F485666
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 918 | 339 | 1836 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300005834|Ga0068851_10016011|Ga0068851_100160111 |
| Length | 344 |
| Sequence | MKILKTFSLLFHLTIFVSFKTFNHRSTFMTQKKIIAVFGATGAQGGGLARAILSDPHSEFSVRVVTRAVHSDKAKALEAMGAELVNADVDNPKEIRKALQGAYGAFFVTFFWAHYSPELENKHAEDFAKAAKEAGLKHVIWSTLEDTRKWYPLDDDRMPTLHDNYKVPHFDGKGASDHYFTDNGVPTTFLMASFYWENMIYFGMGPKRGDDGKLTFTLPMADKKMGGIGAEDIGRCAYGIFKKGTELVGKYVGIAGEQLTGEQMAHHLSKSLGEEVKYNAITPATFRSFGFPGADDLGNMFQFYAEQEKYLDDARDPKISKQLNPQLKNFDAWLKDNAKLIPLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 177 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 187 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 191 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 203 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 204 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 205 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 213 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 229 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 299 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 300 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 301 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 302 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 305 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 306 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 307 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 331 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 333 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 334 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 337 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 338 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 339 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.76 |
| Nodule | 0 |
| Rhizoplane | 1.63 |
| Rhizosphere | 96.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068851_10016011 | 3300005834 | Unclassified | 3581 |
| 2 | JGI24751J29686_10000335 | 3300002459 | Bacteria | 17022 |
| 3 | JGI25406J46586_10023135 | 3300003203 | Bacteria | 2460 |
| 4 | rootH1_10004495 | 3300003323 | Bacteria | 36666 |
| 5 | rootH1_10155694 | 3300003323 | Bacteria | 1652 |
| 6 | Ga0065714_10019946 | 3300005288 | Bacteria | 1173 |
| 7 | Ga0065712_10000781 | 3300005290 | Bacteria | 14555 |
| 8 | Ga0065715_10155878 | 3300005293 | Bacteria | 1670 |
| 9 | Ga0065707_10091080 | 3300005295 | Bacteria | 4010 |
| 10 | Ga0065707_10118341 | 3300005295 | Bacteria | 2188 |
| 11 | Ga0070658_10001806 | 3300005327 | Bacteria | 17989 |
| 12 | Ga0070676_10015570 | 3300005328 | Bacteria | 4196 |
| 13 | Ga0070676_10113135 | 3300005328 | Bacteria | 1693 |
| 14 | Ga0070683_100005550 | 3300005329 | Bacteria | 10535 |
| 15 | Ga0070683_100020750 | 3300005329 | Bacteria | 5852 |
| 16 | Ga0070683_100132805 | 3300005329 | Bacteria | 2356 |
| 17 | Ga0070683_100236805 | 3300005329 | Bacteria | 1736 |
| 18 | Ga0070690_100003963 | 3300005330 | Bacteria | 8179 |
| 19 | Ga0070690_100040289 | 3300005330 | Unclassified | 2954 |
| 20 | Ga0070670_100012132 | 3300005331 | Bacteria | 7371 |
| 21 | Ga0070670_100018444 | 3300005331 | Bacteria | 5987 |
| 22 | Ga0070670_100025152 | 3300005331 | Bacteria | 5122 |
| 23 | Ga0070670_100052931 | 3300005331 | Bacteria | 3487 |
| 24 | Ga0070670_100064587 | 3300005331 | Bacteria | 3140 |
| 25 | Ga0070670_100083934 | 3300005331 | Bacteria | 2737 |
| 26 | Ga0070670_100206539 | 3300005331 | Unclassified | 1707 |
| 27 | Ga0070670_100248776 | 3300005331 | Bacteria | 1548 |
| 28 | Ga0070670_100251733 | 3300005331 | Bacteria | 1539 |
| 29 | Ga0070670_100302109 | 3300005331 | Bacteria | 1400 |
| 30 | Ga0068869_100024944 | 3300005334 | Bacteria | 4147 |
| 31 | Ga0068869_100066941 | 3300005334 | Bacteria | 2648 |
| 32 | Ga0068869_100087483 | 3300005334 | Unclassified | 2337 |
| 33 | Ga0068869_100386438 | 3300005334 | Bacteria | 1148 |
| 34 | Ga0070666_10001316 | 3300005335 | Bacteria | 15045 |
| 35 | Ga0070666_10005429 | 3300005335 | Bacteria | 7817 |
| 36 | Ga0070666_10021319 | 3300005335 | Bacteria | 4200 |
| 37 | Ga0070666_10029682 | 3300005335 | Bacteria | 3597 |
| 38 | Ga0070666_10089305 | 3300005335 | Unclassified | 2115 |
| 39 | Ga0070680_100006966 | 3300005336 | Bacteria | 8616 |
| 40 | Ga0070680_100043075 | 3300005336 | Bacteria | 3665 |
| 41 | Ga0070680_100425293 | 3300005336 | Bacteria | 1133 |
| 42 | Ga0070682_100006403 | 3300005337 | Bacteria | 6613 |
| 43 | Ga0070682_100095781 | 3300005337 | Unclassified | 1950 |
| 44 | Ga0068868_100008292 | 3300005338 | Bacteria | 7442 |
| 45 | Ga0068868_100015287 | 3300005338 | Bacteria | 5675 |
| 46 | Ga0068868_100158765 | 3300005338 | Bacteria | 1866 |
| 47 | Ga0070660_100031268 | 3300005339 | Bacteria | 3997 |
| 48 | Ga0070660_100192229 | 3300005339 | Bacteria | 1653 |
| 49 | Ga0070689_100031031 | 3300005340 | Bacteria | 4060 |
| 50 | Ga0070689_100073946 | 3300005340 | Bacteria | 2666 |
| 51 | Ga0070689_100174977 | 3300005340 | Bacteria | 1740 |
| 52 | Ga0070687_100001102 | 3300005343 | Bacteria | 9291 |
| 53 | Ga0070687_100059306 | 3300005343 | Unclassified | 2014 |
| 54 | Ga0070661_100009793 | 3300005344 | Bacteria | 6645 |
| 55 | Ga0070661_100013569 | 3300005344 | Bacteria | 5721 |
| 56 | Ga0070661_100085471 | 3300005344 | Bacteria | 2331 |
| 57 | Ga0070661_100142381 | 3300005344 | Bacteria | 1808 |
| 58 | Ga0070668_100000951 | 3300005347 | Bacteria | 20217 |
| 59 | Ga0070668_100023794 | 3300005347 | Bacteria | 4636 |
| 60 | Ga0070668_100113597 | 3300005347 | Bacteria | 2158 |
| 61 | Ga0070668_100271460 | 3300005347 | Bacteria | 1414 |
| 62 | Ga0070669_100037947 | 3300005353 | Bacteria | 3496 |
| 63 | Ga0070669_100053889 | 3300005353 | Bacteria | 2945 |
| 64 | Ga0070669_100092951 | 3300005353 | Bacteria | 2265 |
| 65 | Ga0070669_100210329 | 3300005353 | Bacteria | 1534 |
| 66 | Ga0070669_100242384 | 3300005353 | Bacteria | 1433 |
| 67 | Ga0070675_100008620 | 3300005354 | Bacteria | 7918 |
| 68 | Ga0070675_100011460 | 3300005354 | Bacteria | 6942 |
| 69 | Ga0070675_100033681 | 3300005354 | Unclassified | 4154 |
| 70 | Ga0070675_100099784 | 3300005354 | Bacteria | 2445 |
| 71 | Ga0070675_100116193 | 3300005354 | Bacteria | 2269 |
| 72 | Ga0070675_100340387 | 3300005354 | Bacteria | 1328 |
| 73 | Ga0070671_100011830 | 3300005355 | Bacteria | 7020 |
| 74 | Ga0070671_100116251 | 3300005355 | Bacteria | 2249 |
| 75 | Ga0070671_100380375 | 3300005355 | Bacteria | 1206 |
| 76 | Ga0070674_100007915 | 3300005356 | Bacteria | 6291 |
| 77 | Ga0070674_100069510 | 3300005356 | Unclassified | 2484 |
| 78 | Ga0070674_100149299 | 3300005356 | Bacteria | 1762 |
| 79 | Ga0070673_100002269 | 3300005364 | Bacteria | 11656 |
| 80 | Ga0070673_100091941 | 3300005364 | Bacteria | 2481 |
| 81 | Ga0070673_100113975 | 3300005364 | Unclassified | 2246 |
| 82 | Ga0070673_100165222 | 3300005364 | Bacteria | 1885 |
| 83 | Ga0070673_100315594 | 3300005364 | Bacteria | 1379 |
| 84 | Ga0070688_100032273 | 3300005365 | Unclassified | 3156 |
| 85 | Ga0070688_100037566 | 3300005365 | Bacteria | 2951 |
| 86 | Ga0070688_100381889 | 3300005365 | Bacteria | 1038 |
| 87 | Ga0070659_100025517 | 3300005366 | Bacteria | 4540 |
| 88 | Ga0070659_100025984 | 3300005366 | Bacteria | 4504 |
| 89 | Ga0070659_100118369 | 3300005366 | Bacteria | 2143 |
| 90 | Ga0070659_100181859 | 3300005366 | Bacteria | 1726 |
| 91 | Ga0070667_100005498 | 3300005367 | Bacteria | 10581 |
| 92 | Ga0070667_100005708 | 3300005367 | Bacteria | 10398 |
| 93 | Ga0070667_100137970 | 3300005367 | Bacteria | 2133 |
| 94 | Ga0070667_100178526 | 3300005367 | Bacteria | 1877 |
| 95 | Ga0070667_100205033 | 3300005367 | Bacteria | 1750 |
| 96 | Ga0070667_100218193 | 3300005367 | Unclassified | 1697 |
| 97 | Ga0070667_100228292 | 3300005367 | Bacteria | 1659 |
| 98 | Ga0070667_100264626 | 3300005367 | Bacteria | 1540 |
| 99 | Ga0070667_100320443 | 3300005367 | Bacteria | 1399 |
| 100 | Ga0070708_100282992 | 3300005445 | Bacteria | 1561 |
| 101 | Ga0070663_100119781 | 3300005455 | Bacteria | 1987 |
| 102 | Ga0070663_100259117 | 3300005455 | Bacteria | 1379 |
| 103 | Ga0070678_100095547 | 3300005456 | Unclassified | 2290 |
| 104 | Ga0070662_100226440 | 3300005457 | Bacteria | 1494 |
| 105 | Ga0070662_100228348 | 3300005457 | Bacteria | 1488 |
| 106 | Ga0070662_100262169 | 3300005457 | Bacteria | 1392 |
| 107 | Ga0070681_10073654 | 3300005458 | Bacteria | 3377 |
| 108 | Ga0070681_10105715 | 3300005458 | Bacteria | 2757 |
| 109 | Ga0070681_10123298 | 3300005458 | Bacteria | 2524 |
| 110 | Ga0070681_10127861 | 3300005458 | Bacteria | 2474 |
| 111 | Ga0070681_10257086 | 3300005458 | Bacteria | 1658 |
| 112 | Ga0068867_100116337 | 3300005459 | Unclassified | 2060 |
| 113 | Ga0068867_100450975 | 3300005459 | Bacteria | 1096 |
| 114 | Ga0070685_10007265 | 3300005466 | Bacteria | 5664 |
| 115 | Ga0070685_10033897 | 3300005466 | Unclassified | 2872 |
| 116 | Ga0070685_10044525 | 3300005466 | Bacteria | 2541 |
| 117 | Ga0070706_100265778 | 3300005467 | Unclassified | 1601 |
| 118 | Ga0070707_100000032 | 3300005468 | Bacteria | 118776 |
| 119 | Ga0070698_100001998 | 3300005471 | Bacteria | 22644 |
| 120 | Ga0070698_100003211 | 3300005471 | Bacteria | 18007 |
| 121 | Ga0070699_100119960 | 3300005518 | Unclassified | 2312 |
| 122 | Ga0070699_100259085 | 3300005518 | Unclassified | 1555 |
| 123 | Ga0070679_100002339 | 3300005530 | Bacteria | 17152 |
| 124 | Ga0070679_100004116 | 3300005530 | Bacteria | 13409 |
| 125 | Ga0070679_100013309 | 3300005530 | Bacteria | 7876 |
| 126 | Ga0070679_100016964 | 3300005530 | Bacteria | 7039 |
| 127 | Ga0070679_100024167 | 3300005530 | Bacteria | 5954 |
| 128 | Ga0070679_100076615 | 3300005530 | Bacteria | 3333 |
| 129 | Ga0070679_100525512 | 3300005530 | Bacteria | 1127 |
| 130 | Ga0070684_100012839 | 3300005535 | Bacteria | 6729 |
| 131 | Ga0070684_100411356 | 3300005535 | Bacteria | 1248 |
| 132 | Ga0068853_100011024 | 3300005539 | Bacteria | 7331 |
| 133 | Ga0068853_100045604 | 3300005539 | Bacteria | 3755 |
| 134 | Ga0068853_100131745 | 3300005539 | Bacteria | 2239 |
| 135 | Ga0068853_100216381 | 3300005539 | Bacteria | 1748 |
| 136 | Ga0068853_100412894 | 3300005539 | Bacteria | 1265 |
| 137 | Ga0070672_100005846 | 3300005543 | Bacteria | 8207 |
| 138 | Ga0070672_100030941 | 3300005543 | Bacteria | 4026 |
| 139 | Ga0070672_100047244 | 3300005543 | Unclassified | 3339 |
| 140 | Ga0070672_100090118 | 3300005543 | Bacteria | 2472 |
| 141 | Ga0070672_100106674 | 3300005543 | Bacteria | 2279 |
| 142 | Ga0070672_100256135 | 3300005543 | Unclassified | 1475 |
| 143 | Ga0070686_100004512 | 3300005544 | Bacteria | 7676 |
| 144 | Ga0070686_100005546 | 3300005544 | Bacteria | 6981 |
| 145 | Ga0070686_100042469 | 3300005544 | Bacteria | 2848 |
| 146 | Ga0070693_100012709 | 3300005547 | Bacteria | 4268 |
| 147 | Ga0070665_100051291 | 3300005548 | Bacteria | 4138 |
| 148 | Ga0070665_100186816 | 3300005548 | Unclassified | 2073 |
| 149 | Ga0070665_100258668 | 3300005548 | Bacteria | 1742 |
| 150 | Ga0070665_100304326 | 3300005548 | Bacteria | 1597 |
| 151 | Ga0070665_100523045 | 3300005548 | Bacteria | 1198 |
| 152 | Ga0068855_100000014 | 3300005563 | Bacteria | 232720 |
| 153 | Ga0068855_100043250 | 3300005563 | Bacteria | 5336 |
| 154 | Ga0068855_100173463 | 3300005563 | Bacteria | 2441 |
| 155 | Ga0068855_100213568 | 3300005563 | Bacteria | 2167 |
| 156 | Ga0070664_100000492 | 3300005564 | Bacteria | 29880 |
| 157 | Ga0070664_100022854 | 3300005564 | Bacteria | 5158 |
| 158 | Ga0070664_100139951 | 3300005564 | Bacteria | 2130 |
| 159 | Ga0070664_100195286 | 3300005564 | Bacteria | 1804 |
| 160 | Ga0068857_100032403 | 3300005577 | Bacteria | 4620 |
| 161 | Ga0068857_100034845 | 3300005577 | Bacteria | 4454 |
| 162 | Ga0068857_100266590 | 3300005577 | Bacteria | 1573 |
| 163 | Ga0068857_100286052 | 3300005577 | Unclassified | 1517 |
| 164 | Ga0068857_100539105 | 3300005577 | Unclassified | 1098 |
| 165 | Ga0068854_100064759 | 3300005578 | Bacteria | 2656 |
| 166 | Ga0068854_100085130 | 3300005578 | Bacteria | 2341 |
| 167 | Ga0068854_100127144 | 3300005578 | Bacteria | 1942 |
| 168 | Ga0068854_100235901 | 3300005578 | Bacteria | 1454 |
| 169 | Ga0068854_100360405 | 3300005578 | Bacteria | 1193 |
| 170 | Ga0068856_100089457 | 3300005614 | Bacteria | 3062 |
| 171 | Ga0068856_100395590 | 3300005614 | Bacteria | 1401 |
| 172 | Ga0068852_100023253 | 3300005616 | Bacteria | 4985 |
| 173 | Ga0068852_100046341 | 3300005616 | Bacteria | 3704 |
| 174 | Ga0068859_100006459 | 3300005617 | Bacteria | 11893 |
| 175 | Ga0068859_100017217 | 3300005617 | Bacteria | 7257 |
| 176 | Ga0068859_100114918 | 3300005617 | Bacteria | 2756 |
| 177 | Ga0068859_100180101 | 3300005617 | Bacteria | 2196 |
| 178 | Ga0068859_100341549 | 3300005617 | Bacteria | 1591 |
| 179 | Ga0068864_100000781 | 3300005618 | Bacteria | 26753 |
| 180 | Ga0068864_100008888 | 3300005618 | Bacteria | 8282 |
| 181 | Ga0068864_100051164 | 3300005618 | Bacteria | 3557 |
| 182 | Ga0068866_10011514 | 3300005718 | Bacteria | 3829 |
| 183 | Ga0068861_100029438 | 3300005719 | Bacteria | 4018 |
| 184 | Ga0068861_100093705 | 3300005719 | Unclassified | 2375 |
| 185 | Ga0068861_100339685 | 3300005719 | Unclassified | 1314 |
| 186 | Ga0068861_100373493 | 3300005719 | Bacteria | 1257 |
| 187 | Ga0068851_10079402 | 3300005834 | Unclassified | 1711 |
| 188 | Ga0068863_100000221 | 3300005841 | Bacteria | 60285 |
| 189 | Ga0068863_100022837 | 3300005841 | Bacteria | 5977 |
| 190 | Ga0068863_100126403 | 3300005841 | Bacteria | 2439 |
| 191 | Ga0068863_100186873 | 3300005841 | Unclassified | 1990 |
| 192 | Ga0068858_100013096 | 3300005842 | Bacteria | 7821 |
| 193 | Ga0068858_100026396 | 3300005842 | Bacteria | 5398 |
| 194 | Ga0068858_100082124 | 3300005842 | Unclassified | 2995 |
| 195 | Ga0068860_100006424 | 3300005843 | Bacteria | 11803 |
| 196 | Ga0068860_100018722 | 3300005843 | Bacteria | 6730 |
| 197 | Ga0068860_100188187 | 3300005843 | Unclassified | 1997 |
| 198 | Ga0068860_100302272 | 3300005843 | Bacteria | 1568 |
| 199 | Ga0068860_100378000 | 3300005843 | Bacteria | 1398 |
| 200 | Ga0068862_100011917 | 3300005844 | Bacteria | 7182 |
| 201 | Ga0068862_100221636 | 3300005844 | Bacteria | 1712 |
| 202 | Ga0068862_100288606 | 3300005844 | Bacteria | 1506 |
| 203 | Ga0081455_10007011 | 3300005937 | Bacteria | 11975 |
| 204 | Ga0081455_10093709 | 3300005937 | Unclassified | 2427 |
| 205 | Ga0081455_10285818 | 3300005937 | Bacteria | 1189 |
| 206 | Ga0081539_10004015 | 3300005985 | Bacteria | 16914 |
| 207 | Ga0081539_10004448 | 3300005985 | Bacteria | 15475 |
| 208 | Ga0070715_10132209 | 3300006163 | Unclassified | 1202 |
| 209 | Ga0070716_100059682 | 3300006173 | Bacteria | 2200 |
| 210 | Ga0097621_100000554 | 3300006237 | Bacteria | 26269 |
| 211 | Ga0097621_100019149 | 3300006237 | Bacteria | 5247 |
| 212 | Ga0097621_100021327 | 3300006237 | Bacteria | 5009 |
| 213 | Ga0097621_100021395 | 3300006237 | Bacteria | 5002 |
| 214 | Ga0097621_100021757 | 3300006237 | Bacteria | 4968 |
| 215 | Ga0097621_100039645 | 3300006237 | Bacteria | 3784 |
| 216 | Ga0097621_100062570 | 3300006237 | Unclassified | 3056 |
| 217 | Ga0068871_100001750 | 3300006358 | Bacteria | 14634 |
| 218 | Ga0068871_100002575 | 3300006358 | Bacteria | 12387 |
| 219 | Ga0068871_100003879 | 3300006358 | Bacteria | 10310 |
| 220 | Ga0068871_100023121 | 3300006358 | Bacteria | 4801 |
| 221 | Ga0068871_100037217 | 3300006358 | Bacteria | 3880 |
| 222 | Ga0068871_100069994 | 3300006358 | Bacteria | 2883 |
| 223 | Ga0068871_100107602 | 3300006358 | Bacteria | 2342 |
| 224 | Ga0075428_100064824 | 3300006844 | Unclassified | 4001 |
| 225 | Ga0075428_100148569 | 3300006844 | Bacteria | 2547 |
| 226 | Ga0075428_100151035 | 3300006844 | Unclassified | 2523 |
| 227 | Ga0075430_100005824 | 3300006846 | Bacteria | 10398 |
| 228 | Ga0075430_100007274 | 3300006846 | Bacteria | 9345 |
| 229 | Ga0075431_100002400 | 3300006847 | Bacteria | 18025 |
| 230 | Ga0075431_100095188 | 3300006847 | Bacteria | 3074 |
| 231 | Ga0075431_100134669 | 3300006847 | Bacteria | 2547 |
| 232 | Ga0075431_100243672 | 3300006847 | Bacteria | 1828 |
| 233 | Ga0075431_100363120 | 3300006847 | Bacteria | 1454 |
| 234 | Ga0075431_100431028 | 3300006847 | Bacteria | 1316 |
| 235 | Ga0075433_10224420 | 3300006852 | Bacteria | 1668 |
| 236 | Ga0075433_10252385 | 3300006852 | Bacteria | 1565 |
| 237 | Ga0075434_100063233 | 3300006871 | Bacteria | 3684 |
| 238 | Ga0075429_100050163 | 3300006880 | Bacteria | 3631 |
| 239 | Ga0075429_100091904 | 3300006880 | Bacteria | 2647 |
| 240 | Ga0075429_100094474 | 3300006880 | Bacteria | 2608 |
| 241 | Ga0075429_100108399 | 3300006880 | Unclassified | 2427 |
| 242 | Ga0068865_100056511 | 3300006881 | Bacteria | 2735 |
| 243 | Ga0068865_100124073 | 3300006881 | Bacteria | 1925 |
| 244 | Ga0068865_100260300 | 3300006881 | Bacteria | 1373 |
| 245 | Ga0097620_100006459 | 3300006931 | Bacteria | 11893 |
| 246 | Ga0097620_100017217 | 3300006931 | Bacteria | 7257 |
| 247 | Ga0097620_100114917 | 3300006931 | Bacteria | 2756 |
| 248 | Ga0097620_100180104 | 3300006931 | Bacteria | 2196 |
| 249 | Ga0097620_100309232 | 3300006931 | Bacteria | 1674 |
| 250 | Ga0097620_100341549 | 3300006931 | Bacteria | 1591 |
| 251 | Ga0099794_10022038 | 3300007265 | Bacteria | 2901 |
| 252 | Ga0105240_10028359 | 3300009093 | Bacteria | 7314 |
| 253 | Ga0105240_10043874 | 3300009093 | Bacteria | 5686 |
| 254 | Ga0105240_10064765 | 3300009093 | Bacteria | 4540 |
| 255 | Ga0105240_10169230 | 3300009093 | Unclassified | 2589 |
| 256 | Ga0105240_10244183 | 3300009093 | Bacteria | 2080 |
| 257 | Ga0111539_10000536 | 3300009094 | Bacteria | 48260 |
| 258 | Ga0111539_10031210 | 3300009094 | Bacteria | 6475 |
| 259 | Ga0111539_10076633 | 3300009094 | Bacteria | 3937 |
| 260 | Ga0111539_10277409 | 3300009094 | Bacteria | 1951 |
| 261 | Ga0111539_10489102 | 3300009094 | Unclassified | 1433 |
| 262 | Ga0111539_10675418 | 3300009094 | Unclassified | 1203 |
| 263 | Ga0105245_10001786 | 3300009098 | Bacteria | 19580 |
| 264 | Ga0105245_10043077 | 3300009098 | Bacteria | 4027 |
| 265 | Ga0105247_10001541 | 3300009101 | Bacteria | 16441 |
| 266 | Ga0114129_10014027 | 3300009147 | Bacteria | 11414 |
| 267 | Ga0114129_10093237 | 3300009147 | Bacteria | 4171 |
| 268 | Ga0114129_10176339 | 3300009147 | Bacteria | 2911 |
| 269 | Ga0114129_10194413 | 3300009147 | Unclassified | 2752 |
| 270 | Ga0114129_10381086 | 3300009147 | Bacteria | 1863 |
| 271 | Ga0114129_10558725 | 3300009147 | Bacteria | 1487 |
| 272 | Ga0105243_10232472 | 3300009148 | Bacteria | 1636 |
| 273 | Ga0105241_10004396 | 3300009174 | Bacteria | 10420 |
| 274 | Ga0105241_10166884 | 3300009174 | Bacteria | 1815 |
| 275 | Ga0105242_10003021 | 3300009176 | Bacteria | 13152 |
| 276 | Ga0105242_10006100 | 3300009176 | Bacteria | 9291 |
| 277 | Ga0105242_10022569 | 3300009176 | Bacteria | 4952 |
| 278 | Ga0105242_10069023 | 3300009176 | Unclassified | 2927 |
| 279 | Ga0105242_10098613 | 3300009176 | Bacteria | 2471 |
| 280 | Ga0105248_10000048 | 3300009177 | Bacteria | 154635 |
| 281 | Ga0105248_10015185 | 3300009177 | Bacteria | 8486 |
| 282 | Ga0105248_10057845 | 3300009177 | Bacteria | 4353 |
| 283 | Ga0105248_10185968 | 3300009177 | Bacteria | 2341 |
| 284 | Ga0105248_10442529 | 3300009177 | Bacteria | 1464 |
| 285 | Ga0105248_10448313 | 3300009177 | Bacteria | 1454 |
| 286 | Ga0105237_10009302 | 3300009545 | Bacteria | 10530 |
| 287 | Ga0105237_10093453 | 3300009545 | Unclassified | 2997 |
| 288 | Ga0105238_10459933 | 3300009551 | Bacteria | 1270 |
| 289 | Ga0105249_10013169 | 3300009553 | Bacteria | 7297 |
| 290 | Ga0105249_10021095 | 3300009553 | Bacteria | 5830 |
| 291 | Ga0105249_10058553 | 3300009553 | Bacteria | 3531 |
| 292 | Ga0105249_10060141 | 3300009553 | Unclassified | 3485 |
| 293 | Ga0105239_10012617 | 3300010375 | Bacteria | 9403 |
| 294 | Ga0105239_10205151 | 3300010375 | Bacteria | 2209 |
| 295 | Ga0105246_10042738 | 3300011119 | Bacteria | 3070 |
| 296 | Ga0157373_10007196 | 3300013100 | Bacteria | 8299 |
| 297 | Ga0157373_10025876 | 3300013100 | Bacteria | 4240 |
| 298 | Ga0157373_10217816 | 3300013100 | Bacteria | 1347 |
| 299 | Ga0157373_10341215 | 3300013100 | Bacteria | 1068 |
| 300 | Ga0157371_10015347 | 3300013102 | Bacteria | 5749 |
| 301 | Ga0157371_10030981 | 3300013102 | Bacteria | 3855 |
| 302 | Ga0157371_10079361 | 3300013102 | Bacteria | 2325 |
| 303 | Ga0157371_10185743 | 3300013102 | Bacteria | 1487 |
| 304 | Ga0157370_10005480 | 3300013104 | Bacteria | 14234 |
| 305 | Ga0157370_10011127 | 3300013104 | Bacteria | 9432 |
| 306 | Ga0157370_10013214 | 3300013104 | Bacteria | 8513 |
| 307 | Ga0157370_10029120 | 3300013104 | Bacteria | 5425 |
| 308 | Ga0157370_10102080 | 3300013104 | Bacteria | 2686 |
| 309 | Ga0157370_10121961 | 3300013104 | Bacteria | 2434 |
| 310 | Ga0157370_10248094 | 3300013104 | Bacteria | 1647 |
| 311 | Ga0157370_10509787 | 3300013104 | Bacteria | 1104 |
| 312 | Ga0157369_10186487 | 3300013105 | Bacteria | 2181 |
| 313 | Ga0157369_10305621 | 3300013105 | Bacteria | 1654 |
| 314 | Ga0157374_10005430 | 3300013296 | Bacteria | 10708 |
| 315 | Ga0157374_10022899 | 3300013296 | Bacteria | 5579 |
| 316 | Ga0157374_10024433 | 3300013296 | Bacteria | 5419 |
| 317 | Ga0157374_10053519 | 3300013296 | Bacteria | 3763 |
| 318 | Ga0157374_10136846 | 3300013296 | Bacteria | 2375 |
| 319 | Ga0157374_10161837 | 3300013296 | Bacteria | 2180 |
| 320 | Ga0157374_10162036 | 3300013296 | Unclassified | 2178 |
| 321 | Ga0157374_10196769 | 3300013296 | Bacteria | 1973 |
| 322 | Ga0157374_10208221 | 3300013296 | Bacteria | 1917 |
| 323 | Ga0157378_10000437 | 3300013297 | Bacteria | 40470 |
| 324 | Ga0157378_10001754 | 3300013297 | Bacteria | 19460 |
| 325 | Ga0157378_10002581 | 3300013297 | Bacteria | 16118 |
| 326 | Ga0157378_10003439 | 3300013297 | Bacteria | 14041 |
| 327 | Ga0157378_10087958 | 3300013297 | Bacteria | 2819 |
| 328 | Ga0157378_10091891 | 3300013297 | Bacteria | 2760 |
| 329 | Ga0157378_10284743 | 3300013297 | Unclassified | 1594 |
| 330 | Ga0163162_10000523 | 3300013306 | Bacteria | 35637 |
| 331 | Ga0163162_10005980 | 3300013306 | Bacteria | 11778 |
| 332 | Ga0163162_10124903 | 3300013306 | Unclassified | 2679 |
| 333 | Ga0163162_10286741 | 3300013306 | Bacteria | 1778 |
| 334 | Ga0163162_10635131 | 3300013306 | Bacteria | 1192 |
| 335 | Ga0157372_10015460 | 3300013307 | Bacteria | 8181 |
| 336 | Ga0157372_10055142 | 3300013307 | Bacteria | 4437 |
| 337 | Ga0157372_10067718 | 3300013307 | Bacteria | 4013 |
| 338 | Ga0157372_10192125 | 3300013307 | Bacteria | 2364 |
| 339 | Ga0157372_10334192 | 3300013307 | Bacteria | 1765 |
| 340 | Ga0157372_10479819 | 3300013307 | Bacteria | 1450 |
| 341 | Ga0157372_10651318 | 3300013307 | Unclassified | 1227 |
| 342 | Ga0157375_10000262 | 3300013308 | Bacteria | 47771 |
| 343 | Ga0157375_10001301 | 3300013308 | Bacteria | 21494 |
| 344 | Ga0157375_10035272 | 3300013308 | Bacteria | 4773 |
| 345 | Ga0157375_10122921 | 3300013308 | Bacteria | 2707 |
| 346 | Ga0157375_10260729 | 3300013308 | Bacteria | 1895 |
| 347 | Ga0157375_10310801 | 3300013308 | Bacteria | 1740 |
| 348 | Ga0157375_10392539 | 3300013308 | Bacteria | 1554 |
| 349 | Ga0157375_10438695 | 3300013308 | Unclassified | 1472 |
| 350 | Ga0157375_10640445 | 3300013308 | Bacteria | 1220 |
| 351 | Ga0163163_10001342 | 3300014325 | Bacteria | 20762 |
| 352 | Ga0163163_10008192 | 3300014325 | Bacteria | 9270 |
| 353 | Ga0163163_10008479 | 3300014325 | Bacteria | 9135 |
| 354 | Ga0163163_10108304 | 3300014325 | Bacteria | 2806 |
| 355 | Ga0163163_10116640 | 3300014325 | Bacteria | 2701 |
| 356 | Ga0163163_10232956 | 3300014325 | Bacteria | 1891 |
| 357 | Ga0163163_10378901 | 3300014325 | Unclassified | 1472 |
| 358 | Ga0163163_10435545 | 3300014325 | Bacteria | 1370 |
| 359 | Ga0157380_10010459 | 3300014326 | Bacteria | 6675 |
| 360 | Ga0157380_10035103 | 3300014326 | Bacteria | 3872 |
| 361 | Ga0157380_10050034 | 3300014326 | Unclassified | 3299 |
| 362 | Ga0157380_10127011 | 3300014326 | Bacteria | 2169 |
| 363 | Ga0157380_10205732 | 3300014326 | Bacteria | 1750 |
| 364 | Ga0157380_10247718 | 3300014326 | Unclassified | 1611 |
| 365 | Ga0157380_10426794 | 3300014326 | Bacteria | 1266 |
| 366 | Ga0157377_10016681 | 3300014745 | Unclassified | 3782 |
| 367 | Ga0157377_10030983 | 3300014745 | Bacteria | 2903 |
| 368 | Ga0157377_10083580 | 3300014745 | Bacteria | 1871 |
| 369 | Ga0157379_10000264 | 3300014968 | Bacteria | 41186 |
| 370 | Ga0157379_10135713 | 3300014968 | Unclassified | 2217 |
| 371 | Ga0157379_10167729 | 3300014968 | Unclassified | 1982 |
| 372 | Ga0157379_10263715 | 3300014968 | Unclassified | 1566 |
| 373 | Ga0157379_10268109 | 3300014968 | Bacteria | 1552 |
| 374 | Ga0157376_10041099 | 3300014969 | Unclassified | 3784 |
| 375 | Ga0157376_10056318 | 3300014969 | Bacteria | 3284 |
| 376 | Ga0157376_10081417 | 3300014969 | Unclassified | 2780 |
| 377 | Ga0157376_10101092 | 3300014969 | Bacteria | 2519 |
| 378 | Ga0157376_10207736 | 3300014969 | Bacteria | 1806 |
| 379 | Ga0163161_10018613 | 3300017792 | Bacteria | 4868 |
| 380 | Ga0163161_10030173 | 3300017792 | Unclassified | 3856 |
| 381 | Ga0163161_10083804 | 3300017792 | Bacteria | 2350 |
| 382 | Ga0213872_10047235 | 3300021361 | Unclassified | 1958 |
| 383 | Ga0213871_10004166 | 3300021441 | Unclassified | 2869 |
| 384 | Ga0207697_10086919 | 3300025315 | Bacteria | 1322 |
| 385 | Ga0207656_10000483 | 3300025321 | Bacteria | 13166 |
| 386 | Ga0207688_10252598 | 3300025901 | Unclassified | 1068 |
| 387 | Ga0207680_10001546 | 3300025903 | Bacteria | 10833 |
| 388 | Ga0207680_10011290 | 3300025903 | Bacteria | 4509 |
| 389 | Ga0207680_10026291 | 3300025903 | Bacteria | 3225 |
| 390 | Ga0207680_10130427 | 3300025903 | Bacteria | 1656 |
| 391 | Ga0207647_10010393 | 3300025904 | Bacteria | 6574 |
| 392 | Ga0207647_10135566 | 3300025904 | Unclassified | 1445 |
| 393 | Ga0207645_10018735 | 3300025907 | Bacteria | 4547 |
| 394 | Ga0207645_10029340 | 3300025907 | Bacteria | 3547 |
| 395 | Ga0207643_10017411 | 3300025908 | Bacteria | 3929 |
| 396 | Ga0207705_10000623 | 3300025909 | Bacteria | 29594 |
| 397 | Ga0207705_10072838 | 3300025909 | Bacteria | 2492 |
| 398 | Ga0207684_10157635 | 3300025910 | Bacteria | 1954 |
| 399 | Ga0207654_10028106 | 3300025911 | Bacteria | 3064 |
| 400 | Ga0207654_10172482 | 3300025911 | Bacteria | 1405 |
| 401 | Ga0207707_10019903 | 3300025912 | Bacteria | 5858 |
| 402 | Ga0207707_10096788 | 3300025912 | Bacteria | 2579 |
| 403 | Ga0207695_10005932 | 3300025913 | Bacteria | 16010 |
| 404 | Ga0207695_10029463 | 3300025913 | Bacteria | 6064 |
| 405 | Ga0207695_10034212 | 3300025913 | Bacteria | 5531 |
| 406 | Ga0207695_10134545 | 3300025913 | Unclassified | 2426 |
| 407 | Ga0207660_10033757 | 3300025917 | Bacteria | 3542 |
| 408 | Ga0207660_10067556 | 3300025917 | Bacteria | 2590 |
| 409 | Ga0207660_10071945 | 3300025917 | Bacteria | 2517 |
| 410 | Ga0207660_10387918 | 3300025917 | Bacteria | 1123 |
| 411 | Ga0207662_10002985 | 3300025918 | Bacteria | 8615 |
| 412 | Ga0207662_10058259 | 3300025918 | Unclassified | 2312 |
| 413 | Ga0207657_10010235 | 3300025919 | Bacteria | 9367 |
| 414 | Ga0207657_10025421 | 3300025919 | Bacteria | 5462 |
| 415 | Ga0207657_10119828 | 3300025919 | Bacteria | 2165 |
| 416 | Ga0207649_10002503 | 3300025920 | Bacteria | 10263 |
| 417 | Ga0207649_10025152 | 3300025920 | Bacteria | 3468 |
| 418 | Ga0207649_10233776 | 3300025920 | Bacteria | 1316 |
| 419 | Ga0207652_10002089 | 3300025921 | Bacteria | 17168 |
| 420 | Ga0207652_10005426 | 3300025921 | Bacteria | 10345 |
| 421 | Ga0207652_10021177 | 3300025921 | Bacteria | 5365 |
| 422 | Ga0207652_10121649 | 3300025921 | Bacteria | 2323 |
| 423 | Ga0207652_10170678 | 3300025921 | Bacteria | 1952 |
| 424 | Ga0207652_10349652 | 3300025921 | Bacteria | 1334 |
| 425 | Ga0207646_10000032 | 3300025922 | Bacteria | 216397 |
| 426 | Ga0207646_10524475 | 3300025922 | Bacteria | 1066 |
| 427 | Ga0207681_10108322 | 3300025923 | Unclassified | 2016 |
| 428 | Ga0207681_10322777 | 3300025923 | Bacteria | 1228 |
| 429 | Ga0207650_10000510 | 3300025925 | Bacteria | 32441 |
| 430 | Ga0207650_10031978 | 3300025925 | Bacteria | 3805 |
| 431 | Ga0207650_10067621 | 3300025925 | Bacteria | 2681 |
| 432 | Ga0207650_10085894 | 3300025925 | Bacteria | 2394 |
| 433 | Ga0207650_10090549 | 3300025925 | Bacteria | 2336 |
| 434 | Ga0207650_10102126 | 3300025925 | Unclassified | 2209 |
| 435 | Ga0207650_10115851 | 3300025925 | Bacteria | 2080 |
| 436 | Ga0207650_10148330 | 3300025925 | Bacteria | 1849 |
| 437 | Ga0207650_10177790 | 3300025925 | Bacteria | 1695 |
| 438 | Ga0207650_10268623 | 3300025925 | Bacteria | 1386 |
| 439 | Ga0207659_10000173 | 3300025926 | Bacteria | 38585 |
| 440 | Ga0207659_10002371 | 3300025926 | Bacteria | 11213 |
| 441 | Ga0207659_10020599 | 3300025926 | Bacteria | 4362 |
| 442 | Ga0207659_10029299 | 3300025926 | Unclassified | 3751 |
| 443 | Ga0207659_10286541 | 3300025926 | Unclassified | 1348 |
| 444 | Ga0207644_10002882 | 3300025931 | Bacteria | 11083 |
| 445 | Ga0207644_10015078 | 3300025931 | Bacteria | 5185 |
| 446 | Ga0207690_10073407 | 3300025932 | Bacteria | 2366 |
| 447 | Ga0207690_10147506 | 3300025932 | Bacteria | 1741 |
| 448 | Ga0207690_10209824 | 3300025932 | Bacteria | 1484 |
| 449 | Ga0207690_10263057 | 3300025932 | Unclassified | 1337 |
| 450 | Ga0207690_10425887 | 3300025932 | Bacteria | 1063 |
| 451 | Ga0207706_10052994 | 3300025933 | Bacteria | 3581 |
| 452 | Ga0207706_10077398 | 3300025933 | Bacteria | 2925 |
| 453 | Ga0207706_10112705 | 3300025933 | Bacteria | 2393 |
| 454 | Ga0207686_10000884 | 3300025934 | Bacteria | 18109 |
| 455 | Ga0207686_10171732 | 3300025934 | Unclassified | 1529 |
| 456 | Ga0207670_10004333 | 3300025936 | Bacteria | 7624 |
| 457 | Ga0207670_10029226 | 3300025936 | Bacteria | 3509 |
| 458 | Ga0207670_10120701 | 3300025936 | Bacteria | 1905 |
| 459 | Ga0207670_10351037 | 3300025936 | Bacteria | 1168 |
| 460 | Ga0207704_10015131 | 3300025938 | Bacteria | 3922 |
| 461 | Ga0207704_10091665 | 3300025938 | Bacteria | 1998 |
| 462 | Ga0207691_10019398 | 3300025940 | Bacteria | 6435 |
| 463 | Ga0207691_10019513 | 3300025940 | Bacteria | 6415 |
| 464 | Ga0207691_10028488 | 3300025940 | Bacteria | 5231 |
| 465 | Ga0207691_10121889 | 3300025940 | Bacteria | 2310 |
| 466 | Ga0207691_10197390 | 3300025940 | Bacteria | 1752 |
| 467 | Ga0207711_10000648 | 3300025941 | Bacteria | 34717 |
| 468 | Ga0207711_10267390 | 3300025941 | Bacteria | 1573 |
| 469 | Ga0207711_10305515 | 3300025941 | Bacteria | 1468 |
| 470 | Ga0207689_10002805 | 3300025942 | Bacteria | 16095 |
| 471 | Ga0207689_10040689 | 3300025942 | Bacteria | 3846 |
| 472 | Ga0207689_10088810 | 3300025942 | Unclassified | 2539 |
| 473 | Ga0207689_10244290 | 3300025942 | Bacteria | 1484 |
| 474 | Ga0207661_10001069 | 3300025944 | Bacteria | 18229 |
| 475 | Ga0207661_10036520 | 3300025944 | Bacteria | 3836 |
| 476 | Ga0207661_10120313 | 3300025944 | Bacteria | 2234 |
| 477 | Ga0207661_10244550 | 3300025944 | Bacteria | 1593 |
| 478 | Ga0207679_10013567 | 3300025945 | Bacteria | 5340 |
| 479 | Ga0207679_10021225 | 3300025945 | Bacteria | 4398 |
| 480 | Ga0207679_10036606 | 3300025945 | Bacteria | 3481 |
| 481 | Ga0207679_10320840 | 3300025945 | Unclassified | 1341 |
| 482 | Ga0207667_10000049 | 3300025949 | Bacteria | 235027 |
| 483 | Ga0207667_10019413 | 3300025949 | Bacteria | 7590 |
| 484 | Ga0207667_10081514 | 3300025949 | Bacteria | 3352 |
| 485 | Ga0207667_10198753 | 3300025949 | Bacteria | 2057 |
| 486 | Ga0207667_10213407 | 3300025949 | Bacteria | 1978 |
| 487 | Ga0207667_10253002 | 3300025949 | Unclassified | 1802 |
| 488 | Ga0207651_10022287 | 3300025960 | Bacteria | 3869 |
| 489 | Ga0207651_10040387 | 3300025960 | Bacteria | 3086 |
| 490 | Ga0207651_10148977 | 3300025960 | Unclassified | 1819 |
| 491 | Ga0207651_10294905 | 3300025960 | Unclassified | 1346 |
| 492 | Ga0207712_10002170 | 3300025961 | Bacteria | 12828 |
| 493 | Ga0207712_10013251 | 3300025961 | Bacteria | 5285 |
| 494 | Ga0207668_10000663 | 3300025972 | Bacteria | 21145 |
| 495 | Ga0207668_10032610 | 3300025972 | Bacteria | 3444 |
| 496 | Ga0207668_10083168 | 3300025972 | Unclassified | 2328 |
| 497 | Ga0207640_10012544 | 3300025981 | Bacteria | 4831 |
| 498 | Ga0207640_10058766 | 3300025981 | Bacteria | 2535 |
| 499 | Ga0207640_10069819 | 3300025981 | Bacteria | 2360 |
| 500 | Ga0207640_10187764 | 3300025981 | Bacteria | 1555 |
| 501 | Ga0207658_10010785 | 3300025986 | Bacteria | 6217 |
| 502 | Ga0207658_10056336 | 3300025986 | Bacteria | 2917 |
| 503 | Ga0207658_10132733 | 3300025986 | Bacteria | 2003 |
| 504 | Ga0207658_10153660 | 3300025986 | Bacteria | 1878 |
| 505 | Ga0207658_10195617 | 3300025986 | Bacteria | 1684 |
| 506 | Ga0207658_10257330 | 3300025986 | Unclassified | 1486 |
| 507 | Ga0207677_10028007 | 3300026023 | Bacteria | 3558 |
| 508 | Ga0207677_10038103 | 3300026023 | Bacteria | 3148 |
| 509 | Ga0207703_10013004 | 3300026035 | Bacteria | 6485 |
| 510 | Ga0207703_10019904 | 3300026035 | Bacteria | 5246 |
| 511 | Ga0207639_10005388 | 3300026041 | Bacteria | 8651 |
| 512 | Ga0207639_10007679 | 3300026041 | Bacteria | 7362 |
| 513 | Ga0207639_10086260 | 3300026041 | Bacteria | 2499 |
| 514 | Ga0207639_10091546 | 3300026041 | Bacteria | 2435 |
| 515 | Ga0207639_10093975 | 3300026041 | Bacteria | 2406 |
| 516 | Ga0207639_10257563 | 3300026041 | Bacteria | 1524 |
| 517 | Ga0207678_10170339 | 3300026067 | Unclassified | 1859 |
| 518 | Ga0207708_10096778 | 3300026075 | Bacteria | 2281 |
| 519 | Ga0207702_10051789 | 3300026078 | Bacteria | 3471 |
| 520 | Ga0207641_10000561 | 3300026088 | Bacteria | 41567 |
| 521 | Ga0207641_10001235 | 3300026088 | Bacteria | 25590 |
| 522 | Ga0207641_10015720 | 3300026088 | Bacteria | 6201 |
| 523 | Ga0207641_10035180 | 3300026088 | Bacteria | 4171 |
| 524 | Ga0207641_10161340 | 3300026088 | Bacteria | 2038 |
| 525 | Ga0207648_10002623 | 3300026089 | Bacteria | 19251 |
| 526 | Ga0207648_10303428 | 3300026089 | Bacteria | 1432 |
| 527 | Ga0207676_10026191 | 3300026095 | Bacteria | 4335 |
| 528 | Ga0207676_10049325 | 3300026095 | Bacteria | 3274 |
| 529 | Ga0207676_10082344 | 3300026095 | Bacteria | 2617 |
| 530 | Ga0207676_10379983 | 3300026095 | Unclassified | 1315 |
| 531 | Ga0207674_10033423 | 3300026116 | Bacteria | 5385 |
| 532 | Ga0207674_10061864 | 3300026116 | Bacteria | 3782 |
| 533 | Ga0207674_10212617 | 3300026116 | Bacteria | 1883 |
| 534 | Ga0207674_10529904 | 3300026116 | Unclassified | 1138 |
| 535 | Ga0207675_100049100 | 3300026118 | Bacteria | 3939 |
| 536 | Ga0207675_100077458 | 3300026118 | Bacteria | 3115 |
| 537 | Ga0207675_100429753 | 3300026118 | Bacteria | 1305 |
| 538 | Ga0207683_10020712 | 3300026121 | Bacteria | 5627 |
| 539 | Ga0207683_10124392 | 3300026121 | Bacteria | 2317 |
| 540 | Ga0207683_10287154 | 3300026121 | Unclassified | 1504 |
| 541 | Ga0207698_10018072 | 3300026142 | Bacteria | 4797 |
| 542 | Ga0207698_10052775 | 3300026142 | Bacteria | 3117 |
| 543 | Ga0207698_10327836 | 3300026142 | Bacteria | 1437 |
| 544 | Ga0209974_10005581 | 3300027876 | Bacteria | 4420 |
| 545 | Ga0207428_10000031 | 3300027907 | Bacteria | 235245 |
| 546 | Ga0268266_10191970 | 3300028379 | Bacteria | 1865 |
| 547 | Ga0268266_10209886 | 3300028379 | Unclassified | 1785 |
| 548 | Ga0268266_10269806 | 3300028379 | Bacteria | 1579 |
| 549 | Ga0268266_10280572 | 3300028379 | Bacteria | 1549 |
| 550 | Ga0268266_10476697 | 3300028379 | Bacteria | 1189 |
| 551 | Ga0268265_10062858 | 3300028380 | Bacteria | 2854 |
| 552 | Ga0268265_10097521 | 3300028380 | Bacteria | 2365 |
| 553 | Ga0268265_10219681 | 3300028380 | Unclassified | 1662 |
| 554 | Ga0268264_10007005 | 3300028381 | Bacteria | 9459 |
| 555 | Ga0268264_10030284 | 3300028381 | Bacteria | 4436 |
| 556 | Ga0268264_10059906 | 3300028381 | Bacteria | 3191 |
| 557 | Ga0268264_10316568 | 3300028381 | Bacteria | 1474 |
| 558 | Ga0268264_10454451 | 3300028381 | Bacteria | 1242 |
| 559 | Ga0265337_1001644 | 3300028556 | Bacteria | 10866 |
| 560 | Ga0265326_10013130 | 3300028558 | Bacteria | 2426 |
| 561 | Ga0265318_10000195 | 3300028577 | Bacteria | 53122 |
| 562 | Ga0265323_10005862 | 3300028653 | Bacteria | 5194 |
| 563 | Ga0265322_10001230 | 3300028654 | Bacteria | 8712 |
| 564 | Ga0307515_10000092 | 3300028794 | Bacteria | 212425 |
| 565 | Ga0265338_10077849 | 3300028800 | Bacteria | 2800 |
| 566 | Ga0265338_10169127 | 3300028800 | Bacteria | 1679 |
| 567 | Ga0265330_10009657 | 3300031235 | Unclassified | 4575 |
| 568 | Ga0265332_10036575 | 3300031238 | Bacteria | 2131 |
| 569 | Ga0265320_10000070 | 3300031240 | Bacteria | 90235 |
| 570 | Ga0265325_10005122 | 3300031241 | Bacteria | 8153 |
| 571 | Ga0265325_10033045 | 3300031241 | Bacteria | 2759 |
| 572 | Ga0265325_10135437 | 3300031241 | Bacteria | 1176 |
| 573 | Ga0265329_10000929 | 3300031242 | Bacteria | 14720 |
| 574 | Ga0265340_10000108 | 3300031247 | Bacteria | 40680 |
| 575 | Ga0265340_10003007 | 3300031247 | Bacteria | 9597 |
| 576 | Ga0265339_10034529 | 3300031249 | Bacteria | 2841 |
| 577 | Ga0265339_10087891 | 3300031249 | Bacteria | 1633 |
| 578 | Ga0265331_10003091 | 3300031250 | Bacteria | 10913 |
| 579 | Ga0265316_10006923 | 3300031344 | Bacteria | 10753 |
| 580 | Ga0265316_10080444 | 3300031344 | Unclassified | 2499 |
| 581 | Ga0265316_10100115 | 3300031344 | Bacteria | 2203 |
| 582 | Ga0307513_10125887 | 3300031456 | Bacteria | 2518 |
| 583 | Ga0307509_10107579 | 3300031507 | Bacteria | 2804 |
| 584 | Ga0307408_100040397 | 3300031548 | Bacteria | 3303 |
| 585 | Ga0307408_100040579 | 3300031548 | Bacteria | 3296 |
| 586 | Ga0265313_10001878 | 3300031595 | Bacteria | 19092 |
| 587 | Ga0265313_10039862 | 3300031595 | Bacteria | 2327 |
| 588 | Ga0316575_10001544 | 3300031665 | Bacteria | 7459 |
| 589 | Ga0316575_10002566 | 3300031665 | Bacteria | 6107 |
| 590 | Ga0316575_10012027 | 3300031665 | Bacteria | 3212 |
| 591 | Ga0316575_10052820 | 3300031665 | Bacteria | 1618 |
| 592 | Ga0316579_10057577 | 3300031691 | Bacteria | 1826 |
| 593 | Ga0316579_10073899 | 3300031691 | Bacteria | 1618 |
| 594 | Ga0265314_10000104 | 3300031711 | Bacteria | 127566 |
| 595 | Ga0265314_10050435 | 3300031711 | Bacteria | 2907 |
| 596 | Ga0265314_10054940 | 3300031711 | Bacteria | 2752 |
| 597 | Ga0265342_10000433 | 3300031712 | Bacteria | 45864 |
| 598 | Ga0265342_10001030 | 3300031712 | Bacteria | 27382 |
| 599 | Ga0316576_10003610 | 3300031727 | Bacteria | 9123 |
| 600 | Ga0316576_10006995 | 3300031727 | Bacteria | 7059 |
| 601 | Ga0316576_10008823 | 3300031727 | Bacteria | 6465 |
| 602 | Ga0316576_10048941 | 3300031727 | Bacteria | 3068 |
| 603 | Ga0316576_10052550 | 3300031727 | Bacteria | 2967 |
| 604 | Ga0316576_10127808 | 3300031727 | Bacteria | 1911 |
| 605 | Ga0316576_10198194 | 3300031727 | Bacteria | 1513 |
| 606 | Ga0316578_10002870 | 3300031728 | Bacteria | 7704 |
| 607 | Ga0316578_10003237 | 3300031728 | Bacteria | 7393 |
| 608 | Ga0316578_10007341 | 3300031728 | Bacteria | 5519 |
| 609 | Ga0316578_10161863 | 3300031728 | Bacteria | 1349 |
| 610 | Ga0316578_10172301 | 3300031728 | Bacteria | 1304 |
| 611 | Ga0307405_10050942 | 3300031731 | Bacteria | 2567 |
| 612 | Ga0316577_10021897 | 3300031733 | Unclassified | 3547 |
| 613 | Ga0316577_10074270 | 3300031733 | Bacteria | 1898 |
| 614 | Ga0307410_10013477 | 3300031852 | Bacteria | 4771 |
| 615 | Ga0307410_10017356 | 3300031852 | Bacteria | 4321 |
| 616 | Ga0307410_10040082 | 3300031852 | Bacteria | 3080 |
| 617 | Ga0307410_10123549 | 3300031852 | Bacteria | 1891 |
| 618 | Ga0307410_10299823 | 3300031852 | Bacteria | 1268 |
| 619 | Ga0307407_10045299 | 3300031903 | Bacteria | 2485 |
| 620 | Ga0307412_10232205 | 3300031911 | Bacteria | 1421 |
| 621 | Ga0307409_100085900 | 3300031995 | Bacteria | 2559 |
| 622 | Ga0307409_100306417 | 3300031995 | Bacteria | 1480 |
| 623 | Ga0307416_100027174 | 3300032002 | Bacteria | 4233 |
| 624 | Ga0307416_100056409 | 3300032002 | Bacteria | 3170 |
| 625 | Ga0307416_100135889 | 3300032002 | Bacteria | 2224 |
| 626 | Ga0307414_10367887 | 3300032004 | Bacteria | 1239 |
| 627 | Ga0307411_10038303 | 3300032005 | Unclassified | 3023 |
| 628 | Ga0307411_10042060 | 3300032005 | Bacteria | 2912 |
| 629 | Ga0307411_10189530 | 3300032005 | Unclassified | 1569 |
| 630 | Ga0307411_10235310 | 3300032005 | Bacteria | 1430 |
| 631 | Ga0307411_10308563 | 3300032005 | Bacteria | 1272 |
| 632 | Ga0307415_100030729 | 3300032126 | Bacteria | 3452 |
| 633 | Ga0307415_100240574 | 3300032126 | Bacteria | 1464 |
| 634 | Ga0316583_10003577 | 3300032133 | Bacteria | 5488 |
| 635 | Ga0316583_10004947 | 3300032133 | Bacteria | 4760 |
| 636 | Ga0316583_10008550 | 3300032133 | Bacteria | 3692 |
| 637 | Ga0316583_10021390 | 3300032133 | Bacteria | 2318 |
| 638 | Ga0316583_10026515 | 3300032133 | Bacteria | 2068 |
| 639 | Ga0316583_10035788 | 3300032133 | Bacteria | 1762 |
| 640 | Ga0316583_10040292 | 3300032133 | Bacteria | 1654 |
| 641 | Ga0316583_10048860 | 3300032133 | Bacteria | 1489 |
| 642 | Ga0316585_10008588 | 3300032137 | Unclassified | 2967 |
| 643 | Ga0316585_10052164 | 3300032137 | Bacteria | 1314 |
| 644 | Ga0316580_10000900 | 3300032139 | Bacteria | 7356 |
| 645 | Ga0316580_10001815 | 3300032139 | Bacteria | 5722 |
| 646 | Ga0316580_10056442 | 3300032139 | Bacteria | 1207 |
| 647 | Ga0316592_1006636 | 3300033524 | Bacteria | 2236 |
| 648 | Ga0316588_1040045 | 3300033528 | Bacteria | 1118 |
| 649 | Ga0373953_0095547 | 3300035117 | Bacteria | 1247 |
| 650 | Ga0373953_0148845 | 3300035117 | Archaea | 1003 |
| 651 | Ga0373955_0073320 | 3300035172 | Unclassified | 1919 |
| 652 | Ga0316574_0012270 | 3300035398 | Bacteria | 4900 |
| 653 | Ga0316574_0014180 | 3300035398 | Bacteria | 4597 |
| 654 | Ga0316574_0027730 | 3300035398 | Bacteria | 3412 |
| 655 | Ga0373947_0251800 | 3300035725 | Bacteria | 1168 |
| 656 | Ga0373937_0012246 | 3300036401 | Bacteria | 7536 |
| 657 | Ga0373937_0043557 | 3300036401 | Unclassified | 4098 |
| 658 | Ga0373937_0135290 | 3300036401 | Bacteria | 2304 |
| 659 | Ga0373937_0436749 | 3300036401 | Bacteria | 1243 |
| 660 | Ga0316582_0016664 | 3300036647 | Bacteria | 4231 |
| 661 | Ga0316582_0055855 | 3300036647 | Bacteria | 2518 |
| 662 | Ga0316584_0004299 | 3300036712 | Bacteria | 9415 |
| 663 | Ga0316584_0004621 | 3300036712 | Bacteria | 9123 |
| 664 | Ga0316584_0004631 | 3300036712 | Bacteria | 9112 |
| 665 | Ga0373925_0497364 | 3300037068 | Bacteria | 1001 |
| 666 | Ga0395899_0017367 | 3300037312 | Bacteria | 5481 |
| 667 | Ga0395900_0018883 | 3300037418 | Bacteria | 7032 |
| 668 | Ga0395900_0027156 | 3300037418 | Bacteria | 5861 |
| 669 | Ga0395900_0124498 | 3300037418 | Bacteria | 2644 |
| 670 | Ga0395898_0001959 | 3300037466 | Bacteria | 26028 |
| 671 | Ga0395898_0085750 | 3300037466 | Bacteria | 3036 |
| 672 | Ga0395898_0154787 | 3300037466 | Bacteria | 2193 |
| 673 | Ga0395905_0012005 | 3300037471 | Bacteria | 8354 |
| 674 | Ga0316581_0027607 | 3300037588 | Bacteria | 1697 |
| 675 | Ga0316581_0034851 | 3300037588 | Bacteria | 1524 |
| 676 | Ga0395901_0001045 | 3300038443 | Bacteria | 29867 |
| 677 | Ga0395901_0009760 | 3300038443 | Bacteria | 9734 |
| 678 | Ga0395901_0015422 | 3300038443 | Bacteria | 7781 |
| 679 | Ga0436365_0336651 | 3300039437 | Bacteria | 1798 |
| 680 | Ga0436360_0105708 | 3300039438 | Bacteria | 7936 |
| 681 | Ga0436361_0740991 | 3300039447 | Bacteria | 8130 |
| 682 | Ga0436362_0346855 | 3300039453 | Bacteria | 4746 |
| 683 | Ga0439449_0040168 | 3300042007 | Bacteria | 1739 |
| 684 | Ga0439435_0049817 | 3300042436 | Unclassified | 1196 |
| 685 | Ga0451577_0003018 | 3300042876 | Bacteria | 19168 |
| 686 | Ga0451577_0016447 | 3300042876 | Bacteria | 6852 |
| 687 | Ga0451577_0102493 | 3300042876 | Unclassified | 2558 |
| 688 | Ga0451577_0123283 | 3300042876 | Bacteria | 2321 |
| 689 | Ga0451577_0147235 | 3300042876 | Bacteria | 2118 |
| 690 | Ga0451577_0247500 | 3300042876 | Bacteria | 1613 |
| 691 | Ga0466972_0000009 | 3300044658 | Bacteria | 256374 |
| 692 | Ga0453683_0049204 | 3300044673 | Bacteria | 2643 |
| 693 | Ga0453683_0204881 | 3300044673 | Bacteria | 1252 |
| 694 | Ga0453684_0000220 | 3300044712 | Bacteria | 249922 |
| 695 | Ga0453684_0029795 | 3300044712 | Bacteria | 7733 |
| 696 | Ga0453684_0120717 | 3300044712 | Bacteria | 3165 |
| 697 | Ga0453684_0153749 | 3300044712 | Bacteria | 2730 |
| 698 | Ga0453684_0187841 | 3300044712 | Bacteria | 2420 |
| 699 | Ga0453684_0349268 | 3300044712 | Bacteria | 1668 |
| 700 | Ga0453684_0464060 | 3300044712 | Bacteria | 1407 |
| 701 | Ga0453684_0481969 | 3300044712 | Bacteria | 1376 |
| 702 | Ga0453684_0518598 | 3300044712 | Bacteria | 1317 |
| 703 | Ga0466957_0033462 | 3300044842 | Bacteria | 3084 |
| 704 | Ga0451576_0030100 | 3300045051 | Bacteria | 5805 |
| 705 | Ga0451576_0031338 | 3300045051 | Bacteria | 5670 |
| 706 | Ga0451576_0255094 | 3300045051 | Bacteria | 1833 |
| 707 | Ga0495592_0054446 | 3300046454 | Bacteria | 2964 |
| 708 | Ga0495629_0105738 | 3300046459 | Bacteria | 1963 |
| 709 | Ga0495629_0145201 | 3300046459 | Unclassified | 1650 |
| 710 | Ga0495629_0193814 | 3300046459 | Unclassified | 1406 |
| 711 | Ga0495651_0000090 | 3300046462 | Bacteria | 66511 |
| 712 | Ga0495651_0139011 | 3300046462 | Bacteria | 1764 |
| 713 | Ga0495580_0163858 | 3300046472 | Bacteria | 1538 |
| 714 | Ga0495662_0009490 | 3300046476 | Unclassified | 4773 |
| 715 | Ga0495664_0187534 | 3300046477 | Bacteria | 1254 |
| 716 | Ga0495585_0000525 | 3300046492 | Bacteria | 36200 |
| 717 | Ga0495618_0038745 | 3300046514 | Bacteria | 2997 |
| 718 | Ga0495618_0170044 | 3300046514 | Unclassified | 1387 |
| 719 | Ga0495630_0012249 | 3300046517 | Bacteria | 6221 |
| 720 | Ga0495630_0361005 | 3300046517 | Bacteria | 1112 |
| 721 | Ga0495643_0009334 | 3300046522 | Bacteria | 6104 |
| 722 | Ga0495640_0081835 | 3300046533 | Unclassified | 2146 |
| 723 | Ga0495640_0163101 | 3300046533 | Bacteria | 1427 |
| 724 | Ga0495587_0034140 | 3300046536 | Bacteria | 3069 |
| 725 | Ga0495587_0054565 | 3300046536 | Bacteria | 2355 |
| 726 | Ga0495587_0094614 | 3300046536 | Bacteria | 1725 |
| 727 | Ga0495598_0007722 | 3300046537 | Bacteria | 2479 |
| 728 | Ga0495645_0020717 | 3300046543 | Bacteria | 4748 |
| 729 | Ga0495667_0005808 | 3300046559 | Bacteria | 8363 |
| 730 | Ga0495667_0030382 | 3300046559 | Unclassified | 3630 |
| 731 | Ga0495656_0001607 | 3300046615 | Bacteria | 7396 |
| 732 | Ga0495656_0118129 | 3300046615 | Bacteria | 1248 |
| 733 | Ga0495634_0038710 | 3300046642 | Bacteria | 3250 |
| 734 | Ga0495635_0014765 | 3300046663 | Bacteria | 5464 |
| 735 | Ga0495657_0002664 | 3300046675 | Bacteria | 14920 |
| 736 | Ga0495657_0220443 | 3300046675 | Bacteria | 1150 |
| 737 | Ga0495599_0119314 | 3300046678 | Bacteria | 1640 |
| 738 | Ga0495599_0189701 | 3300046678 | Bacteria | 1265 |
| 739 | Ga0495658_0015758 | 3300046683 | Bacteria | 3882 |
| 740 | Ga0495658_0094565 | 3300046683 | Unclassified | 1775 |
| 741 | Ga0495658_0138528 | 3300046683 | Bacteria | 1487 |
| 742 | Ga0495669_0006927 | 3300046684 | Bacteria | 4748 |
| 743 | Ga0495613_0043195 | 3300046689 | Unclassified | 3334 |
| 744 | Ga0495670_0124712 | 3300046691 | Bacteria | 1340 |
| 745 | Ga0495670_0125443 | 3300046691 | Bacteria | 1336 |
| 746 | Ga0495670_0159165 | 3300046691 | Bacteria | 1186 |
| 747 | Ga0495600_0027708 | 3300046809 | Bacteria | 3662 |
| 748 | Ga0495600_0122883 | 3300046809 | Bacteria | 1688 |
| 749 | Ga0495581_0079809 | 3300047315 | Unclassified | 1894 |
| 750 | Ga0495604_0006369 | 3300047317 | Bacteria | 9362 |
| 751 | Ga0495604_0111219 | 3300047317 | Bacteria | 1997 |
| 752 | Ga0495604_0220447 | 3300047317 | Unclassified | 1306 |
| 753 | Ga0495636_0000016 | 3300047318 | Bacteria | 78995 |
| 754 | Ga0495674_0061772 | 3300047319 | Bacteria | 3264 |
| 755 | Ga0495674_0168095 | 3300047319 | Unclassified | 1831 |
| 756 | Ga0495680_0001014 | 3300047322 | Bacteria | 31192 |
| 757 | Ga0495680_0047511 | 3300047322 | Bacteria | 3376 |
| 758 | Ga0495675_0021392 | 3300047444 | Bacteria | 4118 |
| 759 | Ga0495675_0051785 | 3300047444 | Unclassified | 2607 |
| 760 | Ga0495684_0057463 | 3300047471 | Bacteria | 2965 |
| 761 | Ga0495684_0158850 | 3300047471 | Unclassified | 1687 |
| 762 | Ga0495602_0092839 | 3300048088 | Bacteria | 2499 |
| 763 | Ga0495602_0199484 | 3300048088 | Bacteria | 1528 |
| 764 | Ga0496101_0201633 | 3300048904 | Bacteria | 1538 |
| 765 | Ga0496102_0065747 | 3300048905 | Bacteria | 3324 |
| 766 | Ga0496104_0088030 | 3300048907 | Bacteria | 2966 |
| 767 | Ga0496105_0087649 | 3300048908 | Bacteria | 2572 |
| 768 | Ga0496106_0061170 | 3300048909 | Bacteria | 2856 |
| 769 | Ga0496107_0029175 | 3300048910 | Bacteria | 3924 |
| 770 | Ga0496108_0057265 | 3300048911 | Bacteria | 3275 |
| 771 | Ga0496108_0143849 | 3300048911 | Bacteria | 2055 |
| 772 | Ga0496108_0161989 | 3300048911 | Bacteria | 1934 |
| 773 | Ga0496109_0130602 | 3300048912 | Bacteria | 2344 |
| 774 | Ga0496109_0476539 | 3300048912 | Bacteria | 1178 |
| 775 | Ga0496112_0117533 | 3300048915 | Bacteria | 2629 |
| 776 | Ga0496112_0702373 | 3300048915 | Bacteria | 939 |
| 777 | Ga0496114_0058821 | 3300048917 | Bacteria | 3209 |
| 778 | Ga0496114_0135287 | 3300048917 | Bacteria | 2131 |
| 779 | Ga0501032_0128267 | 3300049569 | Unclassified | 1674 |
| 780 | Ga0501033_0045063 | 3300049570 | Unclassified | 3283 |
| 781 | Ga0501033_0226804 | 3300049570 | Bacteria | 1328 |
| 782 | Ga0501034_0010869 | 3300049571 | Bacteria | 9455 |
| 783 | Ga0501034_0011076 | 3300049571 | Bacteria | 9366 |
| 784 | Ga0501036_0006252 | 3300049572 | Bacteria | 9659 |
| 785 | Ga0501036_0115614 | 3300049572 | Unclassified | 2266 |
| 786 | Ga0501037_0014266 | 3300049573 | Bacteria | 5855 |
| 787 | Ga0501037_0038256 | 3300049573 | Bacteria | 3535 |
| 788 | Ga0501038_0069442 | 3300049574 | Bacteria | 2993 |
| 789 | Ga0501038_0090020 | 3300049574 | Bacteria | 2573 |
| 790 | Ga0501038_0112482 | 3300049574 | Unclassified | 2254 |
| 791 | Ga0501038_0116511 | 3300049574 | Bacteria | 2208 |
| 792 | Ga0501038_0247264 | 3300049574 | Bacteria | 1414 |
| 793 | Ga0501039_0016664 | 3300049575 | Bacteria | 5629 |
| 794 | Ga0501039_0022435 | 3300049575 | Unclassified | 4846 |
| 795 | Ga0501039_0084494 | 3300049575 | Bacteria | 2472 |
| 796 | Ga0501040_0001939 | 3300049576 | Bacteria | 13306 |
| 797 | Ga0501040_0028138 | 3300049576 | Bacteria | 3788 |
| 798 | Ga0501042_0014495 | 3300049578 | Bacteria | 5383 |
| 799 | Ga0501042_0095252 | 3300049578 | Bacteria | 2138 |
| 800 | Ga0501043_0150986 | 3300049579 | Bacteria | 1818 |
| 801 | Ga0501043_0166570 | 3300049579 | Unclassified | 1721 |
| 802 | Ga0501046_0018198 | 3300049580 | Bacteria | 5851 |
| 803 | Ga0501046_0062127 | 3300049580 | Bacteria | 2919 |
| 804 | Ga0501046_0158663 | 3300049580 | Unclassified | 1702 |
| 805 | Ga0501047_0034670 | 3300049581 | Unclassified | 4873 |
| 806 | Ga0501047_0137193 | 3300049581 | Bacteria | 2326 |
| 807 | Ga0501048_0009500 | 3300049582 | Bacteria | 7300 |
| 808 | Ga0501048_0046381 | 3300049582 | Bacteria | 3102 |
| 809 | Ga0501048_0210136 | 3300049582 | Bacteria | 1380 |
| 810 | Ga0501067_0000249 | 3300049583 | Bacteria | 29614 |
| 811 | Ga0501067_0043941 | 3300049583 | Bacteria | 2482 |
| 812 | Ga0501068_0270012 | 3300049584 | Unclassified | 1086 |
| 813 | Ga0501070_0209990 | 3300049586 | Bacteria | 1598 |
| 814 | Ga0501072_0022119 | 3300049588 | Bacteria | 4932 |
| 815 | Ga0501073_0031033 | 3300049589 | Bacteria | 3814 |
| 816 | Ga0501074_0059882 | 3300049590 | Bacteria | 2743 |
| 817 | Ga0501074_0095165 | 3300049590 | Bacteria | 2133 |
| 818 | Ga0501075_0008564 | 3300049591 | Bacteria | 7131 |
| 819 | Ga0501075_0093423 | 3300049591 | Bacteria | 2283 |
| 820 | Ga0501075_0430622 | 3300049591 | Bacteria | 1006 |
| 821 | Ga0501076_0008547 | 3300049592 | Bacteria | 7507 |
| 822 | Ga0501076_0033519 | 3300049592 | Bacteria | 4010 |
| 823 | Ga0501076_0181864 | 3300049592 | Bacteria | 1714 |
| 824 | Ga0501076_0301692 | 3300049592 | Bacteria | 1313 |
| 825 | Ga0501076_0305508 | 3300049592 | Bacteria | 1304 |
| 826 | Ga0501076_0441263 | 3300049592 | Unclassified | 1071 |
| 827 | Ga0501077_0009906 | 3300049593 | Bacteria | 5931 |
| 828 | Ga0501198_012893 | 3300049649 | Unclassified | 1260 |
| 829 | Ga0501202_029143 | 3300049652 | Unclassified | 1143 |
| 830 | Ga0501217_000055 | 3300049661 | Bacteria | 13339 |
| 831 | Ga0501222_004506 | 3300049662 | Unclassified | 1892 |
| 832 | Ga0501223_001899 | 3300049663 | Unclassified | 4708 |
| 833 | Ga0501233_004326 | 3300049668 | Unclassified | 2597 |
| 834 | Ga0501243_000975 | 3300049675 | Unclassified | 4027 |
| 835 | Ga0501259_001374 | 3300049688 | Unclassified | 4071 |
| 836 | Ga0501221_000337 | 3300049704 | Bacteria | 7125 |
| 837 | Ga0501225_0001107 | 3300049705 | Bacteria | 8457 |
| 838 | Ga0501225_0001987 | 3300049705 | Bacteria | 6389 |
| 839 | Ga0501245_000875 | 3300049708 | Unclassified | 3811 |
| 840 | Ga0501079_0010716 | 3300049741 | Bacteria | 6981 |
| 841 | Ga0501079_0060330 | 3300049741 | Bacteria | 2926 |
| 842 | Ga0501079_0146628 | 3300049741 | Bacteria | 1839 |
| 843 | Ga0501079_0158162 | 3300049741 | Bacteria | 1766 |
| 844 | Ga0501079_0188864 | 3300049741 | Bacteria | 1608 |
| 845 | Ga0501080_0004871 | 3300049742 | Bacteria | 11965 |
| 846 | Ga0501080_0014784 | 3300049742 | Bacteria | 7189 |
| 847 | Ga0501080_0064218 | 3300049742 | Bacteria | 3415 |
| 848 | Ga0501080_0395661 | 3300049742 | Bacteria | 1243 |
| 849 | Ga0501081_0007334 | 3300049743 | Bacteria | 7157 |
| 850 | Ga0501081_0012374 | 3300049743 | Bacteria | 5605 |
| 851 | Ga0501081_0135937 | 3300049743 | Bacteria | 1759 |
| 852 | Ga0501083_0006560 | 3300049744 | Bacteria | 8257 |
| 853 | Ga0501083_0062118 | 3300049744 | Bacteria | 2493 |
| 854 | Ga0501083_0267033 | 3300049744 | Bacteria | 1113 |
| 855 | Ga0501263_007208 | 3300049760 | Bacteria | 1304 |
| 856 | Ga0501268_023281 | 3300049765 | Bacteria | 1074 |
| 857 | Ga0501035_0035768 | 3300049822 | Unclassified | 4506 |
| 858 | Ga0501035_0133458 | 3300049822 | Bacteria | 2163 |
| 859 | Ga0501044_0002454 | 3300049823 | Bacteria | 21139 |
| 860 | Ga0501044_0044779 | 3300049823 | Bacteria | 4589 |
| 861 | Ga0501044_0101639 | 3300049823 | Unclassified | 2892 |
| 862 | Ga0501044_0250010 | 3300049823 | Bacteria | 1714 |
| 863 | Ga0501045_0002074 | 3300049824 | Bacteria | 13539 |
| 864 | Ga0501045_0039920 | 3300049824 | Bacteria | 3415 |
| 865 | Ga0501045_0043711 | 3300049824 | Bacteria | 3263 |
| 866 | Ga0501045_0051695 | 3300049824 | Bacteria | 2999 |
| 867 | nmdc:mga05p37_142569_c1 | 3300050507 | Bacteria | 2935 |
| 868 | nmdc:mga05p37_148017_c1 | 3300050507 | Bacteria | 2874 |
| 869 | nmdc:mga05p37_462788_c1 | 3300050507 | Unclassified | 1465 |
| 870 | nmdc:mga05p37_50876_c1 | 3300050507 | Bacteria | 5095 |
| 871 | nmdc:mga05p37_561131_c1 | 3300050507 | Bacteria | 1297 |
| 872 | nmdc:mga09592_275417_c1 | 3300050508 | Bacteria | 1460 |
| 873 | nmdc:mga09592_40794_c1 | 3300050508 | Bacteria | 3900 |
| 874 | nmdc:mga09592_72684_c1 | 3300050508 | Bacteria | 2921 |
| 875 | nmdc:mga09592_87369_c1 | 3300050508 | Bacteria | 2662 |
| 876 | nmdc:mga09592_99597_c1 | 3300050508 | Bacteria | 2488 |
| 877 | nmdc:mga0qj67_12488_c1 | 3300050509 | Bacteria | 6398 |
| 878 | nmdc:mga0qj67_2698_c1 | 3300050509 | Bacteria | 12729 |
| 879 | nmdc:mga0qj67_32779_c1 | 3300050509 | Bacteria | 4053 |
| 880 | nmdc:mga0qj67_53056_c1 | 3300050509 | Bacteria | 3209 |
| 881 | nmdc:mga06r32_354305_c1 | 3300050510 | Bacteria | 1452 |
| 882 | nmdc:mga06r32_418705_c1 | 3300050510 | Bacteria | 1321 |
| 883 | nmdc:mga06r32_47840_c1 | 3300050510 | Bacteria | 4087 |
| 884 | nmdc:mga06r32_54656_c1 | 3300050510 | Bacteria | 3829 |
| 885 | nmdc:mga06r32_55517_c1 | 3300050510 | Bacteria | 3799 |
| 886 | nmdc:mga06r32_8661_c1 | 3300050510 | Bacteria | 9168 |
| 887 | nmdc:mga08y16_115285_c1 | 3300050511 | Bacteria | 2797 |
| 888 | nmdc:mga08y16_22_c1 | 3300050511 | Bacteria | 250162 |
| 889 | nmdc:mga0rr50_145607_c2 | 3300050513 | Bacteria | 1563 |
| 890 | nmdc:mga08x19_185705_c1 | 3300050514 | Bacteria | 1421 |
| 891 | nmdc:mga0a205_119095_c1 | 3300050515 | Bacteria | 2539 |
| 892 | nmdc:mga0a205_90561_c1 | 3300050515 | Bacteria | 2956 |
| 893 | Ga0495601_0045849 | 3300053077 | Bacteria | 2751 |
| 894 | Ga0495601_0084683 | 3300053077 | Bacteria | 2037 |
| 895 | Ga0495595_0010711 | 3300053084 | Bacteria | 3819 |
| 896 | Ga0495619_0005570 | 3300053085 | Bacteria | 7989 |
| 897 | Ga0495619_0023411 | 3300053085 | Bacteria | 3959 |
| 898 | Ga0500644_0006740 | 3300053088 | Bacteria | 2959 |
| 899 | Ga0500583_0000027 | 3300053092 | Bacteria | 109138 |
| 900 | Ga0500583_0000598 | 3300053092 | Bacteria | 10793 |
| 901 | Ga0500566_0003670 | 3300053094 | Bacteria | 9165 |
| 902 | Ga0500589_038939 | 3300053147 | Unclassified | 2219 |
| 903 | Ga0500603_003764 | 3300053150 | Bacteria | 3247 |
| 904 | Ga0500603_038290 | 3300053150 | Bacteria | 1269 |
| 905 | Ga0501084_0159099 | 3300054114 | Unclassified | 1905 |
| 906 | Ga0501084_0214105 | 3300054114 | Bacteria | 1625 |
| 907 | Ga0501082_0004906 | 3300060353 | Bacteria | 11666 |
| 908 | Ga0501082_0015866 | 3300060353 | Bacteria | 6477 |
| 909 | Ga0501082_0042729 | 3300060353 | Bacteria | 3907 |
| 910 | Ga0530510_0002730 | 3300061734 | Bacteria | 12149 |
| 911 | Ga0530510_0033484 | 3300061734 | Bacteria | 3699 |
| 912 | Ga0530510_0086070 | 3300061734 | Bacteria | 2290 |
| 913 | Ga0530510_0104328 | 3300061734 | Bacteria | 2074 |
| 914 | Ga0530510_0138981 | 3300061734 | Bacteria | 1789 |
| 915 | Ga0530510_0140894 | 3300061734 | Bacteria | 1776 |
| 916 | 2644016548 | 2643221601 | Bacteria | 7493239 |
| 917 | 2644176468 | 2643221631 | Bacteria | 8168043 |
| 918 | 2738725136 | 2738541278 | Bacteria | 9755573 |
| 919 | Ga0068851_10016011 | |||
| 920 | JGI24751J29686_10000335 | |||
| 921 | JGI25406J46586_10023135 | |||
| 922 | rootH1_10004495 | |||
| 923 | rootH1_10155694 | |||
| 924 | Ga0065714_10019946 | |||
| 925 | Ga0065712_10000781 | |||
| 926 | Ga0065715_10155878 | |||
| 927 | Ga0065707_10091080 | |||
| 928 | Ga0065707_10118341 | |||
| 929 | Ga0070658_10001806 | |||
| 930 | Ga0070676_10015570 | |||
| 931 | Ga0070676_10113135 | |||
| 932 | Ga0070683_100005550 | |||
| 933 | Ga0070683_100020750 | |||
| 934 | Ga0070683_100132805 | |||
| 935 | Ga0070683_100236805 | |||
| 936 | Ga0070690_100003963 | |||
| 937 | Ga0070690_100040289 | |||
| 938 | Ga0070670_100012132 | |||
| 939 | Ga0070670_100018444 | |||
| 940 | Ga0070670_100025152 | |||
| 941 | Ga0070670_100052931 | |||
| 942 | Ga0070670_100064587 | |||
| 943 | Ga0070670_100083934 | |||
| 944 | Ga0070670_100206539 | |||
| 945 | Ga0070670_100248776 | |||
| 946 | Ga0070670_100251733 | |||
| 947 | Ga0070670_100302109 | |||
| 948 | Ga0068869_100024944 | |||
| 949 | Ga0068869_100066941 | |||
| 950 | Ga0068869_100087483 | |||
| 951 | Ga0068869_100386438 | |||
| 952 | Ga0070666_10001316 | |||
| 953 | Ga0070666_10005429 | |||
| 954 | Ga0070666_10021319 | |||
| 955 | Ga0070666_10029682 | |||
| 956 | Ga0070666_10089305 | |||
| 957 | Ga0070680_100006966 | |||
| 958 | Ga0070680_100043075 | |||
| 959 | Ga0070680_100425293 | |||
| 960 | Ga0070682_100006403 | |||
| 961 | Ga0070682_100095781 | |||
| 962 | Ga0068868_100008292 | |||
| 963 | Ga0068868_100015287 | |||
| 964 | Ga0068868_100158765 | |||
| 965 | Ga0070660_100031268 | |||
| 966 | Ga0070660_100192229 | |||
| 967 | Ga0070689_100031031 | |||
| 968 | Ga0070689_100073946 | |||
| 969 | Ga0070689_100174977 | |||
| 970 | Ga0070687_100001102 | |||
| 971 | Ga0070687_100059306 | |||
| 972 | Ga0070661_100009793 | |||
| 973 | Ga0070661_100013569 | |||
| 974 | Ga0070661_100085471 | |||
| 975 | Ga0070661_100142381 | |||
| 976 | Ga0070668_100000951 | |||
| 977 | Ga0070668_100023794 | |||
| 978 | Ga0070668_100113597 | |||
| 979 | Ga0070668_100271460 | |||
| 980 | Ga0070669_100037947 | |||
| 981 | Ga0070669_100053889 | |||
| 982 | Ga0070669_100092951 | |||
| 983 | Ga0070669_100210329 | |||
| 984 | Ga0070669_100242384 | |||
| 985 | Ga0070675_100008620 | |||
| 986 | Ga0070675_100011460 | |||
| 987 | Ga0070675_100033681 | |||
| 988 | Ga0070675_100099784 | |||
| 989 | Ga0070675_100116193 | |||
| 990 | Ga0070675_100340387 | |||
| 991 | Ga0070671_100011830 | |||
| 992 | Ga0070671_100116251 | |||
| 993 | Ga0070671_100380375 | |||
| 994 | Ga0070674_100007915 | |||
| 995 | Ga0070674_100069510 | |||
| 996 | Ga0070674_100149299 | |||
| 997 | Ga0070673_100002269 | |||
| 998 | Ga0070673_100091941 | |||
| 999 | Ga0070673_100113975 | |||
| 1000 | Ga0070673_100165222 | |||
| 1001 | Ga0070673_100315594 | |||
| 1002 | Ga0070688_100032273 | |||
| 1003 | Ga0070688_100037566 | |||
| 1004 | Ga0070688_100381889 | |||
| 1005 | Ga0070659_100025517 | |||
| 1006 | Ga0070659_100025984 | |||
| 1007 | Ga0070659_100118369 | |||
| 1008 | Ga0070659_100181859 | |||
| 1009 | Ga0070667_100005498 | |||
| 1010 | Ga0070667_100005708 | |||
| 1011 | Ga0070667_100137970 | |||
| 1012 | Ga0070667_100178526 | |||
| 1013 | Ga0070667_100205033 | |||
| 1014 | Ga0070667_100218193 | |||
| 1015 | Ga0070667_100228292 | |||
| 1016 | Ga0070667_100264626 | |||
| 1017 | Ga0070667_100320443 | |||
| 1018 | Ga0070708_100282992 | |||
| 1019 | Ga0070663_100119781 | |||
| 1020 | Ga0070663_100259117 | |||
| 1021 | Ga0070678_100095547 | |||
| 1022 | Ga0070662_100226440 | |||
| 1023 | Ga0070662_100228348 | |||
| 1024 | Ga0070662_100262169 | |||
| 1025 | Ga0070681_10073654 | |||
| 1026 | Ga0070681_10105715 | |||
| 1027 | Ga0070681_10123298 | |||
| 1028 | Ga0070681_10127861 | |||
| 1029 | Ga0070681_10257086 | |||
| 1030 | Ga0068867_100116337 | |||
| 1031 | Ga0068867_100450975 | |||
| 1032 | Ga0070685_10007265 | |||
| 1033 | Ga0070685_10033897 | |||
| 1034 | Ga0070685_10044525 | |||
| 1035 | Ga0070706_100265778 | |||
| 1036 | Ga0070707_100000032 | |||
| 1037 | Ga0070698_100001998 | |||
| 1038 | Ga0070698_100003211 | |||
| 1039 | Ga0070699_100119960 | |||
| 1040 | Ga0070699_100259085 | |||
| 1041 | Ga0070679_100002339 | |||
| 1042 | Ga0070679_100004116 | |||
| 1043 | Ga0070679_100013309 | |||
| 1044 | Ga0070679_100016964 | |||
| 1045 | Ga0070679_100024167 | |||
| 1046 | Ga0070679_100076615 | |||
| 1047 | Ga0070679_100525512 | |||
| 1048 | Ga0070684_100012839 | |||
| 1049 | Ga0070684_100411356 | |||
| 1050 | Ga0068853_100011024 | |||
| 1051 | Ga0068853_100045604 | |||
| 1052 | Ga0068853_100131745 | |||
| 1053 | Ga0068853_100216381 | |||
| 1054 | Ga0068853_100412894 | |||
| 1055 | Ga0070672_100005846 | |||
| 1056 | Ga0070672_100030941 | |||
| 1057 | Ga0070672_100047244 | |||
| 1058 | Ga0070672_100090118 | |||
| 1059 | Ga0070672_100106674 | |||
| 1060 | Ga0070672_100256135 | |||
| 1061 | Ga0070686_100004512 | |||
| 1062 | Ga0070686_100005546 | |||
| 1063 | Ga0070686_100042469 | |||
| 1064 | Ga0070693_100012709 | |||
| 1065 | Ga0070665_100051291 | |||
| 1066 | Ga0070665_100186816 | |||
| 1067 | Ga0070665_100258668 | |||
| 1068 | Ga0070665_100304326 | |||
| 1069 | Ga0070665_100523045 | |||
| 1070 | Ga0068855_100000014 | |||
| 1071 | Ga0068855_100043250 | |||
| 1072 | Ga0068855_100173463 | |||
| 1073 | Ga0068855_100213568 | |||
| 1074 | Ga0070664_100000492 | |||
| 1075 | Ga0070664_100022854 | |||
| 1076 | Ga0070664_100139951 | |||
| 1077 | Ga0070664_100195286 | |||
| 1078 | Ga0068857_100032403 | |||
| 1079 | Ga0068857_100034845 | |||
| 1080 | Ga0068857_100266590 | |||
| 1081 | Ga0068857_100286052 | |||
| 1082 | Ga0068857_100539105 | |||
| 1083 | Ga0068854_100064759 | |||
| 1084 | Ga0068854_100085130 | |||
| 1085 | Ga0068854_100127144 | |||
| 1086 | Ga0068854_100235901 | |||
| 1087 | Ga0068854_100360405 | |||
| 1088 | Ga0068856_100089457 | |||
| 1089 | Ga0068856_100395590 | |||
| 1090 | Ga0068852_100023253 | |||
| 1091 | Ga0068852_100046341 | |||
| 1092 | Ga0068859_100006459 | |||
| 1093 | Ga0068859_100017217 | |||
| 1094 | Ga0068859_100114918 | |||
| 1095 | Ga0068859_100180101 | |||
| 1096 | Ga0068859_100341549 | |||
| 1097 | Ga0068864_100000781 | |||
| 1098 | Ga0068864_100008888 | |||
| 1099 | Ga0068864_100051164 | |||
| 1100 | Ga0068866_10011514 | |||
| 1101 | Ga0068861_100029438 | |||
| 1102 | Ga0068861_100093705 | |||
| 1103 | Ga0068861_100339685 | |||
| 1104 | Ga0068861_100373493 | |||
| 1105 | Ga0068851_10079402 | |||
| 1106 | Ga0068863_100000221 | |||
| 1107 | Ga0068863_100022837 | |||
| 1108 | Ga0068863_100126403 | |||
| 1109 | Ga0068863_100186873 | |||
| 1110 | Ga0068858_100013096 | |||
| 1111 | Ga0068858_100026396 | |||
| 1112 | Ga0068858_100082124 | |||
| 1113 | Ga0068860_100006424 | |||
| 1114 | Ga0068860_100018722 | |||
| 1115 | Ga0068860_100188187 | |||
| 1116 | Ga0068860_100302272 | |||
| 1117 | Ga0068860_100378000 | |||
| 1118 | Ga0068862_100011917 | |||
| 1119 | Ga0068862_100221636 | |||
| 1120 | Ga0068862_100288606 | |||
| 1121 | Ga0081455_10007011 | |||
| 1122 | Ga0081455_10093709 | |||
| 1123 | Ga0081455_10285818 | |||
| 1124 | Ga0081539_10004015 | |||
| 1125 | Ga0081539_10004448 | |||
| 1126 | Ga0070715_10132209 | |||
| 1127 | Ga0070716_100059682 | |||
| 1128 | Ga0097621_100000554 | |||
| 1129 | Ga0097621_100019149 | |||
| 1130 | Ga0097621_100021327 | |||
| 1131 | Ga0097621_100021395 | |||
| 1132 | Ga0097621_100021757 | |||
| 1133 | Ga0097621_100039645 | |||
| 1134 | Ga0097621_100062570 | |||
| 1135 | Ga0068871_100001750 | |||
| 1136 | Ga0068871_100002575 | |||
| 1137 | Ga0068871_100003879 | |||
| 1138 | Ga0068871_100023121 | |||
| 1139 | Ga0068871_100037217 | |||
| 1140 | Ga0068871_100069994 | |||
| 1141 | Ga0068871_100107602 | |||
| 1142 | Ga0075428_100064824 | |||
| 1143 | Ga0075428_100148569 | |||
| 1144 | Ga0075428_100151035 | |||
| 1145 | Ga0075430_100005824 | |||
| 1146 | Ga0075430_100007274 | |||
| 1147 | Ga0075431_100002400 | |||
| 1148 | Ga0075431_100095188 | |||
| 1149 | Ga0075431_100134669 | |||
| 1150 | Ga0075431_100243672 | |||
| 1151 | Ga0075431_100363120 | |||
| 1152 | Ga0075431_100431028 | |||
| 1153 | Ga0075433_10224420 | |||
| 1154 | Ga0075433_10252385 | |||
| 1155 | Ga0075434_100063233 | |||
| 1156 | Ga0075429_100050163 | |||
| 1157 | Ga0075429_100091904 | |||
| 1158 | Ga0075429_100094474 | |||
| 1159 | Ga0075429_100108399 | |||
| 1160 | Ga0068865_100056511 | |||
| 1161 | Ga0068865_100124073 | |||
| 1162 | Ga0068865_100260300 | |||
| 1163 | Ga0097620_100006459 | |||
| 1164 | Ga0097620_100017217 | |||
| 1165 | Ga0097620_100114917 | |||
| 1166 | Ga0097620_100180104 | |||
| 1167 | Ga0097620_100309232 | |||
| 1168 | Ga0097620_100341549 | |||
| 1169 | Ga0099794_10022038 | |||
| 1170 | Ga0105240_10028359 | |||
| 1171 | Ga0105240_10043874 | |||
| 1172 | Ga0105240_10064765 | |||
| 1173 | Ga0105240_10169230 | |||
| 1174 | Ga0105240_10244183 | |||
| 1175 | Ga0111539_10000536 | |||
| 1176 | Ga0111539_10031210 | |||
| 1177 | Ga0111539_10076633 | |||
| 1178 | Ga0111539_10277409 | |||
| 1179 | Ga0111539_10489102 | |||
| 1180 | Ga0111539_10675418 | |||
| 1181 | Ga0105245_10001786 | |||
| 1182 | Ga0105245_10043077 | |||
| 1183 | Ga0105247_10001541 | |||
| 1184 | Ga0114129_10014027 | |||
| 1185 | Ga0114129_10093237 | |||
| 1186 | Ga0114129_10176339 | |||
| 1187 | Ga0114129_10194413 | |||
| 1188 | Ga0114129_10381086 | |||
| 1189 | Ga0114129_10558725 | |||
| 1190 | Ga0105243_10232472 | |||
| 1191 | Ga0105241_10004396 | |||
| 1192 | Ga0105241_10166884 | |||
| 1193 | Ga0105242_10003021 | |||
| 1194 | Ga0105242_10006100 | |||
| 1195 | Ga0105242_10022569 | |||
| 1196 | Ga0105242_10069023 | |||
| 1197 | Ga0105242_10098613 | |||
| 1198 | Ga0105248_10000048 | |||
| 1199 | Ga0105248_10015185 | |||
| 1200 | Ga0105248_10057845 | |||
| 1201 | Ga0105248_10185968 | |||
| 1202 | Ga0105248_10442529 | |||
| 1203 | Ga0105248_10448313 | |||
| 1204 | Ga0105237_10009302 | |||
| 1205 | Ga0105237_10093453 | |||
| 1206 | Ga0105238_10459933 | |||
| 1207 | Ga0105249_10013169 | |||
| 1208 | Ga0105249_10021095 | |||
| 1209 | Ga0105249_10058553 | |||
| 1210 | Ga0105249_10060141 | |||
| 1211 | Ga0105239_10012617 | |||
| 1212 | Ga0105239_10205151 | |||
| 1213 | Ga0105246_10042738 | |||
| 1214 | Ga0157373_10007196 | |||
| 1215 | Ga0157373_10025876 | |||
| 1216 | Ga0157373_10217816 | |||
| 1217 | Ga0157373_10341215 | |||
| 1218 | Ga0157371_10015347 | |||
| 1219 | Ga0157371_10030981 | |||
| 1220 | Ga0157371_10079361 | |||
| 1221 | Ga0157371_10185743 | |||
| 1222 | Ga0157370_10005480 | |||
| 1223 | Ga0157370_10011127 | |||
| 1224 | Ga0157370_10013214 | |||
| 1225 | Ga0157370_10029120 | |||
| 1226 | Ga0157370_10102080 | |||
| 1227 | Ga0157370_10121961 | |||
| 1228 | Ga0157370_10248094 | |||
| 1229 | Ga0157370_10509787 | |||
| 1230 | Ga0157369_10186487 | |||
| 1231 | Ga0157369_10305621 | |||
| 1232 | Ga0157374_10005430 | |||
| 1233 | Ga0157374_10022899 | |||
| 1234 | Ga0157374_10024433 | |||
| 1235 | Ga0157374_10053519 | |||
| 1236 | Ga0157374_10136846 | |||
| 1237 | Ga0157374_10161837 | |||
| 1238 | Ga0157374_10162036 | |||
| 1239 | Ga0157374_10196769 | |||
| 1240 | Ga0157374_10208221 | |||
| 1241 | Ga0157378_10000437 | |||
| 1242 | Ga0157378_10001754 | |||
| 1243 | Ga0157378_10002581 | |||
| 1244 | Ga0157378_10003439 | |||
| 1245 | Ga0157378_10087958 | |||
| 1246 | Ga0157378_10091891 | |||
| 1247 | Ga0157378_10284743 | |||
| 1248 | Ga0163162_10000523 | |||
| 1249 | Ga0163162_10005980 | |||
| 1250 | Ga0163162_10124903 | |||
| 1251 | Ga0163162_10286741 | |||
| 1252 | Ga0163162_10635131 | |||
| 1253 | Ga0157372_10015460 | |||
| 1254 | Ga0157372_10055142 | |||
| 1255 | Ga0157372_10067718 | |||
| 1256 | Ga0157372_10192125 | |||
| 1257 | Ga0157372_10334192 | |||
| 1258 | Ga0157372_10479819 | |||
| 1259 | Ga0157372_10651318 | |||
| 1260 | Ga0157375_10000262 | |||
| 1261 | Ga0157375_10001301 | |||
| 1262 | Ga0157375_10035272 | |||
| 1263 | Ga0157375_10122921 | |||
| 1264 | Ga0157375_10260729 | |||
| 1265 | Ga0157375_10310801 | |||
| 1266 | Ga0157375_10392539 | |||
| 1267 | Ga0157375_10438695 | |||
| 1268 | Ga0157375_10640445 | |||
| 1269 | Ga0163163_10001342 | |||
| 1270 | Ga0163163_10008192 | |||
| 1271 | Ga0163163_10008479 | |||
| 1272 | Ga0163163_10108304 | |||
| 1273 | Ga0163163_10116640 | |||
| 1274 | Ga0163163_10232956 | |||
| 1275 | Ga0163163_10378901 | |||
| 1276 | Ga0163163_10435545 | |||
| 1277 | Ga0157380_10010459 | |||
| 1278 | Ga0157380_10035103 | |||
| 1279 | Ga0157380_10050034 | |||
| 1280 | Ga0157380_10127011 | |||
| 1281 | Ga0157380_10205732 | |||
| 1282 | Ga0157380_10247718 | |||
| 1283 | Ga0157380_10426794 | |||
| 1284 | Ga0157377_10016681 | |||
| 1285 | Ga0157377_10030983 | |||
| 1286 | Ga0157377_10083580 | |||
| 1287 | Ga0157379_10000264 | |||
| 1288 | Ga0157379_10135713 | |||
| 1289 | Ga0157379_10167729 | |||
| 1290 | Ga0157379_10263715 | |||
| 1291 | Ga0157379_10268109 | |||
| 1292 | Ga0157376_10041099 | |||
| 1293 | Ga0157376_10056318 | |||
| 1294 | Ga0157376_10081417 | |||
| 1295 | Ga0157376_10101092 | |||
| 1296 | Ga0157376_10207736 | |||
| 1297 | Ga0163161_10018613 | |||
| 1298 | Ga0163161_10030173 | |||
| 1299 | Ga0163161_10083804 | |||
| 1300 | Ga0213872_10047235 | |||
| 1301 | Ga0213871_10004166 | |||
| 1302 | Ga0207697_10086919 | |||
| 1303 | Ga0207656_10000483 | |||
| 1304 | Ga0207688_10252598 | |||
| 1305 | Ga0207680_10001546 | |||
| 1306 | Ga0207680_10011290 | |||
| 1307 | Ga0207680_10026291 | |||
| 1308 | Ga0207680_10130427 | |||
| 1309 | Ga0207647_10010393 | |||
| 1310 | Ga0207647_10135566 | |||
| 1311 | Ga0207645_10018735 | |||
| 1312 | Ga0207645_10029340 | |||
| 1313 | Ga0207643_10017411 | |||
| 1314 | Ga0207705_10000623 | |||
| 1315 | Ga0207705_10072838 | |||
| 1316 | Ga0207684_10157635 | |||
| 1317 | Ga0207654_10028106 | |||
| 1318 | Ga0207654_10172482 | |||
| 1319 | Ga0207707_10019903 | |||
| 1320 | Ga0207707_10096788 | |||
| 1321 | Ga0207695_10005932 | |||
| 1322 | Ga0207695_10029463 | |||
| 1323 | Ga0207695_10034212 | |||
| 1324 | Ga0207695_10134545 | |||
| 1325 | Ga0207660_10033757 | |||
| 1326 | Ga0207660_10067556 | |||
| 1327 | Ga0207660_10071945 | |||
| 1328 | Ga0207660_10387918 | |||
| 1329 | Ga0207662_10002985 | |||
| 1330 | Ga0207662_10058259 | |||
| 1331 | Ga0207657_10010235 | |||
| 1332 | Ga0207657_10025421 | |||
| 1333 | Ga0207657_10119828 | |||
| 1334 | Ga0207649_10002503 | |||
| 1335 | Ga0207649_10025152 | |||
| 1336 | Ga0207649_10233776 | |||
| 1337 | Ga0207652_10002089 | |||
| 1338 | Ga0207652_10005426 | |||
| 1339 | Ga0207652_10021177 | |||
| 1340 | Ga0207652_10121649 | |||
| 1341 | Ga0207652_10170678 | |||
| 1342 | Ga0207652_10349652 | |||
| 1343 | Ga0207646_10000032 | |||
| 1344 | Ga0207646_10524475 | |||
| 1345 | Ga0207681_10108322 | |||
| 1346 | Ga0207681_10322777 | |||
| 1347 | Ga0207650_10000510 | |||
| 1348 | Ga0207650_10031978 | |||
| 1349 | Ga0207650_10067621 | |||
| 1350 | Ga0207650_10085894 | |||
| 1351 | Ga0207650_10090549 | |||
| 1352 | Ga0207650_10102126 | |||
| 1353 | Ga0207650_10115851 | |||
| 1354 | Ga0207650_10148330 | |||
| 1355 | Ga0207650_10177790 | |||
| 1356 | Ga0207650_10268623 | |||
| 1357 | Ga0207659_10000173 | |||
| 1358 | Ga0207659_10002371 | |||
| 1359 | Ga0207659_10020599 | |||
| 1360 | Ga0207659_10029299 | |||
| 1361 | Ga0207659_10286541 | |||
| 1362 | Ga0207644_10002882 | |||
| 1363 | Ga0207644_10015078 | |||
| 1364 | Ga0207690_10073407 | |||
| 1365 | Ga0207690_10147506 | |||
| 1366 | Ga0207690_10209824 | |||
| 1367 | Ga0207690_10263057 | |||
| 1368 | Ga0207690_10425887 | |||
| 1369 | Ga0207706_10052994 | |||
| 1370 | Ga0207706_10077398 | |||
| 1371 | Ga0207706_10112705 | |||
| 1372 | Ga0207686_10000884 | |||
| 1373 | Ga0207686_10171732 | |||
| 1374 | Ga0207670_10004333 | |||
| 1375 | Ga0207670_10029226 | |||
| 1376 | Ga0207670_10120701 | |||
| 1377 | Ga0207670_10351037 | |||
| 1378 | Ga0207704_10015131 | |||
| 1379 | Ga0207704_10091665 | |||
| 1380 | Ga0207691_10019398 | |||
| 1381 | Ga0207691_10019513 | |||
| 1382 | Ga0207691_10028488 | |||
| 1383 | Ga0207691_10121889 | |||
| 1384 | Ga0207691_10197390 | |||
| 1385 | Ga0207711_10000648 | |||
| 1386 | Ga0207711_10267390 | |||
| 1387 | Ga0207711_10305515 | |||
| 1388 | Ga0207689_10002805 | |||
| 1389 | Ga0207689_10040689 | |||
| 1390 | Ga0207689_10088810 | |||
| 1391 | Ga0207689_10244290 | |||
| 1392 | Ga0207661_10001069 | |||
| 1393 | Ga0207661_10036520 | |||
| 1394 | Ga0207661_10120313 | |||
| 1395 | Ga0207661_10244550 | |||
| 1396 | Ga0207679_10013567 | |||
| 1397 | Ga0207679_10021225 | |||
| 1398 | Ga0207679_10036606 | |||
| 1399 | Ga0207679_10320840 | |||
| 1400 | Ga0207667_10000049 | |||
| 1401 | Ga0207667_10019413 | |||
| 1402 | Ga0207667_10081514 | |||
| 1403 | Ga0207667_10198753 | |||
| 1404 | Ga0207667_10213407 | |||
| 1405 | Ga0207667_10253002 | |||
| 1406 | Ga0207651_10022287 | |||
| 1407 | Ga0207651_10040387 | |||
| 1408 | Ga0207651_10148977 | |||
| 1409 | Ga0207651_10294905 | |||
| 1410 | Ga0207712_10002170 | |||
| 1411 | Ga0207712_10013251 | |||
| 1412 | Ga0207668_10000663 | |||
| 1413 | Ga0207668_10032610 | |||
| 1414 | Ga0207668_10083168 | |||
| 1415 | Ga0207640_10012544 | |||
| 1416 | Ga0207640_10058766 | |||
| 1417 | Ga0207640_10069819 | |||
| 1418 | Ga0207640_10187764 | |||
| 1419 | Ga0207658_10010785 | |||
| 1420 | Ga0207658_10056336 | |||
| 1421 | Ga0207658_10132733 | |||
| 1422 | Ga0207658_10153660 | |||
| 1423 | Ga0207658_10195617 | |||
| 1424 | Ga0207658_10257330 | |||
| 1425 | Ga0207677_10028007 | |||
| 1426 | Ga0207677_10038103 | |||
| 1427 | Ga0207703_10013004 | |||
| 1428 | Ga0207703_10019904 | |||
| 1429 | Ga0207639_10005388 | |||
| 1430 | Ga0207639_10007679 | |||
| 1431 | Ga0207639_10086260 | |||
| 1432 | Ga0207639_10091546 | |||
| 1433 | Ga0207639_10093975 | |||
| 1434 | Ga0207639_10257563 | |||
| 1435 | Ga0207678_10170339 | |||
| 1436 | Ga0207708_10096778 | |||
| 1437 | Ga0207702_10051789 | |||
| 1438 | Ga0207641_10000561 | |||
| 1439 | Ga0207641_10001235 | |||
| 1440 | Ga0207641_10015720 | |||
| 1441 | Ga0207641_10035180 | |||
| 1442 | Ga0207641_10161340 | |||
| 1443 | Ga0207648_10002623 | |||
| 1444 | Ga0207648_10303428 | |||
| 1445 | Ga0207676_10026191 | |||
| 1446 | Ga0207676_10049325 | |||
| 1447 | Ga0207676_10082344 | |||
| 1448 | Ga0207676_10379983 | |||
| 1449 | Ga0207674_10033423 | |||
| 1450 | Ga0207674_10061864 | |||
| 1451 | Ga0207674_10212617 | |||
| 1452 | Ga0207674_10529904 | |||
| 1453 | Ga0207675_100049100 | |||
| 1454 | Ga0207675_100077458 | |||
| 1455 | Ga0207675_100429753 | |||
| 1456 | Ga0207683_10020712 | |||
| 1457 | Ga0207683_10124392 | |||
| 1458 | Ga0207683_10287154 | |||
| 1459 | Ga0207698_10018072 | |||
| 1460 | Ga0207698_10052775 | |||
| 1461 | Ga0207698_10327836 | |||
| 1462 | Ga0209974_10005581 | |||
| 1463 | Ga0207428_10000031 | |||
| 1464 | Ga0268266_10191970 | |||
| 1465 | Ga0268266_10209886 | |||
| 1466 | Ga0268266_10269806 | |||
| 1467 | Ga0268266_10280572 | |||
| 1468 | Ga0268266_10476697 | |||
| 1469 | Ga0268265_10062858 | |||
| 1470 | Ga0268265_10097521 | |||
| 1471 | Ga0268265_10219681 | |||
| 1472 | Ga0268264_10007005 | |||
| 1473 | Ga0268264_10030284 | |||
| 1474 | Ga0268264_10059906 | |||
| 1475 | Ga0268264_10316568 | |||
| 1476 | Ga0268264_10454451 | |||
| 1477 | Ga0265337_1001644 | |||
| 1478 | Ga0265326_10013130 | |||
| 1479 | Ga0265318_10000195 | |||
| 1480 | Ga0265323_10005862 | |||
| 1481 | Ga0265322_10001230 | |||
| 1482 | Ga0307515_10000092 | |||
| 1483 | Ga0265338_10077849 | |||
| 1484 | Ga0265338_10169127 | |||
| 1485 | Ga0265330_10009657 | |||
| 1486 | Ga0265332_10036575 | |||
| 1487 | Ga0265320_10000070 | |||
| 1488 | Ga0265325_10005122 | |||
| 1489 | Ga0265325_10033045 | |||
| 1490 | Ga0265325_10135437 | |||
| 1491 | Ga0265329_10000929 | |||
| 1492 | Ga0265340_10000108 | |||
| 1493 | Ga0265340_10003007 | |||
| 1494 | Ga0265339_10034529 | |||
| 1495 | Ga0265339_10087891 | |||
| 1496 | Ga0265331_10003091 | |||
| 1497 | Ga0265316_10006923 | |||
| 1498 | Ga0265316_10080444 | |||
| 1499 | Ga0265316_10100115 | |||
| 1500 | Ga0307513_10125887 | |||
| 1501 | Ga0307509_10107579 | |||
| 1502 | Ga0307408_100040397 | |||
| 1503 | Ga0307408_100040579 | |||
| 1504 | Ga0265313_10001878 | |||
| 1505 | Ga0265313_10039862 | |||
| 1506 | Ga0316575_10001544 | |||
| 1507 | Ga0316575_10002566 | |||
| 1508 | Ga0316575_10012027 | |||
| 1509 | Ga0316575_10052820 | |||
| 1510 | Ga0316579_10057577 | |||
| 1511 | Ga0316579_10073899 | |||
| 1512 | Ga0265314_10000104 | |||
| 1513 | Ga0265314_10050435 | |||
| 1514 | Ga0265314_10054940 | |||
| 1515 | Ga0265342_10000433 | |||
| 1516 | Ga0265342_10001030 | |||
| 1517 | Ga0316576_10003610 | |||
| 1518 | Ga0316576_10006995 | |||
| 1519 | Ga0316576_10008823 | |||
| 1520 | Ga0316576_10048941 | |||
| 1521 | Ga0316576_10052550 | |||
| 1522 | Ga0316576_10127808 | |||
| 1523 | Ga0316576_10198194 | |||
| 1524 | Ga0316578_10002870 | |||
| 1525 | Ga0316578_10003237 | |||
| 1526 | Ga0316578_10007341 | |||
| 1527 | Ga0316578_10161863 | |||
| 1528 | Ga0316578_10172301 | |||
| 1529 | Ga0307405_10050942 | |||
| 1530 | Ga0316577_10021897 | |||
| 1531 | Ga0316577_10074270 | |||
| 1532 | Ga0307410_10013477 | |||
| 1533 | Ga0307410_10017356 | |||
| 1534 | Ga0307410_10040082 | |||
| 1535 | Ga0307410_10123549 | |||
| 1536 | Ga0307410_10299823 | |||
| 1537 | Ga0307407_10045299 | |||
| 1538 | Ga0307412_10232205 | |||
| 1539 | Ga0307409_100085900 | |||
| 1540 | Ga0307409_100306417 | |||
| 1541 | Ga0307416_100027174 | |||
| 1542 | Ga0307416_100056409 | |||
| 1543 | Ga0307416_100135889 | |||
| 1544 | Ga0307414_10367887 | |||
| 1545 | Ga0307411_10038303 | |||
| 1546 | Ga0307411_10042060 | |||
| 1547 | Ga0307411_10189530 | |||
| 1548 | Ga0307411_10235310 | |||
| 1549 | Ga0307411_10308563 | |||
| 1550 | Ga0307415_100030729 | |||
| 1551 | Ga0307415_100240574 | |||
| 1552 | Ga0316583_10003577 | |||
| 1553 | Ga0316583_10004947 | |||
| 1554 | Ga0316583_10008550 | |||
| 1555 | Ga0316583_10021390 | |||
| 1556 | Ga0316583_10026515 | |||
| 1557 | Ga0316583_10035788 | |||
| 1558 | Ga0316583_10040292 | |||
| 1559 | Ga0316583_10048860 | |||
| 1560 | Ga0316585_10008588 | |||
| 1561 | Ga0316585_10052164 | |||
| 1562 | Ga0316580_10000900 | |||
| 1563 | Ga0316580_10001815 | |||
| 1564 | Ga0316580_10056442 | |||
| 1565 | Ga0316592_1006636 | |||
| 1566 | Ga0316588_1040045 | |||
| 1567 | Ga0373953_0095547 | |||
| 1568 | Ga0373953_0148845 | |||
| 1569 | Ga0373955_0073320 | |||
| 1570 | Ga0316574_0012270 | |||
| 1571 | Ga0316574_0014180 | |||
| 1572 | Ga0316574_0027730 | |||
| 1573 | Ga0373947_0251800 | |||
| 1574 | Ga0373937_0012246 | |||
| 1575 | Ga0373937_0043557 | |||
| 1576 | Ga0373937_0135290 | |||
| 1577 | Ga0373937_0436749 | |||
| 1578 | Ga0316582_0016664 | |||
| 1579 | Ga0316582_0055855 | |||
| 1580 | Ga0316584_0004299 | |||
| 1581 | Ga0316584_0004621 | |||
| 1582 | Ga0316584_0004631 | |||
| 1583 | Ga0373925_0497364 | |||
| 1584 | Ga0395899_0017367 | |||
| 1585 | Ga0395900_0018883 | |||
| 1586 | Ga0395900_0027156 | |||
| 1587 | Ga0395900_0124498 | |||
| 1588 | Ga0395898_0001959 | |||
| 1589 | Ga0395898_0085750 | |||
| 1590 | Ga0395898_0154787 | |||
| 1591 | Ga0395905_0012005 | |||
| 1592 | Ga0316581_0027607 | |||
| 1593 | Ga0316581_0034851 | |||
| 1594 | Ga0395901_0001045 | |||
| 1595 | Ga0395901_0009760 | |||
| 1596 | Ga0395901_0015422 | |||
| 1597 | Ga0436365_0336651 | |||
| 1598 | Ga0436360_0105708 | |||
| 1599 | Ga0436361_0740991 | |||
| 1600 | Ga0436362_0346855 | |||
| 1601 | Ga0439449_0040168 | |||
| 1602 | Ga0439435_0049817 | |||
| 1603 | Ga0451577_0003018 | |||
| 1604 | Ga0451577_0016447 | |||
| 1605 | Ga0451577_0102493 | |||
| 1606 | Ga0451577_0123283 | |||
| 1607 | Ga0451577_0147235 | |||
| 1608 | Ga0451577_0247500 | |||
| 1609 | Ga0466972_0000009 | |||
| 1610 | Ga0453683_0049204 | |||
| 1611 | Ga0453683_0204881 | |||
| 1612 | Ga0453684_0000220 | |||
| 1613 | Ga0453684_0029795 | |||
| 1614 | Ga0453684_0120717 | |||
| 1615 | Ga0453684_0153749 | |||
| 1616 | Ga0453684_0187841 | |||
| 1617 | Ga0453684_0349268 | |||
| 1618 | Ga0453684_0464060 | |||
| 1619 | Ga0453684_0481969 | |||
| 1620 | Ga0453684_0518598 | |||
| 1621 | Ga0466957_0033462 | |||
| 1622 | Ga0451576_0030100 | |||
| 1623 | Ga0451576_0031338 | |||
| 1624 | Ga0451576_0255094 | |||
| 1625 | Ga0495592_0054446 | |||
| 1626 | Ga0495629_0105738 | |||
| 1627 | Ga0495629_0145201 | |||
| 1628 | Ga0495629_0193814 | |||
| 1629 | Ga0495651_0000090 | |||
| 1630 | Ga0495651_0139011 | |||
| 1631 | Ga0495580_0163858 | |||
| 1632 | Ga0495662_0009490 | |||
| 1633 | Ga0495664_0187534 | |||
| 1634 | Ga0495585_0000525 | |||
| 1635 | Ga0495618_0038745 | |||
| 1636 | Ga0495618_0170044 | |||
| 1637 | Ga0495630_0012249 | |||
| 1638 | Ga0495630_0361005 | |||
| 1639 | Ga0495643_0009334 | |||
| 1640 | Ga0495640_0081835 | |||
| 1641 | Ga0495640_0163101 | |||
| 1642 | Ga0495587_0034140 | |||
| 1643 | Ga0495587_0054565 | |||
| 1644 | Ga0495587_0094614 | |||
| 1645 | Ga0495598_0007722 | |||
| 1646 | Ga0495645_0020717 | |||
| 1647 | Ga0495667_0005808 | |||
| 1648 | Ga0495667_0030382 | |||
| 1649 | Ga0495656_0001607 | |||
| 1650 | Ga0495656_0118129 | |||
| 1651 | Ga0495634_0038710 | |||
| 1652 | Ga0495635_0014765 | |||
| 1653 | Ga0495657_0002664 | |||
| 1654 | Ga0495657_0220443 | |||
| 1655 | Ga0495599_0119314 | |||
| 1656 | Ga0495599_0189701 | |||
| 1657 | Ga0495658_0015758 | |||
| 1658 | Ga0495658_0094565 | |||
| 1659 | Ga0495658_0138528 | |||
| 1660 | Ga0495669_0006927 | |||
| 1661 | Ga0495613_0043195 | |||
| 1662 | Ga0495670_0124712 | |||
| 1663 | Ga0495670_0125443 | |||
| 1664 | Ga0495670_0159165 | |||
| 1665 | Ga0495600_0027708 | |||
| 1666 | Ga0495600_0122883 | |||
| 1667 | Ga0495581_0079809 | |||
| 1668 | Ga0495604_0006369 | |||
| 1669 | Ga0495604_0111219 | |||
| 1670 | Ga0495604_0220447 | |||
| 1671 | Ga0495636_0000016 | |||
| 1672 | Ga0495674_0061772 | |||
| 1673 | Ga0495674_0168095 | |||
| 1674 | Ga0495680_0001014 | |||
| 1675 | Ga0495680_0047511 | |||
| 1676 | Ga0495675_0021392 | |||
| 1677 | Ga0495675_0051785 | |||
| 1678 | Ga0495684_0057463 | |||
| 1679 | Ga0495684_0158850 | |||
| 1680 | Ga0495602_0092839 | |||
| 1681 | Ga0495602_0199484 | |||
| 1682 | Ga0496101_0201633 | |||
| 1683 | Ga0496102_0065747 | |||
| 1684 | Ga0496104_0088030 | |||
| 1685 | Ga0496105_0087649 | |||
| 1686 | Ga0496106_0061170 | |||
| 1687 | Ga0496107_0029175 | |||
| 1688 | Ga0496108_0057265 | |||
| 1689 | Ga0496108_0143849 | |||
| 1690 | Ga0496108_0161989 | |||
| 1691 | Ga0496109_0130602 | |||
| 1692 | Ga0496109_0476539 | |||
| 1693 | Ga0496112_0117533 | |||
| 1694 | Ga0496112_0702373 | |||
| 1695 | Ga0496114_0058821 | |||
| 1696 | Ga0496114_0135287 | |||
| 1697 | Ga0501032_0128267 | |||
| 1698 | Ga0501033_0045063 | |||
| 1699 | Ga0501033_0226804 | |||
| 1700 | Ga0501034_0010869 | |||
| 1701 | Ga0501034_0011076 | |||
| 1702 | Ga0501036_0006252 | |||
| 1703 | Ga0501036_0115614 | |||
| 1704 | Ga0501037_0014266 | |||
| 1705 | Ga0501037_0038256 | |||
| 1706 | Ga0501038_0069442 | |||
| 1707 | Ga0501038_0090020 | |||
| 1708 | Ga0501038_0112482 | |||
| 1709 | Ga0501038_0116511 | |||
| 1710 | Ga0501038_0247264 | |||
| 1711 | Ga0501039_0016664 | |||
| 1712 | Ga0501039_0022435 | |||
| 1713 | Ga0501039_0084494 | |||
| 1714 | Ga0501040_0001939 | |||
| 1715 | Ga0501040_0028138 | |||
| 1716 | Ga0501042_0014495 | |||
| 1717 | Ga0501042_0095252 | |||
| 1718 | Ga0501043_0150986 | |||
| 1719 | Ga0501043_0166570 | |||
| 1720 | Ga0501046_0018198 | |||
| 1721 | Ga0501046_0062127 | |||
| 1722 | Ga0501046_0158663 | |||
| 1723 | Ga0501047_0034670 | |||
| 1724 | Ga0501047_0137193 | |||
| 1725 | Ga0501048_0009500 | |||
| 1726 | Ga0501048_0046381 | |||
| 1727 | Ga0501048_0210136 | |||
| 1728 | Ga0501067_0000249 | |||
| 1729 | Ga0501067_0043941 | |||
| 1730 | Ga0501068_0270012 | |||
| 1731 | Ga0501070_0209990 | |||
| 1732 | Ga0501072_0022119 | |||
| 1733 | Ga0501073_0031033 | |||
| 1734 | Ga0501074_0059882 | |||
| 1735 | Ga0501074_0095165 | |||
| 1736 | Ga0501075_0008564 | |||
| 1737 | Ga0501075_0093423 | |||
| 1738 | Ga0501075_0430622 | |||
| 1739 | Ga0501076_0008547 | |||
| 1740 | Ga0501076_0033519 | |||
| 1741 | Ga0501076_0181864 | |||
| 1742 | Ga0501076_0301692 | |||
| 1743 | Ga0501076_0305508 | |||
| 1744 | Ga0501076_0441263 | |||
| 1745 | Ga0501077_0009906 | |||
| 1746 | Ga0501198_012893 | |||
| 1747 | Ga0501202_029143 | |||
| 1748 | Ga0501217_000055 | |||
| 1749 | Ga0501222_004506 | |||
| 1750 | Ga0501223_001899 | |||
| 1751 | Ga0501233_004326 | |||
| 1752 | Ga0501243_000975 | |||
| 1753 | Ga0501259_001374 | |||
| 1754 | Ga0501221_000337 | |||
| 1755 | Ga0501225_0001107 | |||
| 1756 | Ga0501225_0001987 | |||
| 1757 | Ga0501245_000875 | |||
| 1758 | Ga0501079_0010716 | |||
| 1759 | Ga0501079_0060330 | |||
| 1760 | Ga0501079_0146628 | |||
| 1761 | Ga0501079_0158162 | |||
| 1762 | Ga0501079_0188864 | |||
| 1763 | Ga0501080_0004871 | |||
| 1764 | Ga0501080_0014784 | |||
| 1765 | Ga0501080_0064218 | |||
| 1766 | Ga0501080_0395661 | |||
| 1767 | Ga0501081_0007334 | |||
| 1768 | Ga0501081_0012374 | |||
| 1769 | Ga0501081_0135937 | |||
| 1770 | Ga0501083_0006560 | |||
| 1771 | Ga0501083_0062118 | |||
| 1772 | Ga0501083_0267033 | |||
| 1773 | Ga0501263_007208 | |||
| 1774 | Ga0501268_023281 | |||
| 1775 | Ga0501035_0035768 | |||
| 1776 | Ga0501035_0133458 | |||
| 1777 | Ga0501044_0002454 | |||
| 1778 | Ga0501044_0044779 | |||
| 1779 | Ga0501044_0101639 | |||
| 1780 | Ga0501044_0250010 | |||
| 1781 | Ga0501045_0002074 | |||
| 1782 | Ga0501045_0039920 | |||
| 1783 | Ga0501045_0043711 | |||
| 1784 | Ga0501045_0051695 | |||
| 1785 | nmdc:mga05p37_142569_c1 | |||
| 1786 | nmdc:mga05p37_148017_c1 | |||
| 1787 | nmdc:mga05p37_462788_c1 | |||
| 1788 | nmdc:mga05p37_50876_c1 | |||
| 1789 | nmdc:mga05p37_561131_c1 | |||
| 1790 | nmdc:mga09592_275417_c1 | |||
| 1791 | nmdc:mga09592_40794_c1 | |||
| 1792 | nmdc:mga09592_72684_c1 | |||
| 1793 | nmdc:mga09592_87369_c1 | |||
| 1794 | nmdc:mga09592_99597_c1 | |||
| 1795 | nmdc:mga0qj67_12488_c1 | |||
| 1796 | nmdc:mga0qj67_2698_c1 | |||
| 1797 | nmdc:mga0qj67_32779_c1 | |||
| 1798 | nmdc:mga0qj67_53056_c1 | |||
| 1799 | nmdc:mga06r32_354305_c1 | |||
| 1800 | nmdc:mga06r32_418705_c1 | |||
| 1801 | nmdc:mga06r32_47840_c1 | |||
| 1802 | nmdc:mga06r32_54656_c1 | |||
| 1803 | nmdc:mga06r32_55517_c1 | |||
| 1804 | nmdc:mga06r32_8661_c1 | |||
| 1805 | nmdc:mga08y16_115285_c1 | |||
| 1806 | nmdc:mga08y16_22_c1 | |||
| 1807 | nmdc:mga0rr50_145607_c2 | |||
| 1808 | nmdc:mga08x19_185705_c1 | |||
| 1809 | nmdc:mga0a205_119095_c1 | |||
| 1810 | nmdc:mga0a205_90561_c1 | |||
| 1811 | Ga0495601_0045849 | |||
| 1812 | Ga0495601_0084683 | |||
| 1813 | Ga0495595_0010711 | |||
| 1814 | Ga0495619_0005570 | |||
| 1815 | Ga0495619_0023411 | |||
| 1816 | Ga0500644_0006740 | |||
| 1817 | Ga0500583_0000027 | |||
| 1818 | Ga0500583_0000598 | |||
| 1819 | Ga0500566_0003670 | |||
| 1820 | Ga0500589_038939 | |||
| 1821 | Ga0500603_003764 | |||
| 1822 | Ga0500603_038290 | |||
| 1823 | Ga0501084_0159099 | |||
| 1824 | Ga0501084_0214105 | |||
| 1825 | Ga0501082_0004906 | |||
| 1826 | Ga0501082_0015866 | |||
| 1827 | Ga0501082_0042729 | |||
| 1828 | Ga0530510_0002730 | |||
| 1829 | Ga0530510_0033484 | |||
| 1830 | Ga0530510_0086070 | |||
| 1831 | Ga0530510_0104328 | |||
| 1832 | Ga0530510_0138981 | |||
| 1833 | Ga0530510_0140894 | |||
| 1834 | 2644016548 | |||
| 1835 | 2644176468 | |||
| 1836 | 2738725136 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dxf-assembly2.cif.gz_B | crystal structure of the hscarg r37a mutant | 0.897 | 4 | 301 |
| 3dxf-assembly2.cif.gz_B | crystal structure of the hscarg r37a mutant | 0.8909 | 4 | 301 |
| 2wmd-assembly1.cif.gz_A-2 | crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid | 0.8858 | 4 | 304 |
| 3dxf-assembly1.cif.gz_A | crystal structure of the hscarg r37a mutant | 0.8842 | 4 | 301 |
| 2wmd-assembly1.cif.gz_A-2 | crystal structure of nmra-like family domain containing protein 1 in complex with nadp and 2-(4-chloro-phenylamino)-nicotinic acid | 0.883 | 4 | 304 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dxfA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8415 | 4 | 287 | 3.40.50.720 |
| 3dxfA02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.8404 | 156 | 301 | 3.90.25.10 |
| 5f5lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8348 | 3 | 305 | 3.40.50.720 |
| 3dxfA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8331 | 4 | 287 | 3.40.50.720 |
| 5f5lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8321 | 3 | 305 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533XDF9-F1-model_v4 | NmrA/HSCARG family protein | 0.9939 | 137 | 305 |
|
| AF-A0A524LHP2-F1-model_v4 | NmrA/HSCARG family protein | 0.9934 | 60 | 305 |
|
| AF-A0A7Y2CQ11-F1-model_v4 | NmrA family NAD(P)-binding protein | 0.9864 | 178 | 305 |
|
| AF-A0A838NQV1-F1-model_v4 | NmrA family NAD(P)-binding protein | 0.9861 | 165 | 305 |
|
| AF-A0A524LHP2-F1-model_v4 | NmrA/HSCARG family protein | 0.9854 | 60 | 305 |
|