F485666

General Info

Members Datasets Scaffolds Average Seq Length
918 339 1836 312

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10016011|Ga0068851_100160111
Length 344
Sequence MKILKTFSLLFHLTIFVSFKTFNHRSTFMTQKKIIAVFGATGAQGGGLARAILSDPHSEFSVRVVTRAVHSDKAKALEAMGAELVNADVDNPKEIRKALQGAYGAFFVTFFWAHYSPELENKHAEDFAKAAKEAGLKHVIWSTLEDTRKWYPLDDDRMPTLHDNYKVPHFDGKGASDHYFTDNGVPTTFLMASFYWENMIYFGMGPKRGDDGKLTFTLPMADKKMGGIGAEDIGRCAYGIFKKGTELVGKYVGIAGEQLTGEQMAHHLSKSLGEEVKYNAITPATFRSFGFPGADDLGNMFQFYAEQEKYLDDARDPKISKQLNPQLKNFDAWLKDNAKLIPLE

Samples

Sample ID Description Type Environment
1 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
187 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
191 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
204 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
205 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
213 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
299 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
300 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
301 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
302 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
303 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
304 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
305 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
306 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
307 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
308 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
314 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
330 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
331 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
332 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
333 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
337 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
338 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
339 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.22
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 1.63
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 13.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068851_10016011 3300005834 Unclassified 3581
2 JGI24751J29686_10000335 3300002459 Bacteria 17022
3 JGI25406J46586_10023135 3300003203 Bacteria 2460
4 rootH1_10004495 3300003323 Bacteria 36666
5 rootH1_10155694 3300003323 Bacteria 1652
6 Ga0065714_10019946 3300005288 Bacteria 1173
7 Ga0065712_10000781 3300005290 Bacteria 14555
8 Ga0065715_10155878 3300005293 Bacteria 1670
9 Ga0065707_10091080 3300005295 Bacteria 4010
10 Ga0065707_10118341 3300005295 Bacteria 2188
11 Ga0070658_10001806 3300005327 Bacteria 17989
12 Ga0070676_10015570 3300005328 Bacteria 4196
13 Ga0070676_10113135 3300005328 Bacteria 1693
14 Ga0070683_100005550 3300005329 Bacteria 10535
15 Ga0070683_100020750 3300005329 Bacteria 5852
16 Ga0070683_100132805 3300005329 Bacteria 2356
17 Ga0070683_100236805 3300005329 Bacteria 1736
18 Ga0070690_100003963 3300005330 Bacteria 8179
19 Ga0070690_100040289 3300005330 Unclassified 2954
20 Ga0070670_100012132 3300005331 Bacteria 7371
21 Ga0070670_100018444 3300005331 Bacteria 5987
22 Ga0070670_100025152 3300005331 Bacteria 5122
23 Ga0070670_100052931 3300005331 Bacteria 3487
24 Ga0070670_100064587 3300005331 Bacteria 3140
25 Ga0070670_100083934 3300005331 Bacteria 2737
26 Ga0070670_100206539 3300005331 Unclassified 1707
27 Ga0070670_100248776 3300005331 Bacteria 1548
28 Ga0070670_100251733 3300005331 Bacteria 1539
29 Ga0070670_100302109 3300005331 Bacteria 1400
30 Ga0068869_100024944 3300005334 Bacteria 4147
31 Ga0068869_100066941 3300005334 Bacteria 2648
32 Ga0068869_100087483 3300005334 Unclassified 2337
33 Ga0068869_100386438 3300005334 Bacteria 1148
34 Ga0070666_10001316 3300005335 Bacteria 15045
35 Ga0070666_10005429 3300005335 Bacteria 7817
36 Ga0070666_10021319 3300005335 Bacteria 4200
37 Ga0070666_10029682 3300005335 Bacteria 3597
38 Ga0070666_10089305 3300005335 Unclassified 2115
39 Ga0070680_100006966 3300005336 Bacteria 8616
40 Ga0070680_100043075 3300005336 Bacteria 3665
41 Ga0070680_100425293 3300005336 Bacteria 1133
42 Ga0070682_100006403 3300005337 Bacteria 6613
43 Ga0070682_100095781 3300005337 Unclassified 1950
44 Ga0068868_100008292 3300005338 Bacteria 7442
45 Ga0068868_100015287 3300005338 Bacteria 5675
46 Ga0068868_100158765 3300005338 Bacteria 1866
47 Ga0070660_100031268 3300005339 Bacteria 3997
48 Ga0070660_100192229 3300005339 Bacteria 1653
49 Ga0070689_100031031 3300005340 Bacteria 4060
50 Ga0070689_100073946 3300005340 Bacteria 2666
51 Ga0070689_100174977 3300005340 Bacteria 1740
52 Ga0070687_100001102 3300005343 Bacteria 9291
53 Ga0070687_100059306 3300005343 Unclassified 2014
54 Ga0070661_100009793 3300005344 Bacteria 6645
55 Ga0070661_100013569 3300005344 Bacteria 5721
56 Ga0070661_100085471 3300005344 Bacteria 2331
57 Ga0070661_100142381 3300005344 Bacteria 1808
58 Ga0070668_100000951 3300005347 Bacteria 20217
59 Ga0070668_100023794 3300005347 Bacteria 4636
60 Ga0070668_100113597 3300005347 Bacteria 2158
61 Ga0070668_100271460 3300005347 Bacteria 1414
62 Ga0070669_100037947 3300005353 Bacteria 3496
63 Ga0070669_100053889 3300005353 Bacteria 2945
64 Ga0070669_100092951 3300005353 Bacteria 2265
65 Ga0070669_100210329 3300005353 Bacteria 1534
66 Ga0070669_100242384 3300005353 Bacteria 1433
67 Ga0070675_100008620 3300005354 Bacteria 7918
68 Ga0070675_100011460 3300005354 Bacteria 6942
69 Ga0070675_100033681 3300005354 Unclassified 4154
70 Ga0070675_100099784 3300005354 Bacteria 2445
71 Ga0070675_100116193 3300005354 Bacteria 2269
72 Ga0070675_100340387 3300005354 Bacteria 1328
73 Ga0070671_100011830 3300005355 Bacteria 7020
74 Ga0070671_100116251 3300005355 Bacteria 2249
75 Ga0070671_100380375 3300005355 Bacteria 1206
76 Ga0070674_100007915 3300005356 Bacteria 6291
77 Ga0070674_100069510 3300005356 Unclassified 2484
78 Ga0070674_100149299 3300005356 Bacteria 1762
79 Ga0070673_100002269 3300005364 Bacteria 11656
80 Ga0070673_100091941 3300005364 Bacteria 2481
81 Ga0070673_100113975 3300005364 Unclassified 2246
82 Ga0070673_100165222 3300005364 Bacteria 1885
83 Ga0070673_100315594 3300005364 Bacteria 1379
84 Ga0070688_100032273 3300005365 Unclassified 3156
85 Ga0070688_100037566 3300005365 Bacteria 2951
86 Ga0070688_100381889 3300005365 Bacteria 1038
87 Ga0070659_100025517 3300005366 Bacteria 4540
88 Ga0070659_100025984 3300005366 Bacteria 4504
89 Ga0070659_100118369 3300005366 Bacteria 2143
90 Ga0070659_100181859 3300005366 Bacteria 1726
91 Ga0070667_100005498 3300005367 Bacteria 10581
92 Ga0070667_100005708 3300005367 Bacteria 10398
93 Ga0070667_100137970 3300005367 Bacteria 2133
94 Ga0070667_100178526 3300005367 Bacteria 1877
95 Ga0070667_100205033 3300005367 Bacteria 1750
96 Ga0070667_100218193 3300005367 Unclassified 1697
97 Ga0070667_100228292 3300005367 Bacteria 1659
98 Ga0070667_100264626 3300005367 Bacteria 1540
99 Ga0070667_100320443 3300005367 Bacteria 1399
100 Ga0070708_100282992 3300005445 Bacteria 1561
101 Ga0070663_100119781 3300005455 Bacteria 1987
102 Ga0070663_100259117 3300005455 Bacteria 1379
103 Ga0070678_100095547 3300005456 Unclassified 2290
104 Ga0070662_100226440 3300005457 Bacteria 1494
105 Ga0070662_100228348 3300005457 Bacteria 1488
106 Ga0070662_100262169 3300005457 Bacteria 1392
107 Ga0070681_10073654 3300005458 Bacteria 3377
108 Ga0070681_10105715 3300005458 Bacteria 2757
109 Ga0070681_10123298 3300005458 Bacteria 2524
110 Ga0070681_10127861 3300005458 Bacteria 2474
111 Ga0070681_10257086 3300005458 Bacteria 1658
112 Ga0068867_100116337 3300005459 Unclassified 2060
113 Ga0068867_100450975 3300005459 Bacteria 1096
114 Ga0070685_10007265 3300005466 Bacteria 5664
115 Ga0070685_10033897 3300005466 Unclassified 2872
116 Ga0070685_10044525 3300005466 Bacteria 2541
117 Ga0070706_100265778 3300005467 Unclassified 1601
118 Ga0070707_100000032 3300005468 Bacteria 118776
119 Ga0070698_100001998 3300005471 Bacteria 22644
120 Ga0070698_100003211 3300005471 Bacteria 18007
121 Ga0070699_100119960 3300005518 Unclassified 2312
122 Ga0070699_100259085 3300005518 Unclassified 1555
123 Ga0070679_100002339 3300005530 Bacteria 17152
124 Ga0070679_100004116 3300005530 Bacteria 13409
125 Ga0070679_100013309 3300005530 Bacteria 7876
126 Ga0070679_100016964 3300005530 Bacteria 7039
127 Ga0070679_100024167 3300005530 Bacteria 5954
128 Ga0070679_100076615 3300005530 Bacteria 3333
129 Ga0070679_100525512 3300005530 Bacteria 1127
130 Ga0070684_100012839 3300005535 Bacteria 6729
131 Ga0070684_100411356 3300005535 Bacteria 1248
132 Ga0068853_100011024 3300005539 Bacteria 7331
133 Ga0068853_100045604 3300005539 Bacteria 3755
134 Ga0068853_100131745 3300005539 Bacteria 2239
135 Ga0068853_100216381 3300005539 Bacteria 1748
136 Ga0068853_100412894 3300005539 Bacteria 1265
137 Ga0070672_100005846 3300005543 Bacteria 8207
138 Ga0070672_100030941 3300005543 Bacteria 4026
139 Ga0070672_100047244 3300005543 Unclassified 3339
140 Ga0070672_100090118 3300005543 Bacteria 2472
141 Ga0070672_100106674 3300005543 Bacteria 2279
142 Ga0070672_100256135 3300005543 Unclassified 1475
143 Ga0070686_100004512 3300005544 Bacteria 7676
144 Ga0070686_100005546 3300005544 Bacteria 6981
145 Ga0070686_100042469 3300005544 Bacteria 2848
146 Ga0070693_100012709 3300005547 Bacteria 4268
147 Ga0070665_100051291 3300005548 Bacteria 4138
148 Ga0070665_100186816 3300005548 Unclassified 2073
149 Ga0070665_100258668 3300005548 Bacteria 1742
150 Ga0070665_100304326 3300005548 Bacteria 1597
151 Ga0070665_100523045 3300005548 Bacteria 1198
152 Ga0068855_100000014 3300005563 Bacteria 232720
153 Ga0068855_100043250 3300005563 Bacteria 5336
154 Ga0068855_100173463 3300005563 Bacteria 2441
155 Ga0068855_100213568 3300005563 Bacteria 2167
156 Ga0070664_100000492 3300005564 Bacteria 29880
157 Ga0070664_100022854 3300005564 Bacteria 5158
158 Ga0070664_100139951 3300005564 Bacteria 2130
159 Ga0070664_100195286 3300005564 Bacteria 1804
160 Ga0068857_100032403 3300005577 Bacteria 4620
161 Ga0068857_100034845 3300005577 Bacteria 4454
162 Ga0068857_100266590 3300005577 Bacteria 1573
163 Ga0068857_100286052 3300005577 Unclassified 1517
164 Ga0068857_100539105 3300005577 Unclassified 1098
165 Ga0068854_100064759 3300005578 Bacteria 2656
166 Ga0068854_100085130 3300005578 Bacteria 2341
167 Ga0068854_100127144 3300005578 Bacteria 1942
168 Ga0068854_100235901 3300005578 Bacteria 1454
169 Ga0068854_100360405 3300005578 Bacteria 1193
170 Ga0068856_100089457 3300005614 Bacteria 3062
171 Ga0068856_100395590 3300005614 Bacteria 1401
172 Ga0068852_100023253 3300005616 Bacteria 4985
173 Ga0068852_100046341 3300005616 Bacteria 3704
174 Ga0068859_100006459 3300005617 Bacteria 11893
175 Ga0068859_100017217 3300005617 Bacteria 7257
176 Ga0068859_100114918 3300005617 Bacteria 2756
177 Ga0068859_100180101 3300005617 Bacteria 2196
178 Ga0068859_100341549 3300005617 Bacteria 1591
179 Ga0068864_100000781 3300005618 Bacteria 26753
180 Ga0068864_100008888 3300005618 Bacteria 8282
181 Ga0068864_100051164 3300005618 Bacteria 3557
182 Ga0068866_10011514 3300005718 Bacteria 3829
183 Ga0068861_100029438 3300005719 Bacteria 4018
184 Ga0068861_100093705 3300005719 Unclassified 2375
185 Ga0068861_100339685 3300005719 Unclassified 1314
186 Ga0068861_100373493 3300005719 Bacteria 1257
187 Ga0068851_10079402 3300005834 Unclassified 1711
188 Ga0068863_100000221 3300005841 Bacteria 60285
189 Ga0068863_100022837 3300005841 Bacteria 5977
190 Ga0068863_100126403 3300005841 Bacteria 2439
191 Ga0068863_100186873 3300005841 Unclassified 1990
192 Ga0068858_100013096 3300005842 Bacteria 7821
193 Ga0068858_100026396 3300005842 Bacteria 5398
194 Ga0068858_100082124 3300005842 Unclassified 2995
195 Ga0068860_100006424 3300005843 Bacteria 11803
196 Ga0068860_100018722 3300005843 Bacteria 6730
197 Ga0068860_100188187 3300005843 Unclassified 1997
198 Ga0068860_100302272 3300005843 Bacteria 1568
199 Ga0068860_100378000 3300005843 Bacteria 1398
200 Ga0068862_100011917 3300005844 Bacteria 7182
201 Ga0068862_100221636 3300005844 Bacteria 1712
202 Ga0068862_100288606 3300005844 Bacteria 1506
203 Ga0081455_10007011 3300005937 Bacteria 11975
204 Ga0081455_10093709 3300005937 Unclassified 2427
205 Ga0081455_10285818 3300005937 Bacteria 1189
206 Ga0081539_10004015 3300005985 Bacteria 16914
207 Ga0081539_10004448 3300005985 Bacteria 15475
208 Ga0070715_10132209 3300006163 Unclassified 1202
209 Ga0070716_100059682 3300006173 Bacteria 2200
210 Ga0097621_100000554 3300006237 Bacteria 26269
211 Ga0097621_100019149 3300006237 Bacteria 5247
212 Ga0097621_100021327 3300006237 Bacteria 5009
213 Ga0097621_100021395 3300006237 Bacteria 5002
214 Ga0097621_100021757 3300006237 Bacteria 4968
215 Ga0097621_100039645 3300006237 Bacteria 3784
216 Ga0097621_100062570 3300006237 Unclassified 3056
217 Ga0068871_100001750 3300006358 Bacteria 14634
218 Ga0068871_100002575 3300006358 Bacteria 12387
219 Ga0068871_100003879 3300006358 Bacteria 10310
220 Ga0068871_100023121 3300006358 Bacteria 4801
221 Ga0068871_100037217 3300006358 Bacteria 3880
222 Ga0068871_100069994 3300006358 Bacteria 2883
223 Ga0068871_100107602 3300006358 Bacteria 2342
224 Ga0075428_100064824 3300006844 Unclassified 4001
225 Ga0075428_100148569 3300006844 Bacteria 2547
226 Ga0075428_100151035 3300006844 Unclassified 2523
227 Ga0075430_100005824 3300006846 Bacteria 10398
228 Ga0075430_100007274 3300006846 Bacteria 9345
229 Ga0075431_100002400 3300006847 Bacteria 18025
230 Ga0075431_100095188 3300006847 Bacteria 3074
231 Ga0075431_100134669 3300006847 Bacteria 2547
232 Ga0075431_100243672 3300006847 Bacteria 1828
233 Ga0075431_100363120 3300006847 Bacteria 1454
234 Ga0075431_100431028 3300006847 Bacteria 1316
235 Ga0075433_10224420 3300006852 Bacteria 1668
236 Ga0075433_10252385 3300006852 Bacteria 1565
237 Ga0075434_100063233 3300006871 Bacteria 3684
238 Ga0075429_100050163 3300006880 Bacteria 3631
239 Ga0075429_100091904 3300006880 Bacteria 2647
240 Ga0075429_100094474 3300006880 Bacteria 2608
241 Ga0075429_100108399 3300006880 Unclassified 2427
242 Ga0068865_100056511 3300006881 Bacteria 2735
243 Ga0068865_100124073 3300006881 Bacteria 1925
244 Ga0068865_100260300 3300006881 Bacteria 1373
245 Ga0097620_100006459 3300006931 Bacteria 11893
246 Ga0097620_100017217 3300006931 Bacteria 7257
247 Ga0097620_100114917 3300006931 Bacteria 2756
248 Ga0097620_100180104 3300006931 Bacteria 2196
249 Ga0097620_100309232 3300006931 Bacteria 1674
250 Ga0097620_100341549 3300006931 Bacteria 1591
251 Ga0099794_10022038 3300007265 Bacteria 2901
252 Ga0105240_10028359 3300009093 Bacteria 7314
253 Ga0105240_10043874 3300009093 Bacteria 5686
254 Ga0105240_10064765 3300009093 Bacteria 4540
255 Ga0105240_10169230 3300009093 Unclassified 2589
256 Ga0105240_10244183 3300009093 Bacteria 2080
257 Ga0111539_10000536 3300009094 Bacteria 48260
258 Ga0111539_10031210 3300009094 Bacteria 6475
259 Ga0111539_10076633 3300009094 Bacteria 3937
260 Ga0111539_10277409 3300009094 Bacteria 1951
261 Ga0111539_10489102 3300009094 Unclassified 1433
262 Ga0111539_10675418 3300009094 Unclassified 1203
263 Ga0105245_10001786 3300009098 Bacteria 19580
264 Ga0105245_10043077 3300009098 Bacteria 4027
265 Ga0105247_10001541 3300009101 Bacteria 16441
266 Ga0114129_10014027 3300009147 Bacteria 11414
267 Ga0114129_10093237 3300009147 Bacteria 4171
268 Ga0114129_10176339 3300009147 Bacteria 2911
269 Ga0114129_10194413 3300009147 Unclassified 2752
270 Ga0114129_10381086 3300009147 Bacteria 1863
271 Ga0114129_10558725 3300009147 Bacteria 1487
272 Ga0105243_10232472 3300009148 Bacteria 1636
273 Ga0105241_10004396 3300009174 Bacteria 10420
274 Ga0105241_10166884 3300009174 Bacteria 1815
275 Ga0105242_10003021 3300009176 Bacteria 13152
276 Ga0105242_10006100 3300009176 Bacteria 9291
277 Ga0105242_10022569 3300009176 Bacteria 4952
278 Ga0105242_10069023 3300009176 Unclassified 2927
279 Ga0105242_10098613 3300009176 Bacteria 2471
280 Ga0105248_10000048 3300009177 Bacteria 154635
281 Ga0105248_10015185 3300009177 Bacteria 8486
282 Ga0105248_10057845 3300009177 Bacteria 4353
283 Ga0105248_10185968 3300009177 Bacteria 2341
284 Ga0105248_10442529 3300009177 Bacteria 1464
285 Ga0105248_10448313 3300009177 Bacteria 1454
286 Ga0105237_10009302 3300009545 Bacteria 10530
287 Ga0105237_10093453 3300009545 Unclassified 2997
288 Ga0105238_10459933 3300009551 Bacteria 1270
289 Ga0105249_10013169 3300009553 Bacteria 7297
290 Ga0105249_10021095 3300009553 Bacteria 5830
291 Ga0105249_10058553 3300009553 Bacteria 3531
292 Ga0105249_10060141 3300009553 Unclassified 3485
293 Ga0105239_10012617 3300010375 Bacteria 9403
294 Ga0105239_10205151 3300010375 Bacteria 2209
295 Ga0105246_10042738 3300011119 Bacteria 3070
296 Ga0157373_10007196 3300013100 Bacteria 8299
297 Ga0157373_10025876 3300013100 Bacteria 4240
298 Ga0157373_10217816 3300013100 Bacteria 1347
299 Ga0157373_10341215 3300013100 Bacteria 1068
300 Ga0157371_10015347 3300013102 Bacteria 5749
301 Ga0157371_10030981 3300013102 Bacteria 3855
302 Ga0157371_10079361 3300013102 Bacteria 2325
303 Ga0157371_10185743 3300013102 Bacteria 1487
304 Ga0157370_10005480 3300013104 Bacteria 14234
305 Ga0157370_10011127 3300013104 Bacteria 9432
306 Ga0157370_10013214 3300013104 Bacteria 8513
307 Ga0157370_10029120 3300013104 Bacteria 5425
308 Ga0157370_10102080 3300013104 Bacteria 2686
309 Ga0157370_10121961 3300013104 Bacteria 2434
310 Ga0157370_10248094 3300013104 Bacteria 1647
311 Ga0157370_10509787 3300013104 Bacteria 1104
312 Ga0157369_10186487 3300013105 Bacteria 2181
313 Ga0157369_10305621 3300013105 Bacteria 1654
314 Ga0157374_10005430 3300013296 Bacteria 10708
315 Ga0157374_10022899 3300013296 Bacteria 5579
316 Ga0157374_10024433 3300013296 Bacteria 5419
317 Ga0157374_10053519 3300013296 Bacteria 3763
318 Ga0157374_10136846 3300013296 Bacteria 2375
319 Ga0157374_10161837 3300013296 Bacteria 2180
320 Ga0157374_10162036 3300013296 Unclassified 2178
321 Ga0157374_10196769 3300013296 Bacteria 1973
322 Ga0157374_10208221 3300013296 Bacteria 1917
323 Ga0157378_10000437 3300013297 Bacteria 40470
324 Ga0157378_10001754 3300013297 Bacteria 19460
325 Ga0157378_10002581 3300013297 Bacteria 16118
326 Ga0157378_10003439 3300013297 Bacteria 14041
327 Ga0157378_10087958 3300013297 Bacteria 2819
328 Ga0157378_10091891 3300013297 Bacteria 2760
329 Ga0157378_10284743 3300013297 Unclassified 1594
330 Ga0163162_10000523 3300013306 Bacteria 35637
331 Ga0163162_10005980 3300013306 Bacteria 11778
332 Ga0163162_10124903 3300013306 Unclassified 2679
333 Ga0163162_10286741 3300013306 Bacteria 1778
334 Ga0163162_10635131 3300013306 Bacteria 1192
335 Ga0157372_10015460 3300013307 Bacteria 8181
336 Ga0157372_10055142 3300013307 Bacteria 4437
337 Ga0157372_10067718 3300013307 Bacteria 4013
338 Ga0157372_10192125 3300013307 Bacteria 2364
339 Ga0157372_10334192 3300013307 Bacteria 1765
340 Ga0157372_10479819 3300013307 Bacteria 1450
341 Ga0157372_10651318 3300013307 Unclassified 1227
342 Ga0157375_10000262 3300013308 Bacteria 47771
343 Ga0157375_10001301 3300013308 Bacteria 21494
344 Ga0157375_10035272 3300013308 Bacteria 4773
345 Ga0157375_10122921 3300013308 Bacteria 2707
346 Ga0157375_10260729 3300013308 Bacteria 1895
347 Ga0157375_10310801 3300013308 Bacteria 1740
348 Ga0157375_10392539 3300013308 Bacteria 1554
349 Ga0157375_10438695 3300013308 Unclassified 1472
350 Ga0157375_10640445 3300013308 Bacteria 1220
351 Ga0163163_10001342 3300014325 Bacteria 20762
352 Ga0163163_10008192 3300014325 Bacteria 9270
353 Ga0163163_10008479 3300014325 Bacteria 9135
354 Ga0163163_10108304 3300014325 Bacteria 2806
355 Ga0163163_10116640 3300014325 Bacteria 2701
356 Ga0163163_10232956 3300014325 Bacteria 1891
357 Ga0163163_10378901 3300014325 Unclassified 1472
358 Ga0163163_10435545 3300014325 Bacteria 1370
359 Ga0157380_10010459 3300014326 Bacteria 6675
360 Ga0157380_10035103 3300014326 Bacteria 3872
361 Ga0157380_10050034 3300014326 Unclassified 3299
362 Ga0157380_10127011 3300014326 Bacteria 2169
363 Ga0157380_10205732 3300014326 Bacteria 1750
364 Ga0157380_10247718 3300014326 Unclassified 1611
365 Ga0157380_10426794 3300014326 Bacteria 1266
366 Ga0157377_10016681 3300014745 Unclassified 3782
367 Ga0157377_10030983 3300014745 Bacteria 2903
368 Ga0157377_10083580 3300014745 Bacteria 1871
369 Ga0157379_10000264 3300014968 Bacteria 41186
370 Ga0157379_10135713 3300014968 Unclassified 2217
371 Ga0157379_10167729 3300014968 Unclassified 1982
372 Ga0157379_10263715 3300014968 Unclassified 1566
373 Ga0157379_10268109 3300014968 Bacteria 1552
374 Ga0157376_10041099 3300014969 Unclassified 3784
375 Ga0157376_10056318 3300014969 Bacteria 3284
376 Ga0157376_10081417 3300014969 Unclassified 2780
377 Ga0157376_10101092 3300014969 Bacteria 2519
378 Ga0157376_10207736 3300014969 Bacteria 1806
379 Ga0163161_10018613 3300017792 Bacteria 4868
380 Ga0163161_10030173 3300017792 Unclassified 3856
381 Ga0163161_10083804 3300017792 Bacteria 2350
382 Ga0213872_10047235 3300021361 Unclassified 1958
383 Ga0213871_10004166 3300021441 Unclassified 2869
384 Ga0207697_10086919 3300025315 Bacteria 1322
385 Ga0207656_10000483 3300025321 Bacteria 13166
386 Ga0207688_10252598 3300025901 Unclassified 1068
387 Ga0207680_10001546 3300025903 Bacteria 10833
388 Ga0207680_10011290 3300025903 Bacteria 4509
389 Ga0207680_10026291 3300025903 Bacteria 3225
390 Ga0207680_10130427 3300025903 Bacteria 1656
391 Ga0207647_10010393 3300025904 Bacteria 6574
392 Ga0207647_10135566 3300025904 Unclassified 1445
393 Ga0207645_10018735 3300025907 Bacteria 4547
394 Ga0207645_10029340 3300025907 Bacteria 3547
395 Ga0207643_10017411 3300025908 Bacteria 3929
396 Ga0207705_10000623 3300025909 Bacteria 29594
397 Ga0207705_10072838 3300025909 Bacteria 2492
398 Ga0207684_10157635 3300025910 Bacteria 1954
399 Ga0207654_10028106 3300025911 Bacteria 3064
400 Ga0207654_10172482 3300025911 Bacteria 1405
401 Ga0207707_10019903 3300025912 Bacteria 5858
402 Ga0207707_10096788 3300025912 Bacteria 2579
403 Ga0207695_10005932 3300025913 Bacteria 16010
404 Ga0207695_10029463 3300025913 Bacteria 6064
405 Ga0207695_10034212 3300025913 Bacteria 5531
406 Ga0207695_10134545 3300025913 Unclassified 2426
407 Ga0207660_10033757 3300025917 Bacteria 3542
408 Ga0207660_10067556 3300025917 Bacteria 2590
409 Ga0207660_10071945 3300025917 Bacteria 2517
410 Ga0207660_10387918 3300025917 Bacteria 1123
411 Ga0207662_10002985 3300025918 Bacteria 8615
412 Ga0207662_10058259 3300025918 Unclassified 2312
413 Ga0207657_10010235 3300025919 Bacteria 9367
414 Ga0207657_10025421 3300025919 Bacteria 5462
415 Ga0207657_10119828 3300025919 Bacteria 2165
416 Ga0207649_10002503 3300025920 Bacteria 10263
417 Ga0207649_10025152 3300025920 Bacteria 3468
418 Ga0207649_10233776 3300025920 Bacteria 1316
419 Ga0207652_10002089 3300025921 Bacteria 17168
420 Ga0207652_10005426 3300025921 Bacteria 10345
421 Ga0207652_10021177 3300025921 Bacteria 5365
422 Ga0207652_10121649 3300025921 Bacteria 2323
423 Ga0207652_10170678 3300025921 Bacteria 1952
424 Ga0207652_10349652 3300025921 Bacteria 1334
425 Ga0207646_10000032 3300025922 Bacteria 216397
426 Ga0207646_10524475 3300025922 Bacteria 1066
427 Ga0207681_10108322 3300025923 Unclassified 2016
428 Ga0207681_10322777 3300025923 Bacteria 1228
429 Ga0207650_10000510 3300025925 Bacteria 32441
430 Ga0207650_10031978 3300025925 Bacteria 3805
431 Ga0207650_10067621 3300025925 Bacteria 2681
432 Ga0207650_10085894 3300025925 Bacteria 2394
433 Ga0207650_10090549 3300025925 Bacteria 2336
434 Ga0207650_10102126 3300025925 Unclassified 2209
435 Ga0207650_10115851 3300025925 Bacteria 2080
436 Ga0207650_10148330 3300025925 Bacteria 1849
437 Ga0207650_10177790 3300025925 Bacteria 1695
438 Ga0207650_10268623 3300025925 Bacteria 1386
439 Ga0207659_10000173 3300025926 Bacteria 38585
440 Ga0207659_10002371 3300025926 Bacteria 11213
441 Ga0207659_10020599 3300025926 Bacteria 4362
442 Ga0207659_10029299 3300025926 Unclassified 3751
443 Ga0207659_10286541 3300025926 Unclassified 1348
444 Ga0207644_10002882 3300025931 Bacteria 11083
445 Ga0207644_10015078 3300025931 Bacteria 5185
446 Ga0207690_10073407 3300025932 Bacteria 2366
447 Ga0207690_10147506 3300025932 Bacteria 1741
448 Ga0207690_10209824 3300025932 Bacteria 1484
449 Ga0207690_10263057 3300025932 Unclassified 1337
450 Ga0207690_10425887 3300025932 Bacteria 1063
451 Ga0207706_10052994 3300025933 Bacteria 3581
452 Ga0207706_10077398 3300025933 Bacteria 2925
453 Ga0207706_10112705 3300025933 Bacteria 2393
454 Ga0207686_10000884 3300025934 Bacteria 18109
455 Ga0207686_10171732 3300025934 Unclassified 1529
456 Ga0207670_10004333 3300025936 Bacteria 7624
457 Ga0207670_10029226 3300025936 Bacteria 3509
458 Ga0207670_10120701 3300025936 Bacteria 1905
459 Ga0207670_10351037 3300025936 Bacteria 1168
460 Ga0207704_10015131 3300025938 Bacteria 3922
461 Ga0207704_10091665 3300025938 Bacteria 1998
462 Ga0207691_10019398 3300025940 Bacteria 6435
463 Ga0207691_10019513 3300025940 Bacteria 6415
464 Ga0207691_10028488 3300025940 Bacteria 5231
465 Ga0207691_10121889 3300025940 Bacteria 2310
466 Ga0207691_10197390 3300025940 Bacteria 1752
467 Ga0207711_10000648 3300025941 Bacteria 34717
468 Ga0207711_10267390 3300025941 Bacteria 1573
469 Ga0207711_10305515 3300025941 Bacteria 1468
470 Ga0207689_10002805 3300025942 Bacteria 16095
471 Ga0207689_10040689 3300025942 Bacteria 3846
472 Ga0207689_10088810 3300025942 Unclassified 2539
473 Ga0207689_10244290 3300025942 Bacteria 1484
474 Ga0207661_10001069 3300025944 Bacteria 18229
475 Ga0207661_10036520 3300025944 Bacteria 3836
476 Ga0207661_10120313 3300025944 Bacteria 2234
477 Ga0207661_10244550 3300025944 Bacteria 1593
478 Ga0207679_10013567 3300025945 Bacteria 5340
479 Ga0207679_10021225 3300025945 Bacteria 4398
480 Ga0207679_10036606 3300025945 Bacteria 3481
481 Ga0207679_10320840 3300025945 Unclassified 1341
482 Ga0207667_10000049 3300025949 Bacteria 235027
483 Ga0207667_10019413 3300025949 Bacteria 7590
484 Ga0207667_10081514 3300025949 Bacteria 3352
485 Ga0207667_10198753 3300025949 Bacteria 2057
486 Ga0207667_10213407 3300025949 Bacteria 1978
487 Ga0207667_10253002 3300025949 Unclassified 1802
488 Ga0207651_10022287 3300025960 Bacteria 3869
489 Ga0207651_10040387 3300025960 Bacteria 3086
490 Ga0207651_10148977 3300025960 Unclassified 1819
491 Ga0207651_10294905 3300025960 Unclassified 1346
492 Ga0207712_10002170 3300025961 Bacteria 12828
493 Ga0207712_10013251 3300025961 Bacteria 5285
494 Ga0207668_10000663 3300025972 Bacteria 21145
495 Ga0207668_10032610 3300025972 Bacteria 3444
496 Ga0207668_10083168 3300025972 Unclassified 2328
497 Ga0207640_10012544 3300025981 Bacteria 4831
498 Ga0207640_10058766 3300025981 Bacteria 2535
499 Ga0207640_10069819 3300025981 Bacteria 2360
500 Ga0207640_10187764 3300025981 Bacteria 1555
501 Ga0207658_10010785 3300025986 Bacteria 6217
502 Ga0207658_10056336 3300025986 Bacteria 2917
503 Ga0207658_10132733 3300025986 Bacteria 2003
504 Ga0207658_10153660 3300025986 Bacteria 1878
505 Ga0207658_10195617 3300025986 Bacteria 1684
506 Ga0207658_10257330 3300025986 Unclassified 1486
507 Ga0207677_10028007 3300026023 Bacteria 3558
508 Ga0207677_10038103 3300026023 Bacteria 3148
509 Ga0207703_10013004 3300026035 Bacteria 6485
510 Ga0207703_10019904 3300026035 Bacteria 5246
511 Ga0207639_10005388 3300026041 Bacteria 8651
512 Ga0207639_10007679 3300026041 Bacteria 7362
513 Ga0207639_10086260 3300026041 Bacteria 2499
514 Ga0207639_10091546 3300026041 Bacteria 2435
515 Ga0207639_10093975 3300026041 Bacteria 2406
516 Ga0207639_10257563 3300026041 Bacteria 1524
517 Ga0207678_10170339 3300026067 Unclassified 1859
518 Ga0207708_10096778 3300026075 Bacteria 2281
519 Ga0207702_10051789 3300026078 Bacteria 3471
520 Ga0207641_10000561 3300026088 Bacteria 41567
521 Ga0207641_10001235 3300026088 Bacteria 25590
522 Ga0207641_10015720 3300026088 Bacteria 6201
523 Ga0207641_10035180 3300026088 Bacteria 4171
524 Ga0207641_10161340 3300026088 Bacteria 2038
525 Ga0207648_10002623 3300026089 Bacteria 19251
526 Ga0207648_10303428 3300026089 Bacteria 1432
527 Ga0207676_10026191 3300026095 Bacteria 4335
528 Ga0207676_10049325 3300026095 Bacteria 3274
529 Ga0207676_10082344 3300026095 Bacteria 2617
530 Ga0207676_10379983 3300026095 Unclassified 1315
531 Ga0207674_10033423 3300026116 Bacteria 5385
532 Ga0207674_10061864 3300026116 Bacteria 3782
533 Ga0207674_10212617 3300026116 Bacteria 1883
534 Ga0207674_10529904 3300026116 Unclassified 1138
535 Ga0207675_100049100 3300026118 Bacteria 3939
536 Ga0207675_100077458 3300026118 Bacteria 3115
537 Ga0207675_100429753 3300026118 Bacteria 1305
538 Ga0207683_10020712 3300026121 Bacteria 5627
539 Ga0207683_10124392 3300026121 Bacteria 2317
540 Ga0207683_10287154 3300026121 Unclassified 1504
541 Ga0207698_10018072 3300026142 Bacteria 4797
542 Ga0207698_10052775 3300026142 Bacteria 3117
543 Ga0207698_10327836 3300026142 Bacteria 1437
544 Ga0209974_10005581 3300027876 Bacteria 4420
545 Ga0207428_10000031 3300027907 Bacteria 235245
546 Ga0268266_10191970 3300028379 Bacteria 1865
547 Ga0268266_10209886 3300028379 Unclassified 1785
548 Ga0268266_10269806 3300028379 Bacteria 1579
549 Ga0268266_10280572 3300028379 Bacteria 1549
550 Ga0268266_10476697 3300028379 Bacteria 1189
551 Ga0268265_10062858 3300028380 Bacteria 2854
552 Ga0268265_10097521 3300028380 Bacteria 2365
553 Ga0268265_10219681 3300028380 Unclassified 1662
554 Ga0268264_10007005 3300028381 Bacteria 9459
555 Ga0268264_10030284 3300028381 Bacteria 4436
556 Ga0268264_10059906 3300028381 Bacteria 3191
557 Ga0268264_10316568 3300028381 Bacteria 1474
558 Ga0268264_10454451 3300028381 Bacteria 1242
559 Ga0265337_1001644 3300028556 Bacteria 10866
560 Ga0265326_10013130 3300028558 Bacteria 2426
561 Ga0265318_10000195 3300028577 Bacteria 53122
562 Ga0265323_10005862 3300028653 Bacteria 5194
563 Ga0265322_10001230 3300028654 Bacteria 8712
564 Ga0307515_10000092 3300028794 Bacteria 212425
565 Ga0265338_10077849 3300028800 Bacteria 2800
566 Ga0265338_10169127 3300028800 Bacteria 1679
567 Ga0265330_10009657 3300031235 Unclassified 4575
568 Ga0265332_10036575 3300031238 Bacteria 2131
569 Ga0265320_10000070 3300031240 Bacteria 90235
570 Ga0265325_10005122 3300031241 Bacteria 8153
571 Ga0265325_10033045 3300031241 Bacteria 2759
572 Ga0265325_10135437 3300031241 Bacteria 1176
573 Ga0265329_10000929 3300031242 Bacteria 14720
574 Ga0265340_10000108 3300031247 Bacteria 40680
575 Ga0265340_10003007 3300031247 Bacteria 9597
576 Ga0265339_10034529 3300031249 Bacteria 2841
577 Ga0265339_10087891 3300031249 Bacteria 1633
578 Ga0265331_10003091 3300031250 Bacteria 10913
579 Ga0265316_10006923 3300031344 Bacteria 10753
580 Ga0265316_10080444 3300031344 Unclassified 2499
581 Ga0265316_10100115 3300031344 Bacteria 2203
582 Ga0307513_10125887 3300031456 Bacteria 2518
583 Ga0307509_10107579 3300031507 Bacteria 2804
584 Ga0307408_100040397 3300031548 Bacteria 3303
585 Ga0307408_100040579 3300031548 Bacteria 3296
586 Ga0265313_10001878 3300031595 Bacteria 19092
587 Ga0265313_10039862 3300031595 Bacteria 2327
588 Ga0316575_10001544 3300031665 Bacteria 7459
589 Ga0316575_10002566 3300031665 Bacteria 6107
590 Ga0316575_10012027 3300031665 Bacteria 3212
591 Ga0316575_10052820 3300031665 Bacteria 1618
592 Ga0316579_10057577 3300031691 Bacteria 1826
593 Ga0316579_10073899 3300031691 Bacteria 1618
594 Ga0265314_10000104 3300031711 Bacteria 127566
595 Ga0265314_10050435 3300031711 Bacteria 2907
596 Ga0265314_10054940 3300031711 Bacteria 2752
597 Ga0265342_10000433 3300031712 Bacteria 45864
598 Ga0265342_10001030 3300031712 Bacteria 27382
599 Ga0316576_10003610 3300031727 Bacteria 9123
600 Ga0316576_10006995 3300031727 Bacteria 7059
601 Ga0316576_10008823 3300031727 Bacteria 6465
602 Ga0316576_10048941 3300031727 Bacteria 3068
603 Ga0316576_10052550 3300031727 Bacteria 2967
604 Ga0316576_10127808 3300031727 Bacteria 1911
605 Ga0316576_10198194 3300031727 Bacteria 1513
606 Ga0316578_10002870 3300031728 Bacteria 7704
607 Ga0316578_10003237 3300031728 Bacteria 7393
608 Ga0316578_10007341 3300031728 Bacteria 5519
609 Ga0316578_10161863 3300031728 Bacteria 1349
610 Ga0316578_10172301 3300031728 Bacteria 1304
611 Ga0307405_10050942 3300031731 Bacteria 2567
612 Ga0316577_10021897 3300031733 Unclassified 3547
613 Ga0316577_10074270 3300031733 Bacteria 1898
614 Ga0307410_10013477 3300031852 Bacteria 4771
615 Ga0307410_10017356 3300031852 Bacteria 4321
616 Ga0307410_10040082 3300031852 Bacteria 3080
617 Ga0307410_10123549 3300031852 Bacteria 1891
618 Ga0307410_10299823 3300031852 Bacteria 1268
619 Ga0307407_10045299 3300031903 Bacteria 2485
620 Ga0307412_10232205 3300031911 Bacteria 1421
621 Ga0307409_100085900 3300031995 Bacteria 2559
622 Ga0307409_100306417 3300031995 Bacteria 1480
623 Ga0307416_100027174 3300032002 Bacteria 4233
624 Ga0307416_100056409 3300032002 Bacteria 3170
625 Ga0307416_100135889 3300032002 Bacteria 2224
626 Ga0307414_10367887 3300032004 Bacteria 1239
627 Ga0307411_10038303 3300032005 Unclassified 3023
628 Ga0307411_10042060 3300032005 Bacteria 2912
629 Ga0307411_10189530 3300032005 Unclassified 1569
630 Ga0307411_10235310 3300032005 Bacteria 1430
631 Ga0307411_10308563 3300032005 Bacteria 1272
632 Ga0307415_100030729 3300032126 Bacteria 3452
633 Ga0307415_100240574 3300032126 Bacteria 1464
634 Ga0316583_10003577 3300032133 Bacteria 5488
635 Ga0316583_10004947 3300032133 Bacteria 4760
636 Ga0316583_10008550 3300032133 Bacteria 3692
637 Ga0316583_10021390 3300032133 Bacteria 2318
638 Ga0316583_10026515 3300032133 Bacteria 2068
639 Ga0316583_10035788 3300032133 Bacteria 1762
640 Ga0316583_10040292 3300032133 Bacteria 1654
641 Ga0316583_10048860 3300032133 Bacteria 1489
642 Ga0316585_10008588 3300032137 Unclassified 2967
643 Ga0316585_10052164 3300032137 Bacteria 1314
644 Ga0316580_10000900 3300032139 Bacteria 7356
645 Ga0316580_10001815 3300032139 Bacteria 5722
646 Ga0316580_10056442 3300032139 Bacteria 1207
647 Ga0316592_1006636 3300033524 Bacteria 2236
648 Ga0316588_1040045 3300033528 Bacteria 1118
649 Ga0373953_0095547 3300035117 Bacteria 1247
650 Ga0373953_0148845 3300035117 Archaea 1003
651 Ga0373955_0073320 3300035172 Unclassified 1919
652 Ga0316574_0012270 3300035398 Bacteria 4900
653 Ga0316574_0014180 3300035398 Bacteria 4597
654 Ga0316574_0027730 3300035398 Bacteria 3412
655 Ga0373947_0251800 3300035725 Bacteria 1168
656 Ga0373937_0012246 3300036401 Bacteria 7536
657 Ga0373937_0043557 3300036401 Unclassified 4098
658 Ga0373937_0135290 3300036401 Bacteria 2304
659 Ga0373937_0436749 3300036401 Bacteria 1243
660 Ga0316582_0016664 3300036647 Bacteria 4231
661 Ga0316582_0055855 3300036647 Bacteria 2518
662 Ga0316584_0004299 3300036712 Bacteria 9415
663 Ga0316584_0004621 3300036712 Bacteria 9123
664 Ga0316584_0004631 3300036712 Bacteria 9112
665 Ga0373925_0497364 3300037068 Bacteria 1001
666 Ga0395899_0017367 3300037312 Bacteria 5481
667 Ga0395900_0018883 3300037418 Bacteria 7032
668 Ga0395900_0027156 3300037418 Bacteria 5861
669 Ga0395900_0124498 3300037418 Bacteria 2644
670 Ga0395898_0001959 3300037466 Bacteria 26028
671 Ga0395898_0085750 3300037466 Bacteria 3036
672 Ga0395898_0154787 3300037466 Bacteria 2193
673 Ga0395905_0012005 3300037471 Bacteria 8354
674 Ga0316581_0027607 3300037588 Bacteria 1697
675 Ga0316581_0034851 3300037588 Bacteria 1524
676 Ga0395901_0001045 3300038443 Bacteria 29867
677 Ga0395901_0009760 3300038443 Bacteria 9734
678 Ga0395901_0015422 3300038443 Bacteria 7781
679 Ga0436365_0336651 3300039437 Bacteria 1798
680 Ga0436360_0105708 3300039438 Bacteria 7936
681 Ga0436361_0740991 3300039447 Bacteria 8130
682 Ga0436362_0346855 3300039453 Bacteria 4746
683 Ga0439449_0040168 3300042007 Bacteria 1739
684 Ga0439435_0049817 3300042436 Unclassified 1196
685 Ga0451577_0003018 3300042876 Bacteria 19168
686 Ga0451577_0016447 3300042876 Bacteria 6852
687 Ga0451577_0102493 3300042876 Unclassified 2558
688 Ga0451577_0123283 3300042876 Bacteria 2321
689 Ga0451577_0147235 3300042876 Bacteria 2118
690 Ga0451577_0247500 3300042876 Bacteria 1613
691 Ga0466972_0000009 3300044658 Bacteria 256374
692 Ga0453683_0049204 3300044673 Bacteria 2643
693 Ga0453683_0204881 3300044673 Bacteria 1252
694 Ga0453684_0000220 3300044712 Bacteria 249922
695 Ga0453684_0029795 3300044712 Bacteria 7733
696 Ga0453684_0120717 3300044712 Bacteria 3165
697 Ga0453684_0153749 3300044712 Bacteria 2730
698 Ga0453684_0187841 3300044712 Bacteria 2420
699 Ga0453684_0349268 3300044712 Bacteria 1668
700 Ga0453684_0464060 3300044712 Bacteria 1407
701 Ga0453684_0481969 3300044712 Bacteria 1376
702 Ga0453684_0518598 3300044712 Bacteria 1317
703 Ga0466957_0033462 3300044842 Bacteria 3084
704 Ga0451576_0030100 3300045051 Bacteria 5805
705 Ga0451576_0031338 3300045051 Bacteria 5670
706 Ga0451576_0255094 3300045051 Bacteria 1833
707 Ga0495592_0054446 3300046454 Bacteria 2964
708 Ga0495629_0105738 3300046459 Bacteria 1963
709 Ga0495629_0145201 3300046459 Unclassified 1650
710 Ga0495629_0193814 3300046459 Unclassified 1406
711 Ga0495651_0000090 3300046462 Bacteria 66511
712 Ga0495651_0139011 3300046462 Bacteria 1764
713 Ga0495580_0163858 3300046472 Bacteria 1538
714 Ga0495662_0009490 3300046476 Unclassified 4773
715 Ga0495664_0187534 3300046477 Bacteria 1254
716 Ga0495585_0000525 3300046492 Bacteria 36200
717 Ga0495618_0038745 3300046514 Bacteria 2997
718 Ga0495618_0170044 3300046514 Unclassified 1387
719 Ga0495630_0012249 3300046517 Bacteria 6221
720 Ga0495630_0361005 3300046517 Bacteria 1112
721 Ga0495643_0009334 3300046522 Bacteria 6104
722 Ga0495640_0081835 3300046533 Unclassified 2146
723 Ga0495640_0163101 3300046533 Bacteria 1427
724 Ga0495587_0034140 3300046536 Bacteria 3069
725 Ga0495587_0054565 3300046536 Bacteria 2355
726 Ga0495587_0094614 3300046536 Bacteria 1725
727 Ga0495598_0007722 3300046537 Bacteria 2479
728 Ga0495645_0020717 3300046543 Bacteria 4748
729 Ga0495667_0005808 3300046559 Bacteria 8363
730 Ga0495667_0030382 3300046559 Unclassified 3630
731 Ga0495656_0001607 3300046615 Bacteria 7396
732 Ga0495656_0118129 3300046615 Bacteria 1248
733 Ga0495634_0038710 3300046642 Bacteria 3250
734 Ga0495635_0014765 3300046663 Bacteria 5464
735 Ga0495657_0002664 3300046675 Bacteria 14920
736 Ga0495657_0220443 3300046675 Bacteria 1150
737 Ga0495599_0119314 3300046678 Bacteria 1640
738 Ga0495599_0189701 3300046678 Bacteria 1265
739 Ga0495658_0015758 3300046683 Bacteria 3882
740 Ga0495658_0094565 3300046683 Unclassified 1775
741 Ga0495658_0138528 3300046683 Bacteria 1487
742 Ga0495669_0006927 3300046684 Bacteria 4748
743 Ga0495613_0043195 3300046689 Unclassified 3334
744 Ga0495670_0124712 3300046691 Bacteria 1340
745 Ga0495670_0125443 3300046691 Bacteria 1336
746 Ga0495670_0159165 3300046691 Bacteria 1186
747 Ga0495600_0027708 3300046809 Bacteria 3662
748 Ga0495600_0122883 3300046809 Bacteria 1688
749 Ga0495581_0079809 3300047315 Unclassified 1894
750 Ga0495604_0006369 3300047317 Bacteria 9362
751 Ga0495604_0111219 3300047317 Bacteria 1997
752 Ga0495604_0220447 3300047317 Unclassified 1306
753 Ga0495636_0000016 3300047318 Bacteria 78995
754 Ga0495674_0061772 3300047319 Bacteria 3264
755 Ga0495674_0168095 3300047319 Unclassified 1831
756 Ga0495680_0001014 3300047322 Bacteria 31192
757 Ga0495680_0047511 3300047322 Bacteria 3376
758 Ga0495675_0021392 3300047444 Bacteria 4118
759 Ga0495675_0051785 3300047444 Unclassified 2607
760 Ga0495684_0057463 3300047471 Bacteria 2965
761 Ga0495684_0158850 3300047471 Unclassified 1687
762 Ga0495602_0092839 3300048088 Bacteria 2499
763 Ga0495602_0199484 3300048088 Bacteria 1528
764 Ga0496101_0201633 3300048904 Bacteria 1538
765 Ga0496102_0065747 3300048905 Bacteria 3324
766 Ga0496104_0088030 3300048907 Bacteria 2966
767 Ga0496105_0087649 3300048908 Bacteria 2572
768 Ga0496106_0061170 3300048909 Bacteria 2856
769 Ga0496107_0029175 3300048910 Bacteria 3924
770 Ga0496108_0057265 3300048911 Bacteria 3275
771 Ga0496108_0143849 3300048911 Bacteria 2055
772 Ga0496108_0161989 3300048911 Bacteria 1934
773 Ga0496109_0130602 3300048912 Bacteria 2344
774 Ga0496109_0476539 3300048912 Bacteria 1178
775 Ga0496112_0117533 3300048915 Bacteria 2629
776 Ga0496112_0702373 3300048915 Bacteria 939
777 Ga0496114_0058821 3300048917 Bacteria 3209
778 Ga0496114_0135287 3300048917 Bacteria 2131
779 Ga0501032_0128267 3300049569 Unclassified 1674
780 Ga0501033_0045063 3300049570 Unclassified 3283
781 Ga0501033_0226804 3300049570 Bacteria 1328
782 Ga0501034_0010869 3300049571 Bacteria 9455
783 Ga0501034_0011076 3300049571 Bacteria 9366
784 Ga0501036_0006252 3300049572 Bacteria 9659
785 Ga0501036_0115614 3300049572 Unclassified 2266
786 Ga0501037_0014266 3300049573 Bacteria 5855
787 Ga0501037_0038256 3300049573 Bacteria 3535
788 Ga0501038_0069442 3300049574 Bacteria 2993
789 Ga0501038_0090020 3300049574 Bacteria 2573
790 Ga0501038_0112482 3300049574 Unclassified 2254
791 Ga0501038_0116511 3300049574 Bacteria 2208
792 Ga0501038_0247264 3300049574 Bacteria 1414
793 Ga0501039_0016664 3300049575 Bacteria 5629
794 Ga0501039_0022435 3300049575 Unclassified 4846
795 Ga0501039_0084494 3300049575 Bacteria 2472
796 Ga0501040_0001939 3300049576 Bacteria 13306
797 Ga0501040_0028138 3300049576 Bacteria 3788
798 Ga0501042_0014495 3300049578 Bacteria 5383
799 Ga0501042_0095252 3300049578 Bacteria 2138
800 Ga0501043_0150986 3300049579 Bacteria 1818
801 Ga0501043_0166570 3300049579 Unclassified 1721
802 Ga0501046_0018198 3300049580 Bacteria 5851
803 Ga0501046_0062127 3300049580 Bacteria 2919
804 Ga0501046_0158663 3300049580 Unclassified 1702
805 Ga0501047_0034670 3300049581 Unclassified 4873
806 Ga0501047_0137193 3300049581 Bacteria 2326
807 Ga0501048_0009500 3300049582 Bacteria 7300
808 Ga0501048_0046381 3300049582 Bacteria 3102
809 Ga0501048_0210136 3300049582 Bacteria 1380
810 Ga0501067_0000249 3300049583 Bacteria 29614
811 Ga0501067_0043941 3300049583 Bacteria 2482
812 Ga0501068_0270012 3300049584 Unclassified 1086
813 Ga0501070_0209990 3300049586 Bacteria 1598
814 Ga0501072_0022119 3300049588 Bacteria 4932
815 Ga0501073_0031033 3300049589 Bacteria 3814
816 Ga0501074_0059882 3300049590 Bacteria 2743
817 Ga0501074_0095165 3300049590 Bacteria 2133
818 Ga0501075_0008564 3300049591 Bacteria 7131
819 Ga0501075_0093423 3300049591 Bacteria 2283
820 Ga0501075_0430622 3300049591 Bacteria 1006
821 Ga0501076_0008547 3300049592 Bacteria 7507
822 Ga0501076_0033519 3300049592 Bacteria 4010
823 Ga0501076_0181864 3300049592 Bacteria 1714
824 Ga0501076_0301692 3300049592 Bacteria 1313
825 Ga0501076_0305508 3300049592 Bacteria 1304
826 Ga0501076_0441263 3300049592 Unclassified 1071
827 Ga0501077_0009906 3300049593 Bacteria 5931
828 Ga0501198_012893 3300049649 Unclassified 1260
829 Ga0501202_029143 3300049652 Unclassified 1143
830 Ga0501217_000055 3300049661 Bacteria 13339
831 Ga0501222_004506 3300049662 Unclassified 1892
832 Ga0501223_001899 3300049663 Unclassified 4708
833 Ga0501233_004326 3300049668 Unclassified 2597
834 Ga0501243_000975 3300049675 Unclassified 4027
835 Ga0501259_001374 3300049688 Unclassified 4071
836 Ga0501221_000337 3300049704 Bacteria 7125
837 Ga0501225_0001107 3300049705 Bacteria 8457
838 Ga0501225_0001987 3300049705 Bacteria 6389
839 Ga0501245_000875 3300049708 Unclassified 3811
840 Ga0501079_0010716 3300049741 Bacteria 6981
841 Ga0501079_0060330 3300049741 Bacteria 2926
842 Ga0501079_0146628 3300049741 Bacteria 1839
843 Ga0501079_0158162 3300049741 Bacteria 1766
844 Ga0501079_0188864 3300049741 Bacteria 1608
845 Ga0501080_0004871 3300049742 Bacteria 11965
846 Ga0501080_0014784 3300049742 Bacteria 7189
847 Ga0501080_0064218 3300049742 Bacteria 3415
848 Ga0501080_0395661 3300049742 Bacteria 1243
849 Ga0501081_0007334 3300049743 Bacteria 7157
850 Ga0501081_0012374 3300049743 Bacteria 5605
851 Ga0501081_0135937 3300049743 Bacteria 1759
852 Ga0501083_0006560 3300049744 Bacteria 8257
853 Ga0501083_0062118 3300049744 Bacteria 2493
854 Ga0501083_0267033 3300049744 Bacteria 1113
855 Ga0501263_007208 3300049760 Bacteria 1304
856 Ga0501268_023281 3300049765 Bacteria 1074
857 Ga0501035_0035768 3300049822 Unclassified 4506
858 Ga0501035_0133458 3300049822 Bacteria 2163
859 Ga0501044_0002454 3300049823 Bacteria 21139
860 Ga0501044_0044779 3300049823 Bacteria 4589
861 Ga0501044_0101639 3300049823 Unclassified 2892
862 Ga0501044_0250010 3300049823 Bacteria 1714
863 Ga0501045_0002074 3300049824 Bacteria 13539
864 Ga0501045_0039920 3300049824 Bacteria 3415
865 Ga0501045_0043711 3300049824 Bacteria 3263
866 Ga0501045_0051695 3300049824 Bacteria 2999
867 nmdc:mga05p37_142569_c1 3300050507 Bacteria 2935
868 nmdc:mga05p37_148017_c1 3300050507 Bacteria 2874
869 nmdc:mga05p37_462788_c1 3300050507 Unclassified 1465
870 nmdc:mga05p37_50876_c1 3300050507 Bacteria 5095
871 nmdc:mga05p37_561131_c1 3300050507 Bacteria 1297
872 nmdc:mga09592_275417_c1 3300050508 Bacteria 1460
873 nmdc:mga09592_40794_c1 3300050508 Bacteria 3900
874 nmdc:mga09592_72684_c1 3300050508 Bacteria 2921
875 nmdc:mga09592_87369_c1 3300050508 Bacteria 2662
876 nmdc:mga09592_99597_c1 3300050508 Bacteria 2488
877 nmdc:mga0qj67_12488_c1 3300050509 Bacteria 6398
878 nmdc:mga0qj67_2698_c1 3300050509 Bacteria 12729
879 nmdc:mga0qj67_32779_c1 3300050509 Bacteria 4053
880 nmdc:mga0qj67_53056_c1 3300050509 Bacteria 3209
881 nmdc:mga06r32_354305_c1 3300050510 Bacteria 1452
882 nmdc:mga06r32_418705_c1 3300050510 Bacteria 1321
883 nmdc:mga06r32_47840_c1 3300050510 Bacteria 4087
884 nmdc:mga06r32_54656_c1 3300050510 Bacteria 3829
885 nmdc:mga06r32_55517_c1 3300050510 Bacteria 3799
886 nmdc:mga06r32_8661_c1 3300050510 Bacteria 9168
887 nmdc:mga08y16_115285_c1 3300050511 Bacteria 2797
888 nmdc:mga08y16_22_c1 3300050511 Bacteria 250162
889 nmdc:mga0rr50_145607_c2 3300050513 Bacteria 1563
890 nmdc:mga08x19_185705_c1 3300050514 Bacteria 1421
891 nmdc:mga0a205_119095_c1 3300050515 Bacteria 2539
892 nmdc:mga0a205_90561_c1 3300050515 Bacteria 2956
893 Ga0495601_0045849 3300053077 Bacteria 2751
894 Ga0495601_0084683 3300053077 Bacteria 2037
895 Ga0495595_0010711 3300053084 Bacteria 3819
896 Ga0495619_0005570 3300053085 Bacteria 7989
897 Ga0495619_0023411 3300053085 Bacteria 3959
898 Ga0500644_0006740 3300053088 Bacteria 2959
899 Ga0500583_0000027 3300053092 Bacteria 109138
900 Ga0500583_0000598 3300053092 Bacteria 10793
901 Ga0500566_0003670 3300053094 Bacteria 9165
902 Ga0500589_038939 3300053147 Unclassified 2219
903 Ga0500603_003764 3300053150 Bacteria 3247
904 Ga0500603_038290 3300053150 Bacteria 1269
905 Ga0501084_0159099 3300054114 Unclassified 1905
906 Ga0501084_0214105 3300054114 Bacteria 1625
907 Ga0501082_0004906 3300060353 Bacteria 11666
908 Ga0501082_0015866 3300060353 Bacteria 6477
909 Ga0501082_0042729 3300060353 Bacteria 3907
910 Ga0530510_0002730 3300061734 Bacteria 12149
911 Ga0530510_0033484 3300061734 Bacteria 3699
912 Ga0530510_0086070 3300061734 Bacteria 2290
913 Ga0530510_0104328 3300061734 Bacteria 2074
914 Ga0530510_0138981 3300061734 Bacteria 1789
915 Ga0530510_0140894 3300061734 Bacteria 1776
916 2644016548 2643221601 Bacteria 7493239
917 2644176468 2643221631 Bacteria 8168043
918 2738725136 2738541278 Bacteria 9755573
919 Ga0068851_10016011
920 JGI24751J29686_10000335
921 JGI25406J46586_10023135
922 rootH1_10004495
923 rootH1_10155694
924 Ga0065714_10019946
925 Ga0065712_10000781
926 Ga0065715_10155878
927 Ga0065707_10091080
928 Ga0065707_10118341
929 Ga0070658_10001806
930 Ga0070676_10015570
931 Ga0070676_10113135
932 Ga0070683_100005550
933 Ga0070683_100020750
934 Ga0070683_100132805
935 Ga0070683_100236805
936 Ga0070690_100003963
937 Ga0070690_100040289
938 Ga0070670_100012132
939 Ga0070670_100018444
940 Ga0070670_100025152
941 Ga0070670_100052931
942 Ga0070670_100064587
943 Ga0070670_100083934
944 Ga0070670_100206539
945 Ga0070670_100248776
946 Ga0070670_100251733
947 Ga0070670_100302109
948 Ga0068869_100024944
949 Ga0068869_100066941
950 Ga0068869_100087483
951 Ga0068869_100386438
952 Ga0070666_10001316
953 Ga0070666_10005429
954 Ga0070666_10021319
955 Ga0070666_10029682
956 Ga0070666_10089305
957 Ga0070680_100006966
958 Ga0070680_100043075
959 Ga0070680_100425293
960 Ga0070682_100006403
961 Ga0070682_100095781
962 Ga0068868_100008292
963 Ga0068868_100015287
964 Ga0068868_100158765
965 Ga0070660_100031268
966 Ga0070660_100192229
967 Ga0070689_100031031
968 Ga0070689_100073946
969 Ga0070689_100174977
970 Ga0070687_100001102
971 Ga0070687_100059306
972 Ga0070661_100009793
973 Ga0070661_100013569
974 Ga0070661_100085471
975 Ga0070661_100142381
976 Ga0070668_100000951
977 Ga0070668_100023794
978 Ga0070668_100113597
979 Ga0070668_100271460
980 Ga0070669_100037947
981 Ga0070669_100053889
982 Ga0070669_100092951
983 Ga0070669_100210329
984 Ga0070669_100242384
985 Ga0070675_100008620
986 Ga0070675_100011460
987 Ga0070675_100033681
988 Ga0070675_100099784
989 Ga0070675_100116193
990 Ga0070675_100340387
991 Ga0070671_100011830
992 Ga0070671_100116251
993 Ga0070671_100380375
994 Ga0070674_100007915
995 Ga0070674_100069510
996 Ga0070674_100149299
997 Ga0070673_100002269
998 Ga0070673_100091941
999 Ga0070673_100113975
1000 Ga0070673_100165222
1001 Ga0070673_100315594
1002 Ga0070688_100032273
1003 Ga0070688_100037566
1004 Ga0070688_100381889
1005 Ga0070659_100025517
1006 Ga0070659_100025984
1007 Ga0070659_100118369
1008 Ga0070659_100181859
1009 Ga0070667_100005498
1010 Ga0070667_100005708
1011 Ga0070667_100137970
1012 Ga0070667_100178526
1013 Ga0070667_100205033
1014 Ga0070667_100218193
1015 Ga0070667_100228292
1016 Ga0070667_100264626
1017 Ga0070667_100320443
1018 Ga0070708_100282992
1019 Ga0070663_100119781
1020 Ga0070663_100259117
1021 Ga0070678_100095547
1022 Ga0070662_100226440
1023 Ga0070662_100228348
1024 Ga0070662_100262169
1025 Ga0070681_10073654
1026 Ga0070681_10105715
1027 Ga0070681_10123298
1028 Ga0070681_10127861
1029 Ga0070681_10257086
1030 Ga0068867_100116337
1031 Ga0068867_100450975
1032 Ga0070685_10007265
1033 Ga0070685_10033897
1034 Ga0070685_10044525
1035 Ga0070706_100265778
1036 Ga0070707_100000032
1037 Ga0070698_100001998
1038 Ga0070698_100003211
1039 Ga0070699_100119960
1040 Ga0070699_100259085
1041 Ga0070679_100002339
1042 Ga0070679_100004116
1043 Ga0070679_100013309
1044 Ga0070679_100016964
1045 Ga0070679_100024167
1046 Ga0070679_100076615
1047 Ga0070679_100525512
1048 Ga0070684_100012839
1049 Ga0070684_100411356
1050 Ga0068853_100011024
1051 Ga0068853_100045604
1052 Ga0068853_100131745
1053 Ga0068853_100216381
1054 Ga0068853_100412894
1055 Ga0070672_100005846
1056 Ga0070672_100030941
1057 Ga0070672_100047244
1058 Ga0070672_100090118
1059 Ga0070672_100106674
1060 Ga0070672_100256135
1061 Ga0070686_100004512
1062 Ga0070686_100005546
1063 Ga0070686_100042469
1064 Ga0070693_100012709
1065 Ga0070665_100051291
1066 Ga0070665_100186816
1067 Ga0070665_100258668
1068 Ga0070665_100304326
1069 Ga0070665_100523045
1070 Ga0068855_100000014
1071 Ga0068855_100043250
1072 Ga0068855_100173463
1073 Ga0068855_100213568
1074 Ga0070664_100000492
1075 Ga0070664_100022854
1076 Ga0070664_100139951
1077 Ga0070664_100195286
1078 Ga0068857_100032403
1079 Ga0068857_100034845
1080 Ga0068857_100266590
1081 Ga0068857_100286052
1082 Ga0068857_100539105
1083 Ga0068854_100064759
1084 Ga0068854_100085130
1085 Ga0068854_100127144
1086 Ga0068854_100235901
1087 Ga0068854_100360405
1088 Ga0068856_100089457
1089 Ga0068856_100395590
1090 Ga0068852_100023253
1091 Ga0068852_100046341
1092 Ga0068859_100006459
1093 Ga0068859_100017217
1094 Ga0068859_100114918
1095 Ga0068859_100180101
1096 Ga0068859_100341549
1097 Ga0068864_100000781
1098 Ga0068864_100008888
1099 Ga0068864_100051164
1100 Ga0068866_10011514
1101 Ga0068861_100029438
1102 Ga0068861_100093705
1103 Ga0068861_100339685
1104 Ga0068861_100373493
1105 Ga0068851_10079402
1106 Ga0068863_100000221
1107 Ga0068863_100022837
1108 Ga0068863_100126403
1109 Ga0068863_100186873
1110 Ga0068858_100013096
1111 Ga0068858_100026396
1112 Ga0068858_100082124
1113 Ga0068860_100006424
1114 Ga0068860_100018722
1115 Ga0068860_100188187
1116 Ga0068860_100302272
1117 Ga0068860_100378000
1118 Ga0068862_100011917
1119 Ga0068862_100221636
1120 Ga0068862_100288606
1121 Ga0081455_10007011
1122 Ga0081455_10093709
1123 Ga0081455_10285818
1124 Ga0081539_10004015
1125 Ga0081539_10004448
1126 Ga0070715_10132209
1127 Ga0070716_100059682
1128 Ga0097621_100000554
1129 Ga0097621_100019149
1130 Ga0097621_100021327
1131 Ga0097621_100021395
1132 Ga0097621_100021757
1133 Ga0097621_100039645
1134 Ga0097621_100062570
1135 Ga0068871_100001750
1136 Ga0068871_100002575
1137 Ga0068871_100003879
1138 Ga0068871_100023121
1139 Ga0068871_100037217
1140 Ga0068871_100069994
1141 Ga0068871_100107602
1142 Ga0075428_100064824
1143 Ga0075428_100148569
1144 Ga0075428_100151035
1145 Ga0075430_100005824
1146 Ga0075430_100007274
1147 Ga0075431_100002400
1148 Ga0075431_100095188
1149 Ga0075431_100134669
1150 Ga0075431_100243672
1151 Ga0075431_100363120
1152 Ga0075431_100431028
1153 Ga0075433_10224420
1154 Ga0075433_10252385
1155 Ga0075434_100063233
1156 Ga0075429_100050163
1157 Ga0075429_100091904
1158 Ga0075429_100094474
1159 Ga0075429_100108399
1160 Ga0068865_100056511
1161 Ga0068865_100124073
1162 Ga0068865_100260300
1163 Ga0097620_100006459
1164 Ga0097620_100017217
1165 Ga0097620_100114917
1166 Ga0097620_100180104
1167 Ga0097620_100309232
1168 Ga0097620_100341549
1169 Ga0099794_10022038
1170 Ga0105240_10028359
1171 Ga0105240_10043874
1172 Ga0105240_10064765
1173 Ga0105240_10169230
1174 Ga0105240_10244183
1175 Ga0111539_10000536
1176 Ga0111539_10031210
1177 Ga0111539_10076633
1178 Ga0111539_10277409
1179 Ga0111539_10489102
1180 Ga0111539_10675418
1181 Ga0105245_10001786
1182 Ga0105245_10043077
1183 Ga0105247_10001541
1184 Ga0114129_10014027
1185 Ga0114129_10093237
1186 Ga0114129_10176339
1187 Ga0114129_10194413
1188 Ga0114129_10381086
1189 Ga0114129_10558725
1190 Ga0105243_10232472
1191 Ga0105241_10004396
1192 Ga0105241_10166884
1193 Ga0105242_10003021
1194 Ga0105242_10006100
1195 Ga0105242_10022569
1196 Ga0105242_10069023
1197 Ga0105242_10098613
1198 Ga0105248_10000048
1199 Ga0105248_10015185
1200 Ga0105248_10057845
1201 Ga0105248_10185968
1202 Ga0105248_10442529
1203 Ga0105248_10448313
1204 Ga0105237_10009302
1205 Ga0105237_10093453
1206 Ga0105238_10459933
1207 Ga0105249_10013169
1208 Ga0105249_10021095
1209 Ga0105249_10058553
1210 Ga0105249_10060141
1211 Ga0105239_10012617
1212 Ga0105239_10205151
1213 Ga0105246_10042738
1214 Ga0157373_10007196
1215 Ga0157373_10025876
1216 Ga0157373_10217816
1217 Ga0157373_10341215
1218 Ga0157371_10015347
1219 Ga0157371_10030981
1220 Ga0157371_10079361
1221 Ga0157371_10185743
1222 Ga0157370_10005480
1223 Ga0157370_10011127
1224 Ga0157370_10013214
1225 Ga0157370_10029120
1226 Ga0157370_10102080
1227 Ga0157370_10121961
1228 Ga0157370_10248094
1229 Ga0157370_10509787
1230 Ga0157369_10186487
1231 Ga0157369_10305621
1232 Ga0157374_10005430
1233 Ga0157374_10022899
1234 Ga0157374_10024433
1235 Ga0157374_10053519
1236 Ga0157374_10136846
1237 Ga0157374_10161837
1238 Ga0157374_10162036
1239 Ga0157374_10196769
1240 Ga0157374_10208221
1241 Ga0157378_10000437
1242 Ga0157378_10001754
1243 Ga0157378_10002581
1244 Ga0157378_10003439
1245 Ga0157378_10087958
1246 Ga0157378_10091891
1247 Ga0157378_10284743
1248 Ga0163162_10000523
1249 Ga0163162_10005980
1250 Ga0163162_10124903
1251 Ga0163162_10286741
1252 Ga0163162_10635131
1253 Ga0157372_10015460
1254 Ga0157372_10055142
1255 Ga0157372_10067718
1256 Ga0157372_10192125
1257 Ga0157372_10334192
1258 Ga0157372_10479819
1259 Ga0157372_10651318
1260 Ga0157375_10000262
1261 Ga0157375_10001301
1262 Ga0157375_10035272
1263 Ga0157375_10122921
1264 Ga0157375_10260729
1265 Ga0157375_10310801
1266 Ga0157375_10392539
1267 Ga0157375_10438695
1268 Ga0157375_10640445
1269 Ga0163163_10001342
1270 Ga0163163_10008192
1271 Ga0163163_10008479
1272 Ga0163163_10108304
1273 Ga0163163_10116640
1274 Ga0163163_10232956
1275 Ga0163163_10378901
1276 Ga0163163_10435545
1277 Ga0157380_10010459
1278 Ga0157380_10035103
1279 Ga0157380_10050034
1280 Ga0157380_10127011
1281 Ga0157380_10205732
1282 Ga0157380_10247718
1283 Ga0157380_10426794
1284 Ga0157377_10016681
1285 Ga0157377_10030983
1286 Ga0157377_10083580
1287 Ga0157379_10000264
1288 Ga0157379_10135713
1289 Ga0157379_10167729
1290 Ga0157379_10263715
1291 Ga0157379_10268109
1292 Ga0157376_10041099
1293 Ga0157376_10056318
1294 Ga0157376_10081417
1295 Ga0157376_10101092
1296 Ga0157376_10207736
1297 Ga0163161_10018613
1298 Ga0163161_10030173
1299 Ga0163161_10083804
1300 Ga0213872_10047235
1301 Ga0213871_10004166
1302 Ga0207697_10086919
1303 Ga0207656_10000483
1304 Ga0207688_10252598
1305 Ga0207680_10001546
1306 Ga0207680_10011290
1307 Ga0207680_10026291
1308 Ga0207680_10130427
1309 Ga0207647_10010393
1310 Ga0207647_10135566
1311 Ga0207645_10018735
1312 Ga0207645_10029340
1313 Ga0207643_10017411
1314 Ga0207705_10000623
1315 Ga0207705_10072838
1316 Ga0207684_10157635
1317 Ga0207654_10028106
1318 Ga0207654_10172482
1319 Ga0207707_10019903
1320 Ga0207707_10096788
1321 Ga0207695_10005932
1322 Ga0207695_10029463
1323 Ga0207695_10034212
1324 Ga0207695_10134545
1325 Ga0207660_10033757
1326 Ga0207660_10067556
1327 Ga0207660_10071945
1328 Ga0207660_10387918
1329 Ga0207662_10002985
1330 Ga0207662_10058259
1331 Ga0207657_10010235
1332 Ga0207657_10025421
1333 Ga0207657_10119828
1334 Ga0207649_10002503
1335 Ga0207649_10025152
1336 Ga0207649_10233776
1337 Ga0207652_10002089
1338 Ga0207652_10005426
1339 Ga0207652_10021177
1340 Ga0207652_10121649
1341 Ga0207652_10170678
1342 Ga0207652_10349652
1343 Ga0207646_10000032
1344 Ga0207646_10524475
1345 Ga0207681_10108322
1346 Ga0207681_10322777
1347 Ga0207650_10000510
1348 Ga0207650_10031978
1349 Ga0207650_10067621
1350 Ga0207650_10085894
1351 Ga0207650_10090549
1352 Ga0207650_10102126
1353 Ga0207650_10115851
1354 Ga0207650_10148330
1355 Ga0207650_10177790
1356 Ga0207650_10268623
1357 Ga0207659_10000173
1358 Ga0207659_10002371
1359 Ga0207659_10020599
1360 Ga0207659_10029299
1361 Ga0207659_10286541
1362 Ga0207644_10002882
1363 Ga0207644_10015078
1364 Ga0207690_10073407
1365 Ga0207690_10147506
1366 Ga0207690_10209824
1367 Ga0207690_10263057
1368 Ga0207690_10425887
1369 Ga0207706_10052994
1370 Ga0207706_10077398
1371 Ga0207706_10112705
1372 Ga0207686_10000884
1373 Ga0207686_10171732
1374 Ga0207670_10004333
1375 Ga0207670_10029226
1376 Ga0207670_10120701
1377 Ga0207670_10351037
1378 Ga0207704_10015131
1379 Ga0207704_10091665
1380 Ga0207691_10019398
1381 Ga0207691_10019513
1382 Ga0207691_10028488
1383 Ga0207691_10121889
1384 Ga0207691_10197390
1385 Ga0207711_10000648
1386 Ga0207711_10267390
1387 Ga0207711_10305515
1388 Ga0207689_10002805
1389 Ga0207689_10040689
1390 Ga0207689_10088810
1391 Ga0207689_10244290
1392 Ga0207661_10001069
1393 Ga0207661_10036520
1394 Ga0207661_10120313
1395 Ga0207661_10244550
1396 Ga0207679_10013567
1397 Ga0207679_10021225
1398 Ga0207679_10036606
1399 Ga0207679_10320840
1400 Ga0207667_10000049
1401 Ga0207667_10019413
1402 Ga0207667_10081514
1403 Ga0207667_10198753
1404 Ga0207667_10213407
1405 Ga0207667_10253002
1406 Ga0207651_10022287
1407 Ga0207651_10040387
1408 Ga0207651_10148977
1409 Ga0207651_10294905
1410 Ga0207712_10002170
1411 Ga0207712_10013251
1412 Ga0207668_10000663
1413 Ga0207668_10032610
1414 Ga0207668_10083168
1415 Ga0207640_10012544
1416 Ga0207640_10058766
1417 Ga0207640_10069819
1418 Ga0207640_10187764
1419 Ga0207658_10010785
1420 Ga0207658_10056336
1421 Ga0207658_10132733
1422 Ga0207658_10153660
1423 Ga0207658_10195617
1424 Ga0207658_10257330
1425 Ga0207677_10028007
1426 Ga0207677_10038103
1427 Ga0207703_10013004
1428 Ga0207703_10019904
1429 Ga0207639_10005388
1430 Ga0207639_10007679
1431 Ga0207639_10086260
1432 Ga0207639_10091546
1433 Ga0207639_10093975
1434 Ga0207639_10257563
1435 Ga0207678_10170339
1436 Ga0207708_10096778
1437 Ga0207702_10051789
1438 Ga0207641_10000561
1439 Ga0207641_10001235
1440 Ga0207641_10015720
1441 Ga0207641_10035180
1442 Ga0207641_10161340
1443 Ga0207648_10002623
1444 Ga0207648_10303428
1445 Ga0207676_10026191
1446 Ga0207676_10049325
1447 Ga0207676_10082344
1448 Ga0207676_10379983
1449 Ga0207674_10033423
1450 Ga0207674_10061864
1451 Ga0207674_10212617
1452 Ga0207674_10529904
1453 Ga0207675_100049100
1454 Ga0207675_100077458
1455 Ga0207675_100429753
1456 Ga0207683_10020712
1457 Ga0207683_10124392
1458 Ga0207683_10287154
1459 Ga0207698_10018072
1460 Ga0207698_10052775
1461 Ga0207698_10327836
1462 Ga0209974_10005581
1463 Ga0207428_10000031
1464 Ga0268266_10191970
1465 Ga0268266_10209886
1466 Ga0268266_10269806
1467 Ga0268266_10280572
1468 Ga0268266_10476697
1469 Ga0268265_10062858
1470 Ga0268265_10097521
1471 Ga0268265_10219681
1472 Ga0268264_10007005
1473 Ga0268264_10030284
1474 Ga0268264_10059906
1475 Ga0268264_10316568
1476 Ga0268264_10454451
1477 Ga0265337_1001644
1478 Ga0265326_10013130
1479 Ga0265318_10000195
1480 Ga0265323_10005862
1481 Ga0265322_10001230
1482 Ga0307515_10000092
1483 Ga0265338_10077849
1484 Ga0265338_10169127
1485 Ga0265330_10009657
1486 Ga0265332_10036575
1487 Ga0265320_10000070
1488 Ga0265325_10005122
1489 Ga0265325_10033045
1490 Ga0265325_10135437
1491 Ga0265329_10000929
1492 Ga0265340_10000108
1493 Ga0265340_10003007
1494 Ga0265339_10034529
1495 Ga0265339_10087891
1496 Ga0265331_10003091
1497 Ga0265316_10006923
1498 Ga0265316_10080444
1499 Ga0265316_10100115
1500 Ga0307513_10125887
1501 Ga0307509_10107579
1502 Ga0307408_100040397
1503 Ga0307408_100040579
1504 Ga0265313_10001878
1505 Ga0265313_10039862
1506 Ga0316575_10001544
1507 Ga0316575_10002566
1508 Ga0316575_10012027
1509 Ga0316575_10052820
1510 Ga0316579_10057577
1511 Ga0316579_10073899
1512 Ga0265314_10000104
1513 Ga0265314_10050435
1514 Ga0265314_10054940
1515 Ga0265342_10000433
1516 Ga0265342_10001030
1517 Ga0316576_10003610
1518 Ga0316576_10006995
1519 Ga0316576_10008823
1520 Ga0316576_10048941
1521 Ga0316576_10052550
1522 Ga0316576_10127808
1523 Ga0316576_10198194
1524 Ga0316578_10002870
1525 Ga0316578_10003237
1526 Ga0316578_10007341
1527 Ga0316578_10161863
1528 Ga0316578_10172301
1529 Ga0307405_10050942
1530 Ga0316577_10021897
1531 Ga0316577_10074270
1532 Ga0307410_10013477
1533 Ga0307410_10017356
1534 Ga0307410_10040082
1535 Ga0307410_10123549
1536 Ga0307410_10299823
1537 Ga0307407_10045299
1538 Ga0307412_10232205
1539 Ga0307409_100085900
1540 Ga0307409_100306417
1541 Ga0307416_100027174
1542 Ga0307416_100056409
1543 Ga0307416_100135889
1544 Ga0307414_10367887
1545 Ga0307411_10038303
1546 Ga0307411_10042060
1547 Ga0307411_10189530
1548 Ga0307411_10235310
1549 Ga0307411_10308563
1550 Ga0307415_100030729
1551 Ga0307415_100240574
1552 Ga0316583_10003577
1553 Ga0316583_10004947
1554 Ga0316583_10008550
1555 Ga0316583_10021390
1556 Ga0316583_10026515
1557 Ga0316583_10035788
1558 Ga0316583_10040292
1559 Ga0316583_10048860
1560 Ga0316585_10008588
1561 Ga0316585_10052164
1562 Ga0316580_10000900
1563 Ga0316580_10001815
1564 Ga0316580_10056442
1565 Ga0316592_1006636
1566 Ga0316588_1040045
1567 Ga0373953_0095547
1568 Ga0373953_0148845
1569 Ga0373955_0073320
1570 Ga0316574_0012270
1571 Ga0316574_0014180
1572 Ga0316574_0027730
1573 Ga0373947_0251800
1574 Ga0373937_0012246
1575 Ga0373937_0043557
1576 Ga0373937_0135290
1577 Ga0373937_0436749
1578 Ga0316582_0016664
1579 Ga0316582_0055855
1580 Ga0316584_0004299
1581 Ga0316584_0004621
1582 Ga0316584_0004631
1583 Ga0373925_0497364
1584 Ga0395899_0017367
1585 Ga0395900_0018883
1586 Ga0395900_0027156
1587 Ga0395900_0124498
1588 Ga0395898_0001959
1589 Ga0395898_0085750
1590 Ga0395898_0154787
1591 Ga0395905_0012005
1592 Ga0316581_0027607
1593 Ga0316581_0034851
1594 Ga0395901_0001045
1595 Ga0395901_0009760
1596 Ga0395901_0015422
1597 Ga0436365_0336651
1598 Ga0436360_0105708
1599 Ga0436361_0740991
1600 Ga0436362_0346855
1601 Ga0439449_0040168
1602 Ga0439435_0049817
1603 Ga0451577_0003018
1604 Ga0451577_0016447
1605 Ga0451577_0102493
1606 Ga0451577_0123283
1607 Ga0451577_0147235
1608 Ga0451577_0247500
1609 Ga0466972_0000009
1610 Ga0453683_0049204
1611 Ga0453683_0204881
1612 Ga0453684_0000220
1613 Ga0453684_0029795
1614 Ga0453684_0120717
1615 Ga0453684_0153749
1616 Ga0453684_0187841
1617 Ga0453684_0349268
1618 Ga0453684_0464060
1619 Ga0453684_0481969
1620 Ga0453684_0518598
1621 Ga0466957_0033462
1622 Ga0451576_0030100
1623 Ga0451576_0031338
1624 Ga0451576_0255094
1625 Ga0495592_0054446
1626 Ga0495629_0105738
1627 Ga0495629_0145201
1628 Ga0495629_0193814
1629 Ga0495651_0000090
1630 Ga0495651_0139011
1631 Ga0495580_0163858
1632 Ga0495662_0009490
1633 Ga0495664_0187534
1634 Ga0495585_0000525
1635 Ga0495618_0038745
1636 Ga0495618_0170044
1637 Ga0495630_0012249
1638 Ga0495630_0361005
1639 Ga0495643_0009334
1640 Ga0495640_0081835
1641 Ga0495640_0163101
1642 Ga0495587_0034140
1643 Ga0495587_0054565
1644 Ga0495587_0094614
1645 Ga0495598_0007722
1646 Ga0495645_0020717
1647 Ga0495667_0005808
1648 Ga0495667_0030382
1649 Ga0495656_0001607
1650 Ga0495656_0118129
1651 Ga0495634_0038710
1652 Ga0495635_0014765
1653 Ga0495657_0002664
1654 Ga0495657_0220443
1655 Ga0495599_0119314
1656 Ga0495599_0189701
1657 Ga0495658_0015758
1658 Ga0495658_0094565
1659 Ga0495658_0138528
1660 Ga0495669_0006927
1661 Ga0495613_0043195
1662 Ga0495670_0124712
1663 Ga0495670_0125443
1664 Ga0495670_0159165
1665 Ga0495600_0027708
1666 Ga0495600_0122883
1667 Ga0495581_0079809
1668 Ga0495604_0006369
1669 Ga0495604_0111219
1670 Ga0495604_0220447
1671 Ga0495636_0000016
1672 Ga0495674_0061772
1673 Ga0495674_0168095
1674 Ga0495680_0001014
1675 Ga0495680_0047511
1676 Ga0495675_0021392
1677 Ga0495675_0051785
1678 Ga0495684_0057463
1679 Ga0495684_0158850
1680 Ga0495602_0092839
1681 Ga0495602_0199484
1682 Ga0496101_0201633
1683 Ga0496102_0065747
1684 Ga0496104_0088030
1685 Ga0496105_0087649
1686 Ga0496106_0061170
1687 Ga0496107_0029175
1688 Ga0496108_0057265
1689 Ga0496108_0143849
1690 Ga0496108_0161989
1691 Ga0496109_0130602
1692 Ga0496109_0476539
1693 Ga0496112_0117533
1694 Ga0496112_0702373
1695 Ga0496114_0058821
1696 Ga0496114_0135287
1697 Ga0501032_0128267
1698 Ga0501033_0045063
1699 Ga0501033_0226804
1700 Ga0501034_0010869
1701 Ga0501034_0011076
1702 Ga0501036_0006252
1703 Ga0501036_0115614
1704 Ga0501037_0014266
1705 Ga0501037_0038256
1706 Ga0501038_0069442
1707 Ga0501038_0090020
1708 Ga0501038_0112482
1709 Ga0501038_0116511
1710 Ga0501038_0247264
1711 Ga0501039_0016664
1712 Ga0501039_0022435
1713 Ga0501039_0084494
1714 Ga0501040_0001939
1715 Ga0501040_0028138
1716 Ga0501042_0014495
1717 Ga0501042_0095252
1718 Ga0501043_0150986
1719 Ga0501043_0166570
1720 Ga0501046_0018198
1721 Ga0501046_0062127
1722 Ga0501046_0158663
1723 Ga0501047_0034670
1724 Ga0501047_0137193
1725 Ga0501048_0009500
1726 Ga0501048_0046381
1727 Ga0501048_0210136
1728 Ga0501067_0000249
1729 Ga0501067_0043941
1730 Ga0501068_0270012
1731 Ga0501070_0209990
1732 Ga0501072_0022119
1733 Ga0501073_0031033
1734 Ga0501074_0059882
1735 Ga0501074_0095165
1736 Ga0501075_0008564
1737 Ga0501075_0093423
1738 Ga0501075_0430622
1739 Ga0501076_0008547
1740 Ga0501076_0033519
1741 Ga0501076_0181864
1742 Ga0501076_0301692
1743 Ga0501076_0305508
1744 Ga0501076_0441263
1745 Ga0501077_0009906
1746 Ga0501198_012893
1747 Ga0501202_029143
1748 Ga0501217_000055
1749 Ga0501222_004506
1750 Ga0501223_001899
1751 Ga0501233_004326
1752 Ga0501243_000975
1753 Ga0501259_001374
1754 Ga0501221_000337
1755 Ga0501225_0001107
1756 Ga0501225_0001987
1757 Ga0501245_000875
1758 Ga0501079_0010716
1759 Ga0501079_0060330
1760 Ga0501079_0146628
1761 Ga0501079_0158162
1762 Ga0501079_0188864
1763 Ga0501080_0004871
1764 Ga0501080_0014784
1765 Ga0501080_0064218
1766 Ga0501080_0395661
1767 Ga0501081_0007334
1768 Ga0501081_0012374
1769 Ga0501081_0135937
1770 Ga0501083_0006560
1771 Ga0501083_0062118
1772 Ga0501083_0267033
1773 Ga0501263_007208
1774 Ga0501268_023281
1775 Ga0501035_0035768
1776 Ga0501035_0133458
1777 Ga0501044_0002454
1778 Ga0501044_0044779
1779 Ga0501044_0101639
1780 Ga0501044_0250010
1781 Ga0501045_0002074
1782 Ga0501045_0039920
1783 Ga0501045_0043711
1784 Ga0501045_0051695
1785 nmdc:mga05p37_142569_c1
1786 nmdc:mga05p37_148017_c1
1787 nmdc:mga05p37_462788_c1
1788 nmdc:mga05p37_50876_c1
1789 nmdc:mga05p37_561131_c1
1790 nmdc:mga09592_275417_c1
1791 nmdc:mga09592_40794_c1
1792 nmdc:mga09592_72684_c1
1793 nmdc:mga09592_87369_c1
1794 nmdc:mga09592_99597_c1
1795 nmdc:mga0qj67_12488_c1
1796 nmdc:mga0qj67_2698_c1
1797 nmdc:mga0qj67_32779_c1
1798 nmdc:mga0qj67_53056_c1
1799 nmdc:mga06r32_354305_c1
1800 nmdc:mga06r32_418705_c1
1801 nmdc:mga06r32_47840_c1
1802 nmdc:mga06r32_54656_c1
1803 nmdc:mga06r32_55517_c1
1804 nmdc:mga06r32_8661_c1
1805 nmdc:mga08y16_115285_c1
1806 nmdc:mga08y16_22_c1
1807 nmdc:mga0rr50_145607_c2
1808 nmdc:mga08x19_185705_c1
1809 nmdc:mga0a205_119095_c1
1810 nmdc:mga0a205_90561_c1
1811 Ga0495601_0045849
1812 Ga0495601_0084683
1813 Ga0495595_0010711
1814 Ga0495619_0005570
1815 Ga0495619_0023411
1816 Ga0500644_0006740
1817 Ga0500583_0000027
1818 Ga0500583_0000598
1819 Ga0500566_0003670
1820 Ga0500589_038939
1821 Ga0500603_003764
1822 Ga0500603_038290
1823 Ga0501084_0159099
1824 Ga0501084_0214105
1825 Ga0501082_0004906
1826 Ga0501082_0015866
1827 Ga0501082_0042729
1828 Ga0530510_0002730
1829 Ga0530510_0033484
1830 Ga0530510_0086070
1831 Ga0530510_0104328
1832 Ga0530510_0138981
1833 Ga0530510_0140894
1834 2644016548
1835 2644176468
1836 2738725136

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

35

280

0.89

PF13460

NAD_binding_10

NAD(P)H-binding

39

197

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxf-assembly2.cif.gz_B crystal structure of the hscarg r37a mutant 0.897 4 301
3dxf-assembly2.cif.gz_B crystal structure of the hscarg r37a mutant 0.8909 4 301
2wmd-assembly1.cif.gz_A-2 crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid 0.8858 4 304
3dxf-assembly1.cif.gz_A crystal structure of the hscarg r37a mutant 0.8842 4 301
2wmd-assembly1.cif.gz_A-2 crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid 0.883 4 304
ID Description Score Start End Superfamily
3dxfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8415 4 287 3.40.50.720
3dxfA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8404 156 301 3.90.25.10
5f5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8348 3 305 3.40.50.720
3dxfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8331 4 287 3.40.50.720
5f5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8321 3 305 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A533XDF9-F1-model_v4 NmrA/HSCARG family protein 0.9939 137 305
AF-A0A524LHP2-F1-model_v4 NmrA/HSCARG family protein 0.9934 60 305
AF-A0A7Y2CQ11-F1-model_v4 NmrA family NAD(P)-binding protein 0.9864 178 305
AF-A0A838NQV1-F1-model_v4 NmrA family NAD(P)-binding protein 0.9861 165 305
AF-A0A524LHP2-F1-model_v4 NmrA/HSCARG family protein 0.9854 60 305

Map