F485679
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 918 | 398 | 1836 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300060353|Ga0501082_1227889|Ga0501082_1227889_55_645 |
| Length | 196 |
| Sequence | MLCSKVCHDVINPVAAMENGFQLLEMDQKPESREEAMKLIQHSAVQATAKLKYARIAFGSSGSPTAQVDVGDAGDLGRQLFEPEIKVEFSIPKTLLAKNRVKLLLNMMLIAASAVSRGGTMKVDPIGSGETMGFTVKVEAERVRMHPSTEGLLAGTPAEALTAQTIQPFYTGVLAREQGMKLTLAADAASAALTAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 130 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 131 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 132 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 133 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 227 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 238 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 240 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 243 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 245 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 277 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 278 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 381 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 382 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 395 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 396 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 397 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 0 |
| Rhizoplane | 7.52 |
| Rhizosphere | 90.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501082_1227889 | 3300060353 | Bacteria | 655 |
| 2 | SwRhRL2b_contig_2732496 | 2162886007 | Bacteria | 862 |
| 3 | 2214544922 | 2209111006 | Bacteria | 19930 |
| 4 | ARSoilYngRDRAFT_c00038 | 3300000042 | Bacteria | 20556 |
| 5 | ARSoilOldRDRAFT_c000060 | 3300000044 | Bacteria | 22426 |
| 6 | ARCol0yngRDRAFT_1000282 | 3300000652 | Bacteria | 8006 |
| 7 | JGI24032J14994_100092 | 3300001430 | Bacteria | 3958 |
| 8 | JGI24752J21851_1012767 | 3300001976 | Bacteria | 1097 |
| 9 | JGI24746J21847_1000292 | 3300001977 | Bacteria | 7164 |
| 10 | JGI24747J21853_1000026 | 3300001978 | Bacteria | 5514 |
| 11 | JGI24747J21853_1001037 | 3300001978 | Bacteria | 1974 |
| 12 | JGI24739J22299_10005110 | 3300001989 | Bacteria | 4996 |
| 13 | JGI24739J22299_10005427 | 3300001989 | Bacteria | 4845 |
| 14 | JGI24737J22298_10057301 | 3300001990 | Bacteria | 1176 |
| 15 | JGI24745J21846_1000461 | 3300002073 | Bacteria | 3614 |
| 16 | JGI24745J21846_1000497 | 3300002073 | Bacteria | 3487 |
| 17 | JGI24738J21930_10000821 | 3300002075 | Bacteria | 8887 |
| 18 | JGI24738J21930_10000907 | 3300002075 | Bacteria | 8520 |
| 19 | JGI24749J21850_1002488 | 3300002076 | Bacteria | 2587 |
| 20 | JGI24744J21845_10000074 | 3300002077 | Bacteria | 12517 |
| 21 | JGI24035J26624_1000024 | 3300002126 | Bacteria | 10977 |
| 22 | JGI24035J26624_1000069 | 3300002126 | Bacteria | 8293 |
| 23 | JGI24742J22300_10000438 | 3300002244 | Bacteria | 6124 |
| 24 | JGI24751J29686_10006843 | 3300002459 | Bacteria | 2325 |
| 25 | JGI25153J46596_10000746 | 3300003215 | Bacteria | 19890 |
| 26 | JGI25405J52794_10009415 | 3300003911 | Bacteria | 1844 |
| 27 | Ga0065716_1002124 | 3300005277 | Bacteria | 2233 |
| 28 | Ga0065704_10152132 | 3300005289 | Bacteria | 1420 |
| 29 | Ga0065712_10005784 | 3300005290 | Bacteria | 4533 |
| 30 | Ga0065712_10022877 | 3300005290 | Bacteria | 1332 |
| 31 | Ga0065715_10029504 | 3300005293 | Bacteria | 1416 |
| 32 | Ga0065707_10182436 | 3300005295 | Bacteria | 1410 |
| 33 | Ga0065707_10211669 | 3300005295 | Bacteria | 1263 |
| 34 | Ga0070676_10000085 | 3300005328 | Bacteria | 32591 |
| 35 | Ga0070676_10627921 | 3300005328 | Bacteria | 777 |
| 36 | Ga0070683_100003426 | 3300005329 | Bacteria | 12877 |
| 37 | Ga0070683_100305116 | 3300005329 | Bacteria | 1515 |
| 38 | Ga0070690_100012202 | 3300005330 | Bacteria | 5050 |
| 39 | Ga0070690_100108706 | 3300005330 | Bacteria | 1848 |
| 40 | Ga0070690_100166829 | 3300005330 | Bacteria | 1513 |
| 41 | Ga0070690_100342153 | 3300005330 | Bacteria | 1083 |
| 42 | Ga0070670_100003301 | 3300005331 | Bacteria | 13350 |
| 43 | Ga0070670_101002555 | 3300005331 | Bacteria | 759 |
| 44 | Ga0070677_10000381 | 3300005333 | Bacteria | 15617 |
| 45 | Ga0068869_100000832 | 3300005334 | Bacteria | 17622 |
| 46 | Ga0070666_10027668 | 3300005335 | Bacteria | 3715 |
| 47 | Ga0070666_10304968 | 3300005335 | Bacteria | 1134 |
| 48 | Ga0070680_100005798 | 3300005336 | Bacteria | 9376 |
| 49 | Ga0070680_100101502 | 3300005336 | Bacteria | 2388 |
| 50 | Ga0070680_100116146 | 3300005336 | Bacteria | 2230 |
| 51 | Ga0070682_100009144 | 3300005337 | Bacteria | 5601 |
| 52 | Ga0070682_100957295 | 3300005337 | Unclassified | 707 |
| 53 | Ga0068868_100000495 | 3300005338 | Bacteria | 26269 |
| 54 | Ga0070660_100018334 | 3300005339 | Bacteria | 5113 |
| 55 | Ga0070660_100024732 | 3300005339 | Bacteria | 4458 |
| 56 | Ga0070660_100288492 | 3300005339 | Bacteria | 1344 |
| 57 | Ga0070660_100400823 | 3300005339 | Bacteria | 1134 |
| 58 | Ga0070689_100001147 | 3300005340 | Bacteria | 16737 |
| 59 | Ga0070689_100021981 | 3300005340 | Bacteria | 4757 |
| 60 | Ga0070689_100237691 | 3300005340 | Bacteria | 1499 |
| 61 | Ga0070689_100251261 | 3300005340 | Bacteria | 1459 |
| 62 | Ga0070691_10004705 | 3300005341 | Bacteria | 6207 |
| 63 | Ga0070687_100004649 | 3300005343 | Bacteria | 5486 |
| 64 | Ga0070687_100005813 | 3300005343 | Bacteria | 5014 |
| 65 | Ga0070661_100000983 | 3300005344 | Bacteria | 20204 |
| 66 | Ga0070661_100371049 | 3300005344 | Bacteria | 1126 |
| 67 | Ga0070692_10008860 | 3300005345 | Bacteria | 4507 |
| 68 | Ga0070692_10044442 | 3300005345 | Bacteria | 2288 |
| 69 | Ga0070668_100005583 | 3300005347 | Bacteria | 9331 |
| 70 | Ga0070668_100361461 | 3300005347 | Bacteria | 1231 |
| 71 | Ga0070668_100568511 | 3300005347 | Bacteria | 988 |
| 72 | Ga0070668_100774944 | 3300005347 | Bacteria | 850 |
| 73 | Ga0070668_101216702 | 3300005347 | Bacteria | 683 |
| 74 | Ga0070669_100002421 | 3300005353 | Bacteria | 13502 |
| 75 | Ga0070669_100098467 | 3300005353 | Bacteria | 2203 |
| 76 | Ga0070669_100204275 | 3300005353 | Bacteria | 1556 |
| 77 | Ga0070669_100736395 | 3300005353 | Bacteria | 834 |
| 78 | Ga0070675_100001045 | 3300005354 | Bacteria | 19938 |
| 79 | Ga0070675_100113993 | 3300005354 | Bacteria | 2290 |
| 80 | Ga0070675_100883406 | 3300005354 | Bacteria | 819 |
| 81 | Ga0070671_100000386 | 3300005355 | Bacteria | 30345 |
| 82 | Ga0070671_100008347 | 3300005355 | Bacteria | 8296 |
| 83 | Ga0070674_100008419 | 3300005356 | Bacteria | 6142 |
| 84 | Ga0070674_100666926 | 3300005356 | Bacteria | 885 |
| 85 | Ga0070673_100000035 | 3300005364 | Bacteria | 57163 |
| 86 | Ga0070673_100069576 | 3300005364 | Bacteria | 2821 |
| 87 | Ga0070673_100205254 | 3300005364 | Bacteria | 1699 |
| 88 | Ga0070673_100884911 | 3300005364 | Bacteria | 827 |
| 89 | Ga0070688_100000837 | 3300005365 | Bacteria | 15251 |
| 90 | Ga0070688_100019122 | 3300005365 | Bacteria | 3966 |
| 91 | Ga0070688_100050002 | 3300005365 | Bacteria | 2603 |
| 92 | Ga0070688_100151172 | 3300005365 | Bacteria | 1587 |
| 93 | Ga0070688_100161291 | 3300005365 | Bacteria | 1541 |
| 94 | Ga0070688_100289209 | 3300005365 | Bacteria | 1180 |
| 95 | Ga0070688_100300461 | 3300005365 | Bacteria | 1160 |
| 96 | Ga0070659_100019273 | 3300005366 | Bacteria | 5166 |
| 97 | Ga0070659_100024284 | 3300005366 | Bacteria | 4645 |
| 98 | Ga0070659_100393008 | 3300005366 | Bacteria | 1170 |
| 99 | Ga0070667_100007647 | 3300005367 | Bacteria | 8962 |
| 100 | Ga0070667_100032699 | 3300005367 | Bacteria | 4340 |
| 101 | Ga0070667_100486802 | 3300005367 | Bacteria | 1130 |
| 102 | Ga0070667_100647417 | 3300005367 | Bacteria | 975 |
| 103 | Ga0070667_100683930 | 3300005367 | Bacteria | 948 |
| 104 | Ga0070703_10032866 | 3300005406 | Bacteria | 1578 |
| 105 | Ga0070709_10091189 | 3300005434 | Bacteria | 2011 |
| 106 | Ga0070709_10208312 | 3300005434 | Bacteria | 1388 |
| 107 | Ga0070714_100016115 | 3300005435 | Bacteria | 6027 |
| 108 | Ga0070713_100009258 | 3300005436 | Bacteria | 7038 |
| 109 | Ga0070713_100305072 | 3300005436 | Bacteria | 1467 |
| 110 | Ga0070710_10015346 | 3300005437 | Bacteria | 3875 |
| 111 | Ga0070701_10000908 | 3300005438 | Bacteria | 10710 |
| 112 | Ga0070701_10130838 | 3300005438 | Bacteria | 1425 |
| 113 | Ga0070701_10191673 | 3300005438 | Bacteria | 1203 |
| 114 | Ga0070701_10258138 | 3300005438 | Bacteria | 1055 |
| 115 | Ga0070711_100077042 | 3300005439 | Bacteria | 2365 |
| 116 | Ga0070705_100052320 | 3300005440 | Bacteria | 2385 |
| 117 | Ga0070700_100010171 | 3300005441 | Bacteria | 5186 |
| 118 | Ga0070700_100067783 | 3300005441 | Bacteria | 2267 |
| 119 | Ga0070700_100396022 | 3300005441 | Bacteria | 1037 |
| 120 | Ga0070700_100677465 | 3300005441 | Bacteria | 817 |
| 121 | Ga0070694_100015329 | 3300005444 | Bacteria | 4812 |
| 122 | Ga0070694_100035826 | 3300005444 | Bacteria | 3283 |
| 123 | Ga0070663_100008870 | 3300005455 | Bacteria | 6207 |
| 124 | Ga0070663_100391152 | 3300005455 | Bacteria | 1134 |
| 125 | Ga0070663_100527579 | 3300005455 | Bacteria | 984 |
| 126 | Ga0070678_100000260 | 3300005456 | Bacteria | 24374 |
| 127 | Ga0070678_100010910 | 3300005456 | Bacteria | 5576 |
| 128 | Ga0070678_100227409 | 3300005456 | Bacteria | 1553 |
| 129 | Ga0070678_100233904 | 3300005456 | Unclassified | 1533 |
| 130 | Ga0070662_100029158 | 3300005457 | Bacteria | 3850 |
| 131 | Ga0070662_100203544 | 3300005457 | Bacteria | 1572 |
| 132 | Ga0070662_100399107 | 3300005457 | Bacteria | 1134 |
| 133 | Ga0070681_10003989 | 3300005458 | Bacteria | 13923 |
| 134 | Ga0070681_10018410 | 3300005458 | Bacteria | 6981 |
| 135 | Ga0068867_100002696 | 3300005459 | Bacteria | 12524 |
| 136 | Ga0068867_100778049 | 3300005459 | Bacteria | 851 |
| 137 | Ga0070685_10009051 | 3300005466 | Bacteria | 5136 |
| 138 | Ga0070685_10208560 | 3300005466 | Bacteria | 1274 |
| 139 | Ga0070699_100150838 | 3300005518 | Bacteria | 2056 |
| 140 | Ga0070679_100074703 | 3300005530 | Bacteria | 3380 |
| 141 | Ga0070679_100081156 | 3300005530 | Bacteria | 3232 |
| 142 | Ga0070679_100330778 | 3300005530 | Bacteria | 1472 |
| 143 | Ga0070679_100503310 | 3300005530 | Bacteria | 1155 |
| 144 | Ga0070684_100002858 | 3300005535 | Bacteria | 12838 |
| 145 | Ga0070684_100288712 | 3300005535 | Bacteria | 1504 |
| 146 | Ga0070684_100365174 | 3300005535 | Unclassified | 1329 |
| 147 | Ga0068853_100384630 | 3300005539 | Bacteria | 1311 |
| 148 | Ga0068853_100511544 | 3300005539 | Bacteria | 1134 |
| 149 | Ga0070672_100017568 | 3300005543 | Bacteria | 5152 |
| 150 | Ga0070672_100078180 | 3300005543 | Bacteria | 2647 |
| 151 | Ga0070672_100757405 | 3300005543 | Bacteria | 852 |
| 152 | Ga0070686_100045017 | 3300005544 | Bacteria | 2778 |
| 153 | Ga0070686_100087173 | 3300005544 | Bacteria | 2080 |
| 154 | Ga0070686_100619926 | 3300005544 | Bacteria | 854 |
| 155 | Ga0070695_100020350 | 3300005545 | Bacteria | 4051 |
| 156 | Ga0070695_100023475 | 3300005545 | Bacteria | 3791 |
| 157 | Ga0070696_100022972 | 3300005546 | Bacteria | 4241 |
| 158 | Ga0070696_100223609 | 3300005546 | Bacteria | 1413 |
| 159 | Ga0070696_100807299 | 3300005546 | Unclassified | 773 |
| 160 | Ga0070693_100000947 | 3300005547 | Bacteria | 12881 |
| 161 | Ga0070693_100017821 | 3300005547 | Bacteria | 3699 |
| 162 | Ga0070693_100276192 | 3300005547 | Bacteria | 1123 |
| 163 | Ga0070665_100091178 | 3300005548 | Bacteria | 3053 |
| 164 | Ga0070665_100153158 | 3300005548 | Bacteria | 2307 |
| 165 | Ga0070665_100182712 | 3300005548 | Bacteria | 2098 |
| 166 | Ga0070704_100095134 | 3300005549 | Bacteria | 2230 |
| 167 | Ga0070704_100412098 | 3300005549 | Bacteria | 1155 |
| 168 | Ga0068855_100325879 | 3300005563 | Bacteria | 1697 |
| 169 | Ga0068855_100351186 | 3300005563 | Bacteria | 1624 |
| 170 | Ga0070664_100002866 | 3300005564 | Bacteria | 13967 |
| 171 | Ga0070664_100143322 | 3300005564 | Bacteria | 2105 |
| 172 | Ga0068857_100002854 | 3300005577 | Bacteria | 14200 |
| 173 | Ga0068854_100014694 | 3300005578 | Bacteria | 5166 |
| 174 | Ga0068856_100002432 | 3300005614 | Bacteria | 19156 |
| 175 | Ga0068856_100353091 | 3300005614 | Bacteria | 1489 |
| 176 | Ga0068856_100854923 | 3300005614 | Bacteria | 929 |
| 177 | Ga0070702_100001455 | 3300005615 | Bacteria | 9702 |
| 178 | Ga0068852_100071249 | 3300005616 | Bacteria | 3051 |
| 179 | Ga0068852_101007818 | 3300005616 | Bacteria | 851 |
| 180 | Ga0068859_100158923 | 3300005617 | Bacteria | 2339 |
| 181 | Ga0068859_100188839 | 3300005617 | Bacteria | 2145 |
| 182 | Ga0068859_101157201 | 3300005617 | Bacteria | 851 |
| 183 | Ga0068864_100003611 | 3300005618 | Bacteria | 12790 |
| 184 | Ga0068864_100384639 | 3300005618 | Bacteria | 1330 |
| 185 | Ga0068864_100385792 | 3300005618 | Bacteria | 1329 |
| 186 | Ga0068866_10000364 | 3300005718 | Bacteria | 21278 |
| 187 | Ga0068866_10438089 | 3300005718 | Bacteria | 851 |
| 188 | Ga0068861_100016949 | 3300005719 | Bacteria | 5166 |
| 189 | Ga0068861_100466605 | 3300005719 | Bacteria | 1134 |
| 190 | Ga0068870_10000015 | 3300005840 | Bacteria | 63346 |
| 191 | Ga0068863_100000278 | 3300005841 | Bacteria | 53024 |
| 192 | Ga0068863_100149304 | 3300005841 | Bacteria | 2236 |
| 193 | Ga0068863_101049554 | 3300005841 | Bacteria | 819 |
| 194 | Ga0068863_101104844 | 3300005841 | Bacteria | 797 |
| 195 | Ga0068858_100061520 | 3300005842 | Bacteria | 3471 |
| 196 | Ga0068858_100068207 | 3300005842 | Bacteria | 3295 |
| 197 | Ga0068858_100173582 | 3300005842 | Bacteria | 2034 |
| 198 | Ga0068858_101016675 | 3300005842 | Bacteria | 812 |
| 199 | Ga0068860_100005473 | 3300005843 | Bacteria | 12870 |
| 200 | Ga0068860_100329548 | 3300005843 | Bacteria | 1499 |
| 201 | Ga0068860_100792452 | 3300005843 | Bacteria | 961 |
| 202 | Ga0068862_100003784 | 3300005844 | Bacteria | 12895 |
| 203 | Ga0068862_101256511 | 3300005844 | Bacteria | 740 |
| 204 | Ga0081455_10001601 | 3300005937 | Bacteria | 27658 |
| 205 | Ga0081540_1066030 | 3300005983 | Bacteria | 1698 |
| 206 | Ga0070717_10050611 | 3300006028 | Bacteria | 3415 |
| 207 | Ga0070717_10120749 | 3300006028 | Bacteria | 2245 |
| 208 | Ga0070715_10031498 | 3300006163 | Bacteria | 2153 |
| 209 | Ga0070715_10101480 | 3300006163 | Bacteria | 1343 |
| 210 | Ga0070715_10224936 | 3300006163 | Bacteria | 967 |
| 211 | Ga0070716_100129182 | 3300006173 | Bacteria | 1594 |
| 212 | Ga0070712_100032022 | 3300006175 | Bacteria | 3548 |
| 213 | Ga0070712_100730752 | 3300006175 | Bacteria | 846 |
| 214 | Ga0075369_10173075 | 3300006186 | Bacteria | 992 |
| 215 | Ga0075366_10333697 | 3300006195 | Bacteria | 929 |
| 216 | Ga0097621_100182827 | 3300006237 | Bacteria | 1812 |
| 217 | Ga0075370_10232616 | 3300006353 | Bacteria | 1091 |
| 218 | Ga0068871_100005547 | 3300006358 | Bacteria | 8846 |
| 219 | Ga0068871_100043579 | 3300006358 | Bacteria | 3604 |
| 220 | Ga0075428_100927995 | 3300006844 | Bacteria | 923 |
| 221 | Ga0075428_101030291 | 3300006844 | Bacteria | 871 |
| 222 | Ga0075433_10278997 | 3300006852 | Bacteria | 1480 |
| 223 | Ga0075433_10707110 | 3300006852 | Bacteria | 882 |
| 224 | Ga0075434_100040806 | 3300006871 | Bacteria | 4596 |
| 225 | Ga0075434_100164262 | 3300006871 | Bacteria | 2240 |
| 226 | Ga0075434_100184960 | 3300006871 | Bacteria | 2104 |
| 227 | Ga0075434_100340124 | 3300006871 | Bacteria | 1521 |
| 228 | Ga0068865_100013483 | 3300006881 | Bacteria | 5166 |
| 229 | Ga0068865_100392683 | 3300006881 | Bacteria | 1134 |
| 230 | Ga0068865_100439823 | 3300006881 | Bacteria | 1076 |
| 231 | Ga0097620_100158911 | 3300006931 | Bacteria | 2339 |
| 232 | Ga0097620_101157223 | 3300006931 | Bacteria | 851 |
| 233 | Ga0075435_100109988 | 3300007076 | Bacteria | 2291 |
| 234 | Ga0075435_100130878 | 3300007076 | Bacteria | 2100 |
| 235 | Ga0105251_10095723 | 3300009011 | Bacteria | 1361 |
| 236 | Ga0105244_10028073 | 3300009036 | Bacteria | 3024 |
| 237 | Ga0105250_10029706 | 3300009092 | Bacteria | 2199 |
| 238 | Ga0105240_10130174 | 3300009093 | Bacteria | 3019 |
| 239 | Ga0111539_10004346 | 3300009094 | Bacteria | 18556 |
| 240 | Ga0111539_10021841 | 3300009094 | Bacteria | 7870 |
| 241 | Ga0111539_10380324 | 3300009094 | Bacteria | 1644 |
| 242 | Ga0111539_11025791 | 3300009094 | Bacteria | 959 |
| 243 | Ga0111539_11334177 | 3300009094 | Bacteria | 832 |
| 244 | Ga0105245_10003800 | 3300009098 | Bacteria | 13429 |
| 245 | Ga0105245_10192160 | 3300009098 | Bacteria | 1956 |
| 246 | Ga0105247_10012563 | 3300009101 | Bacteria | 5087 |
| 247 | Ga0105247_10094805 | 3300009101 | Bacteria | 1899 |
| 248 | Ga0114129_11532294 | 3300009147 | Bacteria | 818 |
| 249 | Ga0105243_10020754 | 3300009148 | Bacteria | 4985 |
| 250 | Ga0105243_10154534 | 3300009148 | Bacteria | 1971 |
| 251 | Ga0105241_10000982 | 3300009174 | Bacteria | 21606 |
| 252 | Ga0105241_10347462 | 3300009174 | Bacteria | 1287 |
| 253 | Ga0105241_10489300 | 3300009174 | Bacteria | 1095 |
| 254 | Ga0105242_10001299 | 3300009176 | Bacteria | 19749 |
| 255 | Ga0105242_10134921 | 3300009176 | Bacteria | 2135 |
| 256 | Ga0105248_10002736 | 3300009177 | Bacteria | 19584 |
| 257 | Ga0105248_10011811 | 3300009177 | Bacteria | 9634 |
| 258 | Ga0105248_10559593 | 3300009177 | Bacteria | 1290 |
| 259 | Ga0105237_10039232 | 3300009545 | Bacteria | 4781 |
| 260 | Ga0105238_10540377 | 3300009551 | Bacteria | 1169 |
| 261 | Ga0105238_10540390 | 3300009551 | Bacteria | 1169 |
| 262 | Ga0105238_10855874 | 3300009551 | Bacteria | 926 |
| 263 | Ga0105249_10002863 | 3300009553 | Bacteria | 14901 |
| 264 | Ga0105249_10003014 | 3300009553 | Bacteria | 14526 |
| 265 | Ga0105239_10040309 | 3300010375 | Bacteria | 5117 |
| 266 | Ga0105239_10051763 | 3300010375 | Bacteria | 4501 |
| 267 | Ga0105239_10444255 | 3300010375 | Bacteria | 1471 |
| 268 | Ga0105246_10014978 | 3300011119 | Bacteria | 4887 |
| 269 | Ga0105246_10422377 | 3300011119 | Bacteria | 1113 |
| 270 | Ga0105246_10507805 | 3300011119 | Bacteria | 1025 |
| 271 | Ga0157344_1001680 | 3300012476 | Bacteria | 1087 |
| 272 | Ga0157337_1001545 | 3300012483 | Bacteria | 1202 |
| 273 | Ga0157337_1001656 | 3300012483 | Bacteria | 1177 |
| 274 | Ga0157335_1005074 | 3300012492 | Bacteria | 909 |
| 275 | Ga0157319_1002180 | 3300012497 | Bacteria | 1099 |
| 276 | Ga0157316_1008033 | 3300012510 | Bacteria | 913 |
| 277 | Ga0157371_10263110 | 3300013102 | Bacteria | 1244 |
| 278 | Ga0157370_10041263 | 3300013104 | Bacteria | 4454 |
| 279 | Ga0157370_10280444 | 3300013104 | Bacteria | 1540 |
| 280 | Ga0157374_10009129 | 3300013296 | Bacteria | 8498 |
| 281 | Ga0157374_10558938 | 3300013296 | Bacteria | 1152 |
| 282 | Ga0157374_10724683 | 3300013296 | Bacteria | 1008 |
| 283 | Ga0157378_10004364 | 3300013297 | Bacteria | 12450 |
| 284 | Ga0157378_10117768 | 3300013297 | Bacteria | 2444 |
| 285 | Ga0163162_10011614 | 3300013306 | Bacteria | 8587 |
| 286 | Ga0163162_10856008 | 3300013306 | Bacteria | 1024 |
| 287 | Ga0157372_10315425 | 3300013307 | Bacteria | 1820 |
| 288 | Ga0157375_10008586 | 3300013308 | Bacteria | 8945 |
| 289 | Ga0157375_10252350 | 3300013308 | Bacteria | 1925 |
| 290 | Ga0157375_10265464 | 3300013308 | Bacteria | 1878 |
| 291 | Ga0157375_10423033 | 3300013308 | Bacteria | 1498 |
| 292 | Ga0157375_11331414 | 3300013308 | Bacteria | 845 |
| 293 | Ga0163163_10087277 | 3300014325 | Bacteria | 3130 |
| 294 | Ga0163163_10224898 | 3300014325 | Bacteria | 1926 |
| 295 | Ga0163163_10228997 | 3300014325 | Bacteria | 1907 |
| 296 | Ga0163163_10282290 | 3300014325 | Bacteria | 1712 |
| 297 | Ga0157380_10003889 | 3300014326 | Bacteria | 10302 |
| 298 | Ga0157380_10110479 | 3300014326 | Bacteria | 2309 |
| 299 | Ga0157380_10231404 | 3300014326 | Bacteria | 1660 |
| 300 | Ga0182008_10203574 | 3300014497 | Bacteria | 1008 |
| 301 | Ga0182008_10308500 | 3300014497 | Bacteria | 830 |
| 302 | Ga0157377_10000317 | 3300014745 | Bacteria | 22023 |
| 303 | Ga0157379_10000067 | 3300014968 | Bacteria | 66051 |
| 304 | Ga0157379_10227954 | 3300014968 | Bacteria | 1688 |
| 305 | Ga0157379_10461229 | 3300014968 | Bacteria | 1174 |
| 306 | Ga0157379_10823754 | 3300014968 | Bacteria | 877 |
| 307 | Ga0157379_10921119 | 3300014968 | Bacteria | 830 |
| 308 | Ga0157376_10005894 | 3300014969 | Bacteria | 8601 |
| 309 | Ga0163161_10000693 | 3300017792 | Bacteria | 26852 |
| 310 | Ga0163161_10236175 | 3300017792 | Bacteria | 1420 |
| 311 | Ga0163161_10237097 | 3300017792 | Bacteria | 1417 |
| 312 | Ga0207666_1000681 | 3300025271 | Bacteria | 4075 |
| 313 | Ga0207666_1024983 | 3300025271 | Bacteria | 894 |
| 314 | Ga0207673_1000509 | 3300025290 | Bacteria | 4108 |
| 315 | Ga0209758_1000294 | 3300025297 | Bacteria | 98618 |
| 316 | Ga0209758_1003227 | 3300025297 | Bacteria | 15167 |
| 317 | Ga0209758_1048766 | 3300025297 | Bacteria | 1501 |
| 318 | Ga0207697_10006734 | 3300025315 | Bacteria | 5171 |
| 319 | Ga0207682_10000264 | 3300025893 | Bacteria | 23612 |
| 320 | Ga0207682_10193403 | 3300025893 | Bacteria | 933 |
| 321 | Ga0207692_10002735 | 3300025898 | Bacteria | 6804 |
| 322 | Ga0207642_10003957 | 3300025899 | Bacteria | 4723 |
| 323 | Ga0207642_10110272 | 3300025899 | Bacteria | 1400 |
| 324 | Ga0207710_10111826 | 3300025900 | Bacteria | 1297 |
| 325 | Ga0207710_10113103 | 3300025900 | Bacteria | 1290 |
| 326 | Ga0207688_10015833 | 3300025901 | Bacteria | 4091 |
| 327 | Ga0207688_10069380 | 3300025901 | Bacteria | 1997 |
| 328 | Ga0207680_10012813 | 3300025903 | Bacteria | 4284 |
| 329 | Ga0207680_10387793 | 3300025903 | Bacteria | 986 |
| 330 | Ga0207647_10026102 | 3300025904 | Bacteria | 3825 |
| 331 | Ga0207685_10053802 | 3300025905 | Unclassified | 1565 |
| 332 | Ga0207645_10000926 | 3300025907 | Bacteria | 24341 |
| 333 | Ga0207645_10048778 | 3300025907 | Bacteria | 2705 |
| 334 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 335 | Ga0207684_10565637 | 3300025910 | Bacteria | 972 |
| 336 | Ga0207654_10000437 | 3300025911 | Bacteria | 23909 |
| 337 | Ga0207654_10096619 | 3300025911 | Bacteria | 1812 |
| 338 | Ga0207707_10004519 | 3300025912 | Bacteria | 12230 |
| 339 | Ga0207707_10027253 | 3300025912 | Bacteria | 4997 |
| 340 | Ga0207695_10193355 | 3300025913 | Bacteria | 1951 |
| 341 | Ga0207693_10064140 | 3300025915 | Bacteria | 2877 |
| 342 | Ga0207693_10099518 | 3300025915 | Bacteria | 2280 |
| 343 | Ga0207693_10495354 | 3300025915 | Bacteria | 954 |
| 344 | Ga0207663_10026971 | 3300025916 | Bacteria | 3342 |
| 345 | Ga0207663_10133837 | 3300025916 | Bacteria | 1717 |
| 346 | Ga0207663_10327165 | 3300025916 | Bacteria | 1153 |
| 347 | Ga0207660_10004154 | 3300025917 | Bacteria | 9422 |
| 348 | Ga0207660_10015289 | 3300025917 | Bacteria | 5062 |
| 349 | Ga0207662_10246257 | 3300025918 | Bacteria | 1172 |
| 350 | Ga0207662_10275008 | 3300025918 | Bacteria | 1112 |
| 351 | Ga0207662_10290891 | 3300025918 | Bacteria | 1083 |
| 352 | Ga0207657_10028591 | 3300025919 | Bacteria | 5082 |
| 353 | Ga0207657_10275644 | 3300025919 | Bacteria | 1336 |
| 354 | Ga0207657_10354529 | 3300025919 | Bacteria | 1157 |
| 355 | Ga0207657_10443458 | 3300025919 | Bacteria | 1019 |
| 356 | Ga0207649_10000090 | 3300025920 | Bacteria | 75387 |
| 357 | Ga0207649_10022533 | 3300025920 | Bacteria | 3640 |
| 358 | Ga0207652_10001397 | 3300025921 | Bacteria | 21434 |
| 359 | Ga0207652_10260347 | 3300025921 | Bacteria | 1565 |
| 360 | Ga0207652_10559384 | 3300025921 | Bacteria | 1027 |
| 361 | Ga0207681_10001592 | 3300025923 | Bacteria | 14608 |
| 362 | Ga0207681_10065632 | 3300025923 | Bacteria | 2510 |
| 363 | Ga0207681_10069096 | 3300025923 | Bacteria | 2456 |
| 364 | Ga0207681_10141370 | 3300025923 | Bacteria | 1793 |
| 365 | Ga0207681_10159181 | 3300025923 | Bacteria | 1700 |
| 366 | Ga0207650_10007098 | 3300025925 | Bacteria | 7630 |
| 367 | Ga0207650_10038297 | 3300025925 | Bacteria | 3501 |
| 368 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 369 | Ga0207659_10546564 | 3300025926 | Bacteria | 984 |
| 370 | Ga0207687_10000342 | 3300025927 | Bacteria | 31186 |
| 371 | Ga0207687_10017603 | 3300025927 | Bacteria | 4707 |
| 372 | Ga0207687_10614390 | 3300025927 | Bacteria | 917 |
| 373 | Ga0207700_10033428 | 3300025928 | Bacteria | 3680 |
| 374 | Ga0207700_10128059 | 3300025928 | Bacteria | 2068 |
| 375 | Ga0207700_10654586 | 3300025928 | Bacteria | 937 |
| 376 | Ga0207664_10019530 | 3300025929 | Bacteria | 5010 |
| 377 | Ga0207644_10000816 | 3300025931 | Bacteria | 19791 |
| 378 | Ga0207644_10453620 | 3300025931 | Bacteria | 1053 |
| 379 | Ga0207644_10467452 | 3300025931 | Bacteria | 1037 |
| 380 | Ga0207690_10000440 | 3300025932 | Bacteria | 26959 |
| 381 | Ga0207690_10697698 | 3300025932 | Bacteria | 834 |
| 382 | Ga0207690_10901450 | 3300025932 | Bacteria | 733 |
| 383 | Ga0207706_10040924 | 3300025933 | Bacteria | 4108 |
| 384 | Ga0207706_10762044 | 3300025933 | Bacteria | 824 |
| 385 | Ga0207686_10000433 | 3300025934 | Bacteria | 28288 |
| 386 | Ga0207686_10481906 | 3300025934 | Bacteria | 959 |
| 387 | Ga0207709_10000494 | 3300025935 | Bacteria | 35647 |
| 388 | Ga0207709_10146562 | 3300025935 | Bacteria | 1630 |
| 389 | Ga0207709_10675308 | 3300025935 | Bacteria | 824 |
| 390 | Ga0207670_10001363 | 3300025936 | Bacteria | 12858 |
| 391 | Ga0207670_10001831 | 3300025936 | Bacteria | 11086 |
| 392 | Ga0207670_10059844 | 3300025936 | Bacteria | 2592 |
| 393 | Ga0207669_10000063 | 3300025937 | Bacteria | 53494 |
| 394 | Ga0207669_10367898 | 3300025937 | Bacteria | 1116 |
| 395 | Ga0207704_10001268 | 3300025938 | Bacteria | 11299 |
| 396 | Ga0207704_10093122 | 3300025938 | Bacteria | 1985 |
| 397 | Ga0207665_10164164 | 3300025939 | Bacteria | 1600 |
| 398 | Ga0207665_10401035 | 3300025939 | Bacteria | 1044 |
| 399 | Ga0207665_10621071 | 3300025939 | Bacteria | 845 |
| 400 | Ga0207691_10000981 | 3300025940 | Bacteria | 28361 |
| 401 | Ga0207691_10120089 | 3300025940 | Bacteria | 2330 |
| 402 | Ga0207691_10182978 | 3300025940 | Bacteria | 1830 |
| 403 | Ga0207691_10243834 | 3300025940 | Bacteria | 1553 |
| 404 | Ga0207691_10248964 | 3300025940 | Bacteria | 1534 |
| 405 | Ga0207691_10902758 | 3300025940 | Bacteria | 740 |
| 406 | Ga0207711_10000792 | 3300025941 | Bacteria | 31089 |
| 407 | Ga0207711_10012513 | 3300025941 | Bacteria | 7052 |
| 408 | Ga0207711_10022018 | 3300025941 | Bacteria | 5325 |
| 409 | Ga0207711_10092688 | 3300025941 | Bacteria | 2659 |
| 410 | Ga0207689_10002635 | 3300025942 | Bacteria | 16609 |
| 411 | Ga0207689_10074973 | 3300025942 | Bacteria | 2780 |
| 412 | Ga0207661_10000531 | 3300025944 | Bacteria | 24434 |
| 413 | Ga0207661_10629686 | 3300025944 | Bacteria | 985 |
| 414 | Ga0207679_10001109 | 3300025945 | Bacteria | 17141 |
| 415 | Ga0207679_10032797 | 3300025945 | Bacteria | 3650 |
| 416 | Ga0207679_10771142 | 3300025945 | Bacteria | 876 |
| 417 | Ga0207667_10274712 | 3300025949 | Bacteria | 1723 |
| 418 | Ga0207667_10571249 | 3300025949 | Bacteria | 1142 |
| 419 | Ga0207651_10000379 | 3300025960 | Bacteria | 18945 |
| 420 | Ga0207651_10022519 | 3300025960 | Bacteria | 3854 |
| 421 | Ga0207651_10249574 | 3300025960 | Bacteria | 1451 |
| 422 | Ga0207712_10000717 | 3300025961 | Bacteria | 25585 |
| 423 | Ga0207712_10097927 | 3300025961 | Bacteria | 2174 |
| 424 | Ga0207668_10000429 | 3300025972 | Bacteria | 26510 |
| 425 | Ga0207668_10221382 | 3300025972 | Bacteria | 1520 |
| 426 | Ga0207668_10560799 | 3300025972 | Bacteria | 991 |
| 427 | Ga0207668_11131131 | 3300025972 | Bacteria | 702 |
| 428 | Ga0207640_10007602 | 3300025981 | Bacteria | 5981 |
| 429 | Ga0207640_10674387 | 3300025981 | Bacteria | 883 |
| 430 | Ga0207658_10020967 | 3300025986 | Bacteria | 4530 |
| 431 | Ga0207658_10427274 | 3300025986 | Bacteria | 1169 |
| 432 | Ga0207658_10457899 | 3300025986 | Bacteria | 1130 |
| 433 | Ga0207658_10554326 | 3300025986 | Bacteria | 1029 |
| 434 | Ga0207658_10695773 | 3300025986 | Bacteria | 918 |
| 435 | Ga0207677_10001164 | 3300026023 | Bacteria | 14343 |
| 436 | Ga0207677_10176280 | 3300026023 | Bacteria | 1677 |
| 437 | Ga0207703_10049279 | 3300026035 | Bacteria | 3405 |
| 438 | Ga0207703_10049601 | 3300026035 | Bacteria | 3394 |
| 439 | Ga0207703_10086248 | 3300026035 | Bacteria | 2629 |
| 440 | Ga0207703_10132072 | 3300026035 | Bacteria | 2157 |
| 441 | Ga0207703_10145952 | 3300026035 | Bacteria | 2058 |
| 442 | Ga0207639_10003596 | 3300026041 | Bacteria | 10414 |
| 443 | Ga0207639_10754052 | 3300026041 | Bacteria | 905 |
| 444 | Ga0207639_10816187 | 3300026041 | Bacteria | 869 |
| 445 | Ga0207678_10002770 | 3300026067 | Bacteria | 15870 |
| 446 | Ga0207678_10155366 | 3300026067 | Bacteria | 1953 |
| 447 | Ga0207678_10773673 | 3300026067 | Bacteria | 847 |
| 448 | Ga0207708_10037726 | 3300026075 | Bacteria | 3681 |
| 449 | Ga0207708_10353834 | 3300026075 | Bacteria | 1205 |
| 450 | Ga0207708_10394842 | 3300026075 | Bacteria | 1143 |
| 451 | Ga0207708_10434773 | 3300026075 | Bacteria | 1090 |
| 452 | Ga0207708_10674829 | 3300026075 | Bacteria | 881 |
| 453 | Ga0207702_10003627 | 3300026078 | Bacteria | 14009 |
| 454 | Ga0207641_10003728 | 3300026088 | Bacteria | 13402 |
| 455 | Ga0207648_10081702 | 3300026089 | Bacteria | 2818 |
| 456 | Ga0207648_10086653 | 3300026089 | Bacteria | 2732 |
| 457 | Ga0207648_10462264 | 3300026089 | Bacteria | 1157 |
| 458 | Ga0207648_10475978 | 3300026089 | Bacteria | 1140 |
| 459 | Ga0207648_11089986 | 3300026089 | Bacteria | 749 |
| 460 | Ga0207676_10000583 | 3300026095 | Bacteria | 30033 |
| 461 | Ga0207676_10009759 | 3300026095 | Bacteria | 6827 |
| 462 | Ga0207676_10958384 | 3300026095 | Bacteria | 841 |
| 463 | Ga0207674_10009493 | 3300026116 | Bacteria | 11108 |
| 464 | Ga0207674_10116312 | 3300026116 | Bacteria | 2645 |
| 465 | Ga0207675_100036186 | 3300026118 | Bacteria | 4605 |
| 466 | Ga0207675_100358633 | 3300026118 | Bacteria | 1430 |
| 467 | Ga0207675_100950513 | 3300026118 | Bacteria | 877 |
| 468 | Ga0207683_10000138 | 3300026121 | Bacteria | 60113 |
| 469 | Ga0207683_10069420 | 3300026121 | Bacteria | 3112 |
| 470 | Ga0207683_10324365 | 3300026121 | Bacteria | 1411 |
| 471 | Ga0207698_10005821 | 3300026142 | Bacteria | 7655 |
| 472 | Ga0207698_10802098 | 3300026142 | Bacteria | 944 |
| 473 | Ga0209969_1010536 | 3300027360 | Bacteria | 1323 |
| 474 | Ga0209967_1026602 | 3300027364 | Bacteria | 859 |
| 475 | Ga0210002_1007605 | 3300027617 | Bacteria | 1645 |
| 476 | Ga0209971_1015585 | 3300027682 | Bacteria | 1802 |
| 477 | Ga0209966_1001354 | 3300027695 | Bacteria | 4294 |
| 478 | Ga0209998_10056168 | 3300027717 | Bacteria | 920 |
| 479 | Ga0209998_10060253 | 3300027717 | Bacteria | 893 |
| 480 | Ga0209974_10087000 | 3300027876 | Bacteria | 1080 |
| 481 | Ga0207428_10001759 | 3300027907 | Bacteria | 22205 |
| 482 | Ga0207428_10023515 | 3300027907 | Bacteria | 5182 |
| 483 | Ga0268266_10031707 | 3300028379 | Bacteria | 4489 |
| 484 | Ga0268266_10187739 | 3300028379 | Bacteria | 1886 |
| 485 | Ga0268266_10327244 | 3300028379 | Bacteria | 1436 |
| 486 | Ga0268266_10406667 | 3300028379 | Bacteria | 1288 |
| 487 | Ga0268265_10002569 | 3300028380 | Bacteria | 13569 |
| 488 | Ga0268265_11366177 | 3300028380 | Bacteria | 710 |
| 489 | Ga0268264_10002097 | 3300028381 | Bacteria | 17812 |
| 490 | Ga0268264_10047998 | 3300028381 | Bacteria | 3551 |
| 491 | Ga0265337_1091773 | 3300028556 | Bacteria | 828 |
| 492 | Ga0265332_10074125 | 3300031238 | Bacteria | 1448 |
| 493 | Ga0265328_10000250 | 3300031239 | Bacteria | 24823 |
| 494 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 495 | Ga0265325_10004257 | 3300031241 | Bacteria | 9079 |
| 496 | Ga0265325_10023603 | 3300031241 | Bacteria | 3354 |
| 497 | Ga0265325_10024151 | 3300031241 | Bacteria | 3309 |
| 498 | Ga0265339_10001671 | 3300031249 | Bacteria | 16385 |
| 499 | Ga0265339_10113673 | 3300031249 | Bacteria | 1398 |
| 500 | Ga0265316_10039394 | 3300031344 | Bacteria | 3795 |
| 501 | Ga0265316_10051312 | 3300031344 | Bacteria | 3241 |
| 502 | Ga0265316_10416293 | 3300031344 | Bacteria | 966 |
| 503 | Ga0265313_10001789 | 3300031595 | Bacteria | 19628 |
| 504 | Ga0265313_10016155 | 3300031595 | Bacteria | 4305 |
| 505 | Ga0265313_10017724 | 3300031595 | Bacteria | 4030 |
| 506 | Ga0265313_10079733 | 3300031595 | Bacteria | 1490 |
| 507 | Ga0265313_10192032 | 3300031595 | Bacteria | 853 |
| 508 | Ga0307405_10225239 | 3300031731 | Bacteria | 1379 |
| 509 | Ga0307410_10726626 | 3300031852 | Bacteria | 839 |
| 510 | Ga0307407_10138773 | 3300031903 | Bacteria | 1566 |
| 511 | Ga0307409_100194752 | 3300031995 | Bacteria | 1808 |
| 512 | Ga0307416_101488159 | 3300032002 | Bacteria | 783 |
| 513 | Ga0307411_10302659 | 3300032005 | Bacteria | 1283 |
| 514 | Ga0373930_0000568 | 3300034816 | Bacteria | 5085 |
| 515 | Ga0373930_0008571 | 3300034816 | Bacteria | 1790 |
| 516 | Ga0373948_0017621 | 3300034817 | Bacteria | 1333 |
| 517 | Ga0373948_0018676 | 3300034817 | Bacteria | 1304 |
| 518 | Ga0373950_0000814 | 3300034818 | Bacteria | 3911 |
| 519 | Ga0373958_0002698 | 3300034819 | Bacteria | 2512 |
| 520 | Ga0373958_0005675 | 3300034819 | Bacteria | 1909 |
| 521 | Ga0373959_0000576 | 3300034820 | Bacteria | 6439 |
| 522 | Ga0373959_0002836 | 3300034820 | Bacteria | 2754 |
| 523 | Ga0373938_0003901 | 3300034957 | Bacteria | 2466 |
| 524 | Ga0373938_0004761 | 3300034957 | Bacteria | 2277 |
| 525 | Ga0373926_0023126 | 3300035083 | Bacteria | 2157 |
| 526 | Ga0373928_0002658 | 3300035084 | Bacteria | 3463 |
| 527 | Ga0373928_0004964 | 3300035084 | Bacteria | 2535 |
| 528 | Ga0373928_0027332 | 3300035084 | Bacteria | 1242 |
| 529 | Ga0373928_0030120 | 3300035084 | Bacteria | 1197 |
| 530 | Ga0373929_0002439 | 3300035085 | Bacteria | 3417 |
| 531 | Ga0373929_0005547 | 3300035085 | Bacteria | 2272 |
| 532 | Ga0373929_0018465 | 3300035085 | Bacteria | 1386 |
| 533 | Ga0373934_0012431 | 3300035086 | Bacteria | 3214 |
| 534 | Ga0373934_0087883 | 3300035086 | Bacteria | 1251 |
| 535 | Ga0373934_0182739 | 3300035086 | Bacteria | 862 |
| 536 | Ga0373940_0003535 | 3300035088 | Bacteria | 3199 |
| 537 | Ga0373944_0019860 | 3300035089 | Bacteria | 1931 |
| 538 | Ga0373949_0008856 | 3300035090 | Bacteria | 2203 |
| 539 | Ga0373949_0031717 | 3300035090 | Bacteria | 1261 |
| 540 | Ga0373951_0001398 | 3300035091 | Bacteria | 6345 |
| 541 | Ga0373951_0024782 | 3300035091 | Bacteria | 1391 |
| 542 | Ga0373952_0002117 | 3300035092 | Bacteria | 3572 |
| 543 | Ga0373952_0012810 | 3300035092 | Bacteria | 1655 |
| 544 | Ga0373952_0027957 | 3300035092 | Bacteria | 1234 |
| 545 | Ga0373923_0014397 | 3300035111 | Bacteria | 2970 |
| 546 | Ga0373923_0021859 | 3300035111 | Bacteria | 2502 |
| 547 | Ga0373923_0044991 | 3300035111 | Bacteria | 1832 |
| 548 | Ga0373932_0001729 | 3300035112 | Bacteria | 5928 |
| 549 | Ga0373932_0011139 | 3300035112 | Bacteria | 2191 |
| 550 | Ga0373932_0011565 | 3300035112 | Bacteria | 2158 |
| 551 | Ga0373932_0132468 | 3300035112 | Bacteria | 841 |
| 552 | Ga0373936_0013383 | 3300035113 | Bacteria | 3132 |
| 553 | Ga0373936_0078928 | 3300035113 | Bacteria | 1367 |
| 554 | Ga0373939_0006286 | 3300035114 | Bacteria | 2857 |
| 555 | Ga0373939_0008750 | 3300035114 | Bacteria | 2490 |
| 556 | Ga0373941_0000363 | 3300035115 | Bacteria | 8980 |
| 557 | Ga0373941_0027712 | 3300035115 | Bacteria | 1656 |
| 558 | Ga0373941_0116689 | 3300035115 | Bacteria | 947 |
| 559 | Ga0373941_0137434 | 3300035115 | Bacteria | 886 |
| 560 | Ga0373941_0206706 | 3300035115 | Bacteria | 749 |
| 561 | Ga0373945_0121532 | 3300035116 | Bacteria | 1039 |
| 562 | Ga0373953_0010709 | 3300035117 | Bacteria | 3201 |
| 563 | Ga0373953_0029615 | 3300035117 | Bacteria | 2118 |
| 564 | Ga0373953_0033619 | 3300035117 | Bacteria | 2007 |
| 565 | Ga0373954_0007394 | 3300035118 | Bacteria | 4808 |
| 566 | Ga0373954_0020427 | 3300035118 | Bacteria | 2996 |
| 567 | Ga0373954_0044866 | 3300035118 | Bacteria | 2064 |
| 568 | Ga0373956_0068703 | 3300035119 | Bacteria | 1614 |
| 569 | Ga0373957_0020044 | 3300035120 | Bacteria | 2359 |
| 570 | Ga0373957_0024014 | 3300035120 | Bacteria | 2186 |
| 571 | Ga0373957_0107019 | 3300035120 | Bacteria | 1124 |
| 572 | Ga0373960_0001466 | 3300035121 | Bacteria | 5225 |
| 573 | Ga0373960_0011233 | 3300035121 | Bacteria | 2202 |
| 574 | Ga0373960_0045498 | 3300035121 | Bacteria | 1285 |
| 575 | Ga0373943_0011804 | 3300035170 | Bacteria | 3931 |
| 576 | Ga0373943_0104061 | 3300035170 | Bacteria | 1489 |
| 577 | Ga0373943_0184741 | 3300035170 | Bacteria | 1147 |
| 578 | Ga0373946_0024161 | 3300035171 | Bacteria | 2379 |
| 579 | Ga0373946_0080846 | 3300035171 | Bacteria | 1422 |
| 580 | Ga0373955_0000249 | 3300035172 | Bacteria | 22417 |
| 581 | Ga0373955_0046317 | 3300035172 | Bacteria | 2350 |
| 582 | Ga0373955_0313727 | 3300035172 | Bacteria | 947 |
| 583 | Ga0373942_0001061 | 3300035207 | Bacteria | 7387 |
| 584 | Ga0373961_0004234 | 3300035241 | Bacteria | 3481 |
| 585 | Ga0373962_0002145 | 3300035242 | Bacteria | 4707 |
| 586 | Ga0373962_0002168 | 3300035242 | Bacteria | 4683 |
| 587 | Ga0373962_0026034 | 3300035242 | Bacteria | 1574 |
| 588 | Ga0373924_0020946 | 3300035410 | Bacteria | 2546 |
| 589 | Ga0373924_0035514 | 3300035410 | Bacteria | 2022 |
| 590 | Ga0373924_0204584 | 3300035410 | Bacteria | 871 |
| 591 | Ga0373931_0000660 | 3300035691 | Bacteria | 14257 |
| 592 | Ga0373931_0053838 | 3300035691 | Bacteria | 2148 |
| 593 | Ga0373931_0054709 | 3300035691 | Bacteria | 2133 |
| 594 | Ga0373931_0303735 | 3300035691 | Bacteria | 986 |
| 595 | Ga0373935_0011299 | 3300035692 | Bacteria | 5363 |
| 596 | Ga0373935_0061176 | 3300035692 | Bacteria | 2410 |
| 597 | Ga0373935_0067945 | 3300035692 | Bacteria | 2293 |
| 598 | Ga0373935_0080830 | 3300035692 | Bacteria | 2112 |
| 599 | Ga0373935_0134672 | 3300035692 | Bacteria | 1663 |
| 600 | Ga0373935_0171461 | 3300035692 | Bacteria | 1484 |
| 601 | Ga0373927_0003778 | 3300035695 | Bacteria | 10745 |
| 602 | Ga0373927_0020050 | 3300035695 | Bacteria | 4385 |
| 603 | Ga0373927_0113856 | 3300035695 | Bacteria | 1763 |
| 604 | Ga0373933_0001754 | 3300035724 | Bacteria | 12584 |
| 605 | Ga0373933_0002548 | 3300035724 | Bacteria | 10223 |
| 606 | Ga0373933_0034363 | 3300035724 | Bacteria | 2954 |
| 607 | Ga0373933_0102986 | 3300035724 | Bacteria | 1773 |
| 608 | Ga0373947_0007280 | 3300035725 | Bacteria | 6412 |
| 609 | Ga0373947_0013018 | 3300035725 | Bacteria | 4770 |
| 610 | Ga0373947_0136757 | 3300035725 | Bacteria | 1568 |
| 611 | Ga0373937_0003253 | 3300036401 | Bacteria | 13620 |
| 612 | Ga0373937_0003343 | 3300036401 | Bacteria | 13462 |
| 613 | Ga0373937_0032148 | 3300036401 | Bacteria | 4758 |
| 614 | Ga0373937_0072611 | 3300036401 | Bacteria | 3174 |
| 615 | Ga0373937_0182008 | 3300036401 | Bacteria | 1974 |
| 616 | Ga0373925_0007120 | 3300037068 | Bacteria | 8176 |
| 617 | Ga0373925_0050588 | 3300037068 | Bacteria | 3099 |
| 618 | Ga0373925_0062775 | 3300037068 | Bacteria | 2794 |
| 619 | Ga0373925_0105338 | 3300037068 | Bacteria | 2173 |
| 620 | Ga0373925_0312699 | 3300037068 | Bacteria | 1270 |
| 621 | Ga0373925_0612910 | 3300037068 | Bacteria | 896 |
| 622 | Ga0242420_001260 | 3300038996 | Bacteria | 3323 |
| 623 | Ga0439460_0016064 | 3300042461 | Bacteria | 1990 |
| 624 | Ga0495617_014146 | 3300046452 | Bacteria | 2712 |
| 625 | Ga0495592_0000604 | 3300046454 | Bacteria | 25327 |
| 626 | Ga0495592_0066040 | 3300046454 | Bacteria | 2648 |
| 627 | Ga0495592_0077045 | 3300046454 | Bacteria | 2418 |
| 628 | Ga0495592_0176252 | 3300046454 | Bacteria | 1460 |
| 629 | Ga0495603_0053734 | 3300046455 | Bacteria | 2389 |
| 630 | Ga0495629_0002040 | 3300046459 | Bacteria | 15689 |
| 631 | Ga0495629_0030668 | 3300046459 | Bacteria | 3810 |
| 632 | Ga0495629_0091694 | 3300046459 | Bacteria | 2120 |
| 633 | Ga0495629_0289661 | 3300046459 | Bacteria | 1122 |
| 634 | Ga0495651_0006940 | 3300046462 | Bacteria | 8660 |
| 635 | Ga0495651_0010467 | 3300046462 | Bacteria | 7127 |
| 636 | Ga0495651_0124365 | 3300046462 | Bacteria | 1890 |
| 637 | Ga0495653_0005806 | 3300046463 | Bacteria | 10100 |
| 638 | Ga0495653_0031963 | 3300046463 | Bacteria | 4182 |
| 639 | Ga0495580_0023927 | 3300046472 | Bacteria | 4479 |
| 640 | Ga0495582_0001980 | 3300046473 | Bacteria | 11492 |
| 641 | Ga0495582_0016329 | 3300046473 | Bacteria | 4067 |
| 642 | Ga0495582_0188849 | 3300046473 | Bacteria | 1175 |
| 643 | Ga0495639_0115959 | 3300046475 | Bacteria | 1274 |
| 644 | Ga0495662_0017079 | 3300046476 | Bacteria | 3512 |
| 645 | Ga0495662_0023074 | 3300046476 | Bacteria | 3004 |
| 646 | Ga0495664_0011215 | 3300046477 | Bacteria | 5047 |
| 647 | Ga0495664_0030428 | 3300046477 | Bacteria | 3162 |
| 648 | Ga0495664_0158397 | 3300046477 | Bacteria | 1373 |
| 649 | Ga0495584_0043380 | 3300046491 | Bacteria | 2270 |
| 650 | Ga0495585_0005655 | 3300046492 | Bacteria | 7848 |
| 651 | Ga0495594_0031426 | 3300046499 | Bacteria | 2878 |
| 652 | Ga0495607_0018716 | 3300046501 | Bacteria | 4407 |
| 653 | Ga0495608_0002361 | 3300046511 | Bacteria | 13592 |
| 654 | Ga0495608_0009924 | 3300046511 | Bacteria | 6648 |
| 655 | Ga0495608_0052523 | 3300046511 | Bacteria | 2698 |
| 656 | Ga0495608_0109666 | 3300046511 | Bacteria | 1775 |
| 657 | Ga0495616_0163600 | 3300046513 | Bacteria | 999 |
| 658 | Ga0495618_0094114 | 3300046514 | Bacteria | 1916 |
| 659 | Ga0495618_0222743 | 3300046514 | Bacteria | 1189 |
| 660 | Ga0495628_0022655 | 3300046516 | Bacteria | 5160 |
| 661 | Ga0495628_0123385 | 3300046516 | Bacteria | 1985 |
| 662 | Ga0495628_0211149 | 3300046516 | Bacteria | 1460 |
| 663 | Ga0495630_0071577 | 3300046517 | Bacteria | 2609 |
| 664 | Ga0495630_0335863 | 3300046517 | Bacteria | 1156 |
| 665 | Ga0495637_0087789 | 3300046520 | Bacteria | 1231 |
| 666 | Ga0495663_0020038 | 3300046525 | Bacteria | 1918 |
| 667 | Ga0495666_0023142 | 3300046526 | Bacteria | 3073 |
| 668 | Ga0495652_0007613 | 3300046529 | Bacteria | 9976 |
| 669 | Ga0495652_0016985 | 3300046529 | Bacteria | 6502 |
| 670 | Ga0495652_0025878 | 3300046529 | Bacteria | 5185 |
| 671 | Ga0495665_0397264 | 3300046531 | Bacteria | 699 |
| 672 | Ga0495640_0014780 | 3300046533 | Bacteria | 5896 |
| 673 | Ga0495640_0050214 | 3300046533 | Bacteria | 2875 |
| 674 | Ga0495640_0169891 | 3300046533 | Bacteria | 1393 |
| 675 | Ga0495640_0549024 | 3300046533 | Bacteria | 700 |
| 676 | Ga0495586_0206836 | 3300046535 | Bacteria | 1113 |
| 677 | Ga0495587_0007105 | 3300046536 | Bacteria | 7263 |
| 678 | Ga0495587_0028567 | 3300046536 | Bacteria | 3391 |
| 679 | Ga0495587_0068743 | 3300046536 | Bacteria | 2063 |
| 680 | Ga0495598_0064750 | 3300046537 | Bacteria | 1136 |
| 681 | Ga0495609_0132264 | 3300046538 | Bacteria | 1068 |
| 682 | Ga0495645_0005135 | 3300046543 | Bacteria | 8967 |
| 683 | Ga0495645_0040951 | 3300046543 | Bacteria | 3378 |
| 684 | Ga0495622_0045358 | 3300046557 | Bacteria | 2042 |
| 685 | Ga0495633_0010760 | 3300046558 | Bacteria | 4975 |
| 686 | Ga0495667_0003355 | 3300046559 | Bacteria | 10716 |
| 687 | Ga0495667_0030087 | 3300046559 | Bacteria | 3651 |
| 688 | Ga0495667_0044995 | 3300046559 | Bacteria | 2924 |
| 689 | Ga0495656_0010834 | 3300046615 | Bacteria | 3329 |
| 690 | Ga0495656_0301522 | 3300046615 | Bacteria | 821 |
| 691 | Ga0495634_0035859 | 3300046642 | Bacteria | 3394 |
| 692 | Ga0495635_0006330 | 3300046663 | Bacteria | 8252 |
| 693 | Ga0495635_0015493 | 3300046663 | Bacteria | 5330 |
| 694 | Ga0495635_0024053 | 3300046663 | Bacteria | 4246 |
| 695 | Ga0495635_0193258 | 3300046663 | Bacteria | 1381 |
| 696 | Ga0495659_0003872 | 3300046664 | Bacteria | 4753 |
| 697 | Ga0495661_0121175 | 3300046665 | Bacteria | 1445 |
| 698 | Ga0495588_0042475 | 3300046674 | Bacteria | 2324 |
| 699 | Ga0495588_0153953 | 3300046674 | Bacteria | 1215 |
| 700 | Ga0495657_0010275 | 3300046675 | Bacteria | 7047 |
| 701 | Ga0495657_0208317 | 3300046675 | Bacteria | 1189 |
| 702 | Ga0495657_0289544 | 3300046675 | Bacteria | 978 |
| 703 | Ga0495599_0006067 | 3300046678 | Bacteria | 7271 |
| 704 | Ga0495599_0030955 | 3300046678 | Bacteria | 3359 |
| 705 | Ga0495599_0059428 | 3300046678 | Bacteria | 2391 |
| 706 | Ga0495646_0027682 | 3300046680 | Bacteria | 3554 |
| 707 | Ga0495646_0065946 | 3300046680 | Bacteria | 2142 |
| 708 | Ga0495647_0002304 | 3300046681 | Bacteria | 5989 |
| 709 | Ga0495658_0001380 | 3300046683 | Bacteria | 12740 |
| 710 | Ga0495658_0008239 | 3300046683 | Bacteria | 5163 |
| 711 | Ga0495658_0018720 | 3300046683 | Bacteria | 3605 |
| 712 | Ga0495658_0098907 | 3300046683 | Bacteria | 1738 |
| 713 | Ga0495669_0187291 | 3300046684 | Bacteria | 987 |
| 714 | Ga0495613_0021544 | 3300046689 | Bacteria | 4801 |
| 715 | Ga0495613_0033002 | 3300046689 | Bacteria | 3847 |
| 716 | Ga0495624_0170296 | 3300046690 | Bacteria | 1328 |
| 717 | Ga0495624_0212406 | 3300046690 | Bacteria | 1173 |
| 718 | Ga0495624_0249232 | 3300046690 | Bacteria | 1074 |
| 719 | Ga0495670_0010386 | 3300046691 | Bacteria | 4573 |
| 720 | Ga0495589_0076957 | 3300046794 | Bacteria | 1626 |
| 721 | Ga0495600_0002926 | 3300046809 | Bacteria | 9951 |
| 722 | Ga0495600_0051389 | 3300046809 | Bacteria | 2691 |
| 723 | Ga0495600_0115064 | 3300046809 | Bacteria | 1751 |
| 724 | Ga0495600_0219998 | 3300046809 | Bacteria | 1215 |
| 725 | Ga0495581_0015174 | 3300047315 | Bacteria | 4472 |
| 726 | Ga0495581_0050936 | 3300047315 | Bacteria | 2392 |
| 727 | Ga0495581_0349107 | 3300047315 | Bacteria | 863 |
| 728 | Ga0495604_0000650 | 3300047317 | Bacteria | 29638 |
| 729 | Ga0495604_0032681 | 3300047317 | Bacteria | 4123 |
| 730 | Ga0495604_0062985 | 3300047317 | Bacteria | 2831 |
| 731 | Ga0495604_0158884 | 3300047317 | Bacteria | 1599 |
| 732 | Ga0495604_0218241 | 3300047317 | Bacteria | 1314 |
| 733 | Ga0495604_0251516 | 3300047317 | Bacteria | 1204 |
| 734 | Ga0495674_0023898 | 3300047319 | Bacteria | 5625 |
| 735 | Ga0495674_0035936 | 3300047319 | Bacteria | 4466 |
| 736 | Ga0495674_0264799 | 3300047319 | Bacteria | 1411 |
| 737 | Ga0495676_0036491 | 3300047321 | Bacteria | 4104 |
| 738 | Ga0495676_0044058 | 3300047321 | Bacteria | 3646 |
| 739 | Ga0495680_0003242 | 3300047322 | Bacteria | 16156 |
| 740 | Ga0495680_0006853 | 3300047322 | Bacteria | 10525 |
| 741 | Ga0495680_0044496 | 3300047322 | Bacteria | 3510 |
| 742 | Ga0495680_0049188 | 3300047322 | Bacteria | 3303 |
| 743 | Ga0495680_0058642 | 3300047322 | Bacteria | 2974 |
| 744 | Ga0495677_0014508 | 3300047445 | Bacteria | 2869 |
| 745 | Ga0495684_0006578 | 3300047471 | Bacteria | 9011 |
| 746 | Ga0495593_0083128 | 3300047673 | Bacteria | 1655 |
| 747 | Ga0495593_0098765 | 3300047673 | Bacteria | 1499 |
| 748 | Ga0495593_0190225 | 3300047673 | Bacteria | 1032 |
| 749 | Ga0495602_0028540 | 3300048088 | Bacteria | 5337 |
| 750 | Ga0495602_0048062 | 3300048088 | Bacteria | 3839 |
| 751 | Ga0495602_0061874 | 3300048088 | Bacteria | 3251 |
| 752 | Ga0495602_0125498 | 3300048088 | Bacteria | 2057 |
| 753 | Ga0495602_0527818 | 3300048088 | Bacteria | 821 |
| 754 | Ga0495614_0003887 | 3300048089 | Bacteria | 6710 |
| 755 | Ga0495614_0224043 | 3300048089 | Bacteria | 855 |
| 756 | Ga0496100_0000839 | 3300048903 | Bacteria | 14752 |
| 757 | Ga0496100_0044549 | 3300048903 | Bacteria | 2842 |
| 758 | Ga0496100_0148617 | 3300048903 | Bacteria | 1668 |
| 759 | Ga0496101_0000633 | 3300048904 | Bacteria | 21327 |
| 760 | Ga0496101_0055305 | 3300048904 | Bacteria | 2866 |
| 761 | Ga0496101_0112641 | 3300048904 | Bacteria | 2049 |
| 762 | Ga0496101_0649406 | 3300048904 | Bacteria | 833 |
| 763 | Ga0496102_0002481 | 3300048905 | Bacteria | 15749 |
| 764 | Ga0496102_0024981 | 3300048905 | Bacteria | 5315 |
| 765 | Ga0496102_0043730 | 3300048905 | Bacteria | 4063 |
| 766 | Ga0496102_0480719 | 3300048905 | Bacteria | 1163 |
| 767 | Ga0496103_0000717 | 3300048906 | Bacteria | 24507 |
| 768 | Ga0496104_0115662 | 3300048907 | Bacteria | 2573 |
| 769 | Ga0496104_0140339 | 3300048907 | Bacteria | 2321 |
| 770 | Ga0496104_0160625 | 3300048907 | Bacteria | 2155 |
| 771 | Ga0496104_0170736 | 3300048907 | Bacteria | 2085 |
| 772 | Ga0496104_0318749 | 3300048907 | Bacteria | 1467 |
| 773 | Ga0496105_0000950 | 3300048908 | Bacteria | 19841 |
| 774 | Ga0496105_0003911 | 3300048908 | Bacteria | 11139 |
| 775 | Ga0496105_0050027 | 3300048908 | Bacteria | 3452 |
| 776 | Ga0496105_0102275 | 3300048908 | Bacteria | 2366 |
| 777 | Ga0496105_0450100 | 3300048908 | Bacteria | 1016 |
| 778 | Ga0496106_0002354 | 3300048909 | Bacteria | 14076 |
| 779 | Ga0496106_0058335 | 3300048909 | Bacteria | 2922 |
| 780 | Ga0496106_0141361 | 3300048909 | Bacteria | 1893 |
| 781 | Ga0496106_0317706 | 3300048909 | Bacteria | 1250 |
| 782 | Ga0496106_0476717 | 3300048909 | Bacteria | 1002 |
| 783 | Ga0496107_0022368 | 3300048910 | Bacteria | 4467 |
| 784 | Ga0496107_0517709 | 3300048910 | Bacteria | 884 |
| 785 | Ga0496107_0738748 | 3300048910 | Bacteria | 723 |
| 786 | Ga0496108_0004886 | 3300048911 | Bacteria | 10821 |
| 787 | Ga0496108_0005842 | 3300048911 | Bacteria | 9975 |
| 788 | Ga0496108_0018525 | 3300048911 | Bacteria | 5702 |
| 789 | Ga0496108_0174300 | 3300048911 | Bacteria | 1861 |
| 790 | Ga0496108_0238287 | 3300048911 | Bacteria | 1582 |
| 791 | Ga0496108_0374615 | 3300048911 | Bacteria | 1243 |
| 792 | Ga0496109_0002017 | 3300048912 | Bacteria | 16843 |
| 793 | Ga0496109_0119288 | 3300048912 | Bacteria | 2456 |
| 794 | Ga0496109_0131793 | 3300048912 | Bacteria | 2333 |
| 795 | Ga0496109_0154323 | 3300048912 | Bacteria | 2150 |
| 796 | Ga0496109_0208984 | 3300048912 | Bacteria | 1835 |
| 797 | Ga0496110_0001386 | 3300048913 | Bacteria | 17473 |
| 798 | Ga0496110_0097681 | 3300048913 | Bacteria | 2631 |
| 799 | Ga0496110_0275790 | 3300048913 | Bacteria | 1531 |
| 800 | Ga0496110_0361497 | 3300048913 | Bacteria | 1322 |
| 801 | Ga0496111_0014927 | 3300048914 | Bacteria | 5319 |
| 802 | Ga0496111_0340883 | 3300048914 | Bacteria | 1109 |
| 803 | Ga0496111_0497363 | 3300048914 | Bacteria | 897 |
| 804 | Ga0496112_0010427 | 3300048915 | Bacteria | 8428 |
| 805 | Ga0496112_0011955 | 3300048915 | Bacteria | 7955 |
| 806 | Ga0496112_0119332 | 3300048915 | Bacteria | 2607 |
| 807 | Ga0496112_0156160 | 3300048915 | Bacteria | 2248 |
| 808 | Ga0496112_0229929 | 3300048915 | Bacteria | 1809 |
| 809 | Ga0496112_0346465 | 3300048915 | Bacteria | 1428 |
| 810 | Ga0496113_0002233 | 3300048916 | Bacteria | 11186 |
| 811 | Ga0496113_0023650 | 3300048916 | Bacteria | 4358 |
| 812 | Ga0496113_0087098 | 3300048916 | Bacteria | 2400 |
| 813 | Ga0496113_0171137 | 3300048916 | Bacteria | 1720 |
| 814 | Ga0496113_0656675 | 3300048916 | Bacteria | 838 |
| 815 | Ga0496114_0012067 | 3300048917 | Bacteria | 6913 |
| 816 | Ga0496114_0114534 | 3300048917 | Bacteria | 2312 |
| 817 | Ga0496114_0132511 | 3300048917 | Bacteria | 2153 |
| 818 | Ga0496114_0718379 | 3300048917 | Bacteria | 875 |
| 819 | Ga0496115_0018060 | 3300048918 | Bacteria | 5405 |
| 820 | Ga0496115_0023335 | 3300048918 | Bacteria | 4800 |
| 821 | Ga0496115_0037136 | 3300048918 | Bacteria | 3860 |
| 822 | Ga0496115_0176500 | 3300048918 | Bacteria | 1766 |
| 823 | Ga0496115_0177725 | 3300048918 | Bacteria | 1760 |
| 824 | Ga0496115_0384668 | 3300048918 | Bacteria | 1140 |
| 825 | Ga0501031_0001817 | 3300049568 | Bacteria | 13417 |
| 826 | Ga0501032_0153867 | 3300049569 | Bacteria | 1511 |
| 827 | Ga0501034_0009043 | 3300049571 | Bacteria | 10461 |
| 828 | Ga0501034_0179070 | 3300049571 | Bacteria | 2085 |
| 829 | Ga0501034_0203497 | 3300049571 | Bacteria | 1937 |
| 830 | Ga0501034_0324289 | 3300049571 | Bacteria | 1472 |
| 831 | Ga0501036_0042231 | 3300049572 | Bacteria | 3861 |
| 832 | Ga0501036_0347595 | 3300049572 | Bacteria | 1238 |
| 833 | Ga0501037_0009760 | 3300049573 | Bacteria | 7048 |
| 834 | Ga0501037_0059787 | 3300049573 | Bacteria | 2779 |
| 835 | Ga0501038_0031990 | 3300049574 | Bacteria | 4645 |
| 836 | Ga0501039_0094852 | 3300049575 | Bacteria | 2326 |
| 837 | Ga0501039_0134976 | 3300049575 | Bacteria | 1937 |
| 838 | Ga0501043_0213634 | 3300049579 | Bacteria | 1494 |
| 839 | Ga0501046_0364018 | 3300049580 | Bacteria | 1048 |
| 840 | Ga0501047_0132012 | 3300049581 | Bacteria | 2377 |
| 841 | Ga0501047_0146198 | 3300049581 | Bacteria | 2241 |
| 842 | Ga0501047_0284234 | 3300049581 | Bacteria | 1498 |
| 843 | Ga0501048_0049354 | 3300049582 | Bacteria | 2999 |
| 844 | Ga0501067_0015831 | 3300049583 | Bacteria | 4171 |
| 845 | Ga0501069_0031197 | 3300049585 | Bacteria | 2929 |
| 846 | Ga0501069_0069043 | 3300049585 | Bacteria | 1978 |
| 847 | Ga0501070_0260131 | 3300049586 | Bacteria | 1418 |
| 848 | Ga0501071_0025068 | 3300049587 | Bacteria | 4176 |
| 849 | Ga0501071_0076163 | 3300049587 | Bacteria | 2450 |
| 850 | Ga0501073_0035135 | 3300049589 | Bacteria | 3563 |
| 851 | Ga0501073_0069577 | 3300049589 | Bacteria | 2452 |
| 852 | Ga0501073_0078496 | 3300049589 | Bacteria | 2297 |
| 853 | Ga0501073_0167848 | 3300049589 | Bacteria | 1519 |
| 854 | Ga0501075_0085900 | 3300049591 | Bacteria | 2384 |
| 855 | Ga0501076_0136607 | 3300049592 | Bacteria | 1990 |
| 856 | Ga0501077_0022622 | 3300049593 | Bacteria | 3982 |
| 857 | Ga0501079_0036324 | 3300049741 | Bacteria | 3796 |
| 858 | Ga0501079_0835308 | 3300049741 | Bacteria | 725 |
| 859 | Ga0501080_0033942 | 3300049742 | Bacteria | 4763 |
| 860 | Ga0501080_0082281 | 3300049742 | Bacteria | 2990 |
| 861 | Ga0501080_0133595 | 3300049742 | Bacteria | 2297 |
| 862 | Ga0501083_0216837 | 3300049744 | Bacteria | 1247 |
| 863 | Ga0501035_0049204 | 3300049822 | Bacteria | 3778 |
| 864 | Ga0501035_0187167 | 3300049822 | Bacteria | 1781 |
| 865 | Ga0501044_0000260 | 3300049823 | Bacteria | 67087 |
| 866 | Ga0501044_0202335 | 3300049823 | Bacteria | 1943 |
| 867 | Ga0501044_0323303 | 3300049823 | Bacteria | 1466 |
| 868 | Ga0501045_0169646 | 3300049824 | Bacteria | 1625 |
| 869 | nmdc:mga03683_104005_c1 | 3300050489 | Bacteria | 1250 |
| 870 | nmdc:mga0k408_327784_c1 | 3300050493 | Bacteria | 913 |
| 871 | nmdc:mga0k408_57250_c1 | 3300050493 | Bacteria | 2263 |
| 872 | nmdc:mga06z11_138949_c1 | 3300050494 | Bacteria | 1371 |
| 873 | nmdc:mga06z11_5417_c1 | 3300050494 | Bacteria | 5116 |
| 874 | nmdc:mga05p37_757163_c1 | 3300050507 | Bacteria | 1069 |
| 875 | nmdc:mga08y16_149785_c1 | 3300050511 | Bacteria | 2426 |
| 876 | nmdc:mga08y16_2489_c1 | 3300050511 | Bacteria | 18925 |
| 877 | nmdc:mga08y16_513940_c1 | 3300050511 | Bacteria | 1215 |
| 878 | nmdc:mga0n895_124763_c1 | 3300050512 | Bacteria | 2598 |
| 879 | nmdc:mga0n895_5206_c1 | 3300050512 | Bacteria | 10827 |
| 880 | nmdc:mga0rr50_368818_c1 | 3300050513 | Bacteria | 1209 |
| 881 | nmdc:mga0rr50_6368_c1 | 3300050513 | Bacteria | 7176 |
| 882 | nmdc:mga08x19_110845_c1 | 3300050514 | Bacteria | 1830 |
| 883 | nmdc:mga0a205_515996_c1 | 3300050515 | Bacteria | 1052 |
| 884 | nmdc:mga0a205_97311_c1 | 3300050515 | Bacteria | 2842 |
| 885 | Ga0495601_0000233 | 3300053077 | Bacteria | 29812 |
| 886 | Ga0495601_0006401 | 3300053077 | Bacteria | 6886 |
| 887 | Ga0495601_0009287 | 3300053077 | Bacteria | 5813 |
| 888 | Ga0495601_0011847 | 3300053077 | Bacteria | 5228 |
| 889 | Ga0495601_0083497 | 3300053077 | Bacteria | 2051 |
| 890 | Ga0495601_0224341 | 3300053077 | Bacteria | 1227 |
| 891 | Ga0495612_0000533 | 3300053078 | Bacteria | 15307 |
| 892 | Ga0495612_0002344 | 3300053078 | Bacteria | 7797 |
| 893 | Ga0495612_0005346 | 3300053078 | Bacteria | 5304 |
| 894 | Ga0495612_0016776 | 3300053078 | Bacteria | 2933 |
| 895 | Ga0495612_0026943 | 3300053078 | Bacteria | 2310 |
| 896 | Ga0495612_0050719 | 3300053078 | Bacteria | 1704 |
| 897 | Ga0495595_0000809 | 3300053084 | Bacteria | 11928 |
| 898 | Ga0495595_0003248 | 3300053084 | Bacteria | 6459 |
| 899 | Ga0495595_0012167 | 3300053084 | Bacteria | 3612 |
| 900 | Ga0495619_0000164 | 3300053085 | Bacteria | 48672 |
| 901 | Ga0495619_0001846 | 3300053085 | Bacteria | 14099 |
| 902 | Ga0495619_0002698 | 3300053085 | Bacteria | 11606 |
| 903 | Ga0495619_0034067 | 3300053085 | Bacteria | 3309 |
| 904 | Ga0495619_0080016 | 3300053085 | Bacteria | 2198 |
| 905 | Ga0495619_0162032 | 3300053085 | Bacteria | 1545 |
| 906 | Ga0495619_0246653 | 3300053085 | Bacteria | 1237 |
| 907 | Ga0500641_0001278 | 3300053096 | Bacteria | 8932 |
| 908 | Ga0500562_030884 | 3300053108 | Bacteria | 1413 |
| 909 | Ga0500642_0144543 | 3300053130 | Bacteria | 1116 |
| 910 | Ga0500616_0096882 | 3300053153 | Bacteria | 1449 |
| 911 | Ga0500616_0112193 | 3300053153 | Bacteria | 1315 |
| 912 | Ga0501084_0004432 | 3300054114 | Bacteria | 11456 |
| 913 | Ga0501084_0606425 | 3300054114 | Bacteria | 925 |
| 914 | Ga0501082_0053046 | 3300060353 | Bacteria | 3496 |
| 915 | Ga0501082_0058848 | 3300060353 | Bacteria | 3311 |
| 916 | Ga0501082_0291081 | 3300060353 | Bacteria | 1422 |
| 917 | Ga0501082_0504765 | 3300060353 | Bacteria | 1057 |
| 918 | 2891089572 | 2891088606 | Bacteria | 4762464 |
| 919 | Ga0501082_1227889 | |||
| 920 | SwRhRL2b_contig_2732496 | |||
| 921 | 2214544922 | |||
| 922 | ARSoilYngRDRAFT_c00038 | |||
| 923 | ARSoilOldRDRAFT_c000060 | |||
| 924 | ARCol0yngRDRAFT_1000282 | |||
| 925 | JGI24032J14994_100092 | |||
| 926 | JGI24752J21851_1012767 | |||
| 927 | JGI24746J21847_1000292 | |||
| 928 | JGI24747J21853_1000026 | |||
| 929 | JGI24747J21853_1001037 | |||
| 930 | JGI24739J22299_10005110 | |||
| 931 | JGI24739J22299_10005427 | |||
| 932 | JGI24737J22298_10057301 | |||
| 933 | JGI24745J21846_1000461 | |||
| 934 | JGI24745J21846_1000497 | |||
| 935 | JGI24738J21930_10000821 | |||
| 936 | JGI24738J21930_10000907 | |||
| 937 | JGI24749J21850_1002488 | |||
| 938 | JGI24744J21845_10000074 | |||
| 939 | JGI24035J26624_1000024 | |||
| 940 | JGI24035J26624_1000069 | |||
| 941 | JGI24742J22300_10000438 | |||
| 942 | JGI24751J29686_10006843 | |||
| 943 | JGI25153J46596_10000746 | |||
| 944 | JGI25405J52794_10009415 | |||
| 945 | Ga0065716_1002124 | |||
| 946 | Ga0065704_10152132 | |||
| 947 | Ga0065712_10005784 | |||
| 948 | Ga0065712_10022877 | |||
| 949 | Ga0065715_10029504 | |||
| 950 | Ga0065707_10182436 | |||
| 951 | Ga0065707_10211669 | |||
| 952 | Ga0070676_10000085 | |||
| 953 | Ga0070676_10627921 | |||
| 954 | Ga0070683_100003426 | |||
| 955 | Ga0070683_100305116 | |||
| 956 | Ga0070690_100012202 | |||
| 957 | Ga0070690_100108706 | |||
| 958 | Ga0070690_100166829 | |||
| 959 | Ga0070690_100342153 | |||
| 960 | Ga0070670_100003301 | |||
| 961 | Ga0070670_101002555 | |||
| 962 | Ga0070677_10000381 | |||
| 963 | Ga0068869_100000832 | |||
| 964 | Ga0070666_10027668 | |||
| 965 | Ga0070666_10304968 | |||
| 966 | Ga0070680_100005798 | |||
| 967 | Ga0070680_100101502 | |||
| 968 | Ga0070680_100116146 | |||
| 969 | Ga0070682_100009144 | |||
| 970 | Ga0070682_100957295 | |||
| 971 | Ga0068868_100000495 | |||
| 972 | Ga0070660_100018334 | |||
| 973 | Ga0070660_100024732 | |||
| 974 | Ga0070660_100288492 | |||
| 975 | Ga0070660_100400823 | |||
| 976 | Ga0070689_100001147 | |||
| 977 | Ga0070689_100021981 | |||
| 978 | Ga0070689_100237691 | |||
| 979 | Ga0070689_100251261 | |||
| 980 | Ga0070691_10004705 | |||
| 981 | Ga0070687_100004649 | |||
| 982 | Ga0070687_100005813 | |||
| 983 | Ga0070661_100000983 | |||
| 984 | Ga0070661_100371049 | |||
| 985 | Ga0070692_10008860 | |||
| 986 | Ga0070692_10044442 | |||
| 987 | Ga0070668_100005583 | |||
| 988 | Ga0070668_100361461 | |||
| 989 | Ga0070668_100568511 | |||
| 990 | Ga0070668_100774944 | |||
| 991 | Ga0070668_101216702 | |||
| 992 | Ga0070669_100002421 | |||
| 993 | Ga0070669_100098467 | |||
| 994 | Ga0070669_100204275 | |||
| 995 | Ga0070669_100736395 | |||
| 996 | Ga0070675_100001045 | |||
| 997 | Ga0070675_100113993 | |||
| 998 | Ga0070675_100883406 | |||
| 999 | Ga0070671_100000386 | |||
| 1000 | Ga0070671_100008347 | |||
| 1001 | Ga0070674_100008419 | |||
| 1002 | Ga0070674_100666926 | |||
| 1003 | Ga0070673_100000035 | |||
| 1004 | Ga0070673_100069576 | |||
| 1005 | Ga0070673_100205254 | |||
| 1006 | Ga0070673_100884911 | |||
| 1007 | Ga0070688_100000837 | |||
| 1008 | Ga0070688_100019122 | |||
| 1009 | Ga0070688_100050002 | |||
| 1010 | Ga0070688_100151172 | |||
| 1011 | Ga0070688_100161291 | |||
| 1012 | Ga0070688_100289209 | |||
| 1013 | Ga0070688_100300461 | |||
| 1014 | Ga0070659_100019273 | |||
| 1015 | Ga0070659_100024284 | |||
| 1016 | Ga0070659_100393008 | |||
| 1017 | Ga0070667_100007647 | |||
| 1018 | Ga0070667_100032699 | |||
| 1019 | Ga0070667_100486802 | |||
| 1020 | Ga0070667_100647417 | |||
| 1021 | Ga0070667_100683930 | |||
| 1022 | Ga0070703_10032866 | |||
| 1023 | Ga0070709_10091189 | |||
| 1024 | Ga0070709_10208312 | |||
| 1025 | Ga0070714_100016115 | |||
| 1026 | Ga0070713_100009258 | |||
| 1027 | Ga0070713_100305072 | |||
| 1028 | Ga0070710_10015346 | |||
| 1029 | Ga0070701_10000908 | |||
| 1030 | Ga0070701_10130838 | |||
| 1031 | Ga0070701_10191673 | |||
| 1032 | Ga0070701_10258138 | |||
| 1033 | Ga0070711_100077042 | |||
| 1034 | Ga0070705_100052320 | |||
| 1035 | Ga0070700_100010171 | |||
| 1036 | Ga0070700_100067783 | |||
| 1037 | Ga0070700_100396022 | |||
| 1038 | Ga0070700_100677465 | |||
| 1039 | Ga0070694_100015329 | |||
| 1040 | Ga0070694_100035826 | |||
| 1041 | Ga0070663_100008870 | |||
| 1042 | Ga0070663_100391152 | |||
| 1043 | Ga0070663_100527579 | |||
| 1044 | Ga0070678_100000260 | |||
| 1045 | Ga0070678_100010910 | |||
| 1046 | Ga0070678_100227409 | |||
| 1047 | Ga0070678_100233904 | |||
| 1048 | Ga0070662_100029158 | |||
| 1049 | Ga0070662_100203544 | |||
| 1050 | Ga0070662_100399107 | |||
| 1051 | Ga0070681_10003989 | |||
| 1052 | Ga0070681_10018410 | |||
| 1053 | Ga0068867_100002696 | |||
| 1054 | Ga0068867_100778049 | |||
| 1055 | Ga0070685_10009051 | |||
| 1056 | Ga0070685_10208560 | |||
| 1057 | Ga0070699_100150838 | |||
| 1058 | Ga0070679_100074703 | |||
| 1059 | Ga0070679_100081156 | |||
| 1060 | Ga0070679_100330778 | |||
| 1061 | Ga0070679_100503310 | |||
| 1062 | Ga0070684_100002858 | |||
| 1063 | Ga0070684_100288712 | |||
| 1064 | Ga0070684_100365174 | |||
| 1065 | Ga0068853_100384630 | |||
| 1066 | Ga0068853_100511544 | |||
| 1067 | Ga0070672_100017568 | |||
| 1068 | Ga0070672_100078180 | |||
| 1069 | Ga0070672_100757405 | |||
| 1070 | Ga0070686_100045017 | |||
| 1071 | Ga0070686_100087173 | |||
| 1072 | Ga0070686_100619926 | |||
| 1073 | Ga0070695_100020350 | |||
| 1074 | Ga0070695_100023475 | |||
| 1075 | Ga0070696_100022972 | |||
| 1076 | Ga0070696_100223609 | |||
| 1077 | Ga0070696_100807299 | |||
| 1078 | Ga0070693_100000947 | |||
| 1079 | Ga0070693_100017821 | |||
| 1080 | Ga0070693_100276192 | |||
| 1081 | Ga0070665_100091178 | |||
| 1082 | Ga0070665_100153158 | |||
| 1083 | Ga0070665_100182712 | |||
| 1084 | Ga0070704_100095134 | |||
| 1085 | Ga0070704_100412098 | |||
| 1086 | Ga0068855_100325879 | |||
| 1087 | Ga0068855_100351186 | |||
| 1088 | Ga0070664_100002866 | |||
| 1089 | Ga0070664_100143322 | |||
| 1090 | Ga0068857_100002854 | |||
| 1091 | Ga0068854_100014694 | |||
| 1092 | Ga0068856_100002432 | |||
| 1093 | Ga0068856_100353091 | |||
| 1094 | Ga0068856_100854923 | |||
| 1095 | Ga0070702_100001455 | |||
| 1096 | Ga0068852_100071249 | |||
| 1097 | Ga0068852_101007818 | |||
| 1098 | Ga0068859_100158923 | |||
| 1099 | Ga0068859_100188839 | |||
| 1100 | Ga0068859_101157201 | |||
| 1101 | Ga0068864_100003611 | |||
| 1102 | Ga0068864_100384639 | |||
| 1103 | Ga0068864_100385792 | |||
| 1104 | Ga0068866_10000364 | |||
| 1105 | Ga0068866_10438089 | |||
| 1106 | Ga0068861_100016949 | |||
| 1107 | Ga0068861_100466605 | |||
| 1108 | Ga0068870_10000015 | |||
| 1109 | Ga0068863_100000278 | |||
| 1110 | Ga0068863_100149304 | |||
| 1111 | Ga0068863_101049554 | |||
| 1112 | Ga0068863_101104844 | |||
| 1113 | Ga0068858_100061520 | |||
| 1114 | Ga0068858_100068207 | |||
| 1115 | Ga0068858_100173582 | |||
| 1116 | Ga0068858_101016675 | |||
| 1117 | Ga0068860_100005473 | |||
| 1118 | Ga0068860_100329548 | |||
| 1119 | Ga0068860_100792452 | |||
| 1120 | Ga0068862_100003784 | |||
| 1121 | Ga0068862_101256511 | |||
| 1122 | Ga0081455_10001601 | |||
| 1123 | Ga0081540_1066030 | |||
| 1124 | Ga0070717_10050611 | |||
| 1125 | Ga0070717_10120749 | |||
| 1126 | Ga0070715_10031498 | |||
| 1127 | Ga0070715_10101480 | |||
| 1128 | Ga0070715_10224936 | |||
| 1129 | Ga0070716_100129182 | |||
| 1130 | Ga0070712_100032022 | |||
| 1131 | Ga0070712_100730752 | |||
| 1132 | Ga0075369_10173075 | |||
| 1133 | Ga0075366_10333697 | |||
| 1134 | Ga0097621_100182827 | |||
| 1135 | Ga0075370_10232616 | |||
| 1136 | Ga0068871_100005547 | |||
| 1137 | Ga0068871_100043579 | |||
| 1138 | Ga0075428_100927995 | |||
| 1139 | Ga0075428_101030291 | |||
| 1140 | Ga0075433_10278997 | |||
| 1141 | Ga0075433_10707110 | |||
| 1142 | Ga0075434_100040806 | |||
| 1143 | Ga0075434_100164262 | |||
| 1144 | Ga0075434_100184960 | |||
| 1145 | Ga0075434_100340124 | |||
| 1146 | Ga0068865_100013483 | |||
| 1147 | Ga0068865_100392683 | |||
| 1148 | Ga0068865_100439823 | |||
| 1149 | Ga0097620_100158911 | |||
| 1150 | Ga0097620_101157223 | |||
| 1151 | Ga0075435_100109988 | |||
| 1152 | Ga0075435_100130878 | |||
| 1153 | Ga0105251_10095723 | |||
| 1154 | Ga0105244_10028073 | |||
| 1155 | Ga0105250_10029706 | |||
| 1156 | Ga0105240_10130174 | |||
| 1157 | Ga0111539_10004346 | |||
| 1158 | Ga0111539_10021841 | |||
| 1159 | Ga0111539_10380324 | |||
| 1160 | Ga0111539_11025791 | |||
| 1161 | Ga0111539_11334177 | |||
| 1162 | Ga0105245_10003800 | |||
| 1163 | Ga0105245_10192160 | |||
| 1164 | Ga0105247_10012563 | |||
| 1165 | Ga0105247_10094805 | |||
| 1166 | Ga0114129_11532294 | |||
| 1167 | Ga0105243_10020754 | |||
| 1168 | Ga0105243_10154534 | |||
| 1169 | Ga0105241_10000982 | |||
| 1170 | Ga0105241_10347462 | |||
| 1171 | Ga0105241_10489300 | |||
| 1172 | Ga0105242_10001299 | |||
| 1173 | Ga0105242_10134921 | |||
| 1174 | Ga0105248_10002736 | |||
| 1175 | Ga0105248_10011811 | |||
| 1176 | Ga0105248_10559593 | |||
| 1177 | Ga0105237_10039232 | |||
| 1178 | Ga0105238_10540377 | |||
| 1179 | Ga0105238_10540390 | |||
| 1180 | Ga0105238_10855874 | |||
| 1181 | Ga0105249_10002863 | |||
| 1182 | Ga0105249_10003014 | |||
| 1183 | Ga0105239_10040309 | |||
| 1184 | Ga0105239_10051763 | |||
| 1185 | Ga0105239_10444255 | |||
| 1186 | Ga0105246_10014978 | |||
| 1187 | Ga0105246_10422377 | |||
| 1188 | Ga0105246_10507805 | |||
| 1189 | Ga0157344_1001680 | |||
| 1190 | Ga0157337_1001545 | |||
| 1191 | Ga0157337_1001656 | |||
| 1192 | Ga0157335_1005074 | |||
| 1193 | Ga0157319_1002180 | |||
| 1194 | Ga0157316_1008033 | |||
| 1195 | Ga0157371_10263110 | |||
| 1196 | Ga0157370_10041263 | |||
| 1197 | Ga0157370_10280444 | |||
| 1198 | Ga0157374_10009129 | |||
| 1199 | Ga0157374_10558938 | |||
| 1200 | Ga0157374_10724683 | |||
| 1201 | Ga0157378_10004364 | |||
| 1202 | Ga0157378_10117768 | |||
| 1203 | Ga0163162_10011614 | |||
| 1204 | Ga0163162_10856008 | |||
| 1205 | Ga0157372_10315425 | |||
| 1206 | Ga0157375_10008586 | |||
| 1207 | Ga0157375_10252350 | |||
| 1208 | Ga0157375_10265464 | |||
| 1209 | Ga0157375_10423033 | |||
| 1210 | Ga0157375_11331414 | |||
| 1211 | Ga0163163_10087277 | |||
| 1212 | Ga0163163_10224898 | |||
| 1213 | Ga0163163_10228997 | |||
| 1214 | Ga0163163_10282290 | |||
| 1215 | Ga0157380_10003889 | |||
| 1216 | Ga0157380_10110479 | |||
| 1217 | Ga0157380_10231404 | |||
| 1218 | Ga0182008_10203574 | |||
| 1219 | Ga0182008_10308500 | |||
| 1220 | Ga0157377_10000317 | |||
| 1221 | Ga0157379_10000067 | |||
| 1222 | Ga0157379_10227954 | |||
| 1223 | Ga0157379_10461229 | |||
| 1224 | Ga0157379_10823754 | |||
| 1225 | Ga0157379_10921119 | |||
| 1226 | Ga0157376_10005894 | |||
| 1227 | Ga0163161_10000693 | |||
| 1228 | Ga0163161_10236175 | |||
| 1229 | Ga0163161_10237097 | |||
| 1230 | Ga0207666_1000681 | |||
| 1231 | Ga0207666_1024983 | |||
| 1232 | Ga0207673_1000509 | |||
| 1233 | Ga0209758_1000294 | |||
| 1234 | Ga0209758_1003227 | |||
| 1235 | Ga0209758_1048766 | |||
| 1236 | Ga0207697_10006734 | |||
| 1237 | Ga0207682_10000264 | |||
| 1238 | Ga0207682_10193403 | |||
| 1239 | Ga0207692_10002735 | |||
| 1240 | Ga0207642_10003957 | |||
| 1241 | Ga0207642_10110272 | |||
| 1242 | Ga0207710_10111826 | |||
| 1243 | Ga0207710_10113103 | |||
| 1244 | Ga0207688_10015833 | |||
| 1245 | Ga0207688_10069380 | |||
| 1246 | Ga0207680_10012813 | |||
| 1247 | Ga0207680_10387793 | |||
| 1248 | Ga0207647_10026102 | |||
| 1249 | Ga0207685_10053802 | |||
| 1250 | Ga0207645_10000926 | |||
| 1251 | Ga0207645_10048778 | |||
| 1252 | Ga0207643_10000004 | |||
| 1253 | Ga0207684_10565637 | |||
| 1254 | Ga0207654_10000437 | |||
| 1255 | Ga0207654_10096619 | |||
| 1256 | Ga0207707_10004519 | |||
| 1257 | Ga0207707_10027253 | |||
| 1258 | Ga0207695_10193355 | |||
| 1259 | Ga0207693_10064140 | |||
| 1260 | Ga0207693_10099518 | |||
| 1261 | Ga0207693_10495354 | |||
| 1262 | Ga0207663_10026971 | |||
| 1263 | Ga0207663_10133837 | |||
| 1264 | Ga0207663_10327165 | |||
| 1265 | Ga0207660_10004154 | |||
| 1266 | Ga0207660_10015289 | |||
| 1267 | Ga0207662_10246257 | |||
| 1268 | Ga0207662_10275008 | |||
| 1269 | Ga0207662_10290891 | |||
| 1270 | Ga0207657_10028591 | |||
| 1271 | Ga0207657_10275644 | |||
| 1272 | Ga0207657_10354529 | |||
| 1273 | Ga0207657_10443458 | |||
| 1274 | Ga0207649_10000090 | |||
| 1275 | Ga0207649_10022533 | |||
| 1276 | Ga0207652_10001397 | |||
| 1277 | Ga0207652_10260347 | |||
| 1278 | Ga0207652_10559384 | |||
| 1279 | Ga0207681_10001592 | |||
| 1280 | Ga0207681_10065632 | |||
| 1281 | Ga0207681_10069096 | |||
| 1282 | Ga0207681_10141370 | |||
| 1283 | Ga0207681_10159181 | |||
| 1284 | Ga0207650_10007098 | |||
| 1285 | Ga0207650_10038297 | |||
| 1286 | Ga0207659_10000038 | |||
| 1287 | Ga0207659_10546564 | |||
| 1288 | Ga0207687_10000342 | |||
| 1289 | Ga0207687_10017603 | |||
| 1290 | Ga0207687_10614390 | |||
| 1291 | Ga0207700_10033428 | |||
| 1292 | Ga0207700_10128059 | |||
| 1293 | Ga0207700_10654586 | |||
| 1294 | Ga0207664_10019530 | |||
| 1295 | Ga0207644_10000816 | |||
| 1296 | Ga0207644_10453620 | |||
| 1297 | Ga0207644_10467452 | |||
| 1298 | Ga0207690_10000440 | |||
| 1299 | Ga0207690_10697698 | |||
| 1300 | Ga0207690_10901450 | |||
| 1301 | Ga0207706_10040924 | |||
| 1302 | Ga0207706_10762044 | |||
| 1303 | Ga0207686_10000433 | |||
| 1304 | Ga0207686_10481906 | |||
| 1305 | Ga0207709_10000494 | |||
| 1306 | Ga0207709_10146562 | |||
| 1307 | Ga0207709_10675308 | |||
| 1308 | Ga0207670_10001363 | |||
| 1309 | Ga0207670_10001831 | |||
| 1310 | Ga0207670_10059844 | |||
| 1311 | Ga0207669_10000063 | |||
| 1312 | Ga0207669_10367898 | |||
| 1313 | Ga0207704_10001268 | |||
| 1314 | Ga0207704_10093122 | |||
| 1315 | Ga0207665_10164164 | |||
| 1316 | Ga0207665_10401035 | |||
| 1317 | Ga0207665_10621071 | |||
| 1318 | Ga0207691_10000981 | |||
| 1319 | Ga0207691_10120089 | |||
| 1320 | Ga0207691_10182978 | |||
| 1321 | Ga0207691_10243834 | |||
| 1322 | Ga0207691_10248964 | |||
| 1323 | Ga0207691_10902758 | |||
| 1324 | Ga0207711_10000792 | |||
| 1325 | Ga0207711_10012513 | |||
| 1326 | Ga0207711_10022018 | |||
| 1327 | Ga0207711_10092688 | |||
| 1328 | Ga0207689_10002635 | |||
| 1329 | Ga0207689_10074973 | |||
| 1330 | Ga0207661_10000531 | |||
| 1331 | Ga0207661_10629686 | |||
| 1332 | Ga0207679_10001109 | |||
| 1333 | Ga0207679_10032797 | |||
| 1334 | Ga0207679_10771142 | |||
| 1335 | Ga0207667_10274712 | |||
| 1336 | Ga0207667_10571249 | |||
| 1337 | Ga0207651_10000379 | |||
| 1338 | Ga0207651_10022519 | |||
| 1339 | Ga0207651_10249574 | |||
| 1340 | Ga0207712_10000717 | |||
| 1341 | Ga0207712_10097927 | |||
| 1342 | Ga0207668_10000429 | |||
| 1343 | Ga0207668_10221382 | |||
| 1344 | Ga0207668_10560799 | |||
| 1345 | Ga0207668_11131131 | |||
| 1346 | Ga0207640_10007602 | |||
| 1347 | Ga0207640_10674387 | |||
| 1348 | Ga0207658_10020967 | |||
| 1349 | Ga0207658_10427274 | |||
| 1350 | Ga0207658_10457899 | |||
| 1351 | Ga0207658_10554326 | |||
| 1352 | Ga0207658_10695773 | |||
| 1353 | Ga0207677_10001164 | |||
| 1354 | Ga0207677_10176280 | |||
| 1355 | Ga0207703_10049279 | |||
| 1356 | Ga0207703_10049601 | |||
| 1357 | Ga0207703_10086248 | |||
| 1358 | Ga0207703_10132072 | |||
| 1359 | Ga0207703_10145952 | |||
| 1360 | Ga0207639_10003596 | |||
| 1361 | Ga0207639_10754052 | |||
| 1362 | Ga0207639_10816187 | |||
| 1363 | Ga0207678_10002770 | |||
| 1364 | Ga0207678_10155366 | |||
| 1365 | Ga0207678_10773673 | |||
| 1366 | Ga0207708_10037726 | |||
| 1367 | Ga0207708_10353834 | |||
| 1368 | Ga0207708_10394842 | |||
| 1369 | Ga0207708_10434773 | |||
| 1370 | Ga0207708_10674829 | |||
| 1371 | Ga0207702_10003627 | |||
| 1372 | Ga0207641_10003728 | |||
| 1373 | Ga0207648_10081702 | |||
| 1374 | Ga0207648_10086653 | |||
| 1375 | Ga0207648_10462264 | |||
| 1376 | Ga0207648_10475978 | |||
| 1377 | Ga0207648_11089986 | |||
| 1378 | Ga0207676_10000583 | |||
| 1379 | Ga0207676_10009759 | |||
| 1380 | Ga0207676_10958384 | |||
| 1381 | Ga0207674_10009493 | |||
| 1382 | Ga0207674_10116312 | |||
| 1383 | Ga0207675_100036186 | |||
| 1384 | Ga0207675_100358633 | |||
| 1385 | Ga0207675_100950513 | |||
| 1386 | Ga0207683_10000138 | |||
| 1387 | Ga0207683_10069420 | |||
| 1388 | Ga0207683_10324365 | |||
| 1389 | Ga0207698_10005821 | |||
| 1390 | Ga0207698_10802098 | |||
| 1391 | Ga0209969_1010536 | |||
| 1392 | Ga0209967_1026602 | |||
| 1393 | Ga0210002_1007605 | |||
| 1394 | Ga0209971_1015585 | |||
| 1395 | Ga0209966_1001354 | |||
| 1396 | Ga0209998_10056168 | |||
| 1397 | Ga0209998_10060253 | |||
| 1398 | Ga0209974_10087000 | |||
| 1399 | Ga0207428_10001759 | |||
| 1400 | Ga0207428_10023515 | |||
| 1401 | Ga0268266_10031707 | |||
| 1402 | Ga0268266_10187739 | |||
| 1403 | Ga0268266_10327244 | |||
| 1404 | Ga0268266_10406667 | |||
| 1405 | Ga0268265_10002569 | |||
| 1406 | Ga0268265_11366177 | |||
| 1407 | Ga0268264_10002097 | |||
| 1408 | Ga0268264_10047998 | |||
| 1409 | Ga0265337_1091773 | |||
| 1410 | Ga0265332_10074125 | |||
| 1411 | Ga0265328_10000250 | |||
| 1412 | Ga0265325_10000019 | |||
| 1413 | Ga0265325_10004257 | |||
| 1414 | Ga0265325_10023603 | |||
| 1415 | Ga0265325_10024151 | |||
| 1416 | Ga0265339_10001671 | |||
| 1417 | Ga0265339_10113673 | |||
| 1418 | Ga0265316_10039394 | |||
| 1419 | Ga0265316_10051312 | |||
| 1420 | Ga0265316_10416293 | |||
| 1421 | Ga0265313_10001789 | |||
| 1422 | Ga0265313_10016155 | |||
| 1423 | Ga0265313_10017724 | |||
| 1424 | Ga0265313_10079733 | |||
| 1425 | Ga0265313_10192032 | |||
| 1426 | Ga0307405_10225239 | |||
| 1427 | Ga0307410_10726626 | |||
| 1428 | Ga0307407_10138773 | |||
| 1429 | Ga0307409_100194752 | |||
| 1430 | Ga0307416_101488159 | |||
| 1431 | Ga0307411_10302659 | |||
| 1432 | Ga0373930_0000568 | |||
| 1433 | Ga0373930_0008571 | |||
| 1434 | Ga0373948_0017621 | |||
| 1435 | Ga0373948_0018676 | |||
| 1436 | Ga0373950_0000814 | |||
| 1437 | Ga0373958_0002698 | |||
| 1438 | Ga0373958_0005675 | |||
| 1439 | Ga0373959_0000576 | |||
| 1440 | Ga0373959_0002836 | |||
| 1441 | Ga0373938_0003901 | |||
| 1442 | Ga0373938_0004761 | |||
| 1443 | Ga0373926_0023126 | |||
| 1444 | Ga0373928_0002658 | |||
| 1445 | Ga0373928_0004964 | |||
| 1446 | Ga0373928_0027332 | |||
| 1447 | Ga0373928_0030120 | |||
| 1448 | Ga0373929_0002439 | |||
| 1449 | Ga0373929_0005547 | |||
| 1450 | Ga0373929_0018465 | |||
| 1451 | Ga0373934_0012431 | |||
| 1452 | Ga0373934_0087883 | |||
| 1453 | Ga0373934_0182739 | |||
| 1454 | Ga0373940_0003535 | |||
| 1455 | Ga0373944_0019860 | |||
| 1456 | Ga0373949_0008856 | |||
| 1457 | Ga0373949_0031717 | |||
| 1458 | Ga0373951_0001398 | |||
| 1459 | Ga0373951_0024782 | |||
| 1460 | Ga0373952_0002117 | |||
| 1461 | Ga0373952_0012810 | |||
| 1462 | Ga0373952_0027957 | |||
| 1463 | Ga0373923_0014397 | |||
| 1464 | Ga0373923_0021859 | |||
| 1465 | Ga0373923_0044991 | |||
| 1466 | Ga0373932_0001729 | |||
| 1467 | Ga0373932_0011139 | |||
| 1468 | Ga0373932_0011565 | |||
| 1469 | Ga0373932_0132468 | |||
| 1470 | Ga0373936_0013383 | |||
| 1471 | Ga0373936_0078928 | |||
| 1472 | Ga0373939_0006286 | |||
| 1473 | Ga0373939_0008750 | |||
| 1474 | Ga0373941_0000363 | |||
| 1475 | Ga0373941_0027712 | |||
| 1476 | Ga0373941_0116689 | |||
| 1477 | Ga0373941_0137434 | |||
| 1478 | Ga0373941_0206706 | |||
| 1479 | Ga0373945_0121532 | |||
| 1480 | Ga0373953_0010709 | |||
| 1481 | Ga0373953_0029615 | |||
| 1482 | Ga0373953_0033619 | |||
| 1483 | Ga0373954_0007394 | |||
| 1484 | Ga0373954_0020427 | |||
| 1485 | Ga0373954_0044866 | |||
| 1486 | Ga0373956_0068703 | |||
| 1487 | Ga0373957_0020044 | |||
| 1488 | Ga0373957_0024014 | |||
| 1489 | Ga0373957_0107019 | |||
| 1490 | Ga0373960_0001466 | |||
| 1491 | Ga0373960_0011233 | |||
| 1492 | Ga0373960_0045498 | |||
| 1493 | Ga0373943_0011804 | |||
| 1494 | Ga0373943_0104061 | |||
| 1495 | Ga0373943_0184741 | |||
| 1496 | Ga0373946_0024161 | |||
| 1497 | Ga0373946_0080846 | |||
| 1498 | Ga0373955_0000249 | |||
| 1499 | Ga0373955_0046317 | |||
| 1500 | Ga0373955_0313727 | |||
| 1501 | Ga0373942_0001061 | |||
| 1502 | Ga0373961_0004234 | |||
| 1503 | Ga0373962_0002145 | |||
| 1504 | Ga0373962_0002168 | |||
| 1505 | Ga0373962_0026034 | |||
| 1506 | Ga0373924_0020946 | |||
| 1507 | Ga0373924_0035514 | |||
| 1508 | Ga0373924_0204584 | |||
| 1509 | Ga0373931_0000660 | |||
| 1510 | Ga0373931_0053838 | |||
| 1511 | Ga0373931_0054709 | |||
| 1512 | Ga0373931_0303735 | |||
| 1513 | Ga0373935_0011299 | |||
| 1514 | Ga0373935_0061176 | |||
| 1515 | Ga0373935_0067945 | |||
| 1516 | Ga0373935_0080830 | |||
| 1517 | Ga0373935_0134672 | |||
| 1518 | Ga0373935_0171461 | |||
| 1519 | Ga0373927_0003778 | |||
| 1520 | Ga0373927_0020050 | |||
| 1521 | Ga0373927_0113856 | |||
| 1522 | Ga0373933_0001754 | |||
| 1523 | Ga0373933_0002548 | |||
| 1524 | Ga0373933_0034363 | |||
| 1525 | Ga0373933_0102986 | |||
| 1526 | Ga0373947_0007280 | |||
| 1527 | Ga0373947_0013018 | |||
| 1528 | Ga0373947_0136757 | |||
| 1529 | Ga0373937_0003253 | |||
| 1530 | Ga0373937_0003343 | |||
| 1531 | Ga0373937_0032148 | |||
| 1532 | Ga0373937_0072611 | |||
| 1533 | Ga0373937_0182008 | |||
| 1534 | Ga0373925_0007120 | |||
| 1535 | Ga0373925_0050588 | |||
| 1536 | Ga0373925_0062775 | |||
| 1537 | Ga0373925_0105338 | |||
| 1538 | Ga0373925_0312699 | |||
| 1539 | Ga0373925_0612910 | |||
| 1540 | Ga0242420_001260 | |||
| 1541 | Ga0439460_0016064 | |||
| 1542 | Ga0495617_014146 | |||
| 1543 | Ga0495592_0000604 | |||
| 1544 | Ga0495592_0066040 | |||
| 1545 | Ga0495592_0077045 | |||
| 1546 | Ga0495592_0176252 | |||
| 1547 | Ga0495603_0053734 | |||
| 1548 | Ga0495629_0002040 | |||
| 1549 | Ga0495629_0030668 | |||
| 1550 | Ga0495629_0091694 | |||
| 1551 | Ga0495629_0289661 | |||
| 1552 | Ga0495651_0006940 | |||
| 1553 | Ga0495651_0010467 | |||
| 1554 | Ga0495651_0124365 | |||
| 1555 | Ga0495653_0005806 | |||
| 1556 | Ga0495653_0031963 | |||
| 1557 | Ga0495580_0023927 | |||
| 1558 | Ga0495582_0001980 | |||
| 1559 | Ga0495582_0016329 | |||
| 1560 | Ga0495582_0188849 | |||
| 1561 | Ga0495639_0115959 | |||
| 1562 | Ga0495662_0017079 | |||
| 1563 | Ga0495662_0023074 | |||
| 1564 | Ga0495664_0011215 | |||
| 1565 | Ga0495664_0030428 | |||
| 1566 | Ga0495664_0158397 | |||
| 1567 | Ga0495584_0043380 | |||
| 1568 | Ga0495585_0005655 | |||
| 1569 | Ga0495594_0031426 | |||
| 1570 | Ga0495607_0018716 | |||
| 1571 | Ga0495608_0002361 | |||
| 1572 | Ga0495608_0009924 | |||
| 1573 | Ga0495608_0052523 | |||
| 1574 | Ga0495608_0109666 | |||
| 1575 | Ga0495616_0163600 | |||
| 1576 | Ga0495618_0094114 | |||
| 1577 | Ga0495618_0222743 | |||
| 1578 | Ga0495628_0022655 | |||
| 1579 | Ga0495628_0123385 | |||
| 1580 | Ga0495628_0211149 | |||
| 1581 | Ga0495630_0071577 | |||
| 1582 | Ga0495630_0335863 | |||
| 1583 | Ga0495637_0087789 | |||
| 1584 | Ga0495663_0020038 | |||
| 1585 | Ga0495666_0023142 | |||
| 1586 | Ga0495652_0007613 | |||
| 1587 | Ga0495652_0016985 | |||
| 1588 | Ga0495652_0025878 | |||
| 1589 | Ga0495665_0397264 | |||
| 1590 | Ga0495640_0014780 | |||
| 1591 | Ga0495640_0050214 | |||
| 1592 | Ga0495640_0169891 | |||
| 1593 | Ga0495640_0549024 | |||
| 1594 | Ga0495586_0206836 | |||
| 1595 | Ga0495587_0007105 | |||
| 1596 | Ga0495587_0028567 | |||
| 1597 | Ga0495587_0068743 | |||
| 1598 | Ga0495598_0064750 | |||
| 1599 | Ga0495609_0132264 | |||
| 1600 | Ga0495645_0005135 | |||
| 1601 | Ga0495645_0040951 | |||
| 1602 | Ga0495622_0045358 | |||
| 1603 | Ga0495633_0010760 | |||
| 1604 | Ga0495667_0003355 | |||
| 1605 | Ga0495667_0030087 | |||
| 1606 | Ga0495667_0044995 | |||
| 1607 | Ga0495656_0010834 | |||
| 1608 | Ga0495656_0301522 | |||
| 1609 | Ga0495634_0035859 | |||
| 1610 | Ga0495635_0006330 | |||
| 1611 | Ga0495635_0015493 | |||
| 1612 | Ga0495635_0024053 | |||
| 1613 | Ga0495635_0193258 | |||
| 1614 | Ga0495659_0003872 | |||
| 1615 | Ga0495661_0121175 | |||
| 1616 | Ga0495588_0042475 | |||
| 1617 | Ga0495588_0153953 | |||
| 1618 | Ga0495657_0010275 | |||
| 1619 | Ga0495657_0208317 | |||
| 1620 | Ga0495657_0289544 | |||
| 1621 | Ga0495599_0006067 | |||
| 1622 | Ga0495599_0030955 | |||
| 1623 | Ga0495599_0059428 | |||
| 1624 | Ga0495646_0027682 | |||
| 1625 | Ga0495646_0065946 | |||
| 1626 | Ga0495647_0002304 | |||
| 1627 | Ga0495658_0001380 | |||
| 1628 | Ga0495658_0008239 | |||
| 1629 | Ga0495658_0018720 | |||
| 1630 | Ga0495658_0098907 | |||
| 1631 | Ga0495669_0187291 | |||
| 1632 | Ga0495613_0021544 | |||
| 1633 | Ga0495613_0033002 | |||
| 1634 | Ga0495624_0170296 | |||
| 1635 | Ga0495624_0212406 | |||
| 1636 | Ga0495624_0249232 | |||
| 1637 | Ga0495670_0010386 | |||
| 1638 | Ga0495589_0076957 | |||
| 1639 | Ga0495600_0002926 | |||
| 1640 | Ga0495600_0051389 | |||
| 1641 | Ga0495600_0115064 | |||
| 1642 | Ga0495600_0219998 | |||
| 1643 | Ga0495581_0015174 | |||
| 1644 | Ga0495581_0050936 | |||
| 1645 | Ga0495581_0349107 | |||
| 1646 | Ga0495604_0000650 | |||
| 1647 | Ga0495604_0032681 | |||
| 1648 | Ga0495604_0062985 | |||
| 1649 | Ga0495604_0158884 | |||
| 1650 | Ga0495604_0218241 | |||
| 1651 | Ga0495604_0251516 | |||
| 1652 | Ga0495674_0023898 | |||
| 1653 | Ga0495674_0035936 | |||
| 1654 | Ga0495674_0264799 | |||
| 1655 | Ga0495676_0036491 | |||
| 1656 | Ga0495676_0044058 | |||
| 1657 | Ga0495680_0003242 | |||
| 1658 | Ga0495680_0006853 | |||
| 1659 | Ga0495680_0044496 | |||
| 1660 | Ga0495680_0049188 | |||
| 1661 | Ga0495680_0058642 | |||
| 1662 | Ga0495677_0014508 | |||
| 1663 | Ga0495684_0006578 | |||
| 1664 | Ga0495593_0083128 | |||
| 1665 | Ga0495593_0098765 | |||
| 1666 | Ga0495593_0190225 | |||
| 1667 | Ga0495602_0028540 | |||
| 1668 | Ga0495602_0048062 | |||
| 1669 | Ga0495602_0061874 | |||
| 1670 | Ga0495602_0125498 | |||
| 1671 | Ga0495602_0527818 | |||
| 1672 | Ga0495614_0003887 | |||
| 1673 | Ga0495614_0224043 | |||
| 1674 | Ga0496100_0000839 | |||
| 1675 | Ga0496100_0044549 | |||
| 1676 | Ga0496100_0148617 | |||
| 1677 | Ga0496101_0000633 | |||
| 1678 | Ga0496101_0055305 | |||
| 1679 | Ga0496101_0112641 | |||
| 1680 | Ga0496101_0649406 | |||
| 1681 | Ga0496102_0002481 | |||
| 1682 | Ga0496102_0024981 | |||
| 1683 | Ga0496102_0043730 | |||
| 1684 | Ga0496102_0480719 | |||
| 1685 | Ga0496103_0000717 | |||
| 1686 | Ga0496104_0115662 | |||
| 1687 | Ga0496104_0140339 | |||
| 1688 | Ga0496104_0160625 | |||
| 1689 | Ga0496104_0170736 | |||
| 1690 | Ga0496104_0318749 | |||
| 1691 | Ga0496105_0000950 | |||
| 1692 | Ga0496105_0003911 | |||
| 1693 | Ga0496105_0050027 | |||
| 1694 | Ga0496105_0102275 | |||
| 1695 | Ga0496105_0450100 | |||
| 1696 | Ga0496106_0002354 | |||
| 1697 | Ga0496106_0058335 | |||
| 1698 | Ga0496106_0141361 | |||
| 1699 | Ga0496106_0317706 | |||
| 1700 | Ga0496106_0476717 | |||
| 1701 | Ga0496107_0022368 | |||
| 1702 | Ga0496107_0517709 | |||
| 1703 | Ga0496107_0738748 | |||
| 1704 | Ga0496108_0004886 | |||
| 1705 | Ga0496108_0005842 | |||
| 1706 | Ga0496108_0018525 | |||
| 1707 | Ga0496108_0174300 | |||
| 1708 | Ga0496108_0238287 | |||
| 1709 | Ga0496108_0374615 | |||
| 1710 | Ga0496109_0002017 | |||
| 1711 | Ga0496109_0119288 | |||
| 1712 | Ga0496109_0131793 | |||
| 1713 | Ga0496109_0154323 | |||
| 1714 | Ga0496109_0208984 | |||
| 1715 | Ga0496110_0001386 | |||
| 1716 | Ga0496110_0097681 | |||
| 1717 | Ga0496110_0275790 | |||
| 1718 | Ga0496110_0361497 | |||
| 1719 | Ga0496111_0014927 | |||
| 1720 | Ga0496111_0340883 | |||
| 1721 | Ga0496111_0497363 | |||
| 1722 | Ga0496112_0010427 | |||
| 1723 | Ga0496112_0011955 | |||
| 1724 | Ga0496112_0119332 | |||
| 1725 | Ga0496112_0156160 | |||
| 1726 | Ga0496112_0229929 | |||
| 1727 | Ga0496112_0346465 | |||
| 1728 | Ga0496113_0002233 | |||
| 1729 | Ga0496113_0023650 | |||
| 1730 | Ga0496113_0087098 | |||
| 1731 | Ga0496113_0171137 | |||
| 1732 | Ga0496113_0656675 | |||
| 1733 | Ga0496114_0012067 | |||
| 1734 | Ga0496114_0114534 | |||
| 1735 | Ga0496114_0132511 | |||
| 1736 | Ga0496114_0718379 | |||
| 1737 | Ga0496115_0018060 | |||
| 1738 | Ga0496115_0023335 | |||
| 1739 | Ga0496115_0037136 | |||
| 1740 | Ga0496115_0176500 | |||
| 1741 | Ga0496115_0177725 | |||
| 1742 | Ga0496115_0384668 | |||
| 1743 | Ga0501031_0001817 | |||
| 1744 | Ga0501032_0153867 | |||
| 1745 | Ga0501034_0009043 | |||
| 1746 | Ga0501034_0179070 | |||
| 1747 | Ga0501034_0203497 | |||
| 1748 | Ga0501034_0324289 | |||
| 1749 | Ga0501036_0042231 | |||
| 1750 | Ga0501036_0347595 | |||
| 1751 | Ga0501037_0009760 | |||
| 1752 | Ga0501037_0059787 | |||
| 1753 | Ga0501038_0031990 | |||
| 1754 | Ga0501039_0094852 | |||
| 1755 | Ga0501039_0134976 | |||
| 1756 | Ga0501043_0213634 | |||
| 1757 | Ga0501046_0364018 | |||
| 1758 | Ga0501047_0132012 | |||
| 1759 | Ga0501047_0146198 | |||
| 1760 | Ga0501047_0284234 | |||
| 1761 | Ga0501048_0049354 | |||
| 1762 | Ga0501067_0015831 | |||
| 1763 | Ga0501069_0031197 | |||
| 1764 | Ga0501069_0069043 | |||
| 1765 | Ga0501070_0260131 | |||
| 1766 | Ga0501071_0025068 | |||
| 1767 | Ga0501071_0076163 | |||
| 1768 | Ga0501073_0035135 | |||
| 1769 | Ga0501073_0069577 | |||
| 1770 | Ga0501073_0078496 | |||
| 1771 | Ga0501073_0167848 | |||
| 1772 | Ga0501075_0085900 | |||
| 1773 | Ga0501076_0136607 | |||
| 1774 | Ga0501077_0022622 | |||
| 1775 | Ga0501079_0036324 | |||
| 1776 | Ga0501079_0835308 | |||
| 1777 | Ga0501080_0033942 | |||
| 1778 | Ga0501080_0082281 | |||
| 1779 | Ga0501080_0133595 | |||
| 1780 | Ga0501083_0216837 | |||
| 1781 | Ga0501035_0049204 | |||
| 1782 | Ga0501035_0187167 | |||
| 1783 | Ga0501044_0000260 | |||
| 1784 | Ga0501044_0202335 | |||
| 1785 | Ga0501044_0323303 | |||
| 1786 | Ga0501045_0169646 | |||
| 1787 | nmdc:mga03683_104005_c1 | |||
| 1788 | nmdc:mga0k408_327784_c1 | |||
| 1789 | nmdc:mga0k408_57250_c1 | |||
| 1790 | nmdc:mga06z11_138949_c1 | |||
| 1791 | nmdc:mga06z11_5417_c1 | |||
| 1792 | nmdc:mga05p37_757163_c1 | |||
| 1793 | nmdc:mga08y16_149785_c1 | |||
| 1794 | nmdc:mga08y16_2489_c1 | |||
| 1795 | nmdc:mga08y16_513940_c1 | |||
| 1796 | nmdc:mga0n895_124763_c1 | |||
| 1797 | nmdc:mga0n895_5206_c1 | |||
| 1798 | nmdc:mga0rr50_368818_c1 | |||
| 1799 | nmdc:mga0rr50_6368_c1 | |||
| 1800 | nmdc:mga08x19_110845_c1 | |||
| 1801 | nmdc:mga0a205_515996_c1 | |||
| 1802 | nmdc:mga0a205_97311_c1 | |||
| 1803 | Ga0495601_0000233 | |||
| 1804 | Ga0495601_0006401 | |||
| 1805 | Ga0495601_0009287 | |||
| 1806 | Ga0495601_0011847 | |||
| 1807 | Ga0495601_0083497 | |||
| 1808 | Ga0495601_0224341 | |||
| 1809 | Ga0495612_0000533 | |||
| 1810 | Ga0495612_0002344 | |||
| 1811 | Ga0495612_0005346 | |||
| 1812 | Ga0495612_0016776 | |||
| 1813 | Ga0495612_0026943 | |||
| 1814 | Ga0495612_0050719 | |||
| 1815 | Ga0495595_0000809 | |||
| 1816 | Ga0495595_0003248 | |||
| 1817 | Ga0495595_0012167 | |||
| 1818 | Ga0495619_0000164 | |||
| 1819 | Ga0495619_0001846 | |||
| 1820 | Ga0495619_0002698 | |||
| 1821 | Ga0495619_0034067 | |||
| 1822 | Ga0495619_0080016 | |||
| 1823 | Ga0495619_0162032 | |||
| 1824 | Ga0495619_0246653 | |||
| 1825 | Ga0500641_0001278 | |||
| 1826 | Ga0500562_030884 | |||
| 1827 | Ga0500642_0144543 | |||
| 1828 | Ga0500616_0096882 | |||
| 1829 | Ga0500616_0112193 | |||
| 1830 | Ga0501084_0004432 | |||
| 1831 | Ga0501084_0606425 | |||
| 1832 | Ga0501082_0053046 | |||
| 1833 | Ga0501082_0058848 | |||
| 1834 | Ga0501082_0291081 | |||
| 1835 | Ga0501082_0504765 | |||
| 1836 | 2891089572 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5awi-assembly1.cif.gz_B | domain-swapped cytochrome cb562 dimer | 0.9418 | 22 | 62 |
| 4qpj-assembly1.cif.gz_B | 2.7 angstrom structure of a phosphotransferase in complex with a receiver domain | 0.9367 | 6 | 210 |
| 7nyu-assembly1.cif.gz_K | respiratory complex i from escherichia coli - conformation 2 | 0.912 | 19 | 64 |
| 4qpk-assembly1.cif.gz_A | 1.7 angstrom structure of a bacterial phosphotransferase | 0.9068 | 3 | 210 |
| 4qpj-assembly1.cif.gz_B | 2.7 angstrom structure of a phosphotransferase in complex with a receiver domain | 0.9066 | 6 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qpkB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain | 0.945 | 6 | 77 | 1.10.287.130 |
| 4qpjB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain | 0.9204 | 1 | 77 | 1.10.287.130 |
| 4qpjB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain | 0.9086 | 1 | 77 | 1.10.287.130 |
| af_C4J1G1_188_275_1.20.58.160 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9079 | 23 | 68 | 1.20.58.160 |
| af_P0A6E6_91_134_1.20.5.440 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain | 0.9052 | 22 | 61 | 1.20.5.440 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q8QSI6-F1-model_v4 | Histidine phosphotransferase | 0.9817 | 6 | 210 |
GO:0016740
|
| AF-A0A431P516-F1-model_v4 | deleted | 0.981 | 18 | 210 |
|
| AF-A0A447CUN8-F1-model_v4 | Histidine phosphotransferase ChpT C-terminal domain-containing protein | 0.9756 | 4 | 209 |
|
| AF-A0A431P516-F1-model_v4 | deleted | 0.971 | 18 | 210 |
|
| AF-A0A327K5E7-F1-model_v4 | Histidine phosphotransferase | 0.968 | 2 | 209 |
GO:0016740
|