157373_10153941 | |||
| 1126 | Ga0157371_10017806 | |||
| 1127 | Ga0157370_10015443 | |||
| 1128 | Ga0157370_10187418 | |||
| 1129 | Ga0157370_10247322 | |||
| 1130 | Ga0157370_10315583 | |||
| 1131 | Ga0157369_10022874 | |||
| 1132 | Ga0157378_10153594 | |||
| 1133 | Ga0157378_10231739 | |||
| 1134 | Ga0157372_10307561 | |||
| 1135 | Ga0157375_10349374 | |||
| 1136 | Ga0163163_10000491 | |||
| 1137 | Ga0163163_10034357 | |||
| 1138 | Ga0157380_10010728 | |||
| 1139 | Ga0157377_10014115 | |||
| 1140 | Ga0157379_10002383 | |||
| 1141 | Ga0157376_10192907 | |||
| 1142 | Ga0183363_1001 | |||
| 1143 | Ga0214544_1017682 | |||
| 1144 | Ga0214542_1018937 | |||
| 1145 | Ga0214545_1018591 | |||
| 1146 | Ga0214543_1017937 | |||
| 1147 | Ga0213873_10014678 | |||
| 1148 | Ga0213872_10015829 | |||
| 1149 | Ga0213876_10000908 | |||
| 1150 | Ga0213871_10003652 | |||
| 1151 | Ga0209233_1000015 | |||
| 1152 | Ga0209233_1000408 | |||
| 1153 | Ga0209455_1002034 | |||
| 1154 | Ga0209564_1000943 | |||
| 1155 | Ga0209758_1000808 | |||
| 1156 | Ga0209758_1001790 | |||
| 1157 | Ga0209758_1001948 | |||
| 1158 | Ga0209758_1008526 | |||
| 1159 | Ga0209256_1005139 | |||
| 1160 | Ga0207426_1003018 | |||
| 1161 | Ga0207653_10028725 | |||
| 1162 | Ga0207682_10001151 | |||
| 1163 | Ga0207692_10006382 | |||
| 1164 | Ga0207692_10020782 | |||
| 1165 | Ga0207710_10019075 | |||
| 1166 | Ga0207680_10085364 | |||
| 1167 | Ga0207685_10009223 | |||
| 1168 | Ga0207699_10000140 | |||
| 1169 | Ga0207699_10013924 | |||
| 1170 | Ga0207645_10014613 | |||
| 1171 | Ga0207643_10000431 | |||
| 1172 | Ga0207705_10000075 | |||
| 1173 | Ga0207705_10015279 | |||
| 1174 | Ga0207705_10016993 | |||
| 1175 | Ga0207654_10098316 | |||
| 1176 | Ga0207654_10115582 | |||
| 1177 | Ga0207695_10041879 | |||
| 1178 | Ga0207695_10106086 | |||
| 1179 | Ga0207695_10114018 | |||
| 1180 | Ga0207695_10136440 | |||
| 1181 | Ga0207695_10353832 | |||
| 1182 | Ga0207671_10000227 | |||
| 1183 | Ga0207671_10018286 | |||
| 1184 | Ga0207671_10198089 | |||
| 1185 | Ga0207693_10001130 | |||
| 1186 | Ga0207693_10003998 | |||
| 1187 | Ga0207693_10006061 | |||
| 1188 | Ga0207693_10010291 | |||
| 1189 | Ga0207693_10064897 | |||
| 1190 | Ga0207693_10075861 | |||
| 1191 | Ga0207663_10001749 | |||
| 1192 | Ga0207663_10002943 | |||
| 1193 | Ga0207663_10015808 | |||
| 1194 | Ga0207663_10088641 | |||
| 1195 | Ga0207657_10008772 | |||
| 1196 | Ga0207657_10017207 | |||
| 1197 | Ga0207657_10025197 | |||
| 1198 | Ga0207657_10025318 | |||
| 1199 | Ga0207657_10048737 | |||
| 1200 | Ga0207649_10046672 | |||
| 1201 | Ga0207646_10247524 | |||
| 1202 | Ga0207694_10021178 | |||
| 1203 | Ga0207694_10113051 | |||
| 1204 | Ga0207650_10019594 | |||
| 1205 | Ga0207650_10100874 | |||
| 1206 | Ga0207659_10155066 | |||
| 1207 | Ga0207687_10004916 | |||
| 1208 | Ga0207687_10247019 | |||
| 1209 | Ga0207700_10000011 | |||
| 1210 | Ga0207700_10000580 | |||
| 1211 | Ga0207700_10010413 | |||
| 1212 | Ga0207700_10024061 | |||
| 1213 | Ga0207700_10030319 | |||
| 1214 | Ga0207700_10040436 | |||
| 1215 | Ga0207664_10003476 | |||
| 1216 | Ga0207664_10307366 | |||
| 1217 | Ga0207644_10007189 | |||
| 1218 | Ga0207690_10131151 | |||
| 1219 | Ga0207706_10012680 | |||
| 1220 | Ga0207686_10059722 | |||
| 1221 | Ga0207670_10132165 | |||
| 1222 | Ga0207669_10012368 | |||
| 1223 | Ga0207704_10215714 | |||
| 1224 | Ga0207665_10008900 | |||
| 1225 | Ga0207691_10000977 | |||
| 1226 | Ga0207691_10061074 | |||
| 1227 | Ga0207691_10195302 | |||
| 1228 | Ga0207711_10008479 | |||
| 1229 | Ga0207711_10113524 | |||
| 1230 | Ga0207689_10009633 | |||
| 1231 | Ga0207689_10028141 | |||
| 1232 | Ga0207661_10025870 | |||
| 1233 | Ga0207679_10026629 | |||
| 1234 | Ga0207667_10012235 | |||
| 1235 | Ga0207667_10019312 | |||
| 1236 | Ga0207667_10028571 | |||
| 1237 | Ga0207667_10073041 | |||
| 1238 | Ga0207667_10226843 | |||
| 1239 | Ga0207651_10071351 | |||
| 1240 | Ga0207712_10162224 | |||
| 1241 | Ga0207668_10127859 | |||
| 1242 | Ga0207640_10000996 | |||
| 1243 | Ga0207658_10027942 | |||
| 1244 | Ga0207703_10111931 | |||
| 1245 | Ga0207639_10004126 | |||
| 1246 | Ga0207639_10045949 | |||
| 1247 | Ga0207678_10007632 | |||
| 1248 | Ga0207678_10011088 | |||
| 1249 | Ga0207678_10022619 | |||
| 1250 | Ga0207678_10026945 | |||
| 1251 | Ga0207678_10033440 | |||
| 1252 | Ga0207678_10038638 | |||
| 1253 | Ga0207708_10012687 | |||
| 1254 | Ga0207708_10042582 | |||
| 1255 | Ga0207702_10000162 | |||
| 1256 | Ga0207702_10011446 | |||
| 1257 | Ga0207702_10065053 | |||
| 1258 | Ga0207702_10119146 | |||
| 1259 | Ga0207641_10206087 | |||
| 1260 | Ga0207641_10313168 | |||
| 1261 | Ga0207648_10000825 | |||
| 1262 | Ga0207648_10135498 | |||
| 1263 | Ga0207676_10016634 | |||
| 1264 | Ga0207674_10014539 | |||
| 1265 | Ga0207674_10031587 | |||
| 1266 | Ga0207674_10274086 | |||
| 1267 | Ga0207675_100000366 | |||
| 1268 | Ga0207675_100020640 | |||
| 1269 | Ga0207683_10028078 | |||
| 1270 | Ga0207683_10082337 | |||
| 1271 | Ga0207683_10123150 | |||
| 1272 | Ga0207698_10000005 | |||
| 1273 | Ga0207698_10004789 | |||
| 1274 | Ga0207698_10012030 | |||
| 1275 | Ga0207698_10077032 | |||
| 1276 | Ga0207698_10251692 | |||
| 1277 | Ga0209588_1009148 | |||
| 1278 | Ga0209974_10002714 | |||
| 1279 | Ga0207428_10000140 | |||
| 1280 | Ga0207428_10010573 | |||
| 1281 | Ga0268266_10000677 | |||
| 1282 | Ga0268266_10000727 | |||
| 1283 | Ga0268266_10001826 | |||
| 1284 | Ga0268266_10003534 | |||
| 1285 | Ga0268266_10096334 | |||
| 1286 | Ga0268265_10008971 | |||
| 1287 | Ga0268265_10024352 | |||
| 1288 | Ga0268264_10000245 | |||
| 1289 | Ga0268264_10025692 | |||
| 1290 | Ga0265318_10000015 | |||
| 1291 | Ga0265318_10033968 | |||
| 1292 | Ga0307517_10000111 | |||
| 1293 | Ga0307515_10197518 | |||
| 1294 | Ga0307515_10258980 | |||
| 1295 | Ga0265338_10000005 | |||
| 1296 | Ga0265338_10017352 | |||
| 1297 | Ga0265338_10017836 | |||
| 1298 | Ga0265760_10007492 | |||
| 1299 | Ga0265330_10037738 | |||
| 1300 | Ga0265332_10003973 | |||
| 1301 | Ga0265320_10000561 | |||
| 1302 | Ga0265325_10000005 | |||
| 1303 | Ga0265325_10006286 | |||
| 1304 | Ga0265325_10015648 | |||
| 1305 | Ga0265340_10006415 | |||
| 1306 | Ga0265340_10032893 | |||
| 1307 | Ga0265339_10000088 | |||
| 1308 | Ga0265339_10000622 | |||
| 1309 | Ga0265339_10000822 | |||
| 1310 | Ga0265339_10001947 | |||
| 1311 | Ga0265331_10003530 | |||
| 1312 | Ga0265331_10008230 | |||
| 1313 | Ga0265331_10050878 | |||
| 1314 | Ga0265313_10000032 | |||
| 1315 | Ga0265313_10000173 | |||
| 1316 | Ga0265313_10000482 | |||
| 1317 | Ga0307508_10001153 | |||
| 1318 | Ga0265314_10015573 | |||
| 1319 | Ga0265314_10028710 | |||
| 1320 | Ga0265314_10047199 | |||
| 1321 | Ga0265342_10000233 | |||
| 1322 | Ga0307409_100135333 | |||
| 1323 | Ga0307416_100110690 | |||
| 1324 | Ga0307414_10059243 | |||
| 1325 | Ga0307510_10003330 | |||
| 1326 | Ga0315911_1000001 | |||
| 1327 | Ga0373934_0012522 | |||
| 1328 | Ga0373923_0041645 | |||
| 1329 | Ga0373936_0008905 | |||
| 1330 | Ga0373936_0041875 | |||
| 1331 | Ga0373945_0008371 | |||
| 1332 | Ga0373953_0004147 | |||
| 1333 | Ga0373954_0076886 | |||
| 1334 | Ga0373956_0061559 | |||
| 1335 | Ga0373943_0000440 | |||
| 1336 | Ga0373943_0001594 | |||
| 1337 | Ga0373943_0009544 | |||
| 1338 | Ga0373943_0041344 | |||
| 1339 | Ga0373946_0003168 | |||
| 1340 | Ga0373946_0005763 | |||
| 1341 | Ga0373955_0013231 | |||
| 1342 | Ga0373955_0033656 | |||
| 1343 | Ga0373924_0017653 | |||
| 1344 | Ga0373924_0037002 | |||
| 1345 | Ga0373931_0021073 | |||
| 1346 | Ga0373935_0034322 | |||
| 1347 | Ga0373935_0044142 | |||
| 1348 | Ga0373935_0128891 | |||
| 1349 | Ga0373927_0000829 | |||
| 1350 | Ga0373927_0006747 | |||
| 1351 | Ga0373927_0102460 | |||
| 1352 | Ga0373933_0009315 | |||
| 1353 | Ga0373933_0121048 | |||
| 1354 | Ga0373947_0000393 | |||
| 1355 | Ga0373947_0015918 | |||
| 1356 | Ga0373937_0002968 | |||
| 1357 | Ga0373937_0050943 | |||
| 1358 | Ga0373937_0113539 | |||
| 1359 | Ga0373937_0137423 | |||
| 1360 | Ga0373925_0002574 | |||
| 1361 | Ga0373925_0048709 | |||
| 1362 | Ga0373925_0066546 | |||
| 1363 | Ga0395899_0000151 | |||
| 1364 | Ga0395900_0058167 | |||
| 1365 | Ga0395900_0098004 | |||
| 1366 | Ga0395900_0351562 | |||
| 1367 | Ga0395905_0008572 | |||
| 1368 | Ga0436364_0056841 | |||
| 1369 | Ga0436364_0344786 | |||
| 1370 | Ga0436364_0883805 | |||
| 1371 | Ga0436364_1010630 | |||
| 1372 | Ga0395901_0113052 | |||
| 1373 | Ga0436365_0300465 | |||
| 1374 | Ga0436365_0599448 | |||
| 1375 | Ga0436365_1236061 | |||
| 1376 | Ga0436365_1340575 | |||
| 1377 | Ga0436365_1578866 | |||
| 1378 | Ga0436365_1822707 | |||
| 1379 | Ga0436360_0762773 | |||
| 1380 | Ga0436361_0099990 | |||
| 1381 | Ga0436362_0044370 | |||
| 1382 | Ga0439445_0007388 | |||
| 1383 | Ga0466966_0155289 | |||
| 1384 | Ga0466963_0045862 | |||
| 1385 | Ga0466957_0115147 | |||
| 1386 | Ga0466959_0028565 | |||
| 1387 | Ga0466958_0035636 | |||
| 1388 | Ga0466967_0230529 | |||
| 1389 | Ga0495617_039501 | |||
| 1390 | Ga0495592_0030516 | |||
| 1391 | Ga0495590_0025611 | |||
| 1392 | Ga0495629_0018296 | |||
| 1393 | Ga0495629_0026350 | |||
| 1394 | Ga0495638_0028797 | |||
| 1395 | Ga0495651_0002898 | |||
| 1396 | Ga0495651_0053124 | |||
| 1397 | Ga0495653_0004703 | |||
| 1398 | Ga0495650_0049588 | |||
| 1399 | Ga0495580_0053797 | |||
| 1400 | Ga0495580_0063181 | |||
| 1401 | Ga0495639_0020683 | |||
| 1402 | Ga0495639_0055033 | |||
| 1403 | Ga0495662_0001821 | |||
| 1404 | Ga0495664_0000147 | |||
| 1405 | Ga0495584_0002124 | |||
| 1406 | Ga0495585_0052560 | |||
| 1407 | Ga0495594_0028286 | |||
| 1408 | Ga0495594_0063898 | |||
| 1409 | Ga0495607_0052549 | |||
| 1410 | Ga0495606_0015801 | |||
| 1411 | Ga0495608_0030981 | |||
| 1412 | Ga0495610_0024380 | |||
| 1413 | Ga0495610_0046336 | |||
| 1414 | Ga0495616_0024868 | |||
| 1415 | Ga0495616_0084039 | |||
| 1416 | Ga0495618_0001877 | |||
| 1417 | Ga0495618_0052262 | |||
| 1418 | Ga0495620_0042192 | |||
| 1419 | Ga0495628_0117871 | |||
| 1420 | Ga0495630_0001952 | |||
| 1421 | Ga0495630_0036955 | |||
| 1422 | Ga0495631_0031506 | |||
| 1423 | Ga0495632_0048220 | |||
| 1424 | Ga0495648_0055384 | |||
| 1425 | Ga0495648_0070035 | |||
| 1426 | Ga0495663_0011031 | |||
| 1427 | Ga0495663_0018223 | |||
| 1428 | Ga0495663_0026301 | |||
| 1429 | Ga0495642_0035680 | |||
| 1430 | Ga0495652_0038908 | |||
| 1431 | Ga0495665_0026023 | |||
| 1432 | Ga0495640_0003988 | |||
| 1433 | Ga0495640_0016016 | |||
| 1434 | Ga0495640_0018616 | |||
| 1435 | Ga0495640_0076083 | |||
| 1436 | Ga0495587_0005767 | |||
| 1437 | Ga0495587_0080216 | |||
| 1438 | Ga0495598_0009785 | |||
| 1439 | Ga0495598_0012176 | |||
| 1440 | Ga0495598_0012522 | |||
| 1441 | Ga0495598_0019139 | |||
| 1442 | Ga0495609_0043291 | |||
| 1443 | Ga0495645_0000695 | |||
| 1444 | Ga0495645_0020278 | |||
| 1445 | Ga0495645_0046620 | |||
| 1446 | Ga0495667_0046423 | |||
| 1447 | Ga0495667_0093862 | |||
| 1448 | Ga0495656_0004791 | |||
| 1449 | Ga0495656_0004869 | |||
| 1450 | Ga0495656_0011721 | |||
| 1451 | Ga0495656_0043463 | |||
| 1452 | Ga0495634_0003638 | |||
| 1453 | Ga0495634_0022313 | |||
| 1454 | Ga0495634_0028582 | |||
| 1455 | Ga0495634_0030570 | |||
| 1456 | Ga0495634_0051752 | |||
| 1457 | Ga0495611_0029288 | |||
| 1458 | Ga0495635_0001303 | |||
| 1459 | Ga0495635_0024452 | |||
| 1460 | Ga0495635_0082082 | |||
| 1461 | Ga0495661_0134686 | |||
| 1462 | Ga0495588_0001989 | |||
| 1463 | Ga0495657_0015784 | |||
| 1464 | Ga0495657_0058062 | |||
| 1465 | Ga0495599_0015104 | |||
| 1466 | Ga0495623_0047760 | |||
| 1467 | Ga0495646_0027762 | |||
| 1468 | Ga0495646_0036024 | |||
| 1469 | Ga0495647_0070743 | |||
| 1470 | Ga0495613_0020414 | |||
| 1471 | Ga0495624_0005355 | |||
| 1472 | Ga0495624_0007520 | |||
| 1473 | Ga0495624_0046918 | |||
| 1474 | Ga0495624_0066900 | |||
| 1475 | Ga0495670_0011468 | |||
| 1476 | Ga0495670_0052910 | |||
| 1477 | Ga0495670_0068679 | |||
| 1478 | Ga0495649_0007881 | |||
| 1479 | Ga0495649_0039226 | |||
| 1480 | Ga0495649_0069132 | |||
| 1481 | Ga0495589_0037484 | |||
| 1482 | Ga0495600_0013812 | |||
| 1483 | Ga0495604_0000643 | |||
| 1484 | Ga0495604_0066980 | |||
| 1485 | Ga0495604_0113211 | |||
| 1486 | Ga0495674_0002888 | |||
| 1487 | Ga0495674_0032807 | |||
| 1488 | Ga0495674_0053632 | |||
| 1489 | Ga0495674_0087934 | |||
| 1490 | Ga0495672_0015830 | |||
| 1491 | Ga0495672_0023135 | |||
| 1492 | Ga0495676_0111851 | |||
| 1493 | Ga0495680_0002277 | |||
| 1494 | Ga0495680_0033115 | |||
| 1495 | Ga0495680_0125717 | |||
| 1496 | Ga0495677_0049378 | |||
| 1497 | Ga0495684_0002109 | |||
| 1498 | Ga0495684_0003387 | |||
| 1499 | Ga0495684_0010675 | |||
| 1500 | Ga0495684_0038567 | |||
| 1501 | Ga0495686_0106874 | |||
| 1502 | Ga0495593_0015087 | |||
| 1503 | Ga0495602_0116017 | |||
| 1504 | Ga0495615_0030541 | |||
| 1505 | Ga0496100_0019308 | |||
| 1506 | Ga0496100_0097807 | |||
| 1507 | Ga0496101_0004879 | |||
| 1508 | Ga0496101_0026770 | |||
| 1509 | Ga0496101_0247270 | |||
| 1510 | Ga0496102_0003387 | |||
| 1511 | Ga0496102_0072275 | |||
| 1512 | Ga0496102_0076352 | |||
| 1513 | Ga0496102_0201928 | |||
| 1514 | Ga0496103_0001033 | |||
| 1515 | Ga0496104_0005340 | |||
| 1516 | Ga0496104_0007801 | |||
| 1517 | Ga0496104_0013744 | |||
| 1518 | Ga0496104_0047965 | |||
| 1519 | Ga0496104_0072489 | |||
| 1520 | Ga0496105_0006335 | |||
| 1521 | Ga0496105_0025501 | |||
| 1522 | Ga0496106_0166262 | |||
| 1523 | Ga0496106_0171011 | |||
| 1524 | Ga0496107_0075248 | |||
| 1525 | Ga0496107_0292237 | |||
| 1526 | Ga0496108_0004005 | |||
| 1527 | Ga0496108_0012723 | |||
| 1528 | Ga0496108_0111899 | |||
| 1529 | Ga0496108_0141917 | |||
| 1530 | Ga0496109_0059073 | |||
| 1531 | Ga0496109_0071325 | |||
| 1532 | Ga0496110_0015820 | |||
| 1533 | Ga0496110_0025176 | |||
| 1534 | Ga0496111_0034923 | |||
| 1535 | Ga0496111_0044803 | |||
| 1536 | Ga0496111_0064581 | |||
| 1537 | Ga0496112_0016711 | |||
| 1538 | Ga0496112_0065913 | |||
| 1539 | Ga0496113_0009665 | |||
| 1540 | Ga0496113_0039825 | |||
| 1541 | Ga0496114_0261513 | |||
| 1542 | Ga0496115_0152394 | |||
| 1543 | Ga0496116_0000092 | |||
| 1544 | Ga0496116_0004967 | |||
| 1545 | Ga0496117_0025927 | |||
| 1546 | Ga0496117_0131036 | |||
| 1547 | Ga0496118_0003713 | |||
| 1548 | Ga0496118_0140762 | |||
| 1549 | Ga0496119_0046060 | |||
| 1550 | Ga0496120_0062526 | |||
| 1551 | Ga0496121_0001453 | |||
| 1552 | Ga0496121_0076249 | |||
| 1553 | Ga0496121_0149551 | |||
| 1554 | Ga0496123_0010093 | |||
| 1555 | Ga0496124_0087263 | |||
| 1556 | Ga0496124_0223949 | |||
| 1557 | Ga0496125_0000600 | |||
| 1558 | Ga0496125_0003378 | |||
| 1559 | Ga0496125_0012349 | |||
| 1560 | Ga0496125_0016087 | |||
| 1561 | Ga0496126_0005363 | |||
| 1562 | Ga0496126_0006357 | |||
| 1563 | Ga0496126_0012601 | |||
| 1564 | Ga0496126_0013331 | |||
| 1565 | Ga0496126_0030143 | |||
| 1566 | Ga0496126_0040376 | |||
| 1567 | Ga0496126_0044205 | |||
| 1568 | Ga0496126_0052280 | |||
| 1569 | Ga0496126_0091007 | |||
| 1570 | Ga0496126_0102827 | |||
| 1571 | Ga0496126_0168034 | |||
| 1572 | Ga0496126_0182215 | |||
| 1573 | Ga0496126_0190562 | |||
| 1574 | Ga0495682_0025804 | |||
| 1575 | Ga0501031_0004551 | |||
| 1576 | Ga0501031_0005519 | |||
| 1577 | Ga0501031_0007975 | |||
| 1578 | Ga0501031_0015856 | |||
| 1579 | Ga0501031_0122119 | |||
| 1580 | Ga0501032_0017717 | |||
| 1581 | Ga0501032_0029614 | |||
| 1582 | Ga0501032_0058391 | |||
| 1583 | Ga0501032_0176984 | |||
| 1584 | Ga0501033_0002357 | |||
| 1585 | Ga0501033_0003960 | |||
| 1586 | Ga0501033_0012332 | |||
| 1587 | Ga0501033_0020067 | |||
| 1588 | Ga0501033_0049959 | |||
| 1589 | Ga0501033_0097648 | |||
| 1590 | Ga0501033_0106597 | |||
| 1591 | Ga0501034_0001188 | |||
| 1592 | Ga0501034_0005818 | |||
| 1593 | Ga0501034_0007444 | |||
| 1594 | Ga0501034_0049402 | |||
| 1595 | Ga0501034_0067987 | |||
| 1596 | Ga0501034_0079596 | |||
| 1597 | Ga0501034_0087883 | |||
| 1598 | Ga0501034_0101821 | |||
| 1599 | Ga0501034_0196613 | |||
| 1600 | Ga0501036_0000992 | |||
| 1601 | Ga0501036_0002298 | |||
| 1602 | Ga0501036_0162233 | |||
| 1603 | Ga0501037_0001908 | |||
| 1604 | Ga0501037_0026075 | |||
| 1605 | Ga0501037_0028885 | |||
| 1606 | Ga0501037_0046474 | |||
| 1607 | Ga0501038_0000319 | |||
| 1608 | Ga0501038_0017132 | |||
| 1609 | Ga0501038_0019199 | |||
| 1610 | Ga0501038_0030908 | |||
| 1611 | Ga0501038_0076882 | |||
| 1612 | Ga0501039_0018593 | |||
| 1613 | Ga0501039_0019245 | |||
| 1614 | Ga0501039_0020632 | |||
| 1615 | Ga0501039_0037800 | |||
| 1616 | Ga0501039_0047031 | |||
| 1617 | Ga0501040_0021621 | |||
| 1618 | Ga0501042_0032025 | |||
| 1619 | Ga0501043_0022088 | |||
| 1620 | Ga0501046_0013563 | |||
| 1621 | Ga0501046_0021773 | |||
| 1622 | Ga0501046_0032910 | |||
| 1623 | Ga0501046_0085755 | |||
| 1624 | Ga0501046_0098415 | |||
| 1625 | Ga0501046_0101309 | |||
| 1626 | Ga0501047_0005396 | |||
| 1627 | Ga0501047_0017866 | |||
| 1628 | Ga0501047_0047369 | |||
| 1629 | Ga0501047_0057254 | |||
| 1630 | Ga0501047_0066167 | |||
| 1631 | Ga0501047_0114884 | |||
| 1632 | Ga0501048_0011226 | |||
| 1633 | Ga0501048_0012479 | |||
| 1634 | Ga0501068_0008709 | |||
| 1635 | Ga0501068_0098618 | |||
| 1636 | Ga0501069_0007703 | |||
| 1637 | Ga0501069_0049752 | |||
| 1638 | Ga0501070_0002559 | |||
| 1639 | Ga0501070_0009673 | |||
| 1640 | Ga0501070_0019935 | |||
| 1641 | Ga0501071_0067076 | |||
| 1642 | Ga0501072_0081943 | |||
| 1643 | Ga0501072_0113619 | |||
| 1644 | Ga0501073_0000802 | |||
| 1645 | Ga0501073_0014281 | |||
| 1646 | Ga0501073_0076193 | |||
| 1647 | Ga0501073_0081044 | |||
| 1648 | Ga0501073_0180223 | |||
| 1649 | Ga0501074_0000138 | |||
| 1650 | Ga0501074_0023846 | |||
| 1651 | Ga0501077_0144320 | |||
| 1652 | Ga0501079_0002710 | |||
| 1653 | Ga0501080_0025164 | |||
| 1654 | Ga0501083_0015481 | |||
| 1655 | Ga0501083_0031844 | |||
| 1656 | Ga0501035_0001024 | |||
| 1657 | Ga0501035_0011540 | |||
| 1658 | Ga0501035_0019433 | |||
| 1659 | Ga0501035_0024254 | |||
| 1660 | Ga0501035_0027006 | |||
| 1661 | Ga0501035_0082971 | |||
| 1662 | Ga0501035_0089302 | |||
| 1663 | Ga0501035_0126136 | |||
| 1664 | Ga0501044_0001970 | |||
| 1665 | Ga0501044_0008807 | |||
| 1666 | Ga0501044_0023213 | |||
| 1667 | Ga0501044_0044972 | |||
| 1668 | Ga0501044_0064394 | |||
| 1669 | Ga0501044_0105644 | |||
| 1670 | Ga0501044_0111682 | |||
| 1671 | Ga0501044_0138195 | |||
| 1672 | Ga0501045_0011643 | |||
| 1673 | nmdc:mga03683_22010_c1 | |||
| 1674 | nmdc:mga03683_5346_c1 | |||
| 1675 | nmdc:mga03n38_159_c1 | |||
| 1676 | nmdc:mga00v17_106199_c1 | |||
| 1677 | nmdc:mga00v17_56888_c1 | |||
| 1678 | nmdc:mga00v17_61162_c1 | |||
| 1679 | nmdc:mga0yw44_100628_c1 | |||
| 1680 | nmdc:mga0yw44_3790_c1 | |||
| 1681 | nmdc:mga0k408_90708_c1 | |||
| 1682 | nmdc:mga04h51_8174_c1 | |||
| 1683 | nmdc:mga07m45_15508_c1 | |||
| 1684 | nmdc:mga07m45_27984_c1 | |||
| 1685 | nmdc:mga05p37_18514_c1 | |||
| 1686 | nmdc:mga05p37_23888_c1 | |||
| 1687 | nmdc:mga05p37_285554_c1 | |||
| 1688 | nmdc:mga05p37_853_c1 | |||
| 1689 | nmdc:mga09592_12918_c1 | |||
| 1690 | nmdc:mga09592_19678_c1 | |||
| 1691 | nmdc:mga0qj67_360891_c1 | |||
| 1692 | nmdc:mga0qj67_37662_c1 | |||
| 1693 | nmdc:mga06r32_146745_c1 | |||
| 1694 | nmdc:mga06r32_205414_c1 | |||
| 1695 | nmdc:mga06r32_557_c1 | |||
| 1696 | nmdc:mga06r32_61387_c1 | |||
| 1697 | nmdc:mga06r32_77538_c1 | |||
| 1698 | nmdc:mga08y16_202602_c1 | |||
| 1699 | nmdc:mga08y16_22775_c1 | |||
| 1700 | nmdc:mga0n895_186339_c1 | |||
| 1701 | nmdc:mga0n895_221558_c1 | |||
| 1702 | nmdc:mga0rr50_87676_c1 | |||
| 1703 | nmdc:mga08x19_15383_c1 | |||
| 1704 | nmdc:mga08x19_394_c1 | |||
| 1705 | nmdc:mga0sz30_7308_c1 | |||
| 1706 | nmdc:mga0sz30_82403_c1 | |||
| 1707 | Ga0495601_0000763 | |||
| 1708 | Ga0495601_0004531 | |||
| 1709 | Ga0495601_0024258 | |||
| 1710 | Ga0495601_0040295 | |||
| 1711 | Ga0495601_0068715 | |||
| 1712 | Ga0495601_0120394 | |||
| 1713 | Ga0495612_0011755 | |||
| 1714 | Ga0495612_0015550 | |||
| 1715 | Ga0495612_0024602 | |||
| 1716 | Ga0495595_0004091 | |||
| 1717 | Ga0495619_0000374 | |||
| 1718 | Ga0495619_0001194 | |||
| 1719 | Ga0495619_0047806 | |||
| 1720 | Ga0495619_0048814 | |||
| 1721 | Ga0495619_0093243 | |||
| 1722 | Ga0500578_0094412 | |||
| 1723 | Ga0500578_0155114 | |||
| 1724 | Ga0500566_0000082 | |||
| 1725 | Ga0500641_0006634 | |||
| 1726 | Ga0500555_029892 | |||
| 1727 | Ga0500556_0000002 | |||
| 1728 | Ga0500572_000521 | |||
| 1729 | Ga0500592_001387 | |||
| 1730 | Ga0500595_000890 | |||
| 1731 | Ga0500595_001314 | |||
| 1732 | Ga0500595_006225 | |||
| 1733 | Ga0500595_023161 | |||
| 1734 | Ga0500608_000450 | |||
| 1735 | Ga0500642_0000115 | |||
| 1736 | Ga0500559_0000282 | |||
| 1737 | Ga0500559_0000574 | |||
| 1738 | Ga0500559_0046470 | |||
| 1739 | Ga0500568_0002196 | |||
| 1740 | Ga0500577_0000716 | |||
| 1741 | Ga0500589_049180 | |||
| 1742 | Ga0500604_0006158 | |||
| 1743 | Ga0500604_0007717 | |||
| 1744 | Ga0500616_0000069 | |||
| 1745 | Ga0500616_0028455 | |||
| 1746 | Ga0500622_0036772 | |||
| 1747 | Ga0500634_0000517 | |||
| 1748 | Ga0500634_0073233 | |||
| 1749 | Ga0500639_011094 | |||
| 1750 | Ga0500639_039988 | |||
| 1751 | Ga0500636_0003738 | |||
| 1752 | Ga0500637_0094081 | |||
| 1753 | Ga0500609_006233 | |||
| 1754 | Ga0501084_0027346 | |||
| 1755 | Ga0501082_0000084 | |||
| 1756 | Ga0501082_0005189 | |||
| 1757 | Ga0501082_0092963 | |||
| 1758 | Ga0530510_0053026 | |||
| 1759 | 2508698851 | |||
| 1760 | 2509144716 | |||
| 1761 | 2509396503 | |||
| 1762 | 2513638954 | |||
| 1763 | 2513694437 | |||
| 1764 | 2513718655 | |||
| 1765 | 2524534115 | |||
| 1766 | 2545679365 | |||
| 1767 | 2596375124 | |||
| 1768 | 2597813552 | |||
| 1769 | 2603858889 | |||
| 1770 | 2643773087 | |||
| 1771 | 2643775927 | |||
| 1772 | 2643912255 | |||
| 1773 | 2643963449 | |||
| 1774 | 2644167499 | |||
| 1775 | 2644167500 | |||
| 1776 | 2644347262 | |||
| 1777 | 2644347263 | |||
| 1778 | 2644410568 | |||
| 1779 | 2738744551 | |||
| 1780 | 2739353781 | |||
| 1781 | 2739612834 | |||
| 1782 | 2793079789 | |||
| 1783 | 2829748923 | |||
| 1784 | 2841739473 | |||
| 1785 | 2842701408 | |||
| 1786 | 2856347445 | |||
| 1787 | 2861694959 | |||
| 1788 | 2871479635 | |||
| 1789 | 2874607026 | |||
| 1790 | 2876817979 | |||
| 1791 | 2878794749 | |||
| 1792 | 2879117142 | |||
| 1793 | 2881366734 | |||
| 1794 | 2885317797 | |||
| 1795 | 2885371799 | |||
| 1796 | 2888347002 | |||
| 1797 | 2889034875 | |||
| 1798 | 2889311795 | |||
| 1799 | 2891050974 | |||
| 1800 | 2902335374 | |||
| 1801 | 2902409465 | |||
| 1802 | 2903728964 | |||
| 1803 | 2904702139 | |||
| 1804 | 2908779444 | |||
| 1805 | 2919453915 | |||
| 1806 | 2922364696 | |||
| 1807 | 2924755070 | |||
| 1808 | 2928126474 | |||
| 1809 | 2932403311 | |||
| 1810 | 2932797443 | |||
| 1811 | 2935989574 | |||
| 1812 | 2937839044 | |||
| 1813 | 2958078014 | |||
| 1814 | 2970530523 | |||
| 1815 | 2970544169 | |||
| 1816 | 2995393177 | |||
| 1817 | 3003670801 | |||
| 1818 | 3005599260 | |||
| 1819 | 641644550 | |||
| 1820 | 643601799 | |||
| 1821 | 8004400175 | |||
| 1822 | 8004637217 | |||
| 1823 | 8006940197 | |||
| 1824 | 8006972493 | |||
| 1825 | 8006979976 | |||
| 1826 | 8006988520 | |||
| 1827 | 8006995272 | |||
| 1828 | 8016553335 | |||
| 1829 | 8048747687 | |||
| 1830 | 8055620968 | |||
| 1831 | 8056679233 | |||
| 1832 | 8056968059 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5udf-assembly1.cif.gz_B | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8866 | 61 | 262 |
| 5udf-assembly1.cif.gz_D | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8707 | 61 | 262 |
| 5udf-assembly1.cif.gz_C | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8613 | 61 | 262 |
| 5udf-assembly1.cif.gz_B | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8532 | 61 | 262 |
| 5udf-assembly1.cif.gz_D | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8508 | 61 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9BPU3_378_783_3.40.850.10 | Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain | 0.5593 | 170 | 202 | 3.40.850.10 |
| af_A0A1D6JR45_49_209_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.5165 | 288 | 420 | 1.10.1760.20 |
| 1cz5A01 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.5158 | 150 | 236 | 2.40.40.20 |
| af_Q1PDX9_48_208_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.5063 | 292 | 420 | 1.10.1760.20 |
| af_Q92376_420_824_3.40.850.10 | Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain | 0.5032 | 172 | 202 | 3.40.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D9KPG3-F1-model_v4 | Lipoprotein-releasing system transmembrane subunit LolC | 0.9502 | 8 | 422 |
GO:0042953
GO:0044874 GO:0098797 |
| AF-A0A7C1AI24-F1-model_v4 | Lipoprotein-releasing ABC transporter permease subunit | 0.9424 | 1 | 362 |
GO:0042953
GO:0044874 GO:0098797 |
| AF-A0A2D9KPG3-F1-model_v4 | Lipoprotein-releasing system transmembrane subunit LolC | 0.9371 | 8 | 422 |
GO:0042953
GO:0044874 GO:0098797 |
| AF-A0A7C1AI24-F1-model_v4 | Lipoprotein-releasing ABC transporter permease subunit | 0.935 | 1 | 362 |
GO:0042953
GO:0044874 GO:0098797 |
| AF-A0A1F2Z7J5-F1-model_v4 | Multidrug ABC transporter substrate-binding protein | 0.9308 | 11 | 422 |
GO:0042953
GO:0044874 GO:0098797 |