F485681

General Info

Members Datasets Scaffolds Average Seq Length
918 576 1836 418

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885312484|2885315494
Length 417
Sequence RTLIGGAAASVAAAVLAAPQVRAQAQPRVVVVGGGFAGASCARALKQLDRGLAVTLIEPETAYLACPFSNAVLAGLRGIEAQTFGYGRFGDIGLIRRRAAAVDAERRRVRLEDGTEIGYTRLVLAPGVDLRFDALPGYDQAAAEIMPHAWKAGPQTLLLRDQLAAMPDGGVVILAAPANPFRCPPGPYERASLIAHYLKTSKPRSKLIILDAKDAFSKQRLFEAAWRELYPGLIEWVPLSSGGRVTEVDPATTTLVTEFGSHKADVANVIPPQRAGRIAQAAGVADQTGWCPIDPVTFESRLQPAIHVVGDAAIGGAMPKSAFSANAQAKACAAAVAALVRGRQPAPPKLINTCYSLVAPGYGISIAGVYQPRDGLLAEVEGAGGTSPLEAPPSVRELEAAYAQDWFRTITSEVFGV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
95 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
96 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
157 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
158 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
340 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
341 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
344 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
345 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
346 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
347 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
348 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
349 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
350 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
351 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
352 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
353 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
355 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
356 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
357 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
358 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
359 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
360 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
361 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
362 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
365 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
366 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
367 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
372 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
373 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
374 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
375 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
376 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
377 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
378 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
379 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
380 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
381 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
382 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
383 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
384 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
385 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
386 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
387 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
388 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
389 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
390 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
391 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
392 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
393 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
394 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
395 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
396 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
397 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
398 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
399 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
400 2791355199
401 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
402 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
403 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
404 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
405 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
406 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
407 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
408 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
409 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
410 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
411 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
412 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
413 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
414 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
415 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
416 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
417 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
418 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
419 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
420 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
421 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
422 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
423 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
424 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
425 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
426 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
427 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
428 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
429 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
430 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
431 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
432 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
433 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
434 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
435 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
436 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
437 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
438 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
439 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
440 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
441 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
442 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
443 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
444 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
445 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
446 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
447 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
448 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
449 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
450 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
451 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
452 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
453 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
454 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
455 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
456 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
457 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
458 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
459 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
460 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
461 2906610324
462 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
463 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
464 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
465 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
466 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
467 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
468 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
469 2922425934
470 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
471 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
472 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
473 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
474 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
475 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
476 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
477 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
478 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
479 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
480 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
481 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
482 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
483 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
484 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
485 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
486 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
487 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
488 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
489 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
490 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
491 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
492 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
493 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
494 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
495 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
496 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
497 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
498 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
499 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
500 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
501 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
502 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
503 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
504 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
505 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
506 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
507 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
508 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
509 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
510 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
511 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
512 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
513 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
514 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
515 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
516 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
517 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
518 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
519 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
520 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
521 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
522 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
523 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
524 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
525 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
526 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
527 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
528 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
529 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
530 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
531 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
532 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
533 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
534 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
535 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
536 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
537 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
538 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
539 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
540 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
541 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
542 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
543 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
544 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
545 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
546 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
547 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
548 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
549 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
550 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
551 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
552 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
553 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
554 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
555 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
556 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
557 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
558 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
559 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
560 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
561 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
562 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
563 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
564 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
565 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
566 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
567 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
568 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
569 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
570 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
571 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
572 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
573 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
574 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
575 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
576 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.92
Metatranscriptomes 0
Isolates 22.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.24
Nodule 18.63
Rhizoplane 6.32
Rhizosphere 54.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000138 3300003203 Bacteria 31765
2 JGI25153J46596_10000317 3300003215 Bacteria 35509
3 JGI25153J46596_10005866 3300003215 Bacteria 6357
4 rootL2_10158942 3300003322 Bacteria 2631
5 JGI25404J52841_10006155 3300003659 Bacteria 2500
6 Ga0055526_1025395 3300003771 Bacteria 1902
7 Ga0055531_10008821 3300003794 Bacteria 5250
8 Ga0055543_1009959 3300004625 Bacteria 2016
9 Ga0065165_1000747 3300005262 Bacteria 44635
10 Ga0065165_1004585 3300005262 Bacteria 8426
11 Ga0065165_1012243 3300005262 Bacteria 3507
12 Ga0070658_10123665 3300005327 Bacteria 2151
13 Ga0070683_100035975 3300005329 Bacteria 4529
14 Ga0070683_100244080 3300005329 Bacteria 1708
15 Ga0070680_100000841 3300005336 Bacteria 21741
16 Ga0070680_100053807 3300005336 Bacteria 3285
17 Ga0070680_100093332 3300005336 Bacteria 2494
18 Ga0070689_100056909 3300005340 Bacteria 3034
19 Ga0070661_100069576 3300005344 Bacteria 2588
20 Ga0070661_100148532 3300005344 Bacteria 1771
21 Ga0070688_100026113 3300005365 Bacteria 3467
22 Ga0070667_100111159 3300005367 Bacteria 2376
23 Ga0070667_100151855 3300005367 Bacteria 2035
24 Ga0070709_10002197 3300005434 Bacteria 10578
25 Ga0070709_10010839 3300005434 Bacteria 5059
26 Ga0070709_10026207 3300005434 Bacteria 3452
27 Ga0070713_100001462 3300005436 Bacteria 15088
28 Ga0070713_100014026 3300005436 Bacteria 5934
29 Ga0070713_100026138 3300005436 Bacteria 4578
30 Ga0070713_100052936 3300005436 Bacteria 3362
31 Ga0070713_100115088 3300005436 Bacteria 2350
32 Ga0070713_100166983 3300005436 Bacteria 1969
33 Ga0070710_10000678 3300005437 Bacteria 16149
34 Ga0070710_10003896 3300005437 Bacteria 7065
35 Ga0070710_10007682 3300005437 Bacteria 5229
36 Ga0070711_100000465 3300005439 Bacteria 21200
37 Ga0070711_100003772 3300005439 Bacteria 8886
38 Ga0070711_100087288 3300005439 Bacteria 2239
39 Ga0070708_100029298 3300005445 Bacteria 4746
40 Ga0070663_100034033 3300005455 Bacteria 3525
41 Ga0070678_100064623 3300005456 Bacteria 2713
42 Ga0070678_100162002 3300005456 Bacteria 1813
43 Ga0070662_100256264 3300005457 Bacteria 1408
44 Ga0070681_10009737 3300005458 Bacteria 9457
45 Ga0070681_10103984 3300005458 Bacteria 2783
46 Ga0070681_10147603 3300005458 Bacteria 2280
47 Ga0068867_100059990 3300005459 Bacteria 2821
48 Ga0070707_100022473 3300005468 Bacteria 5963
49 Ga0070698_100013803 3300005471 Bacteria 8546
50 Ga0070698_100080213 3300005471 Bacteria 3259
51 Ga0070698_100240368 3300005471 Bacteria 1744
52 Ga0070679_100003118 3300005530 Bacteria 15155
53 Ga0070679_100004998 3300005530 Bacteria 12236
54 Ga0070679_100100769 3300005530 Bacteria 2874
55 Ga0070679_100139466 3300005530 Bacteria 2405
56 Ga0070679_100228455 3300005530 Bacteria 1821
57 Ga0070684_100007961 3300005535 Bacteria 8272
58 Ga0070684_100009391 3300005535 Bacteria 7700
59 Ga0070697_100061449 3300005536 Bacteria 3064
60 Ga0070665_100023384 3300005548 Bacteria 6222
61 Ga0070665_100053413 3300005548 Bacteria 4052
62 Ga0070665_100073338 3300005548 Bacteria 3429
63 Ga0068855_100058768 3300005563 Bacteria 4501
64 Ga0068855_100112512 3300005563 Bacteria 3124
65 Ga0068855_100210946 3300005563 Bacteria 2182
66 Ga0068855_100306921 3300005563 Bacteria 1756
67 Ga0070664_100165643 3300005564 Bacteria 1958
68 Ga0068857_100037748 3300005577 Bacteria 4280
69 Ga0068857_100059974 3300005577 Bacteria 3380
70 Ga0068856_100079699 3300005614 Bacteria 3247
71 Ga0068856_100172420 3300005614 Bacteria 2176
72 Ga0068856_100268782 3300005614 Bacteria 1721
73 Ga0070702_100034040 3300005615 Bacteria 2806
74 Ga0068852_100038198 3300005616 Bacteria 4033
75 Ga0068859_100383909 3300005617 Bacteria 1500
76 Ga0068864_100049929 3300005618 Bacteria 3600
77 Ga0068866_10087823 3300005718 Bacteria 1686
78 Ga0068851_10009836 3300005834 Bacteria 4454
79 Ga0068863_100074750 3300005841 Bacteria 3206
80 Ga0068858_100031960 3300005842 Bacteria 4889
81 Ga0068858_100202761 3300005842 Bacteria 1876
82 Ga0068860_100000360 3300005843 Bacteria 60297
83 Ga0081455_10003176 3300005937 Bacteria 19071
84 Ga0081455_10005955 3300005937 Bacteria 13226
85 Ga0081540_1000102 3300005983 Bacteria 91311
86 Ga0081540_1000841 3300005983 Bacteria 28015
87 Ga0081540_1003418 3300005983 Bacteria 12554
88 Ga0081540_1008125 3300005983 Bacteria 7364
89 Ga0081540_1008941 3300005983 Bacteria 6939
90 Ga0081540_1009558 3300005983 Bacteria 6672
91 Ga0081540_1021006 3300005983 Bacteria 3906
92 Ga0081540_1021049 3300005983 Bacteria 3901
93 Ga0081540_1035588 3300005983 Bacteria 2668
94 Ga0081539_10000008 3300005985 Bacteria 525071
95 Ga0081539_10000220 3300005985 Bacteria 133834
96 Ga0081539_10055131 3300005985 Bacteria 2214
97 Ga0070717_10006207 3300006028 Bacteria 8777
98 Ga0070717_10007544 3300006028 Bacteria 8083
99 Ga0070717_10021364 3300006028 Bacteria 5099
100 Ga0070717_10134682 3300006028 Bacteria 2127
101 Ga0075365_10033778 3300006038 Bacteria 3299
102 Ga0075365_10038742 3300006038 Bacteria 3101
103 Ga0075365_10096957 3300006038 Bacteria 2015
104 Ga0075363_100009226 3300006048 Bacteria 4634
105 Ga0075364_10023541 3300006051 Bacteria 3900
106 Ga0075364_10074428 3300006051 Bacteria 2240
107 Ga0070715_10035264 3300006163 Bacteria 2056
108 Ga0070712_100022680 3300006175 Bacteria 4138
109 Ga0070712_100038780 3300006175 Bacteria 3257
110 Ga0070712_100091514 3300006175 Bacteria 2229
111 Ga0070712_100173947 3300006175 Bacteria 1673
112 Ga0075362_10019648 3300006177 Bacteria 2812
113 Ga0075369_10005844 3300006186 Bacteria 4625
114 Ga0075369_10032411 3300006186 Bacteria 2211
115 Ga0075366_10038702 3300006195 Bacteria 2817
116 Ga0097621_100040392 3300006237 Bacteria 3751
117 Ga0097621_100094887 3300006237 Bacteria 2501
118 Ga0097621_100112416 3300006237 Bacteria 2303
119 Ga0075370_10038846 3300006353 Bacteria 2679
120 Ga0068871_100001491 3300006358 Bacteria 15694
121 Ga0075428_100003814 3300006844 Bacteria 16541
122 Ga0075428_100269582 3300006844 Bacteria 1832
123 Ga0075430_100002189 3300006846 Bacteria 16184
124 Ga0075430_100004241 3300006846 Bacteria 12110
125 Ga0075430_100012744 3300006846 Bacteria 7164
126 Ga0075430_100044526 3300006846 Bacteria 3751
127 Ga0075431_100013553 3300006847 Bacteria 8239
128 Ga0075431_100021216 3300006847 Bacteria 6638
129 Ga0075431_100119215 3300006847 Bacteria 2723
130 Ga0075433_10036313 3300006852 Bacteria 4244
131 Ga0075434_100001946 3300006871 Bacteria 17909
132 Ga0075434_100083230 3300006871 Bacteria 3197
133 Ga0075434_100260056 3300006871 Bacteria 1755
134 Ga0075429_100000055 3300006880 Bacteria 55152
135 Ga0075429_100003786 3300006880 Bacteria 12905
136 Ga0075429_100012545 3300006880 Bacteria 7352
137 Ga0097620_100383932 3300006931 Bacteria 1500
138 Ga0099824_1011502 3300006942 Bacteria 9987
139 Ga0099824_1018474 3300006942 Bacteria 5716
140 Ga0075435_100011949 3300007076 Bacteria 6415
141 Ga0075435_100119473 3300007076 Bacteria 2198
142 Ga0099795_10037437 3300007788 Bacteria 1707
143 Ga0105240_10013046 3300009093 Bacteria 11437
144 Ga0105240_10021941 3300009093 Bacteria 8480
145 Ga0105240_10024721 3300009093 Bacteria 7912
146 Ga0105240_10192740 3300009093 Bacteria 2395
147 Ga0111539_10000852 3300009094 Bacteria 39772
148 Ga0105245_10048961 3300009098 Bacteria 3782
149 Ga0105245_10078010 3300009098 Bacteria 3021
150 Ga0105245_10081675 3300009098 Bacteria 2955
151 Ga0105247_10021886 3300009101 Bacteria 3847
152 Ga0105247_10081130 3300009101 Bacteria 2044
153 Ga0114129_10001487 3300009147 Bacteria 31741
154 Ga0114129_10007257 3300009147 Bacteria 15778
155 Ga0114129_10012532 3300009147 Bacteria 12074
156 Ga0114129_10021318 3300009147 Bacteria 9199
157 Ga0114129_10060555 3300009147 Bacteria 5293
158 Ga0105243_10178387 3300009148 Bacteria 1845
159 Ga0105241_10029756 3300009174 Bacteria 4077
160 Ga0105241_10118948 3300009174 Bacteria 2125
161 Ga0105242_10212373 3300009176 Bacteria 1725
162 Ga0105248_10027462 3300009177 Bacteria 6337
163 Ga0105237_10009950 3300009545 Bacteria 10145
164 Ga0105237_10021234 3300009545 Bacteria 6678
165 Ga0105237_10031207 3300009545 Bacteria 5405
166 Ga0105237_10228750 3300009545 Bacteria 1860
167 Ga0105237_10380401 3300009545 Bacteria 1416
168 Ga0105238_10014750 3300009551 Bacteria 7903
169 Ga0105238_10027647 3300009551 Bacteria 5781
170 Ga0105249_10295488 3300009553 Bacteria 1623
171 Ga0099796_10046613 3300010159 Bacteria 1488
172 Ga0105239_10084742 3300010375 Bacteria 3492
173 Ga0105239_10150755 3300010375 Bacteria 2595
174 Ga0105246_10013775 3300011119 Bacteria 5074
175 Ga0157370_10053036 3300013104 Bacteria 3869
176 Ga0157369_10012423 3300013105 Bacteria 9667
177 Ga0157374_10019281 3300013296 Bacteria 6035
178 Ga0157374_10024785 3300013296 Bacteria 5379
179 Ga0157374_10063878 3300013296 Bacteria 3453
180 Ga0157374_10129211 3300013296 Bacteria 2444
181 Ga0157378_10004961 3300013297 Bacteria 11667
182 Ga0157378_10038833 3300013297 Bacteria 4221
183 Ga0163162_10060239 3300013306 Bacteria 3831
184 Ga0163162_10225195 3300013306 Bacteria 2005
185 Ga0163162_10281427 3300013306 Bacteria 1795
186 Ga0157375_10128467 3300013308 Bacteria 2652
187 Ga0157375_10371170 3300013308 Bacteria 1597
188 Ga0163163_10060452 3300014325 Bacteria 3752
189 Ga0163163_10135612 3300014325 Bacteria 2503
190 Ga0163163_10200834 3300014325 Bacteria 2042
191 Ga0163163_10334734 3300014325 Bacteria 1569
192 Ga0157379_10136897 3300014968 Bacteria 2207
193 Ga0157376_10050368 3300014969 Bacteria 3455
194 Ga0157376_10292110 3300014969 Bacteria 1539
195 Ga0214542_1001925 3300021321 Bacteria 42950
196 Ga0214545_1000003 3300021324 Bacteria 720274
197 Ga0214543_1000002 3300021327 Bacteria 712733
198 Ga0213872_10040411 3300021361 Bacteria 2130
199 Ga0213876_10003579 3300021384 Bacteria 8838
200 Ga0213875_10062030 3300021388 Bacteria 1749
201 Ga0209563_100325 3300025230 Bacteria 18742
202 Ga0209677_102245 3300025253 Bacteria 7486
203 Ga0209148_1000812 3300025254 Bacteria 22632
204 Ga0209233_1003610 3300025261 Bacteria 5425
205 Ga0209233_1008563 3300025261 Bacteria 3154
206 Ga0209455_1002923 3300025272 Bacteria 6300
207 Ga0209455_1005249 3300025272 Bacteria 4048
208 Ga0209455_1005452 3300025272 Bacteria 3927
209 Ga0209758_1000011 3300025297 Bacteria 1049685
210 Ga0209758_1000120 3300025297 Bacteria 192212
211 Ga0209758_1001848 3300025297 Bacteria 23245
212 Ga0209758_1002848 3300025297 Bacteria 16788
213 Ga0209758_1007270 3300025297 Bacteria 7608
214 Ga0209758_1018387 3300025297 Bacteria 3426
215 Ga0209758_1032806 3300025297 Bacteria 2100
216 Ga0207426_1000328 3300025302 Bacteria 90659
217 Ga0207426_1000458 3300025302 Bacteria 64019
218 Ga0207426_1019068 3300025302 Bacteria 2405
219 Ga0209257_1001101 3300025304 Bacteria 35153
220 Ga0207692_10000797 3300025898 Bacteria 11223
221 Ga0207692_10006627 3300025898 Bacteria 4706
222 Ga0207692_10017877 3300025898 Bacteria 3171
223 Ga0207710_10008721 3300025900 Bacteria 4274
224 Ga0207688_10059711 3300025901 Bacteria 2148
225 Ga0207647_10008820 3300025904 Bacteria 7199
226 Ga0207685_10002427 3300025905 Bacteria 4270
227 Ga0207685_10028315 3300025905 Bacteria 1972
228 Ga0207699_10001610 3300025906 Bacteria 10719
229 Ga0207699_10004027 3300025906 Bacteria 7033
230 Ga0207699_10014207 3300025906 Bacteria 4097
231 Ga0207645_10066067 3300025907 Bacteria 2312
232 Ga0207645_10081474 3300025907 Bacteria 2075
233 Ga0207643_10058265 3300025908 Bacteria 2201
234 Ga0207705_10003219 3300025909 Bacteria 12434
235 Ga0207684_10003339 3300025910 Bacteria 15735
236 Ga0207684_10019497 3300025910 Bacteria 5800
237 Ga0207654_10120122 3300025911 Bacteria 1649
238 Ga0207707_10000886 3300025912 Bacteria 29266
239 Ga0207707_10003317 3300025912 Bacteria 14301
240 Ga0207707_10023656 3300025912 Bacteria 5372
241 Ga0207707_10027833 3300025912 Bacteria 4942
242 Ga0207707_10031075 3300025912 Bacteria 4672
243 Ga0207707_10117125 3300025912 Bacteria 2328
244 Ga0207707_10141869 3300025912 Bacteria 2100
245 Ga0207707_10235770 3300025912 Bacteria 1592
246 Ga0207695_10000163 3300025913 Bacteria 197030
247 Ga0207671_10056823 3300025914 Bacteria 2900
248 Ga0207693_10000506 3300025915 Bacteria 35208
249 Ga0207693_10002637 3300025915 Bacteria 15580
250 Ga0207693_10007874 3300025915 Bacteria 8752
251 Ga0207693_10014584 3300025915 Bacteria 6315
252 Ga0207693_10034047 3300025915 Bacteria 4019
253 Ga0207693_10062713 3300025915 Bacteria 2912
254 Ga0207693_10095504 3300025915 Bacteria 2330
255 Ga0207663_10004038 3300025916 Bacteria 7275
256 Ga0207663_10006243 3300025916 Bacteria 6080
257 Ga0207663_10021217 3300025916 Bacteria 3695
258 Ga0207663_10062817 3300025916 Bacteria 2362
259 Ga0207663_10065540 3300025916 Bacteria 2322
260 Ga0207660_10010388 3300025917 Bacteria 6040
261 Ga0207660_10022287 3300025917 Bacteria 4267
262 Ga0207657_10008437 3300025919 Bacteria 10455
263 Ga0207649_10040161 3300025920 Bacteria 2842
264 Ga0207649_10109100 3300025920 Bacteria 1846
265 Ga0207652_10016478 3300025921 Bacteria 6035
266 Ga0207652_10019601 3300025921 Bacteria 5566
267 Ga0207652_10115718 3300025921 Bacteria 2382
268 Ga0207652_10148500 3300025921 Bacteria 2098
269 Ga0207652_10178835 3300025921 Bacteria 1906
270 Ga0207646_10002996 3300025922 Bacteria 19501
271 Ga0207646_10003246 3300025922 Bacteria 18533
272 Ga0207694_10071234 3300025924 Bacteria 2716
273 Ga0207650_10205616 3300025925 Bacteria 1579
274 Ga0207687_10021155 3300025927 Bacteria 4319
275 Ga0207687_10053608 3300025927 Bacteria 2818
276 Ga0207687_10117944 3300025927 Bacteria 1980
277 Ga0207700_10000668 3300025928 Bacteria 20081
278 Ga0207700_10007466 3300025928 Bacteria 6681
279 Ga0207700_10041345 3300025928 Bacteria 3372
280 Ga0207700_10083120 3300025928 Bacteria 2506
281 Ga0207700_10158000 3300025928 Bacteria 1880
282 Ga0207664_10102478 3300025929 Bacteria 2367
283 Ga0207690_10172879 3300025932 Bacteria 1620
284 Ga0207706_10015391 3300025933 Bacteria 6910
285 Ga0207706_10107404 3300025933 Bacteria 2456
286 Ga0207686_10040459 3300025934 Bacteria 2834
287 Ga0207709_10212003 3300025935 Bacteria 1391
288 Ga0207669_10086754 3300025937 Bacteria 2025
289 Ga0207669_10107067 3300025937 Bacteria 1864
290 Ga0207665_10000528 3300025939 Bacteria 25777
291 Ga0207665_10001385 3300025939 Bacteria 16335
292 Ga0207691_10186072 3300025940 Bacteria 1813
293 Ga0207711_10009654 3300025941 Bacteria 8041
294 Ga0207711_10018144 3300025941 Bacteria 5851
295 Ga0207689_10036827 3300025942 Bacteria 4060
296 Ga0207661_10008452 3300025944 Bacteria 7359
297 Ga0207661_10018951 3300025944 Bacteria 5120
298 Ga0207661_10083044 3300025944 Bacteria 2650
299 Ga0207661_10291186 3300025944 Bacteria 1461
300 Ga0207667_10019974 3300025949 Bacteria 7463
301 Ga0207667_10027626 3300025949 Bacteria 6173
302 Ga0207651_10065505 3300025960 Bacteria 2548
303 Ga0207668_10143392 3300025972 Bacteria 1840
304 Ga0207668_10186534 3300025972 Bacteria 1640
305 Ga0207703_10045836 3300026035 Bacteria 3518
306 Ga0207639_10034032 3300026041 Bacteria 3763
307 Ga0207678_10022393 3300026067 Bacteria 5534
308 Ga0207678_10023935 3300026067 Bacteria 5340
309 Ga0207678_10033211 3300026067 Bacteria 4496
310 Ga0207678_10034200 3300026067 Bacteria 4427
311 Ga0207678_10035164 3300026067 Bacteria 4362
312 Ga0207641_10198815 3300026088 Bacteria 1847
313 Ga0207648_10184860 3300026089 Bacteria 1846
314 Ga0207676_10097698 3300026095 Bacteria 2426
315 Ga0207674_10007720 3300026116 Bacteria 12520
316 Ga0207674_10078663 3300026116 Bacteria 3303
317 Ga0207674_10128182 3300026116 Bacteria 2502
318 Ga0207683_10003797 3300026121 Bacteria 13083
319 Ga0207683_10009714 3300026121 Bacteria 8206
320 Ga0207683_10091282 3300026121 Bacteria 2713
321 Ga0207683_10262268 3300026121 Bacteria 1578
322 Ga0207698_10060190 3300026142 Bacteria 2952
323 Ga0209389_1000043 3300027296 Bacteria 123224
324 Ga0209389_1000077 3300027296 Bacteria 91273
325 Ga0209589_1000011 3300027357 Bacteria 236981
326 Ga0209589_1000047 3300027357 Bacteria 118659
327 Ga0209489_100012 3300027361 Bacteria 236981
328 Ga0209489_100075 3300027361 Bacteria 136991
329 Ga0209489_100251 3300027361 Bacteria 91273
330 Ga0209700_100019 3300027363 Bacteria 236981
331 Ga0209700_100271 3300027363 Bacteria 91215
332 Ga0209179_1001680 3300027512 Bacteria 2799
333 Ga0207428_10005470 3300027907 Bacteria 11844
334 Ga0268266_10007625 3300028379 Bacteria 9734
335 Ga0268266_10234117 3300028379 Bacteria 1692
336 Ga0268265_10118725 3300028380 Bacteria 2175
337 Ga0268264_10000030 3300028381 Bacteria 418542
338 Ga0268264_10163025 3300028381 Bacteria 2010
339 Ga0265337_1006171 3300028556 Bacteria 4658
340 Ga0265319_1011253 3300028563 Bacteria 3676
341 Ga0265318_10024101 3300028577 Bacteria 2418
342 Ga0265323_10000434 3300028653 Bacteria 23913
343 Ga0265336_10000649 3300028666 Bacteria 18964
344 Ga0307517_10000279 3300028786 Bacteria 88025
345 Ga0307515_10152056 3300028794 Bacteria 2413
346 Ga0265338_10000280 3300028800 Bacteria 91942
347 Ga0265324_10010387 3300029957 Bacteria 3591
348 Ga0265330_10006697 3300031235 Bacteria 5683
349 Ga0265325_10000599 3300031241 Bacteria 26290
350 Ga0265329_10042580 3300031242 Bacteria 1454
351 Ga0265340_10010905 3300031247 Bacteria 4848
352 Ga0265340_10014569 3300031247 Bacteria 4103
353 Ga0265340_10025159 3300031247 Bacteria 3018
354 Ga0265339_10020885 3300031249 Bacteria 3820
355 Ga0265339_10035899 3300031249 Bacteria 2777
356 Ga0265339_10107760 3300031249 Bacteria 1445
357 Ga0307509_10204543 3300031507 Bacteria 1806
358 Ga0307508_10003532 3300031616 Bacteria 15752
359 Ga0307508_10140808 3300031616 Bacteria 2016
360 Ga0265314_10014967 3300031711 Bacteria 6177
361 Ga0265342_10009847 3300031712 Bacteria 6686
362 Ga0307516_10097075 3300031730 Bacteria 2767
363 Ga0307507_10043063 3300033179 Bacteria 4486
364 Ga0307510_10037733 3300033180 Bacteria 5357
365 Ga0307510_10073832 3300033180 Bacteria 3376
366 Ga0315911_1000003 3300033442 Bacteria 502217
367 Ga0373928_0004389 3300035084 Bacteria 2691
368 Ga0373936_0003178 3300035113 Bacteria 6151
369 Ga0373941_0005728 3300035115 Bacteria 2948
370 Ga0373953_0003406 3300035117 Bacteria 4946
371 Ga0373954_0068936 3300035118 Bacteria 1679
372 Ga0373956_0007041 3300035119 Bacteria 4524
373 Ga0373957_0020281 3300035120 Bacteria 2347
374 Ga0373960_0014063 3300035121 Bacteria 2020
375 Ga0373943_0000795 3300035170 Bacteria 13844
376 Ga0373943_0025222 3300035170 Bacteria 2778
377 Ga0373943_0037571 3300035170 Bacteria 2325
378 Ga0373946_0064791 3300035171 Bacteria 1563
379 Ga0373955_0064066 3300035172 Bacteria 2036
380 Ga0373942_0003177 3300035207 Bacteria 3887
381 Ga0373931_0006081 3300035691 Bacteria 5624
382 Ga0373935_0000536 3300035692 Bacteria 19758
383 Ga0373935_0017022 3300035692 Bacteria 4403
384 Ga0373927_0000898 3300035695 Bacteria 22620
385 Ga0373927_0045712 3300035695 Bacteria 2832
386 Ga0373933_0001821 3300035724 Bacteria 12354
387 Ga0373933_0056140 3300035724 Bacteria 2363
388 Ga0373947_0010479 3300035725 Bacteria 5318
389 Ga0373937_0054540 3300036401 Bacteria 3668
390 Ga0373937_0139955 3300036401 Bacteria 2264
391 Ga0373937_0216891 3300036401 Bacteria 1801
392 Ga0373925_0001796 3300037068 Bacteria 17888
393 Ga0373925_0027047 3300037068 Bacteria 4200
394 Ga0373925_0038098 3300037068 Bacteria 3552
395 Ga0373925_0138906 3300037068 Bacteria 1901
396 Ga0373925_0166865 3300037068 Bacteria 1736
397 Ga0373925_0227748 3300037068 Bacteria 1489
398 Ga0395899_0060103 3300037312 Bacteria 2800
399 Ga0395900_0003092 3300037418 Bacteria 18074
400 Ga0395905_0084980 3300037471 Bacteria 2965
401 Ga0436364_0356418 3300037853 Bacteria 2149
402 Ga0395901_0001902 3300038443 Bacteria 21558
403 Ga0395901_0209340 3300038443 Bacteria 2042
404 Ga0436365_1236739 3300039437 Bacteria 30341
405 Ga0436365_1571642 3300039437 Bacteria 1625
406 Ga0436361_0535015 3300039447 Bacteria 2198
407 Ga0436361_0632240 3300039447 Bacteria 3925
408 Ga0436363_0621011 3300039450 Bacteria 2545
409 Ga0436363_0698487 3300039450 Bacteria 1356
410 Ga0436362_0652931 3300039453 Bacteria 7115
411 Ga0466972_0000079 3300044658 Bacteria 90348
412 Ga0466965_0068555 3300044683 Bacteria 1781
413 Ga0466963_0007491 3300044694 Bacteria 6512
414 Ga0466968_0010560 3300044735 Bacteria 3583
415 Ga0466960_0006472 3300044901 Bacteria 4699
416 Ga0466959_0033466 3300045049 Bacteria 3801
417 Ga0466959_0052521 3300045049 Bacteria 2984
418 Ga0466959_0154985 3300045049 Bacteria 1613
419 Ga0466967_0249181 3300045976 Bacteria 1696
420 Ga0466967_0295043 3300045976 Bacteria 1558
421 Ga0495592_0008855 3300046454 Bacteria 7559
422 Ga0495592_0011606 3300046454 Bacteria 6672
423 Ga0495592_0029907 3300046454 Bacteria 4121
424 Ga0495603_0000046 3300046455 Bacteria 53187
425 Ga0495603_0086322 3300046455 Bacteria 1837
426 Ga0495629_0000071 3300046459 Bacteria 88879
427 Ga0495629_0009871 3300046459 Bacteria 6968
428 Ga0495629_0163739 3300046459 Bacteria 1545
429 Ga0495638_0020090 3300046460 Bacteria 4414
430 Ga0495641_0009896 3300046461 Bacteria 5611
431 Ga0495641_0011415 3300046461 Bacteria 5064
432 Ga0495653_0032304 3300046463 Bacteria 4157
433 Ga0495580_0000057 3300046472 Bacteria 64650
434 Ga0495580_0043983 3300046472 Bacteria 3177
435 Ga0495582_0000111 3300046473 Bacteria 42751
436 Ga0495605_0056668 3300046474 Bacteria 1889
437 Ga0495639_0000108 3300046475 Bacteria 41656
438 Ga0495639_0015341 3300046475 Bacteria 3322
439 Ga0495662_0000992 3300046476 Bacteria 13882
440 Ga0495662_0020305 3300046476 Bacteria 3213
441 Ga0495664_0002718 3300046477 Bacteria 9505
442 Ga0495664_0007884 3300046477 Bacteria 5926
443 Ga0495664_0030650 3300046477 Bacteria 3151
444 Ga0495664_0063064 3300046477 Bacteria 2208
445 Ga0495594_0000133 3300046499 Bacteria 34897
446 Ga0495583_0055522 3300046506 Bacteria 1790
447 Ga0495606_0003362 3300046507 Bacteria 17052
448 Ga0495606_0006998 3300046507 Bacteria 10238
449 Ga0495606_0080559 3300046507 Bacteria 2026
450 Ga0495606_0138832 3300046507 Bacteria 1437
451 Ga0495628_0012530 3300046516 Bacteria 7144
452 Ga0495628_0042625 3300046516 Bacteria 3619
453 Ga0495630_0000959 3300046517 Bacteria 20201
454 Ga0495637_0048728 3300046520 Bacteria 1783
455 Ga0495643_0005954 3300046522 Bacteria 8136
456 Ga0495648_0046019 3300046524 Bacteria 2708
457 Ga0495666_0005822 3300046526 Bacteria 6215
458 Ga0495666_0032607 3300046526 Bacteria 2548
459 Ga0495652_0042099 3300046529 Bacteria 3939
460 Ga0495652_0097969 3300046529 Bacteria 2384
461 Ga0495652_0168431 3300046529 Bacteria 1693
462 Ga0495665_0000001 3300046531 Bacteria 156121
463 Ga0495665_0057438 3300046531 Bacteria 2054
464 Ga0495640_0012179 3300046533 Bacteria 6583
465 Ga0495640_0023983 3300046533 Bacteria 4438
466 Ga0495640_0028223 3300046533 Bacteria 4042
467 Ga0495640_0143197 3300046533 Bacteria 1540
468 Ga0495586_0056589 3300046535 Bacteria 2127
469 Ga0495587_0044824 3300046536 Bacteria 2630
470 Ga0495597_0031638 3300046542 Bacteria 2406
471 Ga0495645_0007155 3300046543 Bacteria 7768
472 Ga0495645_0009374 3300046543 Bacteria 6845
473 Ga0495622_0001363 3300046557 Bacteria 12492
474 Ga0495633_0041177 3300046558 Bacteria 2197
475 Ga0495667_0006892 3300046559 Bacteria 7715
476 Ga0495667_0016295 3300046559 Bacteria 5021
477 Ga0495667_0032071 3300046559 Bacteria 3523
478 Ga0495668_0066567 3300046616 Bacteria 1982
479 Ga0495634_0000046 3300046642 Bacteria 97947
480 Ga0495634_0076372 3300046642 Bacteria 2199
481 Ga0495625_0164898 3300046660 Bacteria 1482
482 Ga0495635_0000338 3300046663 Bacteria 29955
483 Ga0495635_0019273 3300046663 Bacteria 4758
484 Ga0495635_0051638 3300046663 Bacteria 2832
485 Ga0495588_0001464 3300046674 Bacteria 10138
486 Ga0495657_0054792 3300046675 Bacteria 2662
487 Ga0495599_0007149 3300046678 Bacteria 6759
488 Ga0495599_0124670 3300046678 Bacteria 1601
489 Ga0495623_0045020 3300046679 Bacteria 2803
490 Ga0495646_0007433 3300046680 Bacteria 6965
491 Ga0495646_0008580 3300046680 Bacteria 6490
492 Ga0495647_0000754 3300046681 Bacteria 9612
493 Ga0495658_0000994 3300046683 Bacteria 14995
494 Ga0495658_0005502 3300046683 Bacteria 6226
495 Ga0495613_0005517 3300046689 Bacteria 9500
496 Ga0495613_0025092 3300046689 Bacteria 4442
497 Ga0495624_0003652 3300046690 Bacteria 11380
498 Ga0495624_0050265 3300046690 Bacteria 2641
499 Ga0495670_0004308 3300046691 Bacteria 6972
500 Ga0495649_0038307 3300046694 Bacteria 2631
501 Ga0495649_0059545 3300046694 Bacteria 2056
502 Ga0495600_0005381 3300046809 Bacteria 7717
503 Ga0495581_0000012 3300047315 Bacteria 62886
504 Ga0495581_0018927 3300047315 Bacteria 3996
505 Ga0495581_0019391 3300047315 Bacteria 3948
506 Ga0495604_0004988 3300047317 Bacteria 10511
507 Ga0495604_0009096 3300047317 Bacteria 7860
508 Ga0495604_0082749 3300047317 Bacteria 2399
509 Ga0495674_0000031 3300047319 Bacteria 115867
510 Ga0495674_0042923 3300047319 Bacteria 4029
511 Ga0495674_0167781 3300047319 Bacteria 1833
512 Ga0495680_0024280 3300047322 Bacteria 5030
513 Ga0495687_014302 3300047443 Bacteria 4091
514 Ga0495673_0036405 3300047469 Bacteria 2258
515 Ga0495684_0010711 3300047471 Bacteria 7091
516 Ga0495684_0028321 3300047471 Bacteria 4301
517 Ga0495684_0087681 3300047471 Bacteria 2358
518 Ga0495684_0106060 3300047471 Bacteria 2123
519 Ga0495686_0057595 3300047472 Bacteria 2425
520 Ga0495593_0000008 3300047673 Bacteria 87310
521 Ga0495593_0089256 3300047673 Bacteria 1588
522 Ga0495602_0011752 3300048088 Bacteria 9041
523 Ga0496100_0024358 3300048903 Bacteria 3691
524 Ga0496100_0048201 3300048903 Bacteria 2749
525 Ga0496100_0057600 3300048903 Bacteria 2546
526 Ga0496101_0006365 3300048904 Bacteria 7599
527 Ga0496101_0143379 3300048904 Bacteria 1822
528 Ga0496101_0175899 3300048904 Bacteria 1646
529 Ga0496102_0003595 3300048905 Bacteria 13132
530 Ga0496102_0047832 3300048905 Bacteria 3888
531 Ga0496102_0135445 3300048905 Bacteria 2308
532 Ga0496102_0155765 3300048905 Bacteria 2147
533 Ga0496102_0405944 3300048905 Bacteria 1280
534 Ga0496103_0013766 3300048906 Bacteria 4802
535 Ga0496103_0056345 3300048906 Bacteria 2439
536 Ga0496104_0047727 3300048907 Bacteria 4036
537 Ga0496104_0091600 3300048907 Bacteria 2906
538 Ga0496104_0105275 3300048907 Bacteria 2703
539 Ga0496104_0156936 3300048907 Bacteria 2183
540 Ga0496104_0191109 3300048907 Bacteria 1959
541 Ga0496104_0209150 3300048907 Bacteria 1863
542 Ga0496105_0019331 3300048908 Bacteria 5493
543 Ga0496105_0047299 3300048908 Bacteria 3550
544 Ga0496105_0051555 3300048908 Bacteria 3399
545 Ga0496106_0048244 3300048909 Bacteria 3207
546 Ga0496106_0223856 3300048909 Bacteria 1501
547 Ga0496107_0000947 3300048910 Bacteria 17177
548 Ga0496107_0059812 3300048910 Bacteria 2757
549 Ga0496107_0116062 3300048910 Bacteria 1970
550 Ga0496108_0009810 3300048911 Bacteria 7756
551 Ga0496108_0013705 3300048911 Bacteria 6616
552 Ga0496109_0008951 3300048912 Bacteria 8527
553 Ga0496109_0009381 3300048912 Bacteria 8337
554 Ga0496109_0031864 3300048912 Bacteria 4735
555 Ga0496109_0048452 3300048912 Bacteria 3866
556 Ga0496110_0013781 3300048913 Bacteria 6698
557 Ga0496110_0033318 3300048913 Bacteria 4455
558 Ga0496110_0126144 3300048913 Bacteria 2309
559 Ga0496111_0029039 3300048914 Bacteria 3923
560 Ga0496112_0000008 3300048915 Bacteria 310323
561 Ga0496112_0029131 3300048915 Bacteria 5337
562 Ga0496112_0030083 3300048915 Bacteria 5255
563 Ga0496112_0034956 3300048915 Bacteria 4890
564 Ga0496112_0065820 3300048915 Bacteria 3576
565 Ga0496112_0165206 3300048915 Bacteria 2179
566 Ga0496113_0001327 3300048916 Bacteria 13676
567 Ga0496113_0038477 3300048916 Bacteria 3517
568 Ga0496113_0067913 3300048916 Bacteria 2704
569 Ga0496113_0139736 3300048916 Bacteria 1905
570 Ga0496113_0152713 3300048916 Bacteria 1822
571 Ga0496114_0009690 3300048917 Bacteria 7651
572 Ga0496114_0024353 3300048917 Bacteria 4940
573 Ga0496115_0000604 3300048918 Bacteria 27391
574 Ga0496115_0011581 3300048918 Bacteria 6613
575 Ga0496115_0071313 3300048918 Bacteria 2818
576 Ga0496115_0119789 3300048918 Bacteria 2165
577 Ga0496115_0176244 3300048918 Bacteria 1768
578 Ga0496115_0242729 3300048918 Bacteria 1485
579 Ga0496115_0247343 3300048918 Bacteria 1469
580 Ga0496117_0010071 3300048920 Bacteria 8683
581 Ga0496117_0064449 3300048920 Bacteria 2498
582 Ga0496118_0008611 3300048921 Bacteria 10500
583 Ga0496118_0009891 3300048921 Bacteria 9537
584 Ga0496118_0116503 3300048921 Bacteria 1755
585 Ga0496119_0006875 3300048922 Bacteria 10389
586 Ga0496119_0072328 3300048922 Bacteria 2015
587 Ga0496120_0005140 3300048923 Bacteria 10571
588 Ga0496121_0002635 3300048924 Bacteria 27038
589 Ga0496121_0014245 3300048924 Bacteria 8457
590 Ga0496121_0020183 3300048924 Bacteria 6613
591 Ga0496121_0048593 3300048924 Bacteria 3608
592 Ga0496121_0152966 3300048924 Bacteria 1695
593 Ga0496124_0011581 3300048927 Bacteria 8801
594 Ga0496124_0190514 3300048927 Bacteria 1570
595 Ga0496125_0000048 3300048928 Bacteria 290651
596 Ga0496125_0000746 3300048928 Bacteria 53671
597 Ga0496125_0071057 3300048928 Bacteria 2721
598 Ga0496126_0008677 3300048929 Bacteria 10918
599 Ga0496126_0009242 3300048929 Bacteria 10508
600 Ga0496126_0022113 3300048929 Bacteria 6194
601 Ga0496126_0045158 3300048929 Bacteria 4052
602 Ga0496126_0065897 3300048929 Bacteria 3239
603 Ga0496126_0073717 3300048929 Bacteria 3034
604 Ga0496126_0127252 3300048929 Bacteria 2204
605 Ga0496126_0239357 3300048929 Bacteria 1517
606 Ga0496126_0247949 3300048929 Bacteria 1485
607 Ga0495682_0018342 3300049460 Bacteria 2636
608 Ga0501032_0022551 3300049569 Bacteria 4363
609 Ga0501034_0165443 3300049571 Bacteria 2180
610 Ga0501036_0005911 3300049572 Bacteria 9917
611 Ga0501037_0065576 3300049573 Bacteria 2645
612 Ga0501038_0020172 3300049574 Bacteria 5996
613 Ga0501039_0009067 3300049575 Bacteria 7583
614 Ga0501046_0008999 3300049580 Bacteria 8663
615 Ga0501048_0013379 3300049582 Bacteria 6089
616 Ga0501069_0001752 3300049585 Bacteria 10825
617 Ga0501070_0051123 3300049586 Bacteria 3430
618 Ga0501070_0119773 3300049586 Bacteria 2175
619 Ga0501071_0046675 3300049587 Bacteria 3111
620 Ga0501074_0002882 3300049590 Bacteria 12058
621 Ga0501076_0010510 3300049592 Bacteria 6869
622 Ga0501076_0051612 3300049592 Bacteria 3256
623 Ga0501076_0090535 3300049592 Bacteria 2461
624 Ga0501079_0080288 3300049741 Bacteria 2522
625 Ga0501083_0003764 3300049744 Bacteria 10648
626 Ga0501044_0001655 3300049823 Bacteria 26167
627 Ga0501044_0049412 3300049823 Bacteria 4343
628 Ga0501044_0061643 3300049823 Bacteria 3836
629 nmdc:mga03683_32601_c1 3300050489 Bacteria 2097
630 nmdc:mga0yw44_134932_c1 3300050492 Bacteria 1601
631 nmdc:mga0k408_22090_c2 3300050493 Bacteria 2760
632 nmdc:mga0k408_25121_c1 3300050493 Bacteria 3372
633 nmdc:mga06z11_108051_c1 3300050494 Bacteria 1537
634 nmdc:mga04h51_25898_c1 3300050495 Bacteria 1810
635 nmdc:mga07m45_63476_c1 3300050496 Bacteria 2095
636 nmdc:mga05p37_213_c1 3300050507 Bacteria 58791
637 nmdc:mga05p37_24611_c1 3300050507 Bacteria 7319
638 nmdc:mga05p37_49620_c1 3300050507 Bacteria 5163
639 nmdc:mga05p37_54085_c1 3300050507 Bacteria 4939
640 nmdc:mga09592_1171_c1 3300050508 Bacteria 12926
641 nmdc:mga09592_1606_c1 3300050508 Bacteria 18226
642 nmdc:mga0qj67_129_c1 3300050509 Bacteria 50064
643 nmdc:mga0qj67_31281_c1 3300050509 Bacteria 4145
644 nmdc:mga0qj67_885_c1 3300050509 Bacteria 20530
645 nmdc:mga06r32_1219_c1 3300050510 Bacteria 23164
646 nmdc:mga06r32_253962_c1 3300050510 Bacteria 1746
647 nmdc:mga06r32_6151_c1 3300050510 Bacteria 10773
648 nmdc:mga08y16_275_c1 3300050511 Bacteria 46750
649 nmdc:mga0n895_179945_c1 3300050512 Bacteria 2146
650 nmdc:mga0n895_72723_c1 3300050512 Bacteria 3412
651 nmdc:mga0rr50_12121_c1 3300050513 Bacteria 5556
652 nmdc:mga0rr50_169464_c1 3300050513 Bacteria 1778
653 nmdc:mga0a205_5452_c1 3300050515 Bacteria 11461
654 nmdc:mga0sz30_34204_c1 3300050516 Bacteria 2114
655 nmdc:mga0sz30_50717_c1 3300050516 Bacteria 1760
656 Ga0495601_0067367 3300053077 Bacteria 2280
657 Ga0495595_0027742 3300053084 Bacteria 2524
658 Ga0495595_0033994 3300053084 Bacteria 2304
659 Ga0495619_0011258 3300053085 Bacteria 5625
660 Ga0495619_0017972 3300053085 Bacteria 4484
661 Ga0495619_0058742 3300053085 Bacteria 2554
662 Ga0495619_0062539 3300053085 Bacteria 2478
663 Ga0500578_0051297 3300053086 Bacteria 2643
664 Ga0500578_0110590 3300053086 Bacteria 1732
665 Ga0500643_002271 3300053087 Bacteria 10082
666 Ga0500644_0000771 3300053088 Bacteria 10930
667 Ga0500583_0052684 3300053092 Bacteria 1894
668 Ga0500651_0031020 3300053093 Bacteria 3365
669 Ga0500651_0090684 3300053093 Bacteria 1882
670 Ga0500566_0000011 3300053094 Bacteria 118644
671 Ga0500566_0000293 3300053094 Bacteria 26861
672 Ga0500566_0000412 3300053094 Bacteria 23818
673 Ga0500566_0135551 3300053094 Bacteria 1312
674 Ga0500640_001527 3300053095 Bacteria 7094
675 Ga0500554_020862 3300053102 Bacteria 1808
676 Ga0500555_001186 3300053103 Bacteria 8535
677 Ga0500557_000062 3300053105 Bacteria 43893
678 Ga0500572_000065 3300053111 Bacteria 32713
679 Ga0500572_001006 3300053111 Bacteria 8512
680 Ga0500595_000003 3300053119 Bacteria 419332
681 Ga0500595_000395 3300053119 Bacteria 28044
682 Ga0500595_003500 3300053119 Bacteria 7305
683 Ga0500607_022647 3300053121 Bacteria 3529
684 Ga0500614_017278 3300053123 Bacteria 1628
685 Ga0500642_0000127 3300053130 Bacteria 34341
686 Ga0500652_005161 3300053131 Bacteria 4091
687 Ga0500559_0001342 3300053136 Bacteria 14123
688 Ga0500559_0001798 3300053136 Bacteria 11758
689 Ga0500603_000269 3300053150 Bacteria 13789
690 Ga0500616_0000002 3300053153 Bacteria 1611257
691 Ga0500616_0002075 3300053153 Bacteria 17550
692 Ga0500616_0029688 3300053153 Bacteria 3008
693 Ga0500630_000832 3300053159 Bacteria 14267
694 Ga0500638_000370 3300053162 Bacteria 10477
695 Ga0500639_000079 3300053163 Bacteria 45631
696 Ga0500639_004522 3300053163 Bacteria 7069
697 Ga0500636_0000041 3300053177 Bacteria 69687
698 Ga0500636_0037290 3300053177 Bacteria 2876
699 Ga0500637_0000026 3300053178 Bacteria 59050
700 Ga0500637_0053059 3300053178 Bacteria 2314
701 Ga0500637_0085364 3300053178 Bacteria 1825
702 Ga0500625_015998 3300053729 Bacteria 3488
703 Ga0500645_000226 3300053730 Bacteria 42982
704 Ga0500609_002277 3300053731 Bacteria 2738
705 Ga0500596_000987 3300053735 Bacteria 5689
706 Ga0500596_004947 3300053735 Bacteria 2393
707 Ga0500599_002636 3300053736 Bacteria 2163
708 Ga0500601_005302 3300053737 Bacteria 1411
709 Ga0501084_0032968 3300054114 Bacteria 4333
710 Ga0500661_001127 3300055283 Bacteria 5003
711 Ga0501082_0002831 3300060353 Bacteria 15119
712 Ga0530510_0090886 3300061734 Bacteria 2227
713 Ga0530510_0161046 3300061734 Bacteria 1660
714 2885315494 2885312484 Bacteria 6415165
715 2507507463 2507262055 Bacteria 8048963
716 2508541577 2508501009 Bacteria 7784016
717 2508692880 2508501042 Bacteria 8719808
718 2509140462 2508501127 Bacteria 7037543
719 2509152283 2508501128 Bacteria 8613869
720 2511398979 2511231028 Bacteria 8046582
721 2513621669 2513237092 Bacteria 8341956
722 2513636902 2513237094 Bacteria 8789602
723 2513657139 2513237096 Bacteria 8722461
724 2513721517 2513237104 Bacteria 10034502
725 2513857027 2513237137 Bacteria 9558895
726 2513878358 2513237139 Bacteria 8737671
727 2513892563 2513237141 Bacteria 8496279
728 2513919147 2513237145 Bacteria 8979722
729 2514011715 2513237161 Bacteria 8871253
730 2515626270 2515154112 Bacteria 8294334
731 2517891159 2517572143 Bacteria 9484767
732 2524436080 2524023205 Bacteria 8918781
733 2528852873 2528768022 Bacteria 10457665
734 2597813935 2597489875 Bacteria 7010078
735 2617352718 2617270735 Bacteria 9163226
736 2671123239 2667528175 Bacteria 7532676
737 2723843502 2721755755 Bacteria 8322773
738 2728755524 2728368998 Bacteria 8720350
739 2745080024 2744054633 Bacteria 8678936
740 2793061081 2791355196 Bacteria 7323613
741 2793066502 2791355197 Bacteria 8420563
742 2793083970
743 2805920581 2802429603 Bacteria 8777136
744 2818236767 2816332527 Bacteria 8933356
745 2824605660 2824600985 Bacteria 8488197
746 2824611778 2824609381 Bacteria 8672835
747 2824655014 2824653114 Bacteria 8493680
748 2824664031 2824661429 Bacteria 9877870
749 2824675199 2824671348 Bacteria 8369588
750 2824681575 2824679649 Bacteria 8248951
751 2824690053 2824687955 Bacteria 8360029
752 2824701150 2824696289 Bacteria 8335049
753 2824711111 2824704595 Bacteria 9667483
754 2824735657 2824732956 Bacteria 7810675
755 2824760454 2824753945 Bacteria 9787441
756 2824766557 2824763712 Bacteria 9792355
757 2824776677 2824773399 Bacteria 8360218
758 2838127373 2838122688 Bacteria 8803140
759 2841740203 2841734538 Bacteria 6784580
760 2841946392 2841941048 Bacteria 8688029
761 2841957111 2841949485 Bacteria 8680857
762 2841965633 2841957949 Bacteria 8652217
763 2841972902 2841966195 Bacteria 8673214
764 2841978426 2841974524 Bacteria 8931498
765 2841987472 2841983080 Bacteria 8395090
766 2842040855 2842038055 Bacteria 8002051
767 2842046200 2842045827 Bacteria 8006841
768 2844320212 2844315083 Bacteria 8138177
769 2844534782 2844533157 Bacteria 7517899
770 2847937534 2847930680 Bacteria 9342022
771 2847947962 2847939898 Bacteria 8606328
772 2849078190 2849076700 Bacteria 7039503
773 2856344111 2856342000 Bacteria 7176905
774 2857511351 2857509624 Bacteria 7472071
775 2871480009 2871474448 Bacteria 6806570
776 2874598579 2874590934 Bacteria 8299676
777 2874616764 2874612657 Bacteria 8252029
778 2874628286 2874620515 Bacteria 8290088
779 2874630117 2874628541 Bacteria 8630250
780 2874652032 2874645413 Bacteria 8214782
781 2876768291 2876761206 Bacteria 10111113
782 2876778617 2876771140 Bacteria 8287509
783 2876823422 2876818435 Bacteria 8274608
784 2879082410 2879074833 Bacteria 8279565
785 2879084947 2879083081 Bacteria 8587928
786 2879107930 2879099564 Bacteria 10442239
787 2879131809 2879127579 Bacteria 8294491
788 2879150145 2879142872 Bacteria 8267021
789 2881370114 2881364244 Bacteria 7710352
790 2881670114 2881665667 Bacteria 8175609
791 2885370179 2885366525 Bacteria 8326213
792 2885414370 2885409591 Bacteria 9235467
793 2888347628 2888343758 Bacteria 6611049
794 2888385690 2888378607 Bacteria 9652610
795 2888392577 2888388044 Bacteria 7304136
796 2888425813 2888419890 Bacteria 7857137
797 2903731198 2903727486 Bacteria 8281579
798 2903752222 2903748898 Bacteria 9972761
799 2904674095 2904666416 Bacteria 8226587
800 2904698941 2904690495 Bacteria 9412302
801 2904711745 2904711408 Bacteria 9771557
802 2906610035 2906602504 Bacteria 8295279
803 2906616339
804 2906629224 2906626472 Bacteria 8826946
805 2906651217 2906643746 Bacteria 8722424
806 2906662878 2906660503 Bacteria 8595048
807 2908781388 2908775508 Bacteria 8092255
808 2922361758 2922361189 Bacteria 7436256
809 2922386997 2922386360 Bacteria 7017218
810 2922396860 2922393267 Bacteria 8285685
811 2922431663
812 2924760248 2924754689 Bacteria 6774424
813 2929621250 2929615660 Bacteria 9193770
814 2929625919 2929624759 Bacteria 9339455
815 2932785196 2932784394 Bacteria 9704911
816 2932808765 2932801729 Bacteria 7987968
817 2932810230 2932809354 Bacteria 9135765
818 2932821802 2932818245 Bacteria 9955613
819 2932829032 2932828146 Bacteria 9745859
820 2933582881 2933577622 Bacteria 9116884
821 2935610033 2935608549 Bacteria 8203142
822 2935619548 2935616580 Bacteria 9032984
823 2935635787 2935630451 Bacteria 8169952
824 2935638528 2935638405 Bacteria 10015038
825 2935656357 2935648319 Bacteria 8801166
826 2935660087 2935656913 Bacteria 8965014
827 2935666620 2935665750 Bacteria 9571747
828 2935682190 2935675223 Bacteria 9928132
829 2935691154 2935684952 Bacteria 9590419
830 2935694421 2935694250 Bacteria 9291695
831 2935703534 2935703347 Bacteria 10242284
832 2935718535 2935713505 Bacteria 9608509
833 2935727485 2935722832 Bacteria 9608746
834 2935736188 2935732158 Bacteria 9706831
835 2935745568 2935741537 Bacteria 9707219
836 2935755949 2935750917 Bacteria 9590372
837 2935760789 2935760218 Bacteria 9817913
838 2935776444 2935769743 Bacteria 7878163
839 2935780837 2935777560 Bacteria 8077691
840 2935792331 2935785616 Bacteria 7962367
841 2935800494 2935793552 Bacteria 8012592
842 2935801671 2935801545 Bacteria 9301974
843 2935814919 2935810662 Bacteria 9401221
844 2935823193 2935819856 Bacteria 8261050
845 2935828022 2935827899 Bacteria 10038562
846 2935842228 2935837841 Bacteria 9454360
847 2935848775 2935847175 Bacteria 8228321
848 2935858136 2935855204 Bacteria 9035059
849 2935868041 2935864058 Bacteria 9784707
850 2935873936 2935873716 Bacteria 9632195
851 2935885695 2935883170 Bacteria 7964738
852 2935909423 2935908558 Bacteria 8568796
853 2935917145 2935916978 Bacteria 9113783
854 2935926904 2935926038 Bacteria 8601059
855 2935937252 2935934488 Bacteria 8602579
856 2935944445 2935942939 Bacteria 8599779
857 2935952882 2935951376 Bacteria 8602333
858 2935962905 2935959822 Bacteria 7869783
859 2935969722 2935967501 Bacteria 8603075
860 2935976333 2935975950 Bacteria 8347125
861 2935991826 2935984226 Bacteria 8302647
862 2935993140 2935992306 Bacteria 9802711
863 2936003077 2936002035 Bacteria 9362176
864 2936014503 2936011229 Bacteria 8801034
865 2936027830 2936019824 Bacteria 8804134
866 2936031300 2936028420 Bacteria 8965941
867 2936040438 2936037263 Bacteria 9446081
868 2936049609 2936046547 Bacteria 8903709
869 2936061175 2936055302 Bacteria 8785755
870 2937837668 2937836603 Bacteria 6811263
871 2940562076 2940556831 Bacteria 9590747
872 2941512376 2941507105 Bacteria 8166816
873 2941520119 2941515067 Bacteria 8166720
874 2941528268 2941523033 Bacteria 8169134
875 2941531402 2941531003 Bacteria 7653939
876 2941542276 2941538514 Bacteria 9402094
877 2958077696 2958071322 Bacteria 6815895
878 2970530301 2970524798 Bacteria 6840927
879 2970542806 2970540015 Bacteria 6977556
880 3003670217 3003665799 Bacteria 7279786
881 3005481462 3005474847 Bacteria 9259049
882 3005488442 3005483717 Bacteria 7877331
883 3005508231 3005506211 Bacteria 6943378
884 3005588267 3005587118 Bacteria 7794411
885 3005600525 3005594810 Bacteria 8716512
886 3005715999 3005710791 Bacteria 7622528
887 8004401455 8004395343 Bacteria 6620908
888 8004637161 8004633249 Bacteria 6723080
889 8006978913 8006973647 Bacteria 10679141
890 8016520429 8016511872 Bacteria 9921665
891 8016528501 8016522445 Bacteria 8156687
892 8016533660 8016530956 Bacteria 8155261
893 8016546882 8016539877 Bacteria 8155419
894 8016555237 8016548790 Bacteria 8155074
895 8016576195 8016575299 Bacteria 8154085
896 8016594597 8016583857 Bacteria 10421953
897 8016601334 8016595262 Bacteria 8149947
898 8016609096 8016603502 Bacteria 8731218
899 8016615808 8016613128 Bacteria 8794220
900 8017065146 8017057580 Bacteria 10023680
901 8019533440 8019530166 Bacteria 8155624
902 8019552473 8019547302 Bacteria 7996444
903 8019565116 8019555841 Bacteria 9642137
904 8019575218 8019565922 Bacteria 9639779
905 8019584536 8019576017 Bacteria 10049540
906 8019592309 8019586578 Bacteria 10212056
907 8019598978 8019597564 Bacteria 10041141
908 8019609399 8019608314 Bacteria 10042931
909 8019620022 8019619141 Bacteria 9218857
910 8019633082 8019629233 Bacteria 8687553
911 8019649593 8019648815 Bacteria 10014479
912 8019660964 8019659431 Bacteria 8577854
913 8019670524 8019668869 Bacteria 8791617
914 8019685708 8019678201 Bacteria 8863603
915 8019691285 8019687851 Bacteria 8712826
916 8055621701 8055617313 Bacteria 7548464
917 8055744889 8055742211 Bacteria 9226248
918 8056690619 8056689827 Bacteria 6712655
919 JGI25406J46586_10000138
920 JGI25153J46596_10000317
921 JGI25153J46596_10005866
922 rootL2_10158942
923 JGI25404J52841_10006155
924 Ga0055526_1025395
925 Ga0055531_10008821
926 Ga0055543_1009959
927 Ga0065165_1000747
928 Ga0065165_1004585
929 Ga0065165_1012243
930 Ga0070658_10123665
931 Ga0070683_100035975
932 Ga0070683_100244080
933 Ga0070680_100000841
934 Ga0070680_100053807
935 Ga0070680_100093332
936 Ga0070689_100056909
937 Ga0070661_100069576
938 Ga0070661_100148532
939 Ga0070688_100026113
940 Ga0070667_100111159
941 Ga0070667_100151855
942 Ga0070709_10002197
943 Ga0070709_10010839
944 Ga0070709_10026207
945 Ga0070713_100001462
946 Ga0070713_100014026
947 Ga0070713_100026138
948 Ga0070713_100052936
949 Ga0070713_100115088
950 Ga0070713_100166983
951 Ga0070710_10000678
952 Ga0070710_10003896
953 Ga0070710_10007682
954 Ga0070711_100000465
955 Ga0070711_100003772
956 Ga0070711_100087288
957 Ga0070708_100029298
958 Ga0070663_100034033
959 Ga0070678_100064623
960 Ga0070678_100162002
961 Ga0070662_100256264
962 Ga0070681_10009737
963 Ga0070681_10103984
964 Ga0070681_10147603
965 Ga0068867_100059990
966 Ga0070707_100022473
967 Ga0070698_100013803
968 Ga0070698_100080213
969 Ga0070698_100240368
970 Ga0070679_100003118
971 Ga0070679_100004998
972 Ga0070679_100100769
973 Ga0070679_100139466
974 Ga0070679_100228455
975 Ga0070684_100007961
976 Ga0070684_100009391
977 Ga0070697_100061449
978 Ga0070665_100023384
979 Ga0070665_100053413
980 Ga0070665_100073338
981 Ga0068855_100058768
982 Ga0068855_100112512
983 Ga0068855_100210946
984 Ga0068855_100306921
985 Ga0070664_100165643
986 Ga0068857_100037748
987 Ga0068857_100059974
988 Ga0068856_100079699
989 Ga0068856_100172420
990 Ga0068856_100268782
991 Ga0070702_100034040
992 Ga0068852_100038198
993 Ga0068859_100383909
994 Ga0068864_100049929
995 Ga0068866_10087823
996 Ga0068851_10009836
997 Ga0068863_100074750
998 Ga0068858_100031960
999 Ga0068858_100202761
1000 Ga0068860_100000360
1001 Ga0081455_10003176
1002 Ga0081455_10005955
1003 Ga0081540_1000102
1004 Ga0081540_1000841
1005 Ga0081540_1003418
1006 Ga0081540_1008125
1007 Ga0081540_1008941
1008 Ga0081540_1009558
1009 Ga0081540_1021006
1010 Ga0081540_1021049
1011 Ga0081540_1035588
1012 Ga0081539_10000008
1013 Ga0081539_10000220
1014 Ga0081539_10055131
1015 Ga0070717_10006207
1016 Ga0070717_10007544
1017 Ga0070717_10021364
1018 Ga0070717_10134682
1019 Ga0075365_10033778
1020 Ga0075365_10038742
1021 Ga0075365_10096957
1022 Ga0075363_100009226
1023 Ga0075364_10023541
1024 Ga0075364_10074428
1025 Ga0070715_10035264
1026 Ga0070712_100022680
1027 Ga0070712_100038780
1028 Ga0070712_100091514
1029 Ga0070712_100173947
1030 Ga0075362_10019648
1031 Ga0075369_10005844
1032 Ga0075369_10032411
1033 Ga0075366_10038702
1034 Ga0097621_100040392
1035 Ga0097621_100094887
1036 Ga0097621_100112416
1037 Ga0075370_10038846
1038 Ga0068871_100001491
1039 Ga0075428_100003814
1040 Ga0075428_100269582
1041 Ga0075430_100002189
1042 Ga0075430_100004241
1043 Ga0075430_100012744
1044 Ga0075430_100044526
1045 Ga0075431_100013553
1046 Ga0075431_100021216
1047 Ga0075431_100119215
1048 Ga0075433_10036313
1049 Ga0075434_100001946
1050 Ga0075434_100083230
1051 Ga0075434_100260056
1052 Ga0075429_100000055
1053 Ga0075429_100003786
1054 Ga0075429_100012545
1055 Ga0097620_100383932
1056 Ga0099824_1011502
1057 Ga0099824_1018474
1058 Ga0075435_100011949
1059 Ga0075435_100119473
1060 Ga0099795_10037437
1061 Ga0105240_10013046
1062 Ga0105240_10021941
1063 Ga0105240_10024721
1064 Ga0105240_10192740
1065 Ga0111539_10000852
1066 Ga0105245_10048961
1067 Ga0105245_10078010
1068 Ga0105245_10081675
1069 Ga0105247_10021886
1070 Ga0105247_10081130
1071 Ga0114129_10001487
1072 Ga0114129_10007257
1073 Ga0114129_10012532
1074 Ga0114129_10021318
1075 Ga0114129_10060555
1076 Ga0105243_10178387
1077 Ga0105241_10029756
1078 Ga0105241_10118948
1079 Ga0105242_10212373
1080 Ga0105248_10027462
1081 Ga0105237_10009950
1082 Ga0105237_10021234
1083 Ga0105237_10031207
1084 Ga0105237_10228750
1085 Ga0105237_10380401
1086 Ga0105238_10014750
1087 Ga0105238_10027647
1088 Ga0105249_10295488
1089 Ga0099796_10046613
1090 Ga0105239_10084742
1091 Ga0105239_10150755
1092 Ga0105246_10013775
1093 Ga0157370_10053036
1094 Ga0157369_10012423
1095 Ga0157374_10019281
1096 Ga0157374_10024785
1097 Ga0157374_10063878
1098 Ga0157374_10129211
1099 Ga0157378_10004961
1100 Ga0157378_10038833
1101 Ga0163162_10060239
1102 Ga0163162_10225195
1103 Ga0163162_10281427
1104 Ga0157375_10128467
1105 Ga0157375_10371170
1106 Ga0163163_10060452
1107 Ga0163163_10135612
1108 Ga0163163_10200834
1109 Ga0163163_10334734
1110 Ga0157379_10136897
1111 Ga0157376_10050368
1112 Ga0157376_10292110
1113 Ga0214542_1001925
1114 Ga0214545_1000003
1115 Ga0214543_1000002
1116 Ga0213872_10040411
1117 Ga0213876_10003579
1118 Ga0213875_10062030
1119 Ga0209563_100325
1120 Ga0209677_102245
1121 Ga0209148_1000812
1122 Ga0209233_1003610
1123 Ga0209233_1008563
1124 Ga0209455_1002923
1125 Ga0209455_1005249
1126 Ga0209455_1005452
1127 Ga0209758_1000011
1128 Ga0209758_1000120
1129 Ga0209758_1001848
1130 Ga0209758_1002848
1131 Ga0209758_1007270
1132 Ga0209758_1018387
1133 Ga0209758_1032806
1134 Ga0207426_1000328
1135 Ga0207426_1000458
1136 Ga0207426_1019068
1137 Ga0209257_1001101
1138 Ga0207692_10000797
1139 Ga0207692_10006627
1140 Ga0207692_10017877
1141 Ga0207710_10008721
1142 Ga0207688_10059711
1143 Ga0207647_10008820
1144 Ga0207685_10002427
1145 Ga0207685_10028315
1146 Ga0207699_10001610
1147 Ga0207699_10004027
1148 Ga0207699_10014207
1149 Ga0207645_10066067
1150 Ga0207645_10081474
1151 Ga0207643_10058265
1152 Ga0207705_10003219
1153 Ga0207684_10003339
1154 Ga0207684_10019497
1155 Ga0207654_10120122
1156 Ga0207707_10000886
1157 Ga0207707_10003317
1158 Ga0207707_10023656
1159 Ga0207707_10027833
1160 Ga0207707_10031075
1161 Ga0207707_10117125
1162 Ga0207707_10141869
1163 Ga0207707_10235770
1164 Ga0207695_10000163
1165 Ga0207671_10056823
1166 Ga0207693_10000506
1167 Ga0207693_10002637
1168 Ga0207693_10007874
1169 Ga0207693_10014584
1170 Ga0207693_10034047
1171 Ga0207693_10062713
1172 Ga0207693_10095504
1173 Ga0207663_10004038
1174 Ga0207663_10006243
1175 Ga0207663_10021217
1176 Ga0207663_10062817
1177 Ga0207663_10065540
1178 Ga0207660_10010388
1179 Ga0207660_10022287
1180 Ga0207657_10008437
1181 Ga0207649_10040161
1182 Ga0207649_10109100
1183 Ga0207652_10016478
1184 Ga0207652_10019601
1185 Ga0207652_10115718
1186 Ga0207652_10148500
1187 Ga0207652_10178835
1188 Ga0207646_10002996
1189 Ga0207646_10003246
1190 Ga0207694_10071234
1191 Ga0207650_10205616
1192 Ga0207687_10021155
1193 Ga0207687_10053608
1194 Ga0207687_10117944
1195 Ga0207700_10000668
1196 Ga0207700_10007466
1197 Ga0207700_10041345
1198 Ga0207700_10083120
1199 Ga0207700_10158000
1200 Ga0207664_10102478
1201 Ga0207690_10172879
1202 Ga0207706_10015391
1203 Ga0207706_10107404
1204 Ga0207686_10040459
1205 Ga0207709_10212003
1206 Ga0207669_10086754
1207 Ga0207669_10107067
1208 Ga0207665_10000528
1209 Ga0207665_10001385
1210 Ga0207691_10186072
1211 Ga0207711_10009654
1212 Ga0207711_10018144
1213 Ga0207689_10036827
1214 Ga0207661_10008452
1215 Ga0207661_10018951
1216 Ga0207661_10083044
1217 Ga0207661_10291186
1218 Ga0207667_10019974
1219 Ga0207667_10027626
1220 Ga0207651_10065505
1221 Ga0207668_10143392
1222 Ga0207668_10186534
1223 Ga0207703_10045836
1224 Ga0207639_10034032
1225 Ga0207678_10022393
1226 Ga0207678_10023935
1227 Ga0207678_10033211
1228 Ga0207678_10034200
1229 Ga0207678_10035164
1230 Ga0207641_10198815
1231 Ga0207648_10184860
1232 Ga0207676_10097698
1233 Ga0207674_10007720
1234 Ga0207674_10078663
1235 Ga0207674_10128182
1236 Ga0207683_10003797
1237 Ga0207683_10009714
1238 Ga0207683_10091282
1239 Ga0207683_10262268
1240 Ga0207698_10060190
1241 Ga0209389_1000043
1242 Ga0209389_1000077
1243 Ga0209589_1000011
1244 Ga0209589_1000047
1245 Ga0209489_100012
1246 Ga0209489_100075
1247 Ga0209489_100251
1248 Ga0209700_100019
1249 Ga0209700_100271
1250 Ga0209179_1001680
1251 Ga0207428_10005470
1252 Ga0268266_10007625
1253 Ga0268266_10234117
1254 Ga0268265_10118725
1255 Ga0268264_10000030
1256 Ga0268264_10163025
1257 Ga0265337_1006171
1258 Ga0265319_1011253
1259 Ga0265318_10024101
1260 Ga0265323_10000434
1261 Ga0265336_10000649
1262 Ga0307517_10000279
1263 Ga0307515_10152056
1264 Ga0265338_10000280
1265 Ga0265324_10010387
1266 Ga0265330_10006697
1267 Ga0265325_10000599
1268 Ga0265329_10042580
1269 Ga0265340_10010905
1270 Ga0265340_10014569
1271 Ga0265340_10025159
1272 Ga0265339_10020885
1273 Ga0265339_10035899
1274 Ga0265339_10107760
1275 Ga0307509_10204543
1276 Ga0307508_10003532
1277 Ga0307508_10140808
1278 Ga0265314_10014967
1279 Ga0265342_10009847
1280 Ga0307516_10097075
1281 Ga0307507_10043063
1282 Ga0307510_10037733
1283 Ga0307510_10073832
1284 Ga0315911_1000003
1285 Ga0373928_0004389
1286 Ga0373936_0003178
1287 Ga0373941_0005728
1288 Ga0373953_0003406
1289 Ga0373954_0068936
1290 Ga0373956_0007041
1291 Ga0373957_0020281
1292 Ga0373960_0014063
1293 Ga0373943_0000795
1294 Ga0373943_0025222
1295 Ga0373943_0037571
1296 Ga0373946_0064791
1297 Ga0373955_0064066
1298 Ga0373942_0003177
1299 Ga0373931_0006081
1300 Ga0373935_0000536
1301 Ga0373935_0017022
1302 Ga0373927_0000898
1303 Ga0373927_0045712
1304 Ga0373933_0001821
1305 Ga0373933_0056140
1306 Ga0373947_0010479
1307 Ga0373937_0054540
1308 Ga0373937_0139955
1309 Ga0373937_0216891
1310 Ga0373925_0001796
1311 Ga0373925_0027047
1312 Ga0373925_0038098
1313 Ga0373925_0138906
1314 Ga0373925_0166865
1315 Ga0373925_0227748
1316 Ga0395899_0060103
1317 Ga0395900_0003092
1318 Ga0395905_0084980
1319 Ga0436364_0356418
1320 Ga0395901_0001902
1321 Ga0395901_0209340
1322 Ga0436365_1236739
1323 Ga0436365_1571642
1324 Ga0436361_0535015
1325 Ga0436361_0632240
1326 Ga0436363_0621011
1327 Ga0436363_0698487
1328 Ga0436362_0652931
1329 Ga0466972_0000079
1330 Ga0466965_0068555
1331 Ga0466963_0007491
1332 Ga0466968_0010560
1333 Ga0466960_0006472
1334 Ga0466959_0033466
1335 Ga0466959_0052521
1336 Ga0466959_0154985
1337 Ga0466967_0249181
1338 Ga0466967_0295043
1339 Ga0495592_0008855
1340 Ga0495592_0011606
1341 Ga0495592_0029907
1342 Ga0495603_0000046
1343 Ga0495603_0086322
1344 Ga0495629_0000071
1345 Ga0495629_0009871
1346 Ga0495629_0163739
1347 Ga0495638_0020090
1348 Ga0495641_0009896
1349 Ga0495641_0011415
1350 Ga0495653_0032304
1351 Ga0495580_0000057
1352 Ga0495580_0043983
1353 Ga0495582_0000111
1354 Ga0495605_0056668
1355 Ga0495639_0000108
1356 Ga0495639_0015341
1357 Ga0495662_0000992
1358 Ga0495662_0020305
1359 Ga0495664_0002718
1360 Ga0495664_0007884
1361 Ga0495664_0030650
1362 Ga0495664_0063064
1363 Ga0495594_0000133
1364 Ga0495583_0055522
1365 Ga0495606_0003362
1366 Ga0495606_0006998
1367 Ga0495606_0080559
1368 Ga0495606_0138832
1369 Ga0495628_0012530
1370 Ga0495628_0042625
1371 Ga0495630_0000959
1372 Ga0495637_0048728
1373 Ga0495643_0005954
1374 Ga0495648_0046019
1375 Ga0495666_0005822
1376 Ga0495666_0032607
1377 Ga0495652_0042099
1378 Ga0495652_0097969
1379 Ga0495652_0168431
1380 Ga0495665_0000001
1381 Ga0495665_0057438
1382 Ga0495640_0012179
1383 Ga0495640_0023983
1384 Ga0495640_0028223
1385 Ga0495640_0143197
1386 Ga0495586_0056589
1387 Ga0495587_0044824
1388 Ga0495597_0031638
1389 Ga0495645_0007155
1390 Ga0495645_0009374
1391 Ga0495622_0001363
1392 Ga0495633_0041177
1393 Ga0495667_0006892
1394 Ga0495667_0016295
1395 Ga0495667_0032071
1396 Ga0495668_0066567
1397 Ga0495634_0000046
1398 Ga0495634_0076372
1399 Ga0495625_0164898
1400 Ga0495635_0000338
1401 Ga0495635_0019273
1402 Ga0495635_0051638
1403 Ga0495588_0001464
1404 Ga0495657_0054792
1405 Ga0495599_0007149
1406 Ga0495599_0124670
1407 Ga0495623_0045020
1408 Ga0495646_0007433
1409 Ga0495646_0008580
1410 Ga0495647_0000754
1411 Ga0495658_0000994
1412 Ga0495658_0005502
1413 Ga0495613_0005517
1414 Ga0495613_0025092
1415 Ga0495624_0003652
1416 Ga0495624_0050265
1417 Ga0495670_0004308
1418 Ga0495649_0038307
1419 Ga0495649_0059545
1420 Ga0495600_0005381
1421 Ga0495581_0000012
1422 Ga0495581_0018927
1423 Ga0495581_0019391
1424 Ga0495604_0004988
1425 Ga0495604_0009096
1426 Ga0495604_0082749
1427 Ga0495674_0000031
1428 Ga0495674_0042923
1429 Ga0495674_0167781
1430 Ga0495680_0024280
1431 Ga0495687_014302
1432 Ga0495673_0036405
1433 Ga0495684_0010711
1434 Ga0495684_0028321
1435 Ga0495684_0087681
1436 Ga0495684_0106060
1437 Ga0495686_0057595
1438 Ga0495593_0000008
1439 Ga0495593_0089256
1440 Ga0495602_0011752
1441 Ga0496100_0024358
1442 Ga0496100_0048201
1443 Ga0496100_0057600
1444 Ga0496101_0006365
1445 Ga0496101_0143379
1446 Ga0496101_0175899
1447 Ga0496102_0003595
1448 Ga0496102_0047832
1449 Ga0496102_0135445
1450 Ga0496102_0155765
1451 Ga0496102_0405944
1452 Ga0496103_0013766
1453 Ga0496103_0056345
1454 Ga0496104_0047727
1455 Ga0496104_0091600
1456 Ga0496104_0105275
1457 Ga0496104_0156936
1458 Ga0496104_0191109
1459 Ga0496104_0209150
1460 Ga0496105_0019331
1461 Ga0496105_0047299
1462 Ga0496105_0051555
1463 Ga0496106_0048244
1464 Ga0496106_0223856
1465 Ga0496107_0000947
1466 Ga0496107_0059812
1467 Ga0496107_0116062
1468 Ga0496108_0009810
1469 Ga0496108_0013705
1470 Ga0496109_0008951
1471 Ga0496109_0009381
1472 Ga0496109_0031864
1473 Ga0496109_0048452
1474 Ga0496110_0013781
1475 Ga0496110_0033318
1476 Ga0496110_0126144
1477 Ga0496111_0029039
1478 Ga0496112_0000008
1479 Ga0496112_0029131
1480 Ga0496112_0030083
1481 Ga0496112_0034956
1482 Ga0496112_0065820
1483 Ga0496112_0165206
1484 Ga0496113_0001327
1485 Ga0496113_0038477
1486 Ga0496113_0067913
1487 Ga0496113_0139736
1488 Ga0496113_0152713
1489 Ga0496114_0009690
1490 Ga0496114_0024353
1491 Ga0496115_0000604
1492 Ga0496115_0011581
1493 Ga0496115_0071313
1494 Ga0496115_0119789
1495 Ga0496115_0176244
1496 Ga0496115_0242729
1497 Ga0496115_0247343
1498 Ga0496117_0010071
1499 Ga0496117_0064449
1500 Ga0496118_0008611
1501 Ga0496118_0009891
1502 Ga0496118_0116503
1503 Ga0496119_0006875
1504 Ga0496119_0072328
1505 Ga0496120_0005140
1506 Ga0496121_0002635
1507 Ga0496121_0014245
1508 Ga0496121_0020183
1509 Ga0496121_0048593
1510 Ga0496121_0152966
1511 Ga0496124_0011581
1512 Ga0496124_0190514
1513 Ga0496125_0000048
1514 Ga0496125_0000746
1515 Ga0496125_0071057
1516 Ga0496126_0008677
1517 Ga0496126_0009242
1518 Ga0496126_0022113
1519 Ga0496126_0045158
1520 Ga0496126_0065897
1521 Ga0496126_0073717
1522 Ga0496126_0127252
1523 Ga0496126_0239357
1524 Ga0496126_0247949
1525 Ga0495682_0018342
1526 Ga0501032_0022551
1527 Ga0501034_0165443
1528 Ga0501036_0005911
1529 Ga0501037_0065576
1530 Ga0501038_0020172
1531 Ga0501039_0009067
1532 Ga0501046_0008999
1533 Ga0501048_0013379
1534 Ga0501069_0001752
1535 Ga0501070_0051123
1536 Ga0501070_0119773
1537 Ga0501071_0046675
1538 Ga0501074_0002882
1539 Ga0501076_0010510
1540 Ga0501076_0051612
1541 Ga0501076_0090535
1542 Ga0501079_0080288
1543 Ga0501083_0003764
1544 Ga0501044_0001655
1545 Ga0501044_0049412
1546 Ga0501044_0061643
1547 nmdc:mga03683_32601_c1
1548 nmdc:mga0yw44_134932_c1
1549 nmdc:mga0k408_22090_c2
1550 nmdc:mga0k408_25121_c1
1551 nmdc:mga06z11_108051_c1
1552 nmdc:mga04h51_25898_c1
1553 nmdc:mga07m45_63476_c1
1554 nmdc:mga05p37_213_c1
1555 nmdc:mga05p37_24611_c1
1556 nmdc:mga05p37_49620_c1
1557 nmdc:mga05p37_54085_c1
1558 nmdc:mga09592_1171_c1
1559 nmdc:mga09592_1606_c1
1560 nmdc:mga0qj67_129_c1
1561 nmdc:mga0qj67_31281_c1
1562 nmdc:mga0qj67_885_c1
1563 nmdc:mga06r32_1219_c1
1564 nmdc:mga06r32_253962_c1
1565 nmdc:mga06r32_6151_c1
1566 nmdc:mga08y16_275_c1
1567 nmdc:mga0n895_179945_c1
1568 nmdc:mga0n895_72723_c1
1569 nmdc:mga0rr50_12121_c1
1570 nmdc:mga0rr50_169464_c1
1571 nmdc:mga0a205_5452_c1
1572 nmdc:mga0sz30_34204_c1
1573 nmdc:mga0sz30_50717_c1
1574 Ga0495601_0067367
1575 Ga0495595_0027742
1576 Ga0495595_0033994
1577 Ga0495619_0011258
1578 Ga0495619_0017972
1579 Ga0495619_0058742
1580 Ga0495619_0062539
1581 Ga0500578_0051297
1582 Ga0500578_0110590
1583 Ga0500643_002271
1584 Ga0500644_0000771
1585 Ga0500583_0052684
1586 Ga0500651_0031020
1587 Ga0500651_0090684
1588 Ga0500566_0000011
1589 Ga0500566_0000293
1590 Ga0500566_0000412
1591 Ga0500566_0135551
1592 Ga0500640_001527
1593 Ga0500554_020862
1594 Ga0500555_001186
1595 Ga0500557_000062
1596 Ga0500572_000065
1597 Ga0500572_001006
1598 Ga0500595_000003
1599 Ga0500595_000395
1600 Ga0500595_003500
1601 Ga0500607_022647
1602 Ga0500614_017278
1603 Ga0500642_0000127
1604 Ga0500652_005161
1605 Ga0500559_0001342
1606 Ga0500559_0001798
1607 Ga0500603_000269
1608 Ga0500616_0000002
1609 Ga0500616_0002075
1610 Ga0500616_0029688
1611 Ga0500630_000832
1612 Ga0500638_000370
1613 Ga0500639_000079
1614 Ga0500639_004522
1615 Ga0500636_0000041
1616 Ga0500636_0037290
1617 Ga0500637_0000026
1618 Ga0500637_0053059
1619 Ga0500637_0085364
1620 Ga0500625_015998
1621 Ga0500645_000226
1622 Ga0500609_002277
1623 Ga0500596_000987
1624 Ga0500596_004947
1625 Ga0500599_002636
1626 Ga0500601_005302
1627 Ga0501084_0032968
1628 Ga0500661_001127
1629 Ga0501082_0002831
1630 Ga0530510_0090886
1631 Ga0530510_0161046
1632 2885315494
1633 2507507463
1634 2508541577
1635 2508692880
1636 2509140462
1637 2509152283
1638 2511398979
1639 2513621669
1640 2513636902
1641 2513657139
1642 2513721517
1643 2513857027
1644 2513878358
1645 2513892563
1646 2513919147
1647 2514011715
1648 2515626270
1649 2517891159
1650 2524436080
1651 2528852873
1652 2597813935
1653 2617352718
1654 2671123239
1655 2723843502
1656 2728755524
1657 2745080024
1658 2793061081
1659 2793066502
1660 2793083970
1661 2805920581
1662 2818236767
1663 2824605660
1664 2824611778
1665 2824655014
1666 2824664031
1667 2824675199
1668 2824681575
1669 2824690053
1670 2824701150
1671 2824711111
1672 2824735657
1673 2824760454
1674 2824766557
1675 2824776677
1676 2838127373
1677 2841740203
1678 2841946392
1679 2841957111
1680 2841965633
1681 2841972902
1682 2841978426
1683 2841987472
1684 2842040855
1685 2842046200
1686 2844320212
1687 2844534782
1688 2847937534
1689 2847947962
1690 2849078190
1691 2856344111
1692 2857511351
1693 2871480009
1694 2874598579
1695 2874616764
1696 2874628286
1697 2874630117
1698 2874652032
1699 2876768291
1700 2876778617
1701 2876823422
1702 2879082410
1703 2879084947
1704 2879107930
1705 2879131809
1706 2879150145
1707 2881370114
1708 2881670114
1709 2885370179
1710 2885414370
1711 2888347628
1712 2888385690
1713 2888392577
1714 2888425813
1715 2903731198
1716 2903752222
1717 2904674095
1718 2904698941
1719 2904711745
1720 2906610035
1721 2906616339
1722 2906629224
1723 2906651217
1724 2906662878
1725 2908781388
1726 2922361758
1727 2922386997
1728 2922396860
1729 2922431663
1730 2924760248
1731 2929621250
1732 2929625919
1733 2932785196
1734 2932808765
1735 2932810230
1736 2932821802
1737 2932829032
1738 2933582881
1739 2935610033
1740 2935619548
1741 2935635787
1742 2935638528
1743 2935656357
1744 2935660087
1745 2935666620
1746 2935682190
1747 2935691154
1748 2935694421
1749 2935703534
1750 2935718535
1751 2935727485
1752 2935736188
1753 2935745568
1754 2935755949
1755 2935760789
1756 2935776444
1757 2935780837
1758 2935792331
1759 2935800494
1760 2935801671
1761 2935814919
1762 2935823193
1763 2935828022
1764 2935842228
1765 2935848775
1766 2935858136
1767 2935868041
1768 2935873936
1769 2935885695
1770 2935909423
1771 2935917145
1772 2935926904
1773 2935937252
1774 2935944445
1775 2935952882
1776 2935962905
1777 2935969722
1778 2935976333
1779 2935991826
1780 2935993140
1781 2936003077
1782 2936014503
1783 2936027830
1784 2936031300
1785 2936040438
1786 2936049609
1787 2936061175
1788 2937837668
1789 2940562076
1790 2941512376
1791 2941520119
1792 2941528268
1793 2941531402
1794 2941542276
1795 2958077696
1796 2970530301
1797 2970542806
1798 3003670217
1799 3005481462
1800 3005488442
1801 3005508231
1802 3005588267
1803 3005600525
1804 3005715999
1805 8004401455
1806 8004637161
1807 8006978913
1808 8016520429
1809 8016528501
1810 8016533660
1811 8016546882
1812 8016555237
1813 8016576195
1814 8016594597
1815 8016601334
1816 8016609096
1817 8016615808
1818 8017065146
1819 8019533440
1820 8019552473
1821 8019565116
1822 8019575218
1823 8019584536
1824 8019592309
1825 8019598978
1826 8019609399
1827 8019620022
1828 8019633082
1829 8019649593
1830 8019660964
1831 8019670524
1832 8019685708
1833 8019691285
1834 8055621701
1835 8055744889
1836 8056690619

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09242

FCSD-flav_bind

Flavocytochrome c sulphide dehydrogenase, flavin-binding

346

415

0.98

PF21706

FCSD_central

Sulfide dehydrogenase [flavocytochrome c] flavoprotein chain, central

156

271

0.97

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

27

154

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n1t-assembly1.cif.gz_A crystal structure of complex between flavocytochrome c and copper chaperone copc from t. paradoxus 0.9615 34 420
1fcd-assembly2.cif.gz_B the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution 0.9552 33 420
3vrd-assembly1.cif.gz_B crystal structure of flavocytochrome c from thermochromatium tepidum 0.9534 35 420
5n1t-assembly1.cif.gz_A crystal structure of complex between flavocytochrome c and copper chaperone copc from t. paradoxus 0.9472 34 420
3vrd-assembly1.cif.gz_B crystal structure of flavocytochrome c from thermochromatium tepidum 0.9231 35 420
ID Description Score Start End Superfamily
af_Q10062_1_488_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9615 36 67 3.50.50.60
af_P40012_11_539_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9598 35 68 3.50.50.60
5n1tA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9517 149 282 3.50.50.60
5n1tA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9448 149 282 3.50.50.60
5n1tA03 Alpha Beta;Alpha-Beta Complex;Flavocytochrome C Sulfide Dehydrogenase; Chain A Domain 3;Flavocytochrome c sulphide dehydrogenase, flavin-binding domain 0.9408 350 420 3.90.760.10
ID Description Score Start End GO Terms
AF-A0A7C1WBB1-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9632 36 375 GO:0016491
GO:0050660
AF-A0A3M0YCT5-F1-model_v4 Cytochrome C 0.9623 33 420 GO:0016491
GO:0050660
AF-A0A5C7T8X0-F1-model_v4 Cytochrome C 0.9611 85 420 GO:0016491
GO:0050660
AF-A0A537TJZ6-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.96 26 231 GO:0016491
AF-A0A661C3F5-F1-model_v4 Cytochrome C 0.9578 40 420 GO:0016491
GO:0050660

Map