F485648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 917 | 322 | 1832 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300046538|Ga0495609_0025283|Ga0495609_0025283_520_1506 |
| Length | 328 |
| Sequence | MSDFTSGFWNYYIITLTMLGVFGCAVLLYSQSKHKVKALKDASSKHHAPVGTTGHIWDEDLTELNTPMPRWWMWLFYITIVFGLAYLFLYPGLGDYAGKLGWKSSGQYGAELKQAEAEYGPLFNQYLKQDLPAVAADPKAQAIGERLFLTYCAQCHGSDARGNKGFPNLTDKDWLYGGAPDVIKTTIMNGRHGVMPPMGAALGSDKDVENVAHYVLSLSGGAADPIKSVFGKSKFNACMGCHTGAGTGNQALGAPNLTDKVWLYGGSAETIMETIRKGRNNTMPAFADFLGEGKVHVLAAYVWGLSNQPAVAAAPAQGNSNERAGTSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 65 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 76 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 117 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 118 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 119 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 132 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 133 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 134 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 135 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 136 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 137 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 141 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 142 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 241 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 242 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 257 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 267 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 268 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 269 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 270 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 271 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 272 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 273 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 274 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 275 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 276 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 277 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 278 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 279 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 280 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 281 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 282 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 283 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 284 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 285 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 286 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 287 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 288 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 289 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 290 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 291 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 292 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 293 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 294 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 295 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 296 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 297 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 298 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 299 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 300 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 301 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 302 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 303 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 304 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 305 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 306 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 307 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 308 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 309 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 310 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 311 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 312 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 313 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 314 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 315 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 316 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 317 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 318 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 319 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 320 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 321 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 322 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.33 |
| Metatranscriptomes | 0.11 |
| Isolates | 5.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.8 |
| Nodule | 0.55 |
| Rhizoplane | 3.38 |
| Rhizosphere | 75.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495609_0025283 | 3300046538 | Bacteria | 2723 |
| 2 | JGI25155J39150_1000045 | 3300002704 | Bacteria | 85779 |
| 3 | JGI25155J39150_1000256 | 3300002704 | Bacteria | 20230 |
| 4 | JGI25156J39149_1000054 | 3300002705 | Bacteria | 88728 |
| 5 | JGI25156J39149_1002432 | 3300002705 | Bacteria | 6680 |
| 6 | JGI25162J39368_1003970 | 3300002737 | Bacteria | 3768 |
| 7 | JGI25154J39366_1000083 | 3300002738 | Bacteria | 88728 |
| 8 | JGI25154J39366_1000474 | 3300002738 | Bacteria | 20990 |
| 9 | JGI25154J39366_1001206 | 3300002738 | Bacteria | 9789 |
| 10 | JGI25158J39367_1002133 | 3300002739 | Bacteria | 3308 |
| 11 | JGI25157J39369_1000208 | 3300002741 | Bacteria | 48951 |
| 12 | JGI25152J39213_1002579 | 3300002773 | Bacteria | 6785 |
| 13 | JGI25152J39213_1007431 | 3300002773 | Bacteria | 2837 |
| 14 | JGI25150J39212_1002242 | 3300002774 | Bacteria | 4906 |
| 15 | JGI25150J39212_1013348 | 3300002774 | Bacteria | 1427 |
| 16 | JGI25159J45721_1001029 | 3300002987 | Bacteria | 11977 |
| 17 | JGI25159J45721_1002206 | 3300002987 | Bacteria | 7551 |
| 18 | JGI25153J46596_10012384 | 3300003215 | Bacteria | 3684 |
| 19 | rootL2_10090070 | 3300003322 | Bacteria | 1381 |
| 20 | rootL2_10174602 | 3300003322 | Bacteria | 2100 |
| 21 | JGI25161J50226_1000734 | 3300003374 | Bacteria | 12666 |
| 22 | Ga0055538_1000030 | 3300003751 | Bacteria | 200831 |
| 23 | Ga0055539_1000040 | 3300003752 | Bacteria | 200831 |
| 24 | Ga0055533_1000050 | 3300003756 | Bacteria | 200831 |
| 25 | Ga0055532_1000099 | 3300003758 | Bacteria | 93811 |
| 26 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 27 | Ga0055525_1000060 | 3300003759 | Bacteria | 200831 |
| 28 | Ga0055529_1000015 | 3300003763 | Bacteria | 366950 |
| 29 | Ga0055526_1000007 | 3300003771 | Bacteria | 321998 |
| 30 | Ga0055526_1000054 | 3300003771 | Bacteria | 113702 |
| 31 | Ga0055526_1000885 | 3300003771 | Bacteria | 22279 |
| 32 | Ga0055526_1001567 | 3300003771 | Bacteria | 16105 |
| 33 | Ga0055526_1011491 | 3300003771 | Bacteria | 3978 |
| 34 | Ga0055537_1000005 | 3300003773 | Bacteria | 160497 |
| 35 | Ga0055537_1003477 | 3300003773 | Bacteria | 4834 |
| 36 | Ga0055524_1000038 | 3300003775 | Bacteria | 162683 |
| 37 | Ga0055524_1002845 | 3300003775 | Bacteria | 8677 |
| 38 | Ga0055524_1006360 | 3300003775 | Bacteria | 5129 |
| 39 | Ga0055524_1028267 | 3300003775 | Bacteria | 1683 |
| 40 | Ga0055534_1000127 | 3300003784 | Bacteria | 57100 |
| 41 | Ga0055534_1001049 | 3300003784 | Bacteria | 12013 |
| 42 | Ga0055528_1000063 | 3300003790 | Bacteria | 85587 |
| 43 | Ga0055528_1002242 | 3300003790 | Bacteria | 10530 |
| 44 | Ga0055530_10001675 | 3300003791 | Bacteria | 15727 |
| 45 | Ga0055541_1000027 | 3300003841 | Bacteria | 200831 |
| 46 | Ga0055543_1001698 | 3300004625 | Bacteria | 8318 |
| 47 | Ga0065165_1000034 | 3300005262 | Bacteria | 214644 |
| 48 | Ga0065165_1003016 | 3300005262 | Bacteria | 12704 |
| 49 | Ga0065714_10008082 | 3300005288 | Bacteria | 4227 |
| 50 | Ga0070658_10066568 | 3300005327 | Bacteria | 2943 |
| 51 | Ga0070670_100002673 | 3300005331 | Bacteria | 14724 |
| 52 | Ga0070660_100008707 | 3300005339 | Bacteria | 7103 |
| 53 | Ga0070661_100017505 | 3300005344 | Bacteria | 5086 |
| 54 | Ga0070661_100460774 | 3300005344 | Bacteria | 1012 |
| 55 | Ga0070668_100108862 | 3300005347 | Bacteria | 2204 |
| 56 | Ga0070673_100052053 | 3300005364 | Bacteria | 3211 |
| 57 | Ga0070659_100000456 | 3300005366 | Bacteria | 30202 |
| 58 | Ga0070659_100059246 | 3300005366 | Bacteria | 3023 |
| 59 | Ga0070678_100599754 | 3300005456 | Bacteria | 983 |
| 60 | Ga0070681_10224156 | 3300005458 | Bacteria | 1795 |
| 61 | Ga0070672_100076017 | 3300005543 | Bacteria | 2682 |
| 62 | Ga0068855_100000243 | 3300005563 | Bacteria | 68537 |
| 63 | Ga0068855_100001100 | 3300005563 | Bacteria | 33596 |
| 64 | Ga0068855_100011885 | 3300005563 | Bacteria | 10526 |
| 65 | Ga0068855_100059076 | 3300005563 | Bacteria | 4488 |
| 66 | Ga0068855_100280904 | 3300005563 | Bacteria | 1849 |
| 67 | Ga0070664_100049799 | 3300005564 | Bacteria | 3543 |
| 68 | Ga0070664_100148823 | 3300005564 | Bacteria | 2066 |
| 69 | Ga0068854_100071853 | 3300005578 | Bacteria | 2532 |
| 70 | Ga0068852_100245011 | 3300005616 | Bacteria | 1715 |
| 71 | Ga0068852_100369736 | 3300005616 | Bacteria | 1404 |
| 72 | Ga0068852_100415233 | 3300005616 | Bacteria | 1326 |
| 73 | Ga0068864_100001909 | 3300005618 | Bacteria | 17108 |
| 74 | Ga0068863_100003624 | 3300005841 | Bacteria | 15249 |
| 75 | Ga0105244_10001568 | 3300009036 | Bacteria | 18161 |
| 76 | Ga0105244_10030858 | 3300009036 | Bacteria | 2848 |
| 77 | Ga0105240_10002667 | 3300009093 | Bacteria | 28399 |
| 78 | Ga0105240_10012212 | 3300009093 | Bacteria | 11874 |
| 79 | Ga0105240_10038896 | 3300009093 | Bacteria | 6098 |
| 80 | Ga0105240_10280612 | 3300009093 | Bacteria | 1914 |
| 81 | Ga0105245_10247558 | 3300009098 | Bacteria | 1730 |
| 82 | Ga0105243_10058147 | 3300009148 | Bacteria | 3081 |
| 83 | Ga0105243_10103814 | 3300009148 | Bacteria | 2364 |
| 84 | Ga0105242_10091289 | 3300009176 | Bacteria | 2564 |
| 85 | Ga0105237_10041247 | 3300009545 | Bacteria | 4656 |
| 86 | Ga0105238_10000547 | 3300009551 | Bacteria | 39292 |
| 87 | Ga0105239_10006605 | 3300010375 | Bacteria | 13429 |
| 88 | Ga0105239_10322528 | 3300010375 | Bacteria | 1742 |
| 89 | Ga0157370_10010253 | 3300013104 | Bacteria | 9894 |
| 90 | Ga0157374_10121038 | 3300013296 | Bacteria | 2526 |
| 91 | Ga0157372_10283305 | 3300013307 | Bacteria | 1927 |
| 92 | Ga0163163_10005831 | 3300014325 | Bacteria | 10709 |
| 93 | Ga0182008_10000542 | 3300014497 | Bacteria | 28046 |
| 94 | Ga0182008_10065918 | 3300014497 | Bacteria | 1781 |
| 95 | Ga0157376_10396373 | 3300014969 | Bacteria | 1333 |
| 96 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 97 | Ga0182006_1000023 | 3300015261 | Bacteria | 275031 |
| 98 | Ga0182006_1002414 | 3300015261 | Bacteria | 10211 |
| 99 | Ga0182007_10000022 | 3300015262 | Bacteria | 189018 |
| 100 | Ga0182007_10002459 | 3300015262 | Bacteria | 9202 |
| 101 | Ga0182007_10071288 | 3300015262 | Bacteria | 1138 |
| 102 | Ga0182005_1000006 | 3300015265 | Bacteria | 515188 |
| 103 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 104 | Ga0163161_10228890 | 3300017792 | Bacteria | 1442 |
| 105 | Ga0213872_10000087 | 3300021361 | Bacteria | 84858 |
| 106 | Ga0213872_10000157 | 3300021361 | Bacteria | 62892 |
| 107 | Ga0213872_10000703 | 3300021361 | Bacteria | 25156 |
| 108 | Ga0213872_10016017 | 3300021361 | Bacteria | 3482 |
| 109 | Ga0213872_10027347 | 3300021361 | Bacteria | 2618 |
| 110 | Ga0209435_100034 | 3300025206 | Bacteria | 144486 |
| 111 | Ga0209435_100074 | 3300025206 | Bacteria | 55837 |
| 112 | Ga0209436_100040 | 3300025208 | Bacteria | 75392 |
| 113 | Ga0209436_104332 | 3300025208 | Bacteria | 3528 |
| 114 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 115 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 116 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 117 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 118 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 119 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 120 | Ga0209437_100072 | 3300025233 | Bacteria | 305152 |
| 121 | Ga0209437_101483 | 3300025233 | Bacteria | 5640 |
| 122 | Ga0209437_109253 | 3300025233 | Bacteria | 1545 |
| 123 | Ga0209258_100417 | 3300025242 | Bacteria | 50597 |
| 124 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 125 | Ga0207425_1000036 | 3300025245 | Bacteria | 225783 |
| 126 | Ga0207425_1001550 | 3300025245 | Bacteria | 9376 |
| 127 | Ga0209646_1000042 | 3300025246 | Bacteria | 343923 |
| 128 | Ga0209646_1000057 | 3300025246 | Bacteria | 266384 |
| 129 | Ga0209646_1000118 | 3300025246 | Bacteria | 149446 |
| 130 | Ga0209026_1000106 | 3300025250 | Bacteria | 149446 |
| 131 | Ga0209026_1002894 | 3300025250 | Bacteria | 6033 |
| 132 | Ga0209026_1006544 | 3300025250 | Bacteria | 2826 |
| 133 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 134 | Ga0209677_102284 | 3300025253 | Bacteria | 7391 |
| 135 | Ga0209759_1000112 | 3300025256 | Bacteria | 143361 |
| 136 | Ga0209759_1000190 | 3300025256 | Bacteria | 97956 |
| 137 | Ga0209129_1000051 | 3300025258 | Bacteria | 267104 |
| 138 | Ga0209129_1016008 | 3300025258 | Bacteria | 1520 |
| 139 | Ga0209565_1000074 | 3300025263 | Bacteria | 164237 |
| 140 | Ga0209565_1000662 | 3300025263 | Bacteria | 21980 |
| 141 | Ga0209565_1001767 | 3300025263 | Bacteria | 8797 |
| 142 | Ga0209565_1005640 | 3300025263 | Bacteria | 3618 |
| 143 | Ga0209565_1021237 | 3300025263 | Bacteria | 1360 |
| 144 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 145 | Ga0209455_1010197 | 3300025272 | Bacteria | 2405 |
| 146 | Ga0209673_1000129 | 3300025273 | Bacteria | 164238 |
| 147 | Ga0209673_1006223 | 3300025273 | Bacteria | 5825 |
| 148 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 149 | Ga0209130_1000217 | 3300025284 | Bacteria | 75515 |
| 150 | Ga0209130_1004379 | 3300025284 | Bacteria | 5385 |
| 151 | Ga0209675_1000072 | 3300025291 | Bacteria | 164237 |
| 152 | Ga0209675_1023079 | 3300025291 | Bacteria | 1619 |
| 153 | Ga0209025_1004319 | 3300025294 | Bacteria | 12434 |
| 154 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 155 | Ga0209564_1000042 | 3300025295 | Bacteria | 392805 |
| 156 | Ga0209564_1000160 | 3300025295 | Bacteria | 164214 |
| 157 | Ga0209564_1000172 | 3300025295 | Bacteria | 155715 |
| 158 | Ga0209564_1009057 | 3300025295 | Bacteria | 4795 |
| 159 | Ga0209564_1016727 | 3300025295 | Bacteria | 2899 |
| 160 | Ga0209758_1000054 | 3300025297 | Bacteria | 337655 |
| 161 | Ga0209758_1000379 | 3300025297 | Bacteria | 77337 |
| 162 | Ga0209050_1000040 | 3300025298 | Bacteria | 408492 |
| 163 | Ga0209050_1000309 | 3300025298 | Bacteria | 99432 |
| 164 | Ga0209050_1040797 | 3300025298 | Bacteria | 1287 |
| 165 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 166 | Ga0209256_1000125 | 3300025299 | Bacteria | 165336 |
| 167 | Ga0209256_1000307 | 3300025299 | Bacteria | 85852 |
| 168 | Ga0209256_1000553 | 3300025299 | Bacteria | 53682 |
| 169 | Ga0209256_1001812 | 3300025299 | Bacteria | 20078 |
| 170 | Ga0207426_1020060 | 3300025302 | Bacteria | 2329 |
| 171 | Ga0209051_1001406 | 3300025303 | Bacteria | 20679 |
| 172 | Ga0209051_1006685 | 3300025303 | Bacteria | 6450 |
| 173 | Ga0209051_1009224 | 3300025303 | Bacteria | 5106 |
| 174 | Ga0209257_1000054 | 3300025304 | Bacteria | 416957 |
| 175 | Ga0207655_1002256 | 3300025728 | Bacteria | 15935 |
| 176 | Ga0207655_1002948 | 3300025728 | Bacteria | 13082 |
| 177 | Ga0207643_10197902 | 3300025908 | Bacteria | 1223 |
| 178 | Ga0207707_10182984 | 3300025912 | Bacteria | 1829 |
| 179 | Ga0207695_10000913 | 3300025913 | Bacteria | 52943 |
| 180 | Ga0207695_10005170 | 3300025913 | Bacteria | 17468 |
| 181 | Ga0207695_10019098 | 3300025913 | Bacteria | 7905 |
| 182 | Ga0207695_10260951 | 3300025913 | Bacteria | 1630 |
| 183 | Ga0207671_10011896 | 3300025914 | Bacteria | 7038 |
| 184 | Ga0207657_10001579 | 3300025919 | Bacteria | 24470 |
| 185 | Ga0207657_10018104 | 3300025919 | Bacteria | 6739 |
| 186 | Ga0207649_10015582 | 3300025920 | Bacteria | 4270 |
| 187 | Ga0207649_10321686 | 3300025920 | Bacteria | 1137 |
| 188 | Ga0207694_10002807 | 3300025924 | Bacteria | 14066 |
| 189 | Ga0207650_10007503 | 3300025925 | Bacteria | 7436 |
| 190 | Ga0207650_10214918 | 3300025925 | Bacteria | 1545 |
| 191 | Ga0207659_10022051 | 3300025926 | Bacteria | 4237 |
| 192 | Ga0207690_10117401 | 3300025932 | Bacteria | 1926 |
| 193 | Ga0207690_10178372 | 3300025932 | Bacteria | 1597 |
| 194 | Ga0207686_10051518 | 3300025934 | Bacteria | 2565 |
| 195 | Ga0207709_10037826 | 3300025935 | Bacteria | 2869 |
| 196 | Ga0207709_10085497 | 3300025935 | Bacteria | 2045 |
| 197 | Ga0207691_10078797 | 3300025940 | Bacteria | 2965 |
| 198 | Ga0207679_10028672 | 3300025945 | Bacteria | 3866 |
| 199 | Ga0207679_10122745 | 3300025945 | Bacteria | 2071 |
| 200 | Ga0207667_10000301 | 3300025949 | Bacteria | 68551 |
| 201 | Ga0207667_10008602 | 3300025949 | Bacteria | 12112 |
| 202 | Ga0207667_10038852 | 3300025949 | Bacteria | 5077 |
| 203 | Ga0207667_10086607 | 3300025949 | Bacteria | 3242 |
| 204 | Ga0207667_10136832 | 3300025949 | Bacteria | 2522 |
| 205 | Ga0207667_10222943 | 3300025949 | Bacteria | 1932 |
| 206 | Ga0207668_10256405 | 3300025972 | Bacteria | 1423 |
| 207 | Ga0207658_10125403 | 3300025986 | Bacteria | 2054 |
| 208 | Ga0207702_10158586 | 3300026078 | Bacteria | 2065 |
| 209 | Ga0207641_10003573 | 3300026088 | Bacteria | 13744 |
| 210 | Ga0207676_10001593 | 3300026095 | Bacteria | 16712 |
| 211 | Ga0207698_10187727 | 3300026142 | Bacteria | 1837 |
| 212 | Ga0207698_10387524 | 3300026142 | Bacteria | 1331 |
| 213 | Ga0209281_1004072 | 3300027111 | Bacteria | 4509 |
| 214 | Ga0209282_1000005 | 3300027666 | Bacteria | 380858 |
| 215 | Ga0316177_1040718 | 3300030731 | Bacteria | 2796 |
| 216 | Ga0316181_1174308 | 3300030744 | Bacteria | 2472 |
| 217 | Ga0265328_10048929 | 3300031239 | Bacteria | 1553 |
| 218 | Ga0265327_10008459 | 3300031251 | Bacteria | 7654 |
| 219 | Ga0265316_10000192 | 3300031344 | Bacteria | 70550 |
| 220 | Ga0307408_100000144 | 3300031548 | Bacteria | 79329 |
| 221 | Ga0307408_100002435 | 3300031548 | Bacteria | 13086 |
| 222 | Ga0307408_100002837 | 3300031548 | Bacteria | 12018 |
| 223 | Ga0307408_100003117 | 3300031548 | Bacteria | 11424 |
| 224 | Ga0265314_10016398 | 3300031711 | Bacteria | 5853 |
| 225 | Ga0307416_100013859 | 3300032002 | Bacteria | 5496 |
| 226 | Ga0373933_0162110 | 3300035724 | Bacteria | 1420 |
| 227 | Ga0395899_0004277 | 3300037312 | Bacteria | 11166 |
| 228 | Ga0395899_0009167 | 3300037312 | Bacteria | 7600 |
| 229 | Ga0395899_0017209 | 3300037312 | Bacteria | 5508 |
| 230 | Ga0395899_0019216 | 3300037312 | Bacteria | 5193 |
| 231 | Ga0395900_0000826 | 3300037418 | Bacteria | 40904 |
| 232 | Ga0395900_0017822 | 3300037418 | Bacteria | 7248 |
| 233 | Ga0395900_0019747 | 3300037418 | Bacteria | 6868 |
| 234 | Ga0395900_0074854 | 3300037418 | Bacteria | 3480 |
| 235 | Ga0395900_0131159 | 3300037418 | Bacteria | 2568 |
| 236 | Ga0395900_0196452 | 3300037418 | Bacteria | 2043 |
| 237 | Ga0395900_0272047 | 3300037418 | Bacteria | 1688 |
| 238 | Ga0395900_0296765 | 3300037418 | Bacteria | 1603 |
| 239 | Ga0395898_0040343 | 3300037466 | Bacteria | 4616 |
| 240 | Ga0395898_0082471 | 3300037466 | Bacteria | 3099 |
| 241 | Ga0395905_0000955 | 3300037471 | Bacteria | 37080 |
| 242 | Ga0395905_0007217 | 3300037471 | Bacteria | 11081 |
| 243 | Ga0395905_0033040 | 3300037471 | Bacteria | 4864 |
| 244 | Ga0395905_0041777 | 3300037471 | Bacteria | 4303 |
| 245 | Ga0395905_0079842 | 3300037471 | Bacteria | 3066 |
| 246 | Ga0395905_0123194 | 3300037471 | Bacteria | 2437 |
| 247 | Ga0395905_0245047 | 3300037471 | Bacteria | 1674 |
| 248 | Ga0395905_0348570 | 3300037471 | Bacteria | 1372 |
| 249 | Ga0395901_0000033 | 3300038443 | Bacteria | 232357 |
| 250 | Ga0395901_0001938 | 3300038443 | Bacteria | 21317 |
| 251 | Ga0395901_0010151 | 3300038443 | Bacteria | 9541 |
| 252 | Ga0395901_0022786 | 3300038443 | Bacteria | 6421 |
| 253 | Ga0395901_0031647 | 3300038443 | Bacteria | 5453 |
| 254 | Ga0395901_0132471 | 3300038443 | Bacteria | 2619 |
| 255 | Ga0395901_0132653 | 3300038443 | Bacteria | 2617 |
| 256 | Ga0395901_0159990 | 3300038443 | Bacteria | 2365 |
| 257 | Ga0395901_0216633 | 3300038443 | Bacteria | 2002 |
| 258 | Ga0395901_0314493 | 3300038443 | Bacteria | 1621 |
| 259 | Ga0395901_0452006 | 3300038443 | Bacteria | 1314 |
| 260 | Ga0436361_0006435 | 3300039447 | Bacteria | 21805 |
| 261 | Ga0436361_0428998 | 3300039447 | Bacteria | 1212 |
| 262 | Ga0436361_0456588 | 3300039447 | Bacteria | 3208 |
| 263 | Ga0436361_0492958 | 3300039447 | Bacteria | 54051 |
| 264 | Ga0436361_0595316 | 3300039447 | Bacteria | 75842 |
| 265 | Ga0436361_0835704 | 3300039447 | Bacteria | 1183 |
| 266 | Ga0436361_0998063 | 3300039447 | Bacteria | 37334 |
| 267 | Ga0436361_1217285 | 3300039447 | Bacteria | 9496 |
| 268 | Ga0439448_0006050 | 3300042005 | Bacteria | 3468 |
| 269 | Ga0439450_003927 | 3300042008 | Bacteria | 2500 |
| 270 | Ga0439455_0022445 | 3300042012 | Bacteria | 1512 |
| 271 | Ga0450904_000694 | 3300042139 | Bacteria | 5972 |
| 272 | Ga0450893_0011512 | 3300042532 | Bacteria | 1462 |
| 273 | Ga0466966_0039284 | 3300044684 | Bacteria | 3048 |
| 274 | Ga0466963_0019225 | 3300044694 | Bacteria | 4281 |
| 275 | Ga0466964_0000038 | 3300044706 | Bacteria | 27277 |
| 276 | Ga0466964_0083204 | 3300044706 | Bacteria | 1378 |
| 277 | Ga0466971_0230075 | 3300044719 | Bacteria | 880 |
| 278 | Ga0466970_0006191 | 3300044765 | Bacteria | 5965 |
| 279 | Ga0466957_0026106 | 3300044842 | Bacteria | 3464 |
| 280 | Ga0466957_0045470 | 3300044842 | Bacteria | 2663 |
| 281 | Ga0466967_0046032 | 3300045976 | Bacteria | 3795 |
| 282 | Ga0466967_0052043 | 3300045976 | Bacteria | 3592 |
| 283 | Ga0495617_000055 | 3300046452 | Bacteria | 102065 |
| 284 | Ga0495617_000197 | 3300046452 | Bacteria | 37981 |
| 285 | Ga0495617_000809 | 3300046452 | Bacteria | 15126 |
| 286 | Ga0495617_008224 | 3300046452 | Bacteria | 3600 |
| 287 | Ga0495617_015288 | 3300046452 | Bacteria | 2601 |
| 288 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 289 | Ga0495627_000123 | 3300046453 | Bacteria | 94862 |
| 290 | Ga0495627_008222 | 3300046453 | Bacteria | 3925 |
| 291 | Ga0495627_024396 | 3300046453 | Bacteria | 1971 |
| 292 | Ga0495592_0028251 | 3300046454 | Bacteria | 4249 |
| 293 | Ga0495603_0060162 | 3300046455 | Bacteria | 2244 |
| 294 | Ga0495590_0000012 | 3300046457 | Bacteria | 303377 |
| 295 | Ga0495590_0002304 | 3300046457 | Bacteria | 7952 |
| 296 | Ga0495590_0011927 | 3300046457 | Bacteria | 3237 |
| 297 | Ga0495590_0015419 | 3300046457 | Bacteria | 2774 |
| 298 | Ga0495590_0056039 | 3300046457 | Bacteria | 1377 |
| 299 | Ga0495591_023414 | 3300046458 | Bacteria | 1979 |
| 300 | Ga0495629_0094381 | 3300046459 | Bacteria | 2087 |
| 301 | Ga0495638_0000047 | 3300046460 | Bacteria | 216004 |
| 302 | Ga0495638_0002024 | 3300046460 | Bacteria | 17261 |
| 303 | Ga0495638_0009661 | 3300046460 | Bacteria | 6746 |
| 304 | Ga0495638_0011357 | 3300046460 | Bacteria | 6138 |
| 305 | Ga0495638_0011670 | 3300046460 | Bacteria | 6051 |
| 306 | Ga0495638_0047332 | 3300046460 | Bacteria | 2696 |
| 307 | Ga0495638_0063804 | 3300046460 | Bacteria | 2270 |
| 308 | Ga0495638_0082126 | 3300046460 | Bacteria | 1955 |
| 309 | Ga0495651_0121657 | 3300046462 | Bacteria | 1916 |
| 310 | Ga0495653_0000082 | 3300046463 | Bacteria | 80285 |
| 311 | Ga0495653_0022531 | 3300046463 | Bacteria | 5095 |
| 312 | Ga0495653_0096197 | 3300046463 | Bacteria | 2153 |
| 313 | Ga0495650_0000226 | 3300046471 | Bacteria | 115930 |
| 314 | Ga0495650_0000437 | 3300046471 | Bacteria | 66997 |
| 315 | Ga0495650_0000462 | 3300046471 | Bacteria | 63149 |
| 316 | Ga0495650_0001511 | 3300046471 | Bacteria | 22114 |
| 317 | Ga0495650_0052773 | 3300046471 | Bacteria | 1667 |
| 318 | Ga0495582_0003405 | 3300046473 | Bacteria | 8955 |
| 319 | Ga0495582_0046243 | 3300046473 | Bacteria | 2397 |
| 320 | Ga0495605_0000018 | 3300046474 | Bacteria | 270187 |
| 321 | Ga0495605_0000035 | 3300046474 | Bacteria | 208069 |
| 322 | Ga0495605_0000206 | 3300046474 | Bacteria | 72593 |
| 323 | Ga0495605_0003120 | 3300046474 | Bacteria | 9985 |
| 324 | Ga0495605_0003394 | 3300046474 | Bacteria | 9502 |
| 325 | Ga0495605_0005369 | 3300046474 | Bacteria | 7466 |
| 326 | Ga0495605_0008334 | 3300046474 | Bacteria | 5860 |
| 327 | Ga0495605_0018918 | 3300046474 | Bacteria | 3687 |
| 328 | Ga0495605_0029583 | 3300046474 | Bacteria | 2816 |
| 329 | Ga0495605_0066553 | 3300046474 | Bacteria | 1711 |
| 330 | Ga0495584_0000006 | 3300046491 | Bacteria | 301775 |
| 331 | Ga0495584_0000570 | 3300046491 | Bacteria | 24884 |
| 332 | Ga0495584_0001531 | 3300046491 | Bacteria | 13751 |
| 333 | Ga0495584_0002419 | 3300046491 | Bacteria | 10590 |
| 334 | Ga0495584_0002756 | 3300046491 | Bacteria | 9828 |
| 335 | Ga0495584_0008363 | 3300046491 | Bacteria | 5359 |
| 336 | Ga0495584_0010792 | 3300046491 | Bacteria | 4689 |
| 337 | Ga0495584_0020430 | 3300046491 | Bacteria | 3364 |
| 338 | Ga0495584_0020746 | 3300046491 | Bacteria | 3337 |
| 339 | Ga0495584_0022479 | 3300046491 | Bacteria | 3200 |
| 340 | Ga0495584_0022925 | 3300046491 | Bacteria | 3168 |
| 341 | Ga0495584_0025346 | 3300046491 | Bacteria | 3007 |
| 342 | Ga0495584_0042803 | 3300046491 | Bacteria | 2285 |
| 343 | Ga0495584_0079987 | 3300046491 | Bacteria | 1644 |
| 344 | Ga0495585_0000005 | 3300046492 | Bacteria | 328103 |
| 345 | Ga0495585_0000049 | 3300046492 | Bacteria | 119546 |
| 346 | Ga0495585_0000162 | 3300046492 | Bacteria | 71606 |
| 347 | Ga0495585_0003133 | 3300046492 | Bacteria | 11336 |
| 348 | Ga0495585_0006337 | 3300046492 | Bacteria | 7347 |
| 349 | Ga0495585_0009264 | 3300046492 | Bacteria | 5915 |
| 350 | Ga0495585_0013680 | 3300046492 | Bacteria | 4744 |
| 351 | Ga0495585_0020793 | 3300046492 | Bacteria | 3772 |
| 352 | Ga0495585_0024583 | 3300046492 | Bacteria | 3452 |
| 353 | Ga0495585_0025442 | 3300046492 | Bacteria | 3390 |
| 354 | Ga0495585_0040572 | 3300046492 | Bacteria | 2613 |
| 355 | Ga0495585_0045473 | 3300046492 | Bacteria | 2450 |
| 356 | Ga0495585_0050114 | 3300046492 | Bacteria | 2316 |
| 357 | Ga0495585_0071327 | 3300046492 | Bacteria | 1893 |
| 358 | Ga0495585_0086482 | 3300046492 | Bacteria | 1693 |
| 359 | Ga0495585_0092960 | 3300046492 | Bacteria | 1622 |
| 360 | Ga0495585_0104980 | 3300046492 | Bacteria | 1507 |
| 361 | Ga0495594_0043180 | 3300046499 | Bacteria | 2470 |
| 362 | Ga0495594_0061635 | 3300046499 | Bacteria | 2076 |
| 363 | Ga0495594_0181046 | 3300046499 | Bacteria | 1199 |
| 364 | Ga0495596_0000013 | 3300046500 | Bacteria | 125228 |
| 365 | Ga0495596_0000570 | 3300046500 | Bacteria | 23022 |
| 366 | Ga0495596_0001390 | 3300046500 | Bacteria | 13899 |
| 367 | Ga0495596_0004436 | 3300046500 | Bacteria | 6830 |
| 368 | Ga0495596_0005617 | 3300046500 | Bacteria | 5895 |
| 369 | Ga0495596_0007448 | 3300046500 | Bacteria | 4936 |
| 370 | Ga0495596_0007810 | 3300046500 | Bacteria | 4798 |
| 371 | Ga0495596_0026349 | 3300046500 | Bacteria | 2344 |
| 372 | Ga0495596_0027105 | 3300046500 | Bacteria | 2306 |
| 373 | Ga0495607_0000447 | 3300046501 | Bacteria | 41522 |
| 374 | Ga0495607_0001792 | 3300046501 | Bacteria | 18328 |
| 375 | Ga0495607_0002443 | 3300046501 | Bacteria | 15135 |
| 376 | Ga0495607_0004972 | 3300046501 | Bacteria | 9649 |
| 377 | Ga0495607_0005432 | 3300046501 | Bacteria | 9128 |
| 378 | Ga0495607_0007839 | 3300046501 | Bacteria | 7348 |
| 379 | Ga0495607_0015793 | 3300046501 | Bacteria | 4884 |
| 380 | Ga0495607_0024570 | 3300046501 | Bacteria | 3754 |
| 381 | Ga0495607_0028489 | 3300046501 | Bacteria | 3446 |
| 382 | Ga0495607_0040921 | 3300046501 | Bacteria | 2755 |
| 383 | Ga0495607_0050499 | 3300046501 | Bacteria | 2420 |
| 384 | Ga0495607_0051010 | 3300046501 | Bacteria | 2405 |
| 385 | Ga0495607_0068780 | 3300046501 | Bacteria | 1984 |
| 386 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 387 | Ga0495583_0000092 | 3300046506 | Bacteria | 158865 |
| 388 | Ga0495583_0000316 | 3300046506 | Bacteria | 76314 |
| 389 | Ga0495583_0000480 | 3300046506 | Bacteria | 58370 |
| 390 | Ga0495583_0001098 | 3300046506 | Bacteria | 29951 |
| 391 | Ga0495583_0001357 | 3300046506 | Bacteria | 25354 |
| 392 | Ga0495583_0005766 | 3300046506 | Bacteria | 8279 |
| 393 | Ga0495583_0016772 | 3300046506 | Bacteria | 3919 |
| 394 | Ga0495583_0017309 | 3300046506 | Bacteria | 3830 |
| 395 | Ga0495583_0028977 | 3300046506 | Bacteria | 2714 |
| 396 | Ga0495583_0053571 | 3300046506 | Bacteria | 1830 |
| 397 | Ga0495583_0069315 | 3300046506 | Bacteria | 1553 |
| 398 | Ga0495606_0000066 | 3300046507 | Bacteria | 181028 |
| 399 | Ga0495606_0000101 | 3300046507 | Bacteria | 146752 |
| 400 | Ga0495606_0000161 | 3300046507 | Bacteria | 117607 |
| 401 | Ga0495606_0000409 | 3300046507 | Bacteria | 72543 |
| 402 | Ga0495606_0000814 | 3300046507 | Bacteria | 47442 |
| 403 | Ga0495606_0000830 | 3300046507 | Bacteria | 46705 |
| 404 | Ga0495606_0002636 | 3300046507 | Bacteria | 20465 |
| 405 | Ga0495606_0018361 | 3300046507 | Bacteria | 5247 |
| 406 | Ga0495606_0025163 | 3300046507 | Bacteria | 4270 |
| 407 | Ga0495606_0061775 | 3300046507 | Bacteria | 2394 |
| 408 | Ga0495606_0115140 | 3300046507 | Bacteria | 1616 |
| 409 | Ga0495608_0082455 | 3300046511 | Bacteria | 2088 |
| 410 | Ga0495610_0000014 | 3300046512 | Bacteria | 444708 |
| 411 | Ga0495610_0005574 | 3300046512 | Bacteria | 8902 |
| 412 | Ga0495610_0005660 | 3300046512 | Bacteria | 8810 |
| 413 | Ga0495610_0009501 | 3300046512 | Bacteria | 6139 |
| 414 | Ga0495610_0012253 | 3300046512 | Bacteria | 5175 |
| 415 | Ga0495616_0000020 | 3300046513 | Bacteria | 162840 |
| 416 | Ga0495616_0000125 | 3300046513 | Bacteria | 66710 |
| 417 | Ga0495616_0001133 | 3300046513 | Bacteria | 18867 |
| 418 | Ga0495616_0001323 | 3300046513 | Bacteria | 17297 |
| 419 | Ga0495616_0001444 | 3300046513 | Bacteria | 16538 |
| 420 | Ga0495616_0014163 | 3300046513 | Bacteria | 4474 |
| 421 | Ga0495616_0019529 | 3300046513 | Bacteria | 3696 |
| 422 | Ga0495616_0022220 | 3300046513 | Bacteria | 3427 |
| 423 | Ga0495616_0023004 | 3300046513 | Bacteria | 3358 |
| 424 | Ga0495616_0041507 | 3300046513 | Bacteria | 2346 |
| 425 | Ga0495616_0042080 | 3300046513 | Bacteria | 2327 |
| 426 | Ga0495616_0064595 | 3300046513 | Bacteria | 1785 |
| 427 | Ga0495618_0054139 | 3300046514 | Bacteria | 2538 |
| 428 | Ga0495620_0017241 | 3300046515 | Bacteria | 3606 |
| 429 | Ga0495628_0000315 | 3300046516 | Bacteria | 43763 |
| 430 | Ga0495628_0007175 | 3300046516 | Bacteria | 9650 |
| 431 | Ga0495631_0000295 | 3300046518 | Bacteria | 34905 |
| 432 | Ga0495631_0002141 | 3300046518 | Bacteria | 11411 |
| 433 | Ga0495631_0002183 | 3300046518 | Bacteria | 11297 |
| 434 | Ga0495631_0004107 | 3300046518 | Bacteria | 7818 |
| 435 | Ga0495631_0006181 | 3300046518 | Bacteria | 6204 |
| 436 | Ga0495631_0018425 | 3300046518 | Bacteria | 3286 |
| 437 | Ga0495631_0028420 | 3300046518 | Bacteria | 2550 |
| 438 | Ga0495631_0035879 | 3300046518 | Bacteria | 2216 |
| 439 | Ga0495631_0049023 | 3300046518 | Bacteria | 1850 |
| 440 | Ga0495631_0050686 | 3300046518 | Bacteria | 1815 |
| 441 | Ga0495632_0000029 | 3300046519 | Bacteria | 171022 |
| 442 | Ga0495632_0000093 | 3300046519 | Bacteria | 91309 |
| 443 | Ga0495632_0001267 | 3300046519 | Bacteria | 21431 |
| 444 | Ga0495632_0005633 | 3300046519 | Bacteria | 8237 |
| 445 | Ga0495632_0009088 | 3300046519 | Bacteria | 6017 |
| 446 | Ga0495637_0001526 | 3300046520 | Bacteria | 13538 |
| 447 | Ga0495637_0037740 | 3300046520 | Bacteria | 2095 |
| 448 | Ga0495643_0000234 | 3300046522 | Bacteria | 84022 |
| 449 | Ga0495643_0000388 | 3300046522 | Bacteria | 58226 |
| 450 | Ga0495643_0001128 | 3300046522 | Bacteria | 26369 |
| 451 | Ga0495643_0001450 | 3300046522 | Bacteria | 21831 |
| 452 | Ga0495643_0003381 | 3300046522 | Bacteria | 11738 |
| 453 | Ga0495643_0068080 | 3300046522 | Bacteria | 1874 |
| 454 | Ga0495644_0000379 | 3300046523 | Bacteria | 20217 |
| 455 | Ga0495644_0002875 | 3300046523 | Bacteria | 6826 |
| 456 | Ga0495644_0009357 | 3300046523 | Bacteria | 3779 |
| 457 | Ga0495644_0021369 | 3300046523 | Bacteria | 2469 |
| 458 | Ga0495644_0023838 | 3300046523 | Bacteria | 2329 |
| 459 | Ga0495644_0082728 | 3300046523 | Bacteria | 1210 |
| 460 | Ga0495644_0086265 | 3300046523 | Bacteria | 1183 |
| 461 | Ga0495648_0000019 | 3300046524 | Bacteria | 276407 |
| 462 | Ga0495648_0000033 | 3300046524 | Bacteria | 199184 |
| 463 | Ga0495648_0000207 | 3300046524 | Bacteria | 68660 |
| 464 | Ga0495648_0000527 | 3300046524 | Bacteria | 41184 |
| 465 | Ga0495648_0005556 | 3300046524 | Bacteria | 10456 |
| 466 | Ga0495648_0007648 | 3300046524 | Bacteria | 8616 |
| 467 | Ga0495648_0015834 | 3300046524 | Bacteria | 5452 |
| 468 | Ga0495648_0025773 | 3300046524 | Bacteria | 3973 |
| 469 | Ga0495648_0037659 | 3300046524 | Bacteria | 3104 |
| 470 | Ga0495648_0038786 | 3300046524 | Bacteria | 3040 |
| 471 | Ga0495648_0041135 | 3300046524 | Bacteria | 2922 |
| 472 | Ga0495648_0048784 | 3300046524 | Bacteria | 2603 |
| 473 | Ga0495663_0002070 | 3300046525 | Bacteria | 6143 |
| 474 | Ga0495663_0008597 | 3300046525 | Bacteria | 2833 |
| 475 | Ga0495666_0020595 | 3300046526 | Bacteria | 3266 |
| 476 | Ga0495666_0030354 | 3300046526 | Bacteria | 2653 |
| 477 | Ga0495642_0000005 | 3300046528 | Bacteria | 176726 |
| 478 | Ga0495642_0000111 | 3300046528 | Bacteria | 46419 |
| 479 | Ga0495642_0001868 | 3300046528 | Bacteria | 8991 |
| 480 | Ga0495642_0002397 | 3300046528 | Bacteria | 7636 |
| 481 | Ga0495642_0004661 | 3300046528 | Bacteria | 5311 |
| 482 | Ga0495642_0009857 | 3300046528 | Bacteria | 3660 |
| 483 | Ga0495642_0017398 | 3300046528 | Bacteria | 2809 |
| 484 | Ga0495642_0024585 | 3300046528 | Bacteria | 2383 |
| 485 | Ga0495642_0031655 | 3300046528 | Bacteria | 2121 |
| 486 | Ga0495642_0032189 | 3300046528 | Bacteria | 2103 |
| 487 | Ga0495642_0070602 | 3300046528 | Bacteria | 1460 |
| 488 | Ga0495652_0046650 | 3300046529 | Bacteria | 3718 |
| 489 | Ga0495652_0052476 | 3300046529 | Bacteria | 3477 |
| 490 | Ga0495652_0149700 | 3300046529 | Bacteria | 1825 |
| 491 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 492 | Ga0495654_0003975 | 3300046530 | Bacteria | 8904 |
| 493 | Ga0495654_0009835 | 3300046530 | Bacteria | 5226 |
| 494 | Ga0495654_0017364 | 3300046530 | Bacteria | 3785 |
| 495 | Ga0495654_0021587 | 3300046530 | Bacteria | 3348 |
| 496 | Ga0495654_0027638 | 3300046530 | Bacteria | 2906 |
| 497 | Ga0495654_0149023 | 3300046530 | Bacteria | 1036 |
| 498 | Ga0495665_0050197 | 3300046531 | Bacteria | 2211 |
| 499 | Ga0495586_0031016 | 3300046535 | Bacteria | 2862 |
| 500 | Ga0495587_0080591 | 3300046536 | Bacteria | 1886 |
| 501 | Ga0495609_0000122 | 3300046538 | Bacteria | 87165 |
| 502 | Ga0495609_0000127 | 3300046538 | Bacteria | 82467 |
| 503 | Ga0495609_0000377 | 3300046538 | Bacteria | 38049 |
| 504 | Ga0495609_0000421 | 3300046538 | Bacteria | 35331 |
| 505 | Ga0495609_0004431 | 3300046538 | Bacteria | 7680 |
| 506 | Ga0495609_0016190 | 3300046538 | Bacteria | 3476 |
| 507 | Ga0495609_0034137 | 3300046538 | Bacteria | 2307 |
| 508 | Ga0495609_0036766 | 3300046538 | Bacteria | 2210 |
| 509 | Ga0495609_0037541 | 3300046538 | Bacteria | 2185 |
| 510 | Ga0495621_0000839 | 3300046539 | Bacteria | 7815 |
| 511 | Ga0495597_0000075 | 3300046542 | Bacteria | 86570 |
| 512 | Ga0495597_0000244 | 3300046542 | Bacteria | 49472 |
| 513 | Ga0495597_0000277 | 3300046542 | Bacteria | 46764 |
| 514 | Ga0495597_0000378 | 3300046542 | Bacteria | 38615 |
| 515 | Ga0495597_0001275 | 3300046542 | Bacteria | 18575 |
| 516 | Ga0495597_0004294 | 3300046542 | Bacteria | 7873 |
| 517 | Ga0495597_0004483 | 3300046542 | Bacteria | 7659 |
| 518 | Ga0495597_0024107 | 3300046542 | Bacteria | 2809 |
| 519 | Ga0495597_0084741 | 3300046542 | Bacteria | 1351 |
| 520 | Ga0495645_0056984 | 3300046543 | Bacteria | 2837 |
| 521 | Ga0495622_0000037 | 3300046557 | Bacteria | 119690 |
| 522 | Ga0495622_0035652 | 3300046557 | Bacteria | 2319 |
| 523 | Ga0495633_0000086 | 3300046558 | Bacteria | 124357 |
| 524 | Ga0495633_0000091 | 3300046558 | Bacteria | 122383 |
| 525 | Ga0495633_0000297 | 3300046558 | Bacteria | 56662 |
| 526 | Ga0495633_0002740 | 3300046558 | Bacteria | 12191 |
| 527 | Ga0495633_0002917 | 3300046558 | Bacteria | 11736 |
| 528 | Ga0495633_0003169 | 3300046558 | Bacteria | 11120 |
| 529 | Ga0495633_0005227 | 3300046558 | Bacteria | 8007 |
| 530 | Ga0495633_0012297 | 3300046558 | Bacteria | 4562 |
| 531 | Ga0495633_0013563 | 3300046558 | Bacteria | 4288 |
| 532 | Ga0495633_0028627 | 3300046558 | Bacteria | 2713 |
| 533 | Ga0495633_0032504 | 3300046558 | Bacteria | 2520 |
| 534 | Ga0495633_0033608 | 3300046558 | Bacteria | 2472 |
| 535 | Ga0495633_0049745 | 3300046558 | Bacteria | 1977 |
| 536 | Ga0495633_0056472 | 3300046558 | Bacteria | 1844 |
| 537 | Ga0495633_0078216 | 3300046558 | Bacteria | 1540 |
| 538 | Ga0495633_0098470 | 3300046558 | Bacteria | 1358 |
| 539 | Ga0495656_0001811 | 3300046615 | Bacteria | 7029 |
| 540 | Ga0495656_0003025 | 3300046615 | Bacteria | 5652 |
| 541 | Ga0495656_0006282 | 3300046615 | Bacteria | 4162 |
| 542 | Ga0495656_0045968 | 3300046615 | Bacteria | 1845 |
| 543 | Ga0495656_0055282 | 3300046615 | Bacteria | 1711 |
| 544 | Ga0495656_0075222 | 3300046615 | Bacteria | 1510 |
| 545 | Ga0495668_0000066 | 3300046616 | Bacteria | 178533 |
| 546 | Ga0495668_0000579 | 3300046616 | Bacteria | 44604 |
| 547 | Ga0495668_0000712 | 3300046616 | Bacteria | 40090 |
| 548 | Ga0495668_0000987 | 3300046616 | Bacteria | 31002 |
| 549 | Ga0495668_0001514 | 3300046616 | Bacteria | 22099 |
| 550 | Ga0495668_0002104 | 3300046616 | Bacteria | 17216 |
| 551 | Ga0495668_0005034 | 3300046616 | Bacteria | 9106 |
| 552 | Ga0495668_0006539 | 3300046616 | Bacteria | 7615 |
| 553 | Ga0495668_0007925 | 3300046616 | Bacteria | 6703 |
| 554 | Ga0495668_0009537 | 3300046616 | Bacteria | 5951 |
| 555 | Ga0495668_0014164 | 3300046616 | Bacteria | 4685 |
| 556 | Ga0495668_0024190 | 3300046616 | Bacteria | 3455 |
| 557 | Ga0495668_0025338 | 3300046616 | Bacteria | 3370 |
| 558 | Ga0495668_0030873 | 3300046616 | Bacteria | 3021 |
| 559 | Ga0495668_0031775 | 3300046616 | Bacteria | 2974 |
| 560 | Ga0495668_0032788 | 3300046616 | Bacteria | 2920 |
| 561 | Ga0495668_0163460 | 3300046616 | Bacteria | 1219 |
| 562 | Ga0495611_0002764 | 3300046648 | Bacteria | 7871 |
| 563 | Ga0495611_0004783 | 3300046648 | Bacteria | 5818 |
| 564 | Ga0495611_0005095 | 3300046648 | Bacteria | 5631 |
| 565 | Ga0495611_0009182 | 3300046648 | Bacteria | 4174 |
| 566 | Ga0495611_0010718 | 3300046648 | Bacteria | 3881 |
| 567 | Ga0495611_0021800 | 3300046648 | Bacteria | 2768 |
| 568 | Ga0495611_0028529 | 3300046648 | Bacteria | 2444 |
| 569 | Ga0495625_0000432 | 3300046660 | Bacteria | 63013 |
| 570 | Ga0495625_0000931 | 3300046660 | Bacteria | 39360 |
| 571 | Ga0495625_0001069 | 3300046660 | Bacteria | 35654 |
| 572 | Ga0495625_0002528 | 3300046660 | Bacteria | 19665 |
| 573 | Ga0495625_0002580 | 3300046660 | Bacteria | 19464 |
| 574 | Ga0495625_0004594 | 3300046660 | Bacteria | 12980 |
| 575 | Ga0495625_0007654 | 3300046660 | Bacteria | 9364 |
| 576 | Ga0495625_0014160 | 3300046660 | Bacteria | 6380 |
| 577 | Ga0495625_0024019 | 3300046660 | Bacteria | 4647 |
| 578 | Ga0495625_0029530 | 3300046660 | Bacteria | 4098 |
| 579 | Ga0495625_0039018 | 3300046660 | Bacteria | 3471 |
| 580 | Ga0495625_0050856 | 3300046660 | Bacteria | 2972 |
| 581 | Ga0495625_0103415 | 3300046660 | Bacteria | 1953 |
| 582 | Ga0495625_0128854 | 3300046660 | Bacteria | 1715 |
| 583 | Ga0495625_0146559 | 3300046660 | Bacteria | 1589 |
| 584 | Ga0495635_0067746 | 3300046663 | Bacteria | 2448 |
| 585 | Ga0495659_0000074 | 3300046664 | Bacteria | 42753 |
| 586 | Ga0495659_0000368 | 3300046664 | Bacteria | 17465 |
| 587 | Ga0495659_0009976 | 3300046664 | Bacteria | 3038 |
| 588 | Ga0495661_0000198 | 3300046665 | Bacteria | 69566 |
| 589 | Ga0495661_0000254 | 3300046665 | Bacteria | 61490 |
| 590 | Ga0495661_0000654 | 3300046665 | Bacteria | 34904 |
| 591 | Ga0495661_0001765 | 3300046665 | Bacteria | 17381 |
| 592 | Ga0495661_0003108 | 3300046665 | Bacteria | 12456 |
| 593 | Ga0495661_0009714 | 3300046665 | Bacteria | 6590 |
| 594 | Ga0495661_0014208 | 3300046665 | Bacteria | 5335 |
| 595 | Ga0495661_0014465 | 3300046665 | Bacteria | 5285 |
| 596 | Ga0495661_0018067 | 3300046665 | Bacteria | 4644 |
| 597 | Ga0495661_0021666 | 3300046665 | Bacteria | 4186 |
| 598 | Ga0495661_0032911 | 3300046665 | Bacteria | 3273 |
| 599 | Ga0495661_0036158 | 3300046665 | Bacteria | 3094 |
| 600 | Ga0495661_0045002 | 3300046665 | Bacteria | 2701 |
| 601 | Ga0495661_0058158 | 3300046665 | Bacteria | 2305 |
| 602 | Ga0495661_0067259 | 3300046665 | Bacteria | 2105 |
| 603 | Ga0495661_0088042 | 3300046665 | Bacteria | 1773 |
| 604 | Ga0495661_0113437 | 3300046665 | Bacteria | 1507 |
| 605 | Ga0495588_0000055 | 3300046674 | Bacteria | 280059 |
| 606 | Ga0495588_0004945 | 3300046674 | Bacteria | 5913 |
| 607 | Ga0495588_0018614 | 3300046674 | Bacteria | 3389 |
| 608 | Ga0495588_0118742 | 3300046674 | Bacteria | 1393 |
| 609 | Ga0495588_0155201 | 3300046674 | Bacteria | 1210 |
| 610 | Ga0495588_0164768 | 3300046674 | Bacteria | 1172 |
| 611 | Ga0495657_0030526 | 3300046675 | Bacteria | 3774 |
| 612 | Ga0495599_0004724 | 3300046678 | Bacteria | 8091 |
| 613 | Ga0495623_0019897 | 3300046679 | Bacteria | 4340 |
| 614 | Ga0495646_0003302 | 3300046680 | Bacteria | 10043 |
| 615 | Ga0495669_0000053 | 3300046684 | Bacteria | 79258 |
| 616 | Ga0495669_0003999 | 3300046684 | Bacteria | 6067 |
| 617 | Ga0495669_0013249 | 3300046684 | Bacteria | 3512 |
| 618 | Ga0495669_0018939 | 3300046684 | Bacteria | 2966 |
| 619 | Ga0495669_0033489 | 3300046684 | Bacteria | 2261 |
| 620 | Ga0495669_0114592 | 3300046684 | Bacteria | 1261 |
| 621 | Ga0495669_0161026 | 3300046684 | Bacteria | 1065 |
| 622 | Ga0495613_0011139 | 3300046689 | Bacteria | 6678 |
| 623 | Ga0495624_0063954 | 3300046690 | Bacteria | 2300 |
| 624 | Ga0495624_0168484 | 3300046690 | Bacteria | 1336 |
| 625 | Ga0495670_0000840 | 3300046691 | Bacteria | 14864 |
| 626 | Ga0495670_0003303 | 3300046691 | Bacteria | 7948 |
| 627 | Ga0495670_0003637 | 3300046691 | Bacteria | 7574 |
| 628 | Ga0495670_0007293 | 3300046691 | Bacteria | 5434 |
| 629 | Ga0495670_0014746 | 3300046691 | Bacteria | 3846 |
| 630 | Ga0495670_0036166 | 3300046691 | Bacteria | 2460 |
| 631 | Ga0495670_0043790 | 3300046691 | Bacteria | 2234 |
| 632 | Ga0495671_0000294 | 3300046692 | Bacteria | 41764 |
| 633 | Ga0495671_0000493 | 3300046692 | Bacteria | 30406 |
| 634 | Ga0495671_0001143 | 3300046692 | Bacteria | 18230 |
| 635 | Ga0495671_0001848 | 3300046692 | Bacteria | 13620 |
| 636 | Ga0495671_0015630 | 3300046692 | Bacteria | 4062 |
| 637 | Ga0495671_0022530 | 3300046692 | Bacteria | 3299 |
| 638 | Ga0495671_0056155 | 3300046692 | Bacteria | 1949 |
| 639 | Ga0495671_0089866 | 3300046692 | Bacteria | 1504 |
| 640 | Ga0495671_0147816 | 3300046692 | Bacteria | 1144 |
| 641 | Ga0495649_0001632 | 3300046694 | Bacteria | 16686 |
| 642 | Ga0495649_0002517 | 3300046694 | Bacteria | 12864 |
| 643 | Ga0495649_0002914 | 3300046694 | Bacteria | 11836 |
| 644 | Ga0495649_0017973 | 3300046694 | Bacteria | 3985 |
| 645 | Ga0495649_0029483 | 3300046694 | Bacteria | 3034 |
| 646 | Ga0495649_0033827 | 3300046694 | Bacteria | 2813 |
| 647 | Ga0495649_0056711 | 3300046694 | Bacteria | 2114 |
| 648 | Ga0495589_0000049 | 3300046794 | Bacteria | 116553 |
| 649 | Ga0495589_0000248 | 3300046794 | Bacteria | 44186 |
| 650 | Ga0495589_0000732 | 3300046794 | Bacteria | 21182 |
| 651 | Ga0495589_0017384 | 3300046794 | Bacteria | 3691 |
| 652 | Ga0495589_0023524 | 3300046794 | Bacteria | 3139 |
| 653 | Ga0495589_0025063 | 3300046794 | Bacteria | 3028 |
| 654 | Ga0495589_0034199 | 3300046794 | Bacteria | 2552 |
| 655 | Ga0495589_0148308 | 3300046794 | Bacteria | 1121 |
| 656 | Ga0495589_0191931 | 3300046794 | Bacteria | 966 |
| 657 | Ga0495600_0003375 | 3300046809 | Bacteria | 9393 |
| 658 | Ga0495600_0092665 | 3300046809 | Bacteria | 1970 |
| 659 | Ga0495660_0000167 | 3300046810 | Bacteria | 71094 |
| 660 | Ga0495660_0000419 | 3300046810 | Bacteria | 35881 |
| 661 | Ga0495660_0002961 | 3300046810 | Bacteria | 10619 |
| 662 | Ga0495660_0007004 | 3300046810 | Bacteria | 6646 |
| 663 | Ga0495660_0011538 | 3300046810 | Bacteria | 5126 |
| 664 | Ga0495660_0012541 | 3300046810 | Bacteria | 4921 |
| 665 | Ga0495660_0020217 | 3300046810 | Bacteria | 3816 |
| 666 | Ga0495660_0024157 | 3300046810 | Bacteria | 3463 |
| 667 | Ga0495660_0027283 | 3300046810 | Bacteria | 3232 |
| 668 | Ga0495660_0094127 | 3300046810 | Bacteria | 1552 |
| 669 | Ga0495660_0180040 | 3300046810 | Bacteria | 1023 |
| 670 | Ga0495581_0048258 | 3300047315 | Bacteria | 2459 |
| 671 | Ga0495581_0059508 | 3300047315 | Bacteria | 2207 |
| 672 | Ga0495604_0011517 | 3300047317 | Bacteria | 7026 |
| 673 | Ga0495604_0113077 | 3300047317 | Bacteria | 1976 |
| 674 | Ga0495636_0001381 | 3300047318 | Bacteria | 9172 |
| 675 | Ga0495636_0001424 | 3300047318 | Bacteria | 9048 |
| 676 | Ga0495636_0038726 | 3300047318 | Bacteria | 1973 |
| 677 | Ga0495636_0126537 | 3300047318 | Bacteria | 1134 |
| 678 | Ga0495672_0000026 | 3300047320 | Bacteria | 340319 |
| 679 | Ga0495672_0000226 | 3300047320 | Bacteria | 80307 |
| 680 | Ga0495672_0005477 | 3300047320 | Bacteria | 10063 |
| 681 | Ga0495672_0023423 | 3300047320 | Bacteria | 3996 |
| 682 | Ga0495672_0027083 | 3300047320 | Bacteria | 3648 |
| 683 | Ga0495672_0036485 | 3300047320 | Bacteria | 3018 |
| 684 | Ga0495672_0199766 | 3300047320 | Bacteria | 1000 |
| 685 | Ga0495676_0000030 | 3300047321 | Bacteria | 133637 |
| 686 | Ga0495676_0063085 | 3300047321 | Bacteria | 2890 |
| 687 | Ga0495676_0309762 | 3300047321 | Bacteria | 1063 |
| 688 | Ga0495683_0000072 | 3300047323 | Bacteria | 104027 |
| 689 | Ga0495683_0011411 | 3300047323 | Bacteria | 4675 |
| 690 | Ga0495683_0026453 | 3300047323 | Bacteria | 2968 |
| 691 | Ga0495683_0037071 | 3300047323 | Bacteria | 2473 |
| 692 | Ga0495683_0037948 | 3300047323 | Bacteria | 2440 |
| 693 | Ga0495683_0042743 | 3300047323 | Bacteria | 2284 |
| 694 | Ga0495683_0049462 | 3300047323 | Bacteria | 2105 |
| 695 | Ga0495683_0065004 | 3300047323 | Bacteria | 1800 |
| 696 | Ga0495683_0120187 | 3300047323 | Bacteria | 1247 |
| 697 | Ga0495687_000024 | 3300047443 | Bacteria | 316676 |
| 698 | Ga0495687_000213 | 3300047443 | Bacteria | 83235 |
| 699 | Ga0495687_000456 | 3300047443 | Bacteria | 50293 |
| 700 | Ga0495687_000855 | 3300047443 | Bacteria | 32474 |
| 701 | Ga0495687_000970 | 3300047443 | Bacteria | 29214 |
| 702 | Ga0495687_001969 | 3300047443 | Bacteria | 17520 |
| 703 | Ga0495687_003707 | 3300047443 | Bacteria | 10857 |
| 704 | Ga0495677_0000017 | 3300047445 | Bacteria | 121483 |
| 705 | Ga0495677_0000478 | 3300047445 | Bacteria | 17034 |
| 706 | Ga0495677_0000650 | 3300047445 | Bacteria | 14031 |
| 707 | Ga0495677_0003557 | 3300047445 | Bacteria | 6044 |
| 708 | Ga0495677_0007617 | 3300047445 | Bacteria | 4040 |
| 709 | Ga0495677_0008886 | 3300047445 | Bacteria | 3719 |
| 710 | Ga0495677_0017215 | 3300047445 | Bacteria | 2620 |
| 711 | Ga0495677_0026044 | 3300047445 | Bacteria | 2122 |
| 712 | Ga0495677_0032325 | 3300047445 | Bacteria | 1905 |
| 713 | Ga0495677_0033579 | 3300047445 | Bacteria | 1870 |
| 714 | Ga0495677_0052114 | 3300047445 | Bacteria | 1508 |
| 715 | Ga0495677_0084548 | 3300047445 | Bacteria | 1192 |
| 716 | Ga0495677_0094802 | 3300047445 | Bacteria | 1126 |
| 717 | Ga0495677_0128884 | 3300047445 | Bacteria | 968 |
| 718 | Ga0495679_014141 | 3300047446 | Bacteria | 2969 |
| 719 | Ga0495679_020250 | 3300047446 | Bacteria | 2319 |
| 720 | Ga0495679_038105 | 3300047446 | Bacteria | 1507 |
| 721 | Ga0495685_000263 | 3300047447 | Bacteria | 18095 |
| 722 | Ga0495685_005104 | 3300047447 | Bacteria | 4274 |
| 723 | Ga0495685_026805 | 3300047447 | Bacteria | 1982 |
| 724 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 725 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 726 | Ga0495673_0007222 | 3300047469 | Bacteria | 6419 |
| 727 | Ga0495673_0014443 | 3300047469 | Bacteria | 4107 |
| 728 | Ga0495673_0067398 | 3300047469 | Bacteria | 1515 |
| 729 | Ga0495681_0003096 | 3300047470 | Bacteria | 11665 |
| 730 | Ga0495681_0006805 | 3300047470 | Bacteria | 7437 |
| 731 | Ga0495681_0011676 | 3300047470 | Bacteria | 5212 |
| 732 | Ga0495681_0030978 | 3300047470 | Bacteria | 2715 |
| 733 | Ga0495681_0043297 | 3300047470 | Bacteria | 2172 |
| 734 | Ga0495681_0044896 | 3300047470 | Bacteria | 2119 |
| 735 | Ga0495681_0060524 | 3300047470 | Bacteria | 1747 |
| 736 | Ga0495681_0061168 | 3300047470 | Bacteria | 1735 |
| 737 | Ga0495681_0085133 | 3300047470 | Bacteria | 1404 |
| 738 | Ga0495681_0103962 | 3300047470 | Bacteria | 1238 |
| 739 | Ga0495686_0000062 | 3300047472 | Bacteria | 235234 |
| 740 | Ga0495686_0000431 | 3300047472 | Bacteria | 65240 |
| 741 | Ga0495686_0002226 | 3300047472 | Bacteria | 18792 |
| 742 | Ga0495686_0048025 | 3300047472 | Bacteria | 2693 |
| 743 | Ga0495686_0156380 | 3300047472 | Bacteria | 1335 |
| 744 | Ga0495686_0210553 | 3300047472 | Bacteria | 1111 |
| 745 | Ga0495593_0002258 | 3300047673 | Bacteria | 11560 |
| 746 | Ga0495593_0020776 | 3300047673 | Bacteria | 3672 |
| 747 | Ga0495593_0106482 | 3300047673 | Bacteria | 1434 |
| 748 | Ga0495602_0050252 | 3300048088 | Bacteria | 3727 |
| 749 | Ga0495602_0157991 | 3300048088 | Bacteria | 1773 |
| 750 | Ga0495614_0057335 | 3300048089 | Bacteria | 1672 |
| 751 | Ga0495615_0003336 | 3300048090 | Bacteria | 2676 |
| 752 | Ga0495615_0008300 | 3300048090 | Bacteria | 2003 |
| 753 | Ga0495626_0000202 | 3300048091 | Bacteria | 72266 |
| 754 | Ga0495626_0001340 | 3300048091 | Bacteria | 19924 |
| 755 | Ga0495626_0002145 | 3300048091 | Bacteria | 14272 |
| 756 | Ga0495626_0003033 | 3300048091 | Bacteria | 11062 |
| 757 | Ga0495626_0003131 | 3300048091 | Bacteria | 10834 |
| 758 | Ga0495626_0003253 | 3300048091 | Bacteria | 10510 |
| 759 | Ga0495626_0014993 | 3300048091 | Bacteria | 3975 |
| 760 | Ga0495626_0025563 | 3300048091 | Bacteria | 2887 |
| 761 | Ga0495626_0030964 | 3300048091 | Bacteria | 2578 |
| 762 | Ga0495626_0076195 | 3300048091 | Bacteria | 1497 |
| 763 | Ga0495626_0083539 | 3300048091 | Bacteria | 1414 |
| 764 | Ga0495626_0088777 | 3300048091 | Bacteria | 1362 |
| 765 | Ga0496100_0034984 | 3300048903 | Bacteria | 3157 |
| 766 | Ga0496100_0203498 | 3300048903 | Bacteria | 1444 |
| 767 | Ga0496101_0249842 | 3300048904 | Bacteria | 1382 |
| 768 | Ga0496102_0000071 | 3300048905 | Bacteria | 154320 |
| 769 | Ga0496102_0031176 | 3300048905 | Bacteria | 4780 |
| 770 | Ga0496102_0114322 | 3300048905 | Bacteria | 2518 |
| 771 | Ga0496102_0305413 | 3300048905 | Bacteria | 1499 |
| 772 | Ga0496103_0006209 | 3300048906 | Bacteria | 7137 |
| 773 | Ga0496103_0030941 | 3300048906 | Bacteria | 3258 |
| 774 | Ga0496103_0033175 | 3300048906 | Bacteria | 3154 |
| 775 | Ga0496103_0050773 | 3300048906 | Bacteria | 2566 |
| 776 | Ga0496103_0143341 | 3300048906 | Bacteria | 1529 |
| 777 | Ga0496104_0101788 | 3300048907 | Bacteria | 2751 |
| 778 | Ga0496104_0275695 | 3300048907 | Bacteria | 1595 |
| 779 | Ga0496104_0451729 | 3300048907 | Bacteria | 1197 |
| 780 | Ga0496108_0070387 | 3300048911 | Bacteria | 2952 |
| 781 | Ga0496109_0148947 | 3300048912 | Bacteria | 2190 |
| 782 | Ga0496110_0001557 | 3300048913 | Bacteria | 16711 |
| 783 | Ga0496110_0086963 | 3300048913 | Bacteria | 2791 |
| 784 | Ga0496110_0126770 | 3300048913 | Bacteria | 2303 |
| 785 | Ga0496111_0038096 | 3300048914 | Bacteria | 3443 |
| 786 | Ga0496111_0077330 | 3300048914 | Bacteria | 2426 |
| 787 | Ga0496111_0123990 | 3300048914 | Bacteria | 1909 |
| 788 | Ga0496113_0029191 | 3300048916 | Bacteria | 3979 |
| 789 | Ga0496113_0137320 | 3300048916 | Bacteria | 1922 |
| 790 | Ga0496114_0144584 | 3300048917 | Bacteria | 2061 |
| 791 | Ga0496115_0023301 | 3300048918 | Bacteria | 4803 |
| 792 | Ga0496115_0239605 | 3300048918 | Bacteria | 1495 |
| 793 | Ga0496115_0309751 | 3300048918 | Bacteria | 1293 |
| 794 | Ga0496116_0002196 | 3300048919 | Bacteria | 20783 |
| 795 | Ga0496116_0008492 | 3300048919 | Bacteria | 8903 |
| 796 | Ga0496116_0043485 | 3300048919 | Bacteria | 3060 |
| 797 | Ga0496116_0067960 | 3300048919 | Bacteria | 2273 |
| 798 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 799 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 800 | Ga0496118_0044587 | 3300048921 | Bacteria | 3471 |
| 801 | Ga0496121_0004994 | 3300048924 | Bacteria | 17366 |
| 802 | Ga0496121_0006051 | 3300048924 | Bacteria | 15233 |
| 803 | Ga0496121_0114687 | 3300048924 | Bacteria | 2047 |
| 804 | Ga0496122_0000121 | 3300048925 | Bacteria | 181589 |
| 805 | Ga0496122_0000263 | 3300048925 | Bacteria | 117762 |
| 806 | Ga0496122_0001857 | 3300048925 | Bacteria | 32205 |
| 807 | Ga0496122_0022503 | 3300048925 | Bacteria | 5599 |
| 808 | Ga0496122_0078180 | 3300048925 | Bacteria | 2318 |
| 809 | Ga0496123_0000040 | 3300048926 | Bacteria | 258569 |
| 810 | Ga0496123_0000156 | 3300048926 | Bacteria | 139362 |
| 811 | Ga0496123_0006176 | 3300048926 | Bacteria | 11711 |
| 812 | Ga0496123_0034198 | 3300048926 | Bacteria | 3645 |
| 813 | Ga0496123_0045315 | 3300048926 | Bacteria | 2998 |
| 814 | Ga0496124_0005845 | 3300048927 | Bacteria | 13655 |
| 815 | Ga0496124_0011979 | 3300048927 | Bacteria | 8623 |
| 816 | Ga0496124_0038760 | 3300048927 | Bacteria | 4135 |
| 817 | Ga0496124_0058411 | 3300048927 | Bacteria | 3245 |
| 818 | Ga0496124_0060934 | 3300048927 | Bacteria | 3164 |
| 819 | Ga0496124_0067409 | 3300048927 | Bacteria | 2978 |
| 820 | Ga0496124_0077481 | 3300048927 | Bacteria | 2742 |
| 821 | Ga0496124_0157902 | 3300048927 | Bacteria | 1771 |
| 822 | Ga0496124_0210580 | 3300048927 | Bacteria | 1471 |
| 823 | Ga0496124_0355674 | 3300048927 | Bacteria | 1034 |
| 824 | Ga0496125_0000672 | 3300048928 | Bacteria | 57073 |
| 825 | Ga0496125_0000720 | 3300048928 | Bacteria | 54770 |
| 826 | Ga0496125_0000995 | 3300048928 | Bacteria | 44209 |
| 827 | Ga0496125_0030196 | 3300048928 | Bacteria | 4852 |
| 828 | Ga0496126_0006238 | 3300048929 | Bacteria | 13323 |
| 829 | Ga0501307_003330 | 3300049162 | Bacteria | 1569 |
| 830 | Ga0495678_000012 | 3300049459 | Bacteria | 333905 |
| 831 | Ga0495678_000035 | 3300049459 | Bacteria | 200957 |
| 832 | Ga0495678_000130 | 3300049459 | Bacteria | 88909 |
| 833 | Ga0495678_000232 | 3300049459 | Bacteria | 63796 |
| 834 | Ga0495678_000782 | 3300049459 | Bacteria | 28498 |
| 835 | Ga0495678_001730 | 3300049459 | Bacteria | 16272 |
| 836 | Ga0495678_002896 | 3300049459 | Bacteria | 11050 |
| 837 | Ga0495678_025648 | 3300049459 | Bacteria | 2528 |
| 838 | Ga0495678_027597 | 3300049459 | Bacteria | 2407 |
| 839 | Ga0495682_0000210 | 3300049460 | Bacteria | 47048 |
| 840 | Ga0495682_0001032 | 3300049460 | Bacteria | 16423 |
| 841 | Ga0495682_0001446 | 3300049460 | Bacteria | 12830 |
| 842 | Ga0495682_0004102 | 3300049460 | Bacteria | 6324 |
| 843 | Ga0495682_0005703 | 3300049460 | Bacteria | 5140 |
| 844 | Ga0495682_0012843 | 3300049460 | Bacteria | 3199 |
| 845 | Ga0501034_0284748 | 3300049571 | Bacteria | 1592 |
| 846 | Ga0501034_0369288 | 3300049571 | Bacteria | 1361 |
| 847 | Ga0501069_0018296 | 3300049585 | Bacteria | 3779 |
| 848 | Ga0501070_0004652 | 3300049586 | Bacteria | 11754 |
| 849 | Ga0501074_0004908 | 3300049590 | Bacteria | 9587 |
| 850 | Ga0501211_002271 | 3300049658 | Bacteria | 2043 |
| 851 | Ga0501249_001082 | 3300049679 | Bacteria | 5782 |
| 852 | Ga0501079_0010210 | 3300049741 | Bacteria | 7130 |
| 853 | Ga0501080_0004308 | 3300049742 | Bacteria | 12635 |
| 854 | Ga0501083_0014146 | 3300049744 | Bacteria | 5580 |
| 855 | Ga0501269_000461 | 3300049766 | Bacteria | 8895 |
| 856 | Ga0501035_0028204 | 3300049822 | Bacteria | 5124 |
| 857 | Ga0501044_0049236 | 3300049823 | Bacteria | 4350 |
| 858 | nmdc:mga03683_37356_c1 | 3300050489 | Bacteria | 1979 |
| 859 | Ga0495601_0008185 | 3300053077 | Bacteria | 6167 |
| 860 | Ga0500594_0036941 | 3300053118 | Bacteria | 1317 |
| 861 | Ga0500595_003105 | 3300053119 | Bacteria | 7864 |
| 862 | Ga0500618_000088 | 3300053125 | Bacteria | 74892 |
| 863 | Ga0500573_0135707 | 3300053140 | Bacteria | 1359 |
| 864 | Ga0500586_001756 | 3300053145 | Bacteria | 4691 |
| 865 | Ga0500619_002584 | 3300053154 | Bacteria | 3522 |
| 866 | 2511384664 | 2511231026 | Bacteria | 5225445 |
| 867 | 2521559095 | 2521172590 | Bacteria | 5047645 |
| 868 | 2548848507 | 2547132512 | Bacteria | 3416496 |
| 869 | 2550692772 | 2548876994 | Bacteria | 4904866 |
| 870 | 2553003907 | 2551306416 | Bacteria | 6152985 |
| 871 | 2601671530 | 2600255292 | Bacteria | 6300551 |
| 872 | 2643792452 | 2643221554 | Bacteria | 6603920 |
| 873 | 2643800025 | 2643221556 | Bacteria | 7251154 |
| 874 | 2644031481 | 2643221603 | Bacteria | 6147767 |
| 875 | 2644217031 | 2643221638 | Bacteria | 6579467 |
| 876 | 2644250649 | 2643221645 | Bacteria | 7207331 |
| 877 | 2644358961 | 2643221664 | Bacteria | 7272945 |
| 878 | 2644475025 | 2643221684 | Bacteria | 7145183 |
| 879 | 2738738592 | 2738541280 | Bacteria | 6630198 |
| 880 | 2738826325 | 2738541297 | Bacteria | 6549566 |
| 881 | 2738842599 | 2738541300 | Bacteria | 6675882 |
| 882 | 2739150122 | 2738541357 | Bacteria | 6549408 |
| 883 | 2739192041 | 2738543003 | Bacteria | 6549560 |
| 884 | 2739273346 | 2738543018 | Bacteria | 6718814 |
| 885 | 2739318518 | 2738543026 | Bacteria | 6549408 |
| 886 | 2739336759 | 2738543029 | Bacteria | 6549249 |
| 887 | 2739342390 | 2738543030 | Bacteria | 6719714 |
| 888 | 2765568658 | 2765235838 | Bacteria | 5445269 |
| 889 | 2819541439 | 2818991436 | Bacteria | 5376622 |
| 890 | 2819593680 | 2818991445 | Bacteria | 4955017 |
| 891 | 2819615605 | 2818991449 | Bacteria | 5518009 |
| 892 | 2821134866 | 2821131069 | Bacteria | 6108407 |
| 893 | 2839096458 | 2839094727 | Bacteria | 5534556 |
| 894 | 2842715716 | 2842711865 | Bacteria | 7155354 |
| 895 | 2857548636 | 2857547612 | Bacteria | 6179999 |
| 896 | 2857558440 | 2857553236 | Bacteria | 6166726 |
| 897 | 2857558880 | 2857558681 | Bacteria | 6617694 |
| 898 | 2884815856 | 2884811622 | Bacteria | 5552861 |
| 899 | 2884837881 | 2884836552 | Bacteria | 5219991 |
| 900 | 2884854173 | 2884852848 | Bacteria | 5221161 |
| 901 | 2885082231 | 2885080285 | Bacteria | 6355622 |
| 902 | 2896154710 | 2896154374 | Bacteria | 5221518 |
| 903 | 2904428247 | 2904424332 | Bacteria | 7633521 |
| 904 | 2904444842 | 2904439833 | Bacteria | 5931679 |
| 905 | 2904532342 | 2904530477 | Bacteria | 5876334 |
| 906 | 2904584784 | 2904584206 | Bacteria | 6028872 |
| 907 | 2904591306 | 2904589729 | Bacteria | 6113573 |
| 908 | 2904605151 | 2904601388 | Bacteria | 5884906 |
| 909 | 2919048319 | 2919046199 | Bacteria | 5567169 |
| 910 | 2919081155 | 2919079590 | Bacteria | 5946433 |
| 911 | 2919476530 | 2919476304 | Bacteria | 5888696 |
| 912 | 2923512765 | 2923510766 | Bacteria | 5926163 |
| 913 | 2928132767 | 2928130867 | Bacteria | 5467269 |
| 914 | 2932416031 | 2932410948 | Bacteria | 6312192 |
| 915 | 2932421956 | 2932416698 | Bacteria | 6315112 |
| 916 | 8047673533 | 8047673197 | Bacteria | 7395230 |
| 917 | Ga0495609_0025283 | |||
| 918 | JGI25155J39150_1000045 | |||
| 919 | JGI25155J39150_1000256 | |||
| 920 | JGI25156J39149_1000054 | |||
| 921 | JGI25156J39149_1002432 | |||
| 922 | JGI25162J39368_1003970 | |||
| 923 | JGI25154J39366_1000083 | |||
| 924 | JGI25154J39366_1000474 | |||
| 925 | JGI25154J39366_1001206 | |||
| 926 | JGI25158J39367_1002133 | |||
| 927 | JGI25157J39369_1000208 | |||
| 928 | JGI25152J39213_1002579 | |||
| 929 | JGI25152J39213_1007431 | |||
| 930 | JGI25150J39212_1002242 | |||
| 931 | JGI25150J39212_1013348 | |||
| 932 | JGI25159J45721_1001029 | |||
| 933 | JGI25159J45721_1002206 | |||
| 934 | JGI25153J46596_10012384 | |||
| 935 | rootL2_10090070 | |||
| 936 | rootL2_10174602 | |||
| 937 | JGI25161J50226_1000734 | |||
| 938 | Ga0055538_1000030 | |||
| 939 | Ga0055539_1000040 | |||
| 940 | Ga0055533_1000050 | |||
| 941 | Ga0055532_1000099 | |||
| 942 | Ga0055525_1000001 | |||
| 943 | Ga0055525_1000060 | |||
| 944 | Ga0055529_1000015 | |||
| 945 | Ga0055526_1000007 | |||
| 946 | Ga0055526_1000054 | |||
| 947 | Ga0055526_1000885 | |||
| 948 | Ga0055526_1001567 | |||
| 949 | Ga0055526_1011491 | |||
| 950 | Ga0055537_1000005 | |||
| 951 | Ga0055537_1003477 | |||
| 952 | Ga0055524_1000038 | |||
| 953 | Ga0055524_1002845 | |||
| 954 | Ga0055524_1006360 | |||
| 955 | Ga0055524_1028267 | |||
| 956 | Ga0055534_1000127 | |||
| 957 | Ga0055534_1001049 | |||
| 958 | Ga0055528_1000063 | |||
| 959 | Ga0055528_1002242 | |||
| 960 | Ga0055530_10001675 | |||
| 961 | Ga0055541_1000027 | |||
| 962 | Ga0055543_1001698 | |||
| 963 | Ga0065165_1000034 | |||
| 964 | Ga0065165_1003016 | |||
| 965 | Ga0065714_10008082 | |||
| 966 | Ga0070658_10066568 | |||
| 967 | Ga0070670_100002673 | |||
| 968 | Ga0070660_100008707 | |||
| 969 | Ga0070661_100017505 | |||
| 970 | Ga0070661_100460774 | |||
| 971 | Ga0070668_100108862 | |||
| 972 | Ga0070673_100052053 | |||
| 973 | Ga0070659_100000456 | |||
| 974 | Ga0070659_100059246 | |||
| 975 | Ga0070678_100599754 | |||
| 976 | Ga0070681_10224156 | |||
| 977 | Ga0070672_100076017 | |||
| 978 | Ga0068855_100000243 | |||
| 979 | Ga0068855_100001100 | |||
| 980 | Ga0068855_100011885 | |||
| 981 | Ga0068855_100059076 | |||
| 982 | Ga0068855_100280904 | |||
| 983 | Ga0070664_100049799 | |||
| 984 | Ga0070664_100148823 | |||
| 985 | Ga0068854_100071853 | |||
| 986 | Ga0068852_100245011 | |||
| 987 | Ga0068852_100369736 | |||
| 988 | Ga0068852_100415233 | |||
| 989 | Ga0068864_100001909 | |||
| 990 | Ga0068863_100003624 | |||
| 991 | Ga0105244_10001568 | |||
| 992 | Ga0105244_10030858 | |||
| 993 | Ga0105240_10002667 | |||
| 994 | Ga0105240_10012212 | |||
| 995 | Ga0105240_10038896 | |||
| 996 | Ga0105240_10280612 | |||
| 997 | Ga0105245_10247558 | |||
| 998 | Ga0105243_10058147 | |||
| 999 | Ga0105243_10103814 | |||
| 1000 | Ga0105242_10091289 | |||
| 1001 | Ga0105237_10041247 | |||
| 1002 | Ga0105238_10000547 | |||
| 1003 | Ga0105239_10006605 | |||
| 1004 | Ga0105239_10322528 | |||
| 1005 | Ga0157370_10010253 | |||
| 1006 | Ga0157374_10121038 | |||
| 1007 | Ga0157372_10283305 | |||
| 1008 | Ga0163163_10005831 | |||
| 1009 | Ga0182008_10000542 | |||
| 1010 | Ga0182008_10065918 | |||
| 1011 | Ga0157376_10396373 | |||
| 1012 | Ga0182006_1000007 | |||
| 1013 | Ga0182006_1000023 | |||
| 1014 | Ga0182006_1002414 | |||
| 1015 | Ga0182007_10000022 | |||
| 1016 | Ga0182007_10002459 | |||
| 1017 | Ga0182007_10071288 | |||
| 1018 | Ga0182005_1000006 | |||
| 1019 | Ga0182005_1000010 | |||
| 1020 | Ga0163161_10228890 | |||
| 1021 | Ga0213872_10000087 | |||
| 1022 | Ga0213872_10000157 | |||
| 1023 | Ga0213872_10000703 | |||
| 1024 | Ga0213872_10016017 | |||
| 1025 | Ga0213872_10027347 | |||
| 1026 | Ga0209435_100034 | |||
| 1027 | Ga0209435_100074 | |||
| 1028 | Ga0209436_100040 | |||
| 1029 | Ga0209436_104332 | |||
| 1030 | Ga0209784_100005 | |||
| 1031 | Ga0209566_100005 | |||
| 1032 | Ga0209674_100009 | |||
| 1033 | Ga0209147_100004 | |||
| 1034 | Ga0209563_100007 | |||
| 1035 | Ga0209563_100012 | |||
| 1036 | Ga0209437_100072 | |||
| 1037 | Ga0209437_101483 | |||
| 1038 | Ga0209437_109253 | |||
| 1039 | Ga0209258_100417 | |||
| 1040 | Ga0207425_1000009 | |||
| 1041 | Ga0207425_1000036 | |||
| 1042 | Ga0207425_1001550 | |||
| 1043 | Ga0209646_1000042 | |||
| 1044 | Ga0209646_1000057 | |||
| 1045 | Ga0209646_1000118 | |||
| 1046 | Ga0209026_1000106 | |||
| 1047 | Ga0209026_1002894 | |||
| 1048 | Ga0209026_1006544 | |||
| 1049 | Ga0209677_100006 | |||
| 1050 | Ga0209677_102284 | |||
| 1051 | Ga0209759_1000112 | |||
| 1052 | Ga0209759_1000190 | |||
| 1053 | Ga0209129_1000051 | |||
| 1054 | Ga0209129_1016008 | |||
| 1055 | Ga0209565_1000074 | |||
| 1056 | Ga0209565_1000662 | |||
| 1057 | Ga0209565_1001767 | |||
| 1058 | Ga0209565_1005640 | |||
| 1059 | Ga0209565_1021237 | |||
| 1060 | Ga0209455_1000031 | |||
| 1061 | Ga0209455_1010197 | |||
| 1062 | Ga0209673_1000129 | |||
| 1063 | Ga0209673_1006223 | |||
| 1064 | Ga0209130_1000016 | |||
| 1065 | Ga0209130_1000217 | |||
| 1066 | Ga0209130_1004379 | |||
| 1067 | Ga0209675_1000072 | |||
| 1068 | Ga0209675_1023079 | |||
| 1069 | Ga0209025_1004319 | |||
| 1070 | Ga0209564_1000010 | |||
| 1071 | Ga0209564_1000042 | |||
| 1072 | Ga0209564_1000160 | |||
| 1073 | Ga0209564_1000172 | |||
| 1074 | Ga0209564_1009057 | |||
| 1075 | Ga0209564_1016727 | |||
| 1076 | Ga0209758_1000054 | |||
| 1077 | Ga0209758_1000379 | |||
| 1078 | Ga0209050_1000040 | |||
| 1079 | Ga0209050_1000309 | |||
| 1080 | Ga0209050_1040797 | |||
| 1081 | Ga0209256_1000018 | |||
| 1082 | Ga0209256_1000125 | |||
| 1083 | Ga0209256_1000307 | |||
| 1084 | Ga0209256_1000553 | |||
| 1085 | Ga0209256_1001812 | |||
| 1086 | Ga0207426_1020060 | |||
| 1087 | Ga0209051_1001406 | |||
| 1088 | Ga0209051_1006685 | |||
| 1089 | Ga0209051_1009224 | |||
| 1090 | Ga0209257_1000054 | |||
| 1091 | Ga0207655_1002256 | |||
| 1092 | Ga0207655_1002948 | |||
| 1093 | Ga0207643_10197902 | |||
| 1094 | Ga0207707_10182984 | |||
| 1095 | Ga0207695_10000913 | |||
| 1096 | Ga0207695_10005170 | |||
| 1097 | Ga0207695_10019098 | |||
| 1098 | Ga0207695_10260951 | |||
| 1099 | Ga0207671_10011896 | |||
| 1100 | Ga0207657_10001579 | |||
| 1101 | Ga0207657_10018104 | |||
| 1102 | Ga0207649_10015582 | |||
| 1103 | Ga0207649_10321686 | |||
| 1104 | Ga0207694_10002807 | |||
| 1105 | Ga0207650_10007503 | |||
| 1106 | Ga0207650_10214918 | |||
| 1107 | Ga0207659_10022051 | |||
| 1108 | Ga0207690_10117401 | |||
| 1109 | Ga0207690_10178372 | |||
| 1110 | Ga0207686_10051518 | |||
| 1111 | Ga0207709_10037826 | |||
| 1112 | Ga0207709_10085497 | |||
| 1113 | Ga0207691_10078797 | |||
| 1114 | Ga0207679_10028672 | |||
| 1115 | Ga0207679_10122745 | |||
| 1116 | Ga0207667_10000301 | |||
| 1117 | Ga0207667_10008602 | |||
| 1118 | Ga0207667_10038852 | |||
| 1119 | Ga0207667_10086607 | |||
| 1120 | Ga0207667_10136832 | |||
| 1121 | Ga0207667_10222943 | |||
| 1122 | Ga0207668_10256405 | |||
| 1123 | Ga0207658_10125403 | |||
| 1124 | Ga0207702_10158586 | |||
| 1125 | Ga0207641_10003573 | |||
| 1126 | Ga0207676_10001593 | |||
| 1127 | Ga0207698_10187727 | |||
| 1128 | Ga0207698_10387524 | |||
| 1129 | Ga0209281_1004072 | |||
| 1130 | Ga0209282_1000005 | |||
| 1131 | Ga0316177_1040718 | |||
| 1132 | Ga0316181_1174308 | |||
| 1133 | Ga0265328_10048929 | |||
| 1134 | Ga0265327_10008459 | |||
| 1135 | Ga0265316_10000192 | |||
| 1136 | Ga0307408_100000144 | |||
| 1137 | Ga0307408_100002435 | |||
| 1138 | Ga0307408_100002837 | |||
| 1139 | Ga0307408_100003117 | |||
| 1140 | Ga0265314_10016398 | |||
| 1141 | Ga0307416_100013859 | |||
| 1142 | Ga0373933_0162110 | |||
| 1143 | Ga0395899_0004277 | |||
| 1144 | Ga0395899_0009167 | |||
| 1145 | Ga0395899_0017209 | |||
| 1146 | Ga0395899_0019216 | |||
| 1147 | Ga0395900_0000826 | |||
| 1148 | Ga0395900_0017822 | |||
| 1149 | Ga0395900_0019747 | |||
| 1150 | Ga0395900_0074854 | |||
| 1151 | Ga0395900_0131159 | |||
| 1152 | Ga0395900_0196452 | |||
| 1153 | Ga0395900_0272047 | |||
| 1154 | Ga0395900_0296765 | |||
| 1155 | Ga0395898_0040343 | |||
| 1156 | Ga0395898_0082471 | |||
| 1157 | Ga0395905_0000955 | |||
| 1158 | Ga0395905_0007217 | |||
| 1159 | Ga0395905_0033040 | |||
| 1160 | Ga0395905_0041777 | |||
| 1161 | Ga0395905_0079842 | |||
| 1162 | Ga0395905_0123194 | |||
| 1163 | Ga0395905_0245047 | |||
| 1164 | Ga0395905_0348570 | |||
| 1165 | Ga0395901_0000033 | |||
| 1166 | Ga0395901_0001938 | |||
| 1167 | Ga0395901_0010151 | |||
| 1168 | Ga0395901_0022786 | |||
| 1169 | Ga0395901_0031647 | |||
| 1170 | Ga0395901_0132471 | |||
| 1171 | Ga0395901_0132653 | |||
| 1172 | Ga0395901_0159990 | |||
| 1173 | Ga0395901_0216633 | |||
| 1174 | Ga0395901_0314493 | |||
| 1175 | Ga0395901_0452006 | |||
| 1176 | Ga0436361_0006435 | |||
| 1177 | Ga0436361_0428998 | |||
| 1178 | Ga0436361_0456588 | |||
| 1179 | Ga0436361_0492958 | |||
| 1180 | Ga0436361_0595316 | |||
| 1181 | Ga0436361_0835704 | |||
| 1182 | Ga0436361_0998063 | |||
| 1183 | Ga0436361_1217285 | |||
| 1184 | Ga0439448_0006050 | |||
| 1185 | Ga0439450_003927 | |||
| 1186 | Ga0439455_0022445 | |||
| 1187 | Ga0450904_000694 | |||
| 1188 | Ga0450893_0011512 | |||
| 1189 | Ga0466966_0039284 | |||
| 1190 | Ga0466963_0019225 | |||
| 1191 | Ga0466964_0000038 | |||
| 1192 | Ga0466964_0083204 | |||
| 1193 | Ga0466971_0230075 | |||
| 1194 | Ga0466970_0006191 | |||
| 1195 | Ga0466957_0026106 | |||
| 1196 | Ga0466957_0045470 | |||
| 1197 | Ga0466967_0046032 | |||
| 1198 | Ga0466967_0052043 | |||
| 1199 | Ga0495617_000055 | |||
| 1200 | Ga0495617_000197 | |||
| 1201 | Ga0495617_000809 | |||
| 1202 | Ga0495617_008224 | |||
| 1203 | Ga0495617_015288 | |||
| 1204 | Ga0495627_000004 | |||
| 1205 | Ga0495627_000123 | |||
| 1206 | Ga0495627_008222 | |||
| 1207 | Ga0495627_024396 | |||
| 1208 | Ga0495592_0028251 | |||
| 1209 | Ga0495603_0060162 | |||
| 1210 | Ga0495590_0000012 | |||
| 1211 | Ga0495590_0002304 | |||
| 1212 | Ga0495590_0011927 | |||
| 1213 | Ga0495590_0015419 | |||
| 1214 | Ga0495590_0056039 | |||
| 1215 | Ga0495591_023414 | |||
| 1216 | Ga0495629_0094381 | |||
| 1217 | Ga0495638_0000047 | |||
| 1218 | Ga0495638_0002024 | |||
| 1219 | Ga0495638_0009661 | |||
| 1220 | Ga0495638_0011357 | |||
| 1221 | Ga0495638_0011670 | |||
| 1222 | Ga0495638_0047332 | |||
| 1223 | Ga0495638_0063804 | |||
| 1224 | Ga0495638_0082126 | |||
| 1225 | Ga0495651_0121657 | |||
| 1226 | Ga0495653_0000082 | |||
| 1227 | Ga0495653_0022531 | |||
| 1228 | Ga0495653_0096197 | |||
| 1229 | Ga0495650_0000226 | |||
| 1230 | Ga0495650_0000437 | |||
| 1231 | Ga0495650_0000462 | |||
| 1232 | Ga0495650_0001511 | |||
| 1233 | Ga0495650_0052773 | |||
| 1234 | Ga0495582_0003405 | |||
| 1235 | Ga0495582_0046243 | |||
| 1236 | Ga0495605_0000018 | |||
| 1237 | Ga0495605_0000035 | |||
| 1238 | Ga0495605_0000206 | |||
| 1239 | Ga0495605_0003120 | |||
| 1240 | Ga0495605_0003394 | |||
| 1241 | Ga0495605_0005369 | |||
| 1242 | Ga0495605_0008334 | |||
| 1243 | Ga0495605_0018918 | |||
| 1244 | Ga0495605_0029583 | |||
| 1245 | Ga0495605_0066553 | |||
| 1246 | Ga0495584_0000006 | |||
| 1247 | Ga0495584_0000570 | |||
| 1248 | Ga0495584_0001531 | |||
| 1249 | Ga0495584_0002419 | |||
| 1250 | Ga0495584_0002756 | |||
| 1251 | Ga0495584_0008363 | |||
| 1252 | Ga0495584_0010792 | |||
| 1253 | Ga0495584_0020430 | |||
| 1254 | Ga0495584_0020746 | |||
| 1255 | Ga0495584_0022479 | |||
| 1256 | Ga0495584_0022925 | |||
| 1257 | Ga0495584_0025346 | |||
| 1258 | Ga0495584_0042803 | |||
| 1259 | Ga0495584_0079987 | |||
| 1260 | Ga0495585_0000005 | |||
| 1261 | Ga0495585_0000049 | |||
| 1262 | Ga0495585_0000162 | |||
| 1263 | Ga0495585_0003133 | |||
| 1264 | Ga0495585_0006337 | |||
| 1265 | Ga0495585_0009264 | |||
| 1266 | Ga0495585_0013680 | |||
| 1267 | Ga0495585_0020793 | |||
| 1268 | Ga0495585_0024583 | |||
| 1269 | Ga0495585_0025442 | |||
| 1270 | Ga0495585_0040572 | |||
| 1271 | Ga0495585_0045473 | |||
| 1272 | Ga0495585_0050114 | |||
| 1273 | Ga0495585_0071327 | |||
| 1274 | Ga0495585_0086482 | |||
| 1275 | Ga0495585_0092960 | |||
| 1276 | Ga0495585_0104980 | |||
| 1277 | Ga0495594_0043180 | |||
| 1278 | Ga0495594_0061635 | |||
| 1279 | Ga0495594_0181046 | |||
| 1280 | Ga0495596_0000013 | |||
| 1281 | Ga0495596_0000570 | |||
| 1282 | Ga0495596_0001390 | |||
| 1283 | Ga0495596_0004436 | |||
| 1284 | Ga0495596_0005617 | |||
| 1285 | Ga0495596_0007448 | |||
| 1286 | Ga0495596_0007810 | |||
| 1287 | Ga0495596_0026349 | |||
| 1288 | Ga0495596_0027105 | |||
| 1289 | Ga0495607_0000447 | |||
| 1290 | Ga0495607_0001792 | |||
| 1291 | Ga0495607_0002443 | |||
| 1292 | Ga0495607_0004972 | |||
| 1293 | Ga0495607_0005432 | |||
| 1294 | Ga0495607_0007839 | |||
| 1295 | Ga0495607_0015793 | |||
| 1296 | Ga0495607_0024570 | |||
| 1297 | Ga0495607_0028489 | |||
| 1298 | Ga0495607_0040921 | |||
| 1299 | Ga0495607_0050499 | |||
| 1300 | Ga0495607_0051010 | |||
| 1301 | Ga0495607_0068780 | |||
| 1302 | Ga0495583_0000008 | |||
| 1303 | Ga0495583_0000092 | |||
| 1304 | Ga0495583_0000316 | |||
| 1305 | Ga0495583_0000480 | |||
| 1306 | Ga0495583_0001098 | |||
| 1307 | Ga0495583_0001357 | |||
| 1308 | Ga0495583_0005766 | |||
| 1309 | Ga0495583_0016772 | |||
| 1310 | Ga0495583_0017309 | |||
| 1311 | Ga0495583_0028977 | |||
| 1312 | Ga0495583_0053571 | |||
| 1313 | Ga0495583_0069315 | |||
| 1314 | Ga0495606_0000066 | |||
| 1315 | Ga0495606_0000101 | |||
| 1316 | Ga0495606_0000161 | |||
| 1317 | Ga0495606_0000409 | |||
| 1318 | Ga0495606_0000814 | |||
| 1319 | Ga0495606_0000830 | |||
| 1320 | Ga0495606_0002636 | |||
| 1321 | Ga0495606_0018361 | |||
| 1322 | Ga0495606_0025163 | |||
| 1323 | Ga0495606_0061775 | |||
| 1324 | Ga0495606_0115140 | |||
| 1325 | Ga0495608_0082455 | |||
| 1326 | Ga0495610_0000014 | |||
| 1327 | Ga0495610_0005574 | |||
| 1328 | Ga0495610_0005660 | |||
| 1329 | Ga0495610_0009501 | |||
| 1330 | Ga0495610_0012253 | |||
| 1331 | Ga0495616_0000020 | |||
| 1332 | Ga0495616_0000125 | |||
| 1333 | Ga0495616_0001133 | |||
| 1334 | Ga0495616_0001323 | |||
| 1335 | Ga0495616_0001444 | |||
| 1336 | Ga0495616_0014163 | |||
| 1337 | Ga0495616_0019529 | |||
| 1338 | Ga0495616_0022220 | |||
| 1339 | Ga0495616_0023004 | |||
| 1340 | Ga0495616_0041507 | |||
| 1341 | Ga0495616_0042080 | |||
| 1342 | Ga0495616_0064595 | |||
| 1343 | Ga0495618_0054139 | |||
| 1344 | Ga0495620_0017241 | |||
| 1345 | Ga0495628_0000315 | |||
| 1346 | Ga0495628_0007175 | |||
| 1347 | Ga0495631_0000295 | |||
| 1348 | Ga0495631_0002141 | |||
| 1349 | Ga0495631_0002183 | |||
| 1350 | Ga0495631_0004107 | |||
| 1351 | Ga0495631_0006181 | |||
| 1352 | Ga0495631_0018425 | |||
| 1353 | Ga0495631_0028420 | |||
| 1354 | Ga0495631_0035879 | |||
| 1355 | Ga0495631_0049023 | |||
| 1356 | Ga0495631_0050686 | |||
| 1357 | Ga0495632_0000029 | |||
| 1358 | Ga0495632_0000093 | |||
| 1359 | Ga0495632_0001267 | |||
| 1360 | Ga0495632_0005633 | |||
| 1361 | Ga0495632_0009088 | |||
| 1362 | Ga0495637_0001526 | |||
| 1363 | Ga0495637_0037740 | |||
| 1364 | Ga0495643_0000234 | |||
| 1365 | Ga0495643_0000388 | |||
| 1366 | Ga0495643_0001128 | |||
| 1367 | Ga0495643_0001450 | |||
| 1368 | Ga0495643_0003381 | |||
| 1369 | Ga0495643_0068080 | |||
| 1370 | Ga0495644_0000379 | |||
| 1371 | Ga0495644_0002875 | |||
| 1372 | Ga0495644_0009357 | |||
| 1373 | Ga0495644_0021369 | |||
| 1374 | Ga0495644_0023838 | |||
| 1375 | Ga0495644_0082728 | |||
| 1376 | Ga0495644_0086265 | |||
| 1377 | Ga0495648_0000019 | |||
| 1378 | Ga0495648_0000033 | |||
| 1379 | Ga0495648_0000207 | |||
| 1380 | Ga0495648_0000527 | |||
| 1381 | Ga0495648_0005556 | |||
| 1382 | Ga0495648_0007648 | |||
| 1383 | Ga0495648_0015834 | |||
| 1384 | Ga0495648_0025773 | |||
| 1385 | Ga0495648_0037659 | |||
| 1386 | Ga0495648_0038786 | |||
| 1387 | Ga0495648_0041135 | |||
| 1388 | Ga0495648_0048784 | |||
| 1389 | Ga0495663_0002070 | |||
| 1390 | Ga0495663_0008597 | |||
| 1391 | Ga0495666_0020595 | |||
| 1392 | Ga0495666_0030354 | |||
| 1393 | Ga0495642_0000005 | |||
| 1394 | Ga0495642_0000111 | |||
| 1395 | Ga0495642_0001868 | |||
| 1396 | Ga0495642_0002397 | |||
| 1397 | Ga0495642_0004661 | |||
| 1398 | Ga0495642_0009857 | |||
| 1399 | Ga0495642_0017398 | |||
| 1400 | Ga0495642_0024585 | |||
| 1401 | Ga0495642_0031655 | |||
| 1402 | Ga0495642_0032189 | |||
| 1403 | Ga0495642_0070602 | |||
| 1404 | Ga0495652_0046650 | |||
| 1405 | Ga0495652_0052476 | |||
| 1406 | Ga0495652_0149700 | |||
| 1407 | Ga0495654_0000014 | |||
| 1408 | Ga0495654_0003975 | |||
| 1409 | Ga0495654_0009835 | |||
| 1410 | Ga0495654_0017364 | |||
| 1411 | Ga0495654_0021587 | |||
| 1412 | Ga0495654_0027638 | |||
| 1413 | Ga0495654_0149023 | |||
| 1414 | Ga0495665_0050197 | |||
| 1415 | Ga0495586_0031016 | |||
| 1416 | Ga0495587_0080591 | |||
| 1417 | Ga0495609_0000122 | |||
| 1418 | Ga0495609_0000127 | |||
| 1419 | Ga0495609_0000377 | |||
| 1420 | Ga0495609_0000421 | |||
| 1421 | Ga0495609_0004431 | |||
| 1422 | Ga0495609_0016190 | |||
| 1423 | Ga0495609_0034137 | |||
| 1424 | Ga0495609_0036766 | |||
| 1425 | Ga0495609_0037541 | |||
| 1426 | Ga0495621_0000839 | |||
| 1427 | Ga0495597_0000075 | |||
| 1428 | Ga0495597_0000244 | |||
| 1429 | Ga0495597_0000277 | |||
| 1430 | Ga0495597_0000378 | |||
| 1431 | Ga0495597_0001275 | |||
| 1432 | Ga0495597_0004294 | |||
| 1433 | Ga0495597_0004483 | |||
| 1434 | Ga0495597_0024107 | |||
| 1435 | Ga0495597_0084741 | |||
| 1436 | Ga0495645_0056984 | |||
| 1437 | Ga0495622_0000037 | |||
| 1438 | Ga0495622_0035652 | |||
| 1439 | Ga0495633_0000086 | |||
| 1440 | Ga0495633_0000091 | |||
| 1441 | Ga0495633_0000297 | |||
| 1442 | Ga0495633_0002740 | |||
| 1443 | Ga0495633_0002917 | |||
| 1444 | Ga0495633_0003169 | |||
| 1445 | Ga0495633_0005227 | |||
| 1446 | Ga0495633_0012297 | |||
| 1447 | Ga0495633_0013563 | |||
| 1448 | Ga0495633_0028627 | |||
| 1449 | Ga0495633_0032504 | |||
| 1450 | Ga0495633_0033608 | |||
| 1451 | Ga0495633_0049745 | |||
| 1452 | Ga0495633_0056472 | |||
| 1453 | Ga0495633_0078216 | |||
| 1454 | Ga0495633_0098470 | |||
| 1455 | Ga0495656_0001811 | |||
| 1456 | Ga0495656_0003025 | |||
| 1457 | Ga0495656_0006282 | |||
| 1458 | Ga0495656_0045968 | |||
| 1459 | Ga0495656_0055282 | |||
| 1460 | Ga0495656_0075222 | |||
| 1461 | Ga0495668_0000066 | |||
| 1462 | Ga0495668_0000579 | |||
| 1463 | Ga0495668_0000712 | |||
| 1464 | Ga0495668_0000987 | |||
| 1465 | Ga0495668_0001514 | |||
| 1466 | Ga0495668_0002104 | |||
| 1467 | Ga0495668_0005034 | |||
| 1468 | Ga0495668_0006539 | |||
| 1469 | Ga0495668_0007925 | |||
| 1470 | Ga0495668_0009537 | |||
| 1471 | Ga0495668_0014164 | |||
| 1472 | Ga0495668_0024190 | |||
| 1473 | Ga0495668_0025338 | |||
| 1474 | Ga0495668_0030873 | |||
| 1475 | Ga0495668_0031775 | |||
| 1476 | Ga0495668_0032788 | |||
| 1477 | Ga0495668_0163460 | |||
| 1478 | Ga0495611_0002764 | |||
| 1479 | Ga0495611_0004783 | |||
| 1480 | Ga0495611_0005095 | |||
| 1481 | Ga0495611_0009182 | |||
| 1482 | Ga0495611_0010718 | |||
| 1483 | Ga0495611_0021800 | |||
| 1484 | Ga0495611_0028529 | |||
| 1485 | Ga0495625_0000432 | |||
| 1486 | Ga0495625_0000931 | |||
| 1487 | Ga0495625_0001069 | |||
| 1488 | Ga0495625_0002528 | |||
| 1489 | Ga0495625_0002580 | |||
| 1490 | Ga0495625_0004594 | |||
| 1491 | Ga0495625_0007654 | |||
| 1492 | Ga0495625_0014160 | |||
| 1493 | Ga0495625_0024019 | |||
| 1494 | Ga0495625_0029530 | |||
| 1495 | Ga0495625_0039018 | |||
| 1496 | Ga0495625_0050856 | |||
| 1497 | Ga0495625_0103415 | |||
| 1498 | Ga0495625_0128854 | |||
| 1499 | Ga0495625_0146559 | |||
| 1500 | Ga0495635_0067746 | |||
| 1501 | Ga0495659_0000074 | |||
| 1502 | Ga0495659_0000368 | |||
| 1503 | Ga0495659_0009976 | |||
| 1504 | Ga0495661_0000198 | |||
| 1505 | Ga0495661_0000254 | |||
| 1506 | Ga0495661_0000654 | |||
| 1507 | Ga0495661_0001765 | |||
| 1508 | Ga0495661_0003108 | |||
| 1509 | Ga0495661_0009714 | |||
| 1510 | Ga0495661_0014208 | |||
| 1511 | Ga0495661_0014465 | |||
| 1512 | Ga0495661_0018067 | |||
| 1513 | Ga0495661_0021666 | |||
| 1514 | Ga0495661_0032911 | |||
| 1515 | Ga0495661_0036158 | |||
| 1516 | Ga0495661_0045002 | |||
| 1517 | Ga0495661_0058158 | |||
| 1518 | Ga0495661_0067259 | |||
| 1519 | Ga0495661_0088042 | |||
| 1520 | Ga0495661_0113437 | |||
| 1521 | Ga0495588_0000055 | |||
| 1522 | Ga0495588_0004945 | |||
| 1523 | Ga0495588_0018614 | |||
| 1524 | Ga0495588_0118742 | |||
| 1525 | Ga0495588_0155201 | |||
| 1526 | Ga0495588_0164768 | |||
| 1527 | Ga0495657_0030526 | |||
| 1528 | Ga0495599_0004724 | |||
| 1529 | Ga0495623_0019897 | |||
| 1530 | Ga0495646_0003302 | |||
| 1531 | Ga0495669_0000053 | |||
| 1532 | Ga0495669_0003999 | |||
| 1533 | Ga0495669_0013249 | |||
| 1534 | Ga0495669_0018939 | |||
| 1535 | Ga0495669_0033489 | |||
| 1536 | Ga0495669_0114592 | |||
| 1537 | Ga0495669_0161026 | |||
| 1538 | Ga0495613_0011139 | |||
| 1539 | Ga0495624_0063954 | |||
| 1540 | Ga0495624_0168484 | |||
| 1541 | Ga0495670_0000840 | |||
| 1542 | Ga0495670_0003303 | |||
| 1543 | Ga0495670_0003637 | |||
| 1544 | Ga0495670_0007293 | |||
| 1545 | Ga0495670_0014746 | |||
| 1546 | Ga0495670_0036166 | |||
| 1547 | Ga0495670_0043790 | |||
| 1548 | Ga0495671_0000294 | |||
| 1549 | Ga0495671_0000493 | |||
| 1550 | Ga0495671_0001143 | |||
| 1551 | Ga0495671_0001848 | |||
| 1552 | Ga0495671_0015630 | |||
| 1553 | Ga0495671_0022530 | |||
| 1554 | Ga0495671_0056155 | |||
| 1555 | Ga0495671_0089866 | |||
| 1556 | Ga0495671_0147816 | |||
| 1557 | Ga0495649_0001632 | |||
| 1558 | Ga0495649_0002517 | |||
| 1559 | Ga0495649_0002914 | |||
| 1560 | Ga0495649_0017973 | |||
| 1561 | Ga0495649_0029483 | |||
| 1562 | Ga0495649_0033827 | |||
| 1563 | Ga0495649_0056711 | |||
| 1564 | Ga0495589_0000049 | |||
| 1565 | Ga0495589_0000248 | |||
| 1566 | Ga0495589_0000732 | |||
| 1567 | Ga0495589_0017384 | |||
| 1568 | Ga0495589_0023524 | |||
| 1569 | Ga0495589_0025063 | |||
| 1570 | Ga0495589_0034199 | |||
| 1571 | Ga0495589_0148308 | |||
| 1572 | Ga0495589_0191931 | |||
| 1573 | Ga0495600_0003375 | |||
| 1574 | Ga0495600_0092665 | |||
| 1575 | Ga0495660_0000167 | |||
| 1576 | Ga0495660_0000419 | |||
| 1577 | Ga0495660_0002961 | |||
| 1578 | Ga0495660_0007004 | |||
| 1579 | Ga0495660_0011538 | |||
| 1580 | Ga0495660_0012541 | |||
| 1581 | Ga0495660_0020217 | |||
| 1582 | Ga0495660_0024157 | |||
| 1583 | Ga0495660_0027283 | |||
| 1584 | Ga0495660_0094127 | |||
| 1585 | Ga0495660_0180040 | |||
| 1586 | Ga0495581_0048258 | |||
| 1587 | Ga0495581_0059508 | |||
| 1588 | Ga0495604_0011517 | |||
| 1589 | Ga0495604_0113077 | |||
| 1590 | Ga0495636_0001381 | |||
| 1591 | Ga0495636_0001424 | |||
| 1592 | Ga0495636_0038726 | |||
| 1593 | Ga0495636_0126537 | |||
| 1594 | Ga0495672_0000026 | |||
| 1595 | Ga0495672_0000226 | |||
| 1596 | Ga0495672_0005477 | |||
| 1597 | Ga0495672_0023423 | |||
| 1598 | Ga0495672_0027083 | |||
| 1599 | Ga0495672_0036485 | |||
| 1600 | Ga0495672_0199766 | |||
| 1601 | Ga0495676_0000030 | |||
| 1602 | Ga0495676_0063085 | |||
| 1603 | Ga0495676_0309762 | |||
| 1604 | Ga0495683_0000072 | |||
| 1605 | Ga0495683_0011411 | |||
| 1606 | Ga0495683_0026453 | |||
| 1607 | Ga0495683_0037071 | |||
| 1608 | Ga0495683_0037948 | |||
| 1609 | Ga0495683_0042743 | |||
| 1610 | Ga0495683_0049462 | |||
| 1611 | Ga0495683_0065004 | |||
| 1612 | Ga0495683_0120187 | |||
| 1613 | Ga0495687_000024 | |||
| 1614 | Ga0495687_000213 | |||
| 1615 | Ga0495687_000456 | |||
| 1616 | Ga0495687_000855 | |||
| 1617 | Ga0495687_000970 | |||
| 1618 | Ga0495687_001969 | |||
| 1619 | Ga0495687_003707 | |||
| 1620 | Ga0495677_0000017 | |||
| 1621 | Ga0495677_0000478 | |||
| 1622 | Ga0495677_0000650 | |||
| 1623 | Ga0495677_0003557 | |||
| 1624 | Ga0495677_0007617 | |||
| 1625 | Ga0495677_0008886 | |||
| 1626 | Ga0495677_0017215 | |||
| 1627 | Ga0495677_0026044 | |||
| 1628 | Ga0495677_0032325 | |||
| 1629 | Ga0495677_0033579 | |||
| 1630 | Ga0495677_0052114 | |||
| 1631 | Ga0495677_0084548 | |||
| 1632 | Ga0495677_0094802 | |||
| 1633 | Ga0495677_0128884 | |||
| 1634 | Ga0495679_014141 | |||
| 1635 | Ga0495679_020250 | |||
| 1636 | Ga0495679_038105 | |||
| 1637 | Ga0495685_000263 | |||
| 1638 | Ga0495685_005104 | |||
| 1639 | Ga0495685_026805 | |||
| 1640 | Ga0495673_0000009 | |||
| 1641 | Ga0495673_0000012 | |||
| 1642 | Ga0495673_0007222 | |||
| 1643 | Ga0495673_0014443 | |||
| 1644 | Ga0495673_0067398 | |||
| 1645 | Ga0495681_0003096 | |||
| 1646 | Ga0495681_0006805 | |||
| 1647 | Ga0495681_0011676 | |||
| 1648 | Ga0495681_0030978 | |||
| 1649 | Ga0495681_0043297 | |||
| 1650 | Ga0495681_0044896 | |||
| 1651 | Ga0495681_0060524 | |||
| 1652 | Ga0495681_0061168 | |||
| 1653 | Ga0495681_0085133 | |||
| 1654 | Ga0495681_0103962 | |||
| 1655 | Ga0495686_0000062 | |||
| 1656 | Ga0495686_0000431 | |||
| 1657 | Ga0495686_0002226 | |||
| 1658 | Ga0495686_0048025 | |||
| 1659 | Ga0495686_0156380 | |||
| 1660 | Ga0495686_0210553 | |||
| 1661 | Ga0495593_0002258 | |||
| 1662 | Ga0495593_0020776 | |||
| 1663 | Ga0495593_0106482 | |||
| 1664 | Ga0495602_0050252 | |||
| 1665 | Ga0495602_0157991 | |||
| 1666 | Ga0495614_0057335 | |||
| 1667 | Ga0495615_0003336 | |||
| 1668 | Ga0495615_0008300 | |||
| 1669 | Ga0495626_0000202 | |||
| 1670 | Ga0495626_0001340 | |||
| 1671 | Ga0495626_0002145 | |||
| 1672 | Ga0495626_0003033 | |||
| 1673 | Ga0495626_0003131 | |||
| 1674 | Ga0495626_0003253 | |||
| 1675 | Ga0495626_0014993 | |||
| 1676 | Ga0495626_0025563 | |||
| 1677 | Ga0495626_0030964 | |||
| 1678 | Ga0495626_0076195 | |||
| 1679 | Ga0495626_0083539 | |||
| 1680 | Ga0495626_0088777 | |||
| 1681 | Ga0496100_0034984 | |||
| 1682 | Ga0496100_0203498 | |||
| 1683 | Ga0496101_0249842 | |||
| 1684 | Ga0496102_0000071 | |||
| 1685 | Ga0496102_0031176 | |||
| 1686 | Ga0496102_0114322 | |||
| 1687 | Ga0496102_0305413 | |||
| 1688 | Ga0496103_0006209 | |||
| 1689 | Ga0496103_0030941 | |||
| 1690 | Ga0496103_0033175 | |||
| 1691 | Ga0496103_0050773 | |||
| 1692 | Ga0496103_0143341 | |||
| 1693 | Ga0496104_0101788 | |||
| 1694 | Ga0496104_0275695 | |||
| 1695 | Ga0496104_0451729 | |||
| 1696 | Ga0496108_0070387 | |||
| 1697 | Ga0496109_0148947 | |||
| 1698 | Ga0496110_0001557 | |||
| 1699 | Ga0496110_0086963 | |||
| 1700 | Ga0496110_0126770 | |||
| 1701 | Ga0496111_0038096 | |||
| 1702 | Ga0496111_0077330 | |||
| 1703 | Ga0496111_0123990 | |||
| 1704 | Ga0496113_0029191 | |||
| 1705 | Ga0496113_0137320 | |||
| 1706 | Ga0496114_0144584 | |||
| 1707 | Ga0496115_0023301 | |||
| 1708 | Ga0496115_0239605 | |||
| 1709 | Ga0496115_0309751 | |||
| 1710 | Ga0496116_0002196 | |||
| 1711 | Ga0496116_0008492 | |||
| 1712 | Ga0496116_0043485 | |||
| 1713 | Ga0496116_0067960 | |||
| 1714 | Ga0496117_0000005 | |||
| 1715 | Ga0496118_0000022 | |||
| 1716 | Ga0496118_0044587 | |||
| 1717 | Ga0496121_0004994 | |||
| 1718 | Ga0496121_0006051 | |||
| 1719 | Ga0496121_0114687 | |||
| 1720 | Ga0496122_0000121 | |||
| 1721 | Ga0496122_0000263 | |||
| 1722 | Ga0496122_0001857 | |||
| 1723 | Ga0496122_0022503 | |||
| 1724 | Ga0496122_0078180 | |||
| 1725 | Ga0496123_0000040 | |||
| 1726 | Ga0496123_0000156 | |||
| 1727 | Ga0496123_0006176 | |||
| 1728 | Ga0496123_0034198 | |||
| 1729 | Ga0496123_0045315 | |||
| 1730 | Ga0496124_0005845 | |||
| 1731 | Ga0496124_0011979 | |||
| 1732 | Ga0496124_0038760 | |||
| 1733 | Ga0496124_0058411 | |||
| 1734 | Ga0496124_0060934 | |||
| 1735 | Ga0496124_0067409 | |||
| 1736 | Ga0496124_0077481 | |||
| 1737 | Ga0496124_0157902 | |||
| 1738 | Ga0496124_0210580 | |||
| 1739 | Ga0496124_0355674 | |||
| 1740 | Ga0496125_0000672 | |||
| 1741 | Ga0496125_0000720 | |||
| 1742 | Ga0496125_0000995 | |||
| 1743 | Ga0496125_0030196 | |||
| 1744 | Ga0496126_0006238 | |||
| 1745 | Ga0501307_003330 | |||
| 1746 | Ga0495678_000012 | |||
| 1747 | Ga0495678_000035 | |||
| 1748 | Ga0495678_000130 | |||
| 1749 | Ga0495678_000232 | |||
| 1750 | Ga0495678_000782 | |||
| 1751 | Ga0495678_001730 | |||
| 1752 | Ga0495678_002896 | |||
| 1753 | Ga0495678_025648 | |||
| 1754 | Ga0495678_027597 | |||
| 1755 | Ga0495682_0000210 | |||
| 1756 | Ga0495682_0001032 | |||
| 1757 | Ga0495682_0001446 | |||
| 1758 | Ga0495682_0004102 | |||
| 1759 | Ga0495682_0005703 | |||
| 1760 | Ga0495682_0012843 | |||
| 1761 | Ga0501034_0284748 | |||
| 1762 | Ga0501034_0369288 | |||
| 1763 | Ga0501069_0018296 | |||
| 1764 | Ga0501070_0004652 | |||
| 1765 | Ga0501074_0004908 | |||
| 1766 | Ga0501211_002271 | |||
| 1767 | Ga0501249_001082 | |||
| 1768 | Ga0501079_0010210 | |||
| 1769 | Ga0501080_0004308 | |||
| 1770 | Ga0501083_0014146 | |||
| 1771 | Ga0501269_000461 | |||
| 1772 | Ga0501035_0028204 | |||
| 1773 | Ga0501044_0049236 | |||
| 1774 | nmdc:mga03683_37356_c1 | |||
| 1775 | Ga0495601_0008185 | |||
| 1776 | Ga0500594_0036941 | |||
| 1777 | Ga0500595_003105 | |||
| 1778 | Ga0500618_000088 | |||
| 1779 | Ga0500573_0135707 | |||
| 1780 | Ga0500586_001756 | |||
| 1781 | Ga0500619_002584 | |||
| 1782 | 2511384664 | |||
| 1783 | 2521559095 | |||
| 1784 | 2548848507 | |||
| 1785 | 2550692772 | |||
| 1786 | 2553003907 | |||
| 1787 | 2601671530 | |||
| 1788 | 2643792452 | |||
| 1789 | 2643800025 | |||
| 1790 | 2644031481 | |||
| 1791 | 2644217031 | |||
| 1792 | 2644250649 | |||
| 1793 | 2644358961 | |||
| 1794 | 2644475025 | |||
| 1795 | 2738738592 | |||
| 1796 | 2738826325 | |||
| 1797 | 2738842599 | |||
| 1798 | 2739150122 | |||
| 1799 | 2739192041 | |||
| 1800 | 2739273346 | |||
| 1801 | 2739318518 | |||
| 1802 | 2739336759 | |||
| 1803 | 2739342390 | |||
| 1804 | 2765568658 | |||
| 1805 | 2819541439 | |||
| 1806 | 2819593680 | |||
| 1807 | 2819615605 | |||
| 1808 | 2821134866 | |||
| 1809 | 2839096458 | |||
| 1810 | 2842715716 | |||
| 1811 | 2857548636 | |||
| 1812 | 2857558440 | |||
| 1813 | 2857558880 | |||
| 1814 | 2884815856 | |||
| 1815 | 2884837881 | |||
| 1816 | 2884854173 | |||
| 1817 | 2885082231 | |||
| 1818 | 2896154710 | |||
| 1819 | 2904428247 | |||
| 1820 | 2904444842 | |||
| 1821 | 2904532342 | |||
| 1822 | 2904584784 | |||
| 1823 | 2904591306 | |||
| 1824 | 2904605151 | |||
| 1825 | 2919048319 | |||
| 1826 | 2919081155 | |||
| 1827 | 2919476530 | |||
| 1828 | 2923512765 | |||
| 1829 | 2928132767 | |||
| 1830 | 2932416031 | |||
| 1831 | 2932421956 | |||
| 1832 | 8047673533 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wq8-assembly1.cif.gz_A | thiosulfate dehydrogenase (tsda) from allochromatium vinosum - tetrathionate soak | 0.9075 | 138 | 166 |
| 2c8s-assembly1.cif.gz_A | cytochrome cl from methylobacterium extorquens | 0.8828 | 133 | 184 |
| 6onq-assembly1.cif.gz_A | crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1 | 0.8135 | 137 | 303 |
| 2zoo-assembly1.cif.gz_A | crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125 | 0.7935 | 137 | 193 |
| 3zbm-assembly1.cif.gz_A | structure of m92a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii | 0.7919 | 141 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mk7C02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9203 | 101 | 303 | 1.10.760.10 |
| 3mk7C02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9054 | 101 | 303 | 1.10.760.10 |
| 3mk7M03 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8894 | 192 | 276 | 1.10.760.10 |
| 2c8sA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8828 | 133 | 184 | 1.10.760.10 |
| 1yiqA02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8357 | 133 | 167 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C9YAH0-F1-model_v4 | Cytochrome c domain-containing protein | 0.9969 | 167 | 304 |
GO:0005506
GO:0009055 GO:0016491 GO:0020037 |
| AF-A0A3C0YM75-F1-model_v4 | Cytochrome-c oxidase, cbb3-type subunit III | 0.9935 | 131 | 304 |
GO:0005506
GO:0009055 GO:0020037 |
| AF-A0A2W5PT04-F1-model_v4 | Cytochrome-c oxidase, cbb3-type subunit III | 0.9898 | 152 | 308 |
GO:0005506
GO:0009055 GO:0020037 |
| AF-A0A2P7P329-F1-model_v4 | deleted | 0.9822 | 206 | 304 |
|
| AF-A0A0B8Q7J7-F1-model_v4 | Cytochrome c oxidase subunit ccoP (EC 1.9.3.1) | 0.9817 | 145 | 305 |
GO:0005506
GO:0009055 GO:0016491 GO:0020037 |