F485688

General Info

Members Datasets Scaffolds Average Seq Length
919 350 1838 141

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100022034|Ga0068869_1000220346
Length 169
Sequence MPRKTKTFSGSDSVETSRGKSGPAYWLFKTEPEEHSWEMQKERGAKGEPWTGVRNFVARNNMKAMQLGDLGFFYHTGEEKRVVGVVEVCALAHPDPTDSTGVWKCVDVRAVCDMPSPVTLADAKANPRLANMALVKTARLSVQPVTPEEWKEVCRMGGLSETDLAAKSR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
220 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
255 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
297 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
335 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
336 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
337 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
338 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
339 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
340 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
341 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
344 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
345 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
346 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
347 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
348 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 0
Rhizoplane 3.05
Rhizosphere 92.38
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100022034 3300005334 Bacteria 4386
2 rootH2_10003615 3300003320 Bacteria 47811
3 rootH1_10086183 3300003323 Bacteria 4922
4 Ga0065715_10013462 3300005293 Bacteria 3455
5 Ga0070658_10485055 3300005327 Bacteria 1067
6 Ga0070676_10054296 3300005328 Bacteria 2362
7 Ga0070683_100066738 3300005329 Bacteria 3351
8 Ga0070683_100174094 3300005329 Bacteria 2043
9 Ga0070690_100098017 3300005330 Bacteria 1940
10 Ga0070670_100328713 3300005331 Bacteria 1340
11 Ga0070670_100816579 3300005331 Unclassified 843
12 Ga0070677_10081362 3300005333 Bacteria 1386
13 Ga0070677_10466887 3300005333 Bacteria 678
14 Ga0068869_100007911 3300005334 Bacteria 6827
15 Ga0070666_10012507 3300005335 Bacteria 5357
16 Ga0070666_10054557 3300005335 Bacteria 2696
17 Ga0070666_10059713 3300005335 Bacteria 2580
18 Ga0070680_100001296 3300005336 Bacteria 18096
19 Ga0070680_100032951 3300005336 Bacteria 4172
20 Ga0070680_100052097 3300005336 Bacteria 3341
21 Ga0070680_100191007 3300005336 Bacteria 1725
22 Ga0070680_100255639 3300005336 Bacteria 1482
23 Ga0070680_100501288 3300005336 Bacteria 1039
24 Ga0070680_101424195 3300005336 Bacteria 600
25 Ga0070682_100694785 3300005337 Bacteria 815
26 Ga0068868_100115734 3300005338 Bacteria 2183
27 Ga0068868_100192988 3300005338 Bacteria 1694
28 Ga0068868_100661447 3300005338 Bacteria 931
29 Ga0068868_101127523 3300005338 Bacteria 723
30 Ga0070660_100001022 3300005339 Bacteria 18783
31 Ga0070660_100112340 3300005339 Bacteria 2169
32 Ga0070660_100290881 3300005339 Bacteria 1338
33 Ga0070689_100065867 3300005340 Bacteria 2822
34 Ga0070689_100635132 3300005340 Bacteria 927
35 Ga0070691_10002229 3300005341 Bacteria 8566
36 Ga0070691_10044283 3300005341 Bacteria 2110
37 Ga0070687_100849807 3300005343 Bacteria 650
38 Ga0070687_101281319 3300005343 Bacteria 543
39 Ga0070661_100000165 3300005344 Bacteria 54127
40 Ga0070661_100034735 3300005344 Bacteria 3658
41 Ga0070661_100131627 3300005344 Bacteria 1879
42 Ga0070661_100619896 3300005344 Bacteria 876
43 Ga0070661_100740898 3300005344 Bacteria 803
44 Ga0070692_10435158 3300005345 Bacteria 836
45 Ga0070669_100101408 3300005353 Bacteria 2172
46 Ga0070669_100129491 3300005353 Bacteria 1934
47 Ga0070675_100023390 3300005354 Bacteria 4941
48 Ga0070675_100136133 3300005354 Bacteria 2096
49 Ga0070675_100344275 3300005354 Bacteria 1321
50 Ga0070671_100182861 3300005355 Bacteria 1775
51 Ga0070671_101519245 3300005355 Bacteria 593
52 Ga0070674_100084604 3300005356 Bacteria 2275
53 Ga0070674_100087670 3300005356 Bacteria 2238
54 Ga0070674_100114579 3300005356 Bacteria 1985
55 Ga0070674_100201583 3300005356 Bacteria 1537
56 Ga0070673_100019561 3300005364 Bacteria 4863
57 Ga0070673_100105365 3300005364 Bacteria 2329
58 Ga0070673_100370472 3300005364 Bacteria 1275
59 Ga0070673_101184424 3300005364 Bacteria 715
60 Ga0070673_102269622 3300005364 Bacteria 516
61 Ga0070688_100292161 3300005365 Bacteria 1175
62 Ga0070688_100530041 3300005365 Unclassified 892
63 Ga0070659_100062634 3300005366 Bacteria 2940
64 Ga0070659_100970347 3300005366 Bacteria 745
65 Ga0070659_101107463 3300005366 Bacteria 698
66 Ga0070667_100114912 3300005367 Bacteria 2337
67 Ga0070667_100267394 3300005367 Bacteria 1532
68 Ga0070667_100647373 3300005367 Bacteria 976
69 Ga0070703_10022299 3300005406 Bacteria 1858
70 Ga0070709_11567477 3300005434 Bacteria 536
71 Ga0070714_100197705 3300005435 Bacteria 1838
72 Ga0070714_100312480 3300005435 Bacteria 1468
73 Ga0070713_100059694 3300005436 Bacteria 3186
74 Ga0070713_100289434 3300005436 Bacteria 1505
75 Ga0070713_100696024 3300005436 Bacteria 970
76 Ga0070713_100916827 3300005436 Bacteria 843
77 Ga0070701_10156247 3300005438 Bacteria 1318
78 Ga0070711_100426532 3300005439 Bacteria 1081
79 Ga0070705_100000594 3300005440 Bacteria 21004
80 Ga0070700_100001488 3300005441 Bacteria 11671
81 Ga0070694_100016877 3300005444 Bacteria 4603
82 Ga0070708_100003124 3300005445 Bacteria 12898
83 Ga0070708_100184018 3300005445 Bacteria 1953
84 Ga0070708_100339566 3300005445 Bacteria 1416
85 Ga0070708_100612013 3300005445 Unclassified 1027
86 Ga0070663_100020033 3300005455 Bacteria 4421
87 Ga0070663_100216909 3300005455 Bacteria 1501
88 Ga0070678_100012205 3300005456 Bacteria 5330
89 Ga0070678_100198397 3300005456 Bacteria 1655
90 Ga0070678_100476592 3300005456 Bacteria 1097
91 Ga0070678_101231309 3300005456 Bacteria 695
92 Ga0070662_100092995 3300005457 Bacteria 2268
93 Ga0070681_10000003 3300005458 Bacteria 252785
94 Ga0070681_10028766 3300005458 Bacteria 5586
95 Ga0070681_10076253 3300005458 Bacteria 3312
96 Ga0070681_10126394 3300005458 Bacteria 2489
97 Ga0070681_11490583 3300005458 Bacteria 601
98 Ga0068867_100014115 3300005459 Bacteria 5660
99 Ga0068867_100087383 3300005459 Bacteria 2360
100 Ga0068867_100095047 3300005459 Bacteria 2267
101 Ga0070685_10875820 3300005466 Bacteria 667
102 Ga0070706_100189758 3300005467 Bacteria 1920
103 Ga0070707_100067177 3300005468 Bacteria 3448
104 Ga0070698_100092500 3300005471 Bacteria 3005
105 Ga0070698_100225911 3300005471 Bacteria 1805
106 Ga0070699_100120054 3300005518 Bacteria 2311
107 Ga0070699_100365374 3300005518 Bacteria 1301
108 Ga0070699_100641472 3300005518 Bacteria 969
109 Ga0070679_100000756 3300005530 Bacteria 27999
110 Ga0070679_100050682 3300005530 Bacteria 4135
111 Ga0070679_100076318 3300005530 Bacteria 3341
112 Ga0070679_100081002 3300005530 Bacteria 3236
113 Ga0070679_100141922 3300005530 Bacteria 2381
114 Ga0070679_100143342 3300005530 Bacteria 2368
115 Ga0070679_100463913 3300005530 Unclassified 1211
116 Ga0070679_101219228 3300005530 Unclassified 698
117 Ga0070679_101280620 3300005530 Bacteria 679
118 Ga0070684_100124749 3300005535 Bacteria 2319
119 Ga0070684_100619242 3300005535 Bacteria 1007
120 Ga0070684_100711268 3300005535 Bacteria 937
121 Ga0070697_100073546 3300005536 Bacteria 2807
122 Ga0070697_100108355 3300005536 Bacteria 2312
123 Ga0068853_100006714 3300005539 Bacteria 9168
124 Ga0068853_100062368 3300005539 Bacteria 3226
125 Ga0068853_100114216 3300005539 Bacteria 2402
126 Ga0068853_100377313 3300005539 Bacteria 1324
127 Ga0068853_100492415 3300005539 Bacteria 1157
128 Ga0068853_100545233 3300005539 Bacteria 1098
129 Ga0068853_101299859 3300005539 Unclassified 703
130 Ga0070672_100016318 3300005543 Bacteria 5315
131 Ga0070672_100958815 3300005543 Bacteria 757
132 Ga0070695_100002480 3300005545 Bacteria 10620
133 Ga0070696_100000216 3300005546 Bacteria 34636
134 Ga0070693_100100257 3300005547 Bacteria 1763
135 Ga0070693_100770422 3300005547 Bacteria 711
136 Ga0070665_100002717 3300005548 Bacteria 19178
137 Ga0070665_100022762 3300005548 Bacteria 6308
138 Ga0070665_100185572 3300005548 Bacteria 2080
139 Ga0070665_100301417 3300005548 Bacteria 1605
140 Ga0070665_100515959 3300005548 Bacteria 1207
141 Ga0070704_100001646 3300005549 Bacteria 12117
142 Ga0068855_100000006 3300005563 Bacteria 298092
143 Ga0068855_100004642 3300005563 Bacteria 16763
144 Ga0068855_100076667 3300005563 Bacteria 3879
145 Ga0068855_100093176 3300005563 Bacteria 3474
146 Ga0068855_100286597 3300005563 Bacteria 1827
147 Ga0068855_100366855 3300005563 Bacteria 1583
148 Ga0068855_100692223 3300005563 Bacteria 1091
149 Ga0068855_100753470 3300005563 Bacteria 1038
150 Ga0068855_102009133 3300005563 Unclassified 584
151 Ga0070664_100166897 3300005564 Bacteria 1951
152 Ga0070664_100530078 3300005564 Bacteria 1088
153 Ga0068857_100015358 3300005577 Bacteria 6686
154 Ga0068857_100078796 3300005577 Bacteria 2941
155 Ga0068857_100185385 3300005577 Bacteria 1894
156 Ga0068857_100282852 3300005577 Bacteria 1526
157 Ga0068857_100314631 3300005577 Bacteria 1445
158 Ga0068857_100380164 3300005577 Bacteria 1311
159 Ga0068857_100438525 3300005577 Bacteria 1220
160 Ga0068857_101053505 3300005577 Bacteria 784
161 Ga0068854_100692409 3300005578 Bacteria 879
162 Ga0068856_100026166 3300005614 Bacteria 5689
163 Ga0068856_100161515 3300005614 Bacteria 2251
164 Ga0068856_100172249 3300005614 Bacteria 2177
165 Ga0068856_100418150 3300005614 Bacteria 1361
166 Ga0070702_100032649 3300005615 Bacteria 2857
167 Ga0068852_100072660 3300005616 Bacteria 3024
168 Ga0068852_100075037 3300005616 Bacteria 2981
169 Ga0068852_100132382 3300005616 Bacteria 2298
170 Ga0068852_100303293 3300005616 Bacteria 1546
171 Ga0068859_100025836 3300005617 Bacteria 5892
172 Ga0068859_100101276 3300005617 Bacteria 2937
173 Ga0068859_100899509 3300005617 Bacteria 970
174 Ga0068864_100036513 3300005618 Bacteria 4189
175 Ga0068864_100199211 3300005618 Bacteria 1838
176 Ga0068864_100481978 3300005618 Unclassified 1191
177 Ga0068864_100864724 3300005618 Bacteria 891
178 Ga0068866_10019794 3300005718 Bacteria 3072
179 Ga0068866_10095399 3300005718 Bacteria 1629
180 Ga0068866_10129210 3300005718 Bacteria 1434
181 Ga0068861_100758975 3300005719 Bacteria 907
182 Ga0068861_102336781 3300005719 Bacteria 537
183 Ga0068870_11078072 3300005840 Bacteria 577
184 Ga0068863_100017820 3300005841 Bacteria 6797
185 Ga0068863_100685858 3300005841 Bacteria 1018
186 Ga0068863_100899101 3300005841 Bacteria 886
187 Ga0068858_100324204 3300005842 Bacteria 1472
188 Ga0068858_100655988 3300005842 Bacteria 1020
189 Ga0068858_100757036 3300005842 Bacteria 947
190 Ga0068858_100846763 3300005842 Bacteria 893
191 Ga0068860_100003742 3300005843 Bacteria 15653
192 Ga0068860_100072608 3300005843 Bacteria 3270
193 Ga0068860_101001374 3300005843 Bacteria 854
194 Ga0068860_101005294 3300005843 Unclassified 852
195 Ga0068862_102290653 3300005844 Bacteria 552
196 Ga0081455_10477553 3300005937 Bacteria 844
197 Ga0081540_1030413 3300005983 Bacteria 2991
198 Ga0081539_10035135 3300005985 Bacteria 3018
199 Ga0070717_10082530 3300006028 Bacteria 2701
200 Ga0070717_10114133 3300006028 Bacteria 2307
201 Ga0075364_10515020 3300006051 Bacteria 818
202 Ga0070715_10054399 3300006163 Bacteria 1733
203 Ga0070712_100147389 3300006175 Bacteria 1803
204 Ga0070712_100883946 3300006175 Bacteria 770
205 Ga0070712_100908690 3300006175 Bacteria 759
206 Ga0097621_100002395 3300006237 Bacteria 12851
207 Ga0097621_100009652 3300006237 Bacteria 7016
208 Ga0097621_100027693 3300006237 Bacteria 4459
209 Ga0097621_100081479 3300006237 Bacteria 2693
210 Ga0097621_100113447 3300006237 Unclassified 2292
211 Ga0097621_100592055 3300006237 Bacteria 1013
212 Ga0097621_101087986 3300006237 Bacteria 750
213 Ga0068871_100002867 3300006358 Bacteria 11816
214 Ga0068871_100024326 3300006358 Bacteria 4695
215 Ga0068871_100025966 3300006358 Bacteria 4564
216 Ga0068871_100055975 3300006358 Bacteria 3204
217 Ga0068871_100111526 3300006358 Bacteria 2301
218 Ga0068871_100115069 3300006358 Bacteria 2267
219 Ga0068871_101143501 3300006358 Bacteria 729
220 Ga0075428_100056440 3300006844 Bacteria 4302
221 Ga0075430_100000509 3300006846 Bacteria 29219
222 Ga0075430_100023775 3300006846 Bacteria 5218
223 Ga0075431_100023178 3300006847 Bacteria 6348
224 Ga0075433_10944150 3300006852 Bacteria 752
225 Ga0075433_11354987 3300006852 Bacteria 616
226 Ga0075434_100413580 3300006871 Bacteria 1370
227 Ga0075434_100508385 3300006871 Bacteria 1225
228 Ga0068865_100013600 3300006881 Bacteria 5149
229 Ga0068865_101112535 3300006881 Bacteria 696
230 Ga0075436_100291622 3300006914 Bacteria 1168
231 Ga0097620_100025835 3300006931 Bacteria 5892
232 Ga0097620_100101273 3300006931 Bacteria 2937
233 Ga0097620_100899479 3300006931 Bacteria 970
234 Ga0075435_100285344 3300007076 Bacteria 1410
235 Ga0105240_10000357 3300009093 Bacteria 85936
236 Ga0105240_10016205 3300009093 Bacteria 10101
237 Ga0105240_10088510 3300009093 Bacteria 3788
238 Ga0105240_10103311 3300009093 Bacteria 3463
239 Ga0105240_10117267 3300009093 Bacteria 3210
240 Ga0105240_10291751 3300009093 Bacteria 1869
241 Ga0105240_10338697 3300009093 Bacteria 1709
242 Ga0105240_10503387 3300009093 Bacteria 1346
243 Ga0105240_10694431 3300009093 Bacteria 1111
244 Ga0105240_10720875 3300009093 Bacteria 1087
245 Ga0105240_10789891 3300009093 Bacteria 1029
246 Ga0105240_10917951 3300009093 Bacteria 941
247 Ga0105240_11358490 3300009093 Bacteria 748
248 Ga0105240_11702806 3300009093 Bacteria 658
249 Ga0105245_10003180 3300009098 Bacteria 14678
250 Ga0105245_10044614 3300009098 Bacteria 3958
251 Ga0105245_10149813 3300009098 Bacteria 2205
252 Ga0105245_10210118 3300009098 Bacteria 1873
253 Ga0105247_10053097 3300009101 Bacteria 2499
254 Ga0105247_10059924 3300009101 Bacteria 2358
255 Ga0105247_10407980 3300009101 Bacteria 970
256 Ga0105247_10453941 3300009101 Bacteria 925
257 Ga0114129_10225577 3300009147 Bacteria 2525
258 Ga0114129_10330447 3300009147 Bacteria 2024
259 Ga0105243_10001197 3300009148 Bacteria 23346
260 Ga0105243_10368041 3300009148 Bacteria 1325
261 Ga0105243_10524480 3300009148 Bacteria 1127
262 Ga0105241_10076378 3300009174 Bacteria 2612
263 Ga0105241_10080356 3300009174 Bacteria 2551
264 Ga0105241_10140264 3300009174 Bacteria 1967
265 Ga0105241_10323329 3300009174 Bacteria 1331
266 Ga0105241_10394210 3300009174 Bacteria 1213
267 Ga0105242_10007711 3300009176 Bacteria 8282
268 Ga0105242_10061809 3300009176 Bacteria 3081
269 Ga0105242_10164754 3300009176 Bacteria 1944
270 Ga0105242_10605430 3300009176 Bacteria 1059
271 Ga0105242_11888230 3300009176 Bacteria 637
272 Ga0105242_12336331 3300009176 Bacteria 581
273 Ga0105248_10000001 3300009177 Bacteria 1881304
274 Ga0105248_10042026 3300009177 Bacteria 5126
275 Ga0105248_11135654 3300009177 Bacteria 883
276 Ga0105248_11659855 3300009177 Bacteria 724
277 Ga0105237_10032985 3300009545 Bacteria 5244
278 Ga0105237_10039524 3300009545 Bacteria 4762
279 Ga0105237_10152857 3300009545 Unclassified 2304
280 Ga0105237_10269493 3300009545 Bacteria 1706
281 Ga0105237_10623240 3300009545 Bacteria 1086
282 Ga0105237_10748996 3300009545 Bacteria 983
283 Ga0105237_10851684 3300009545 Bacteria 918
284 Ga0105237_11423354 3300009545 Bacteria 700
285 Ga0105238_10003553 3300009551 Bacteria 15544
286 Ga0105238_10033198 3300009551 Bacteria 5253
287 Ga0105238_10053777 3300009551 Bacteria 4046
288 Ga0105238_10065161 3300009551 Bacteria 3644
289 Ga0105238_10086512 3300009551 Bacteria 3122
290 Ga0105238_10427453 3300009551 Bacteria 1320
291 Ga0105238_10474101 3300009551 Bacteria 1250
292 Ga0105238_10500881 3300009551 Bacteria 1215
293 Ga0105238_10552613 3300009551 Bacteria 1156
294 Ga0105238_10818503 3300009551 Bacteria 947
295 Ga0105238_10836130 3300009551 Unclassified 937
296 Ga0105238_10967405 3300009551 Bacteria 871
297 Ga0105238_11204778 3300009551 Bacteria 782
298 Ga0105238_11272880 3300009551 Bacteria 761
299 Ga0105238_11516223 3300009551 Bacteria 699
300 Ga0105238_12206223 3300009551 Bacteria 585
301 Ga0105238_12316927 3300009551 Bacteria 572
302 Ga0105249_10003967 3300009553 Bacteria 12769
303 Ga0105249_10092579 3300009553 Bacteria 2830
304 Ga0105249_10691902 3300009553 Bacteria 1079
305 Ga0105249_11790004 3300009553 Bacteria 687
306 Ga0105249_13134002 3300009553 Bacteria 531
307 Ga0105239_10003772 3300010375 Bacteria 18440
308 Ga0105239_10007112 3300010375 Bacteria 12877
309 Ga0105239_10014498 3300010375 Bacteria 8744
310 Ga0105239_10072562 3300010375 Bacteria 3784
311 Ga0105239_10131570 3300010375 Bacteria 2783
312 Ga0105239_10168720 3300010375 Bacteria 2447
313 Ga0105239_10346538 3300010375 Bacteria 1677
314 Ga0105239_10356377 3300010375 Bacteria 1652
315 Ga0105239_10665509 3300010375 Bacteria 1189
316 Ga0105239_11620324 3300010375 Bacteria 749
317 Ga0105239_12259738 3300010375 Bacteria 633
318 Ga0105239_12519122 3300010375 Bacteria 600
319 Ga0105246_10048332 3300011119 Bacteria 2908
320 Ga0105246_10089227 3300011119 Bacteria 2218
321 Ga0105246_10111406 3300011119 Bacteria 2011
322 Ga0105246_10187770 3300011119 Bacteria 1597
323 Ga0157373_10148125 3300013100 Bacteria 1651
324 Ga0157373_10328689 3300013100 Unclassified 1088
325 Ga0157370_10016907 3300013104 Bacteria 7374
326 Ga0157370_10228514 3300013104 Bacteria 1722
327 Ga0157370_10342192 3300013104 Bacteria 1379
328 Ga0157370_10458252 3300013104 Bacteria 1172
329 Ga0157369_10015039 3300013105 Bacteria 8733
330 Ga0157369_10052510 3300013105 Bacteria 4410
331 Ga0157369_10141962 3300013105 Bacteria 2541
332 Ga0157369_10169785 3300013105 Bacteria 2299
333 Ga0157369_10377536 3300013105 Bacteria 1471
334 Ga0157369_10455278 3300013105 Bacteria 1325
335 Ga0157369_10657823 3300013105 Bacteria 1080
336 Ga0157374_10081841 3300013296 Bacteria 3064
337 Ga0157374_10431954 3300013296 Bacteria 1317
338 Ga0157374_10574531 3300013296 Bacteria 1136
339 Ga0157374_10631717 3300013296 Bacteria 1082
340 Ga0157374_10790483 3300013296 Bacteria 964
341 Ga0157378_10048467 3300013297 Bacteria 3778
342 Ga0157378_10094659 3300013297 Bacteria 2720
343 Ga0157378_10178622 3300013297 Bacteria 1995
344 Ga0157378_10207387 3300013297 Bacteria 1857
345 Ga0157378_10334136 3300013297 Bacteria 1476
346 Ga0157378_10515273 3300013297 Bacteria 1197
347 Ga0163162_10024684 3300013306 Bacteria 5937
348 Ga0163162_10315994 3300013306 Unclassified 1695
349 Ga0163162_10567689 3300013306 Bacteria 1262
350 Ga0157372_10040697 3300013307 Bacteria 5134
351 Ga0157372_10352344 3300013307 Bacteria 1715
352 Ga0157372_10378279 3300013307 Bacteria 1650
353 Ga0157372_10519786 3300013307 Bacteria 1388
354 Ga0157372_11063141 3300013307 Bacteria 937
355 Ga0157372_11088339 3300013307 Unclassified 925
356 Ga0157375_11178851 3300013308 Bacteria 898
357 Ga0157375_11840440 3300013308 Bacteria 718
358 Ga0157375_13125574 3300013308 Bacteria 552
359 Ga0163163_10000555 3300014325 Bacteria 32756
360 Ga0163163_10129694 3300014325 Bacteria 2561
361 Ga0163163_10136936 3300014325 Bacteria 2490
362 Ga0163163_10233690 3300014325 Bacteria 1888
363 Ga0163163_10307794 3300014325 Bacteria 1637
364 Ga0163163_10849285 3300014325 Bacteria 976
365 Ga0163163_11431533 3300014325 Bacteria 753
366 Ga0163163_12273724 3300014325 Bacteria 601
367 Ga0157380_10135250 3300014326 Bacteria 2109
368 Ga0157380_10146916 3300014326 Bacteria 2033
369 Ga0182008_10448225 3300014497 Bacteria 701
370 Ga0157377_10761588 3300014745 Bacteria 710
371 Ga0157379_10002872 3300014968 Bacteria 14522
372 Ga0157379_10011144 3300014968 Bacteria 7838
373 Ga0157379_10165538 3300014968 Bacteria 1995
374 Ga0157379_10502540 3300014968 Bacteria 1124
375 Ga0157376_10113904 3300014969 Bacteria 2385
376 Ga0157376_10139409 3300014969 Bacteria 2174
377 Ga0157376_10160778 3300014969 Bacteria 2036
378 Ga0157376_10227101 3300014969 Bacteria 1732
379 Ga0157376_10529593 3300014969 Bacteria 1163
380 Ga0157376_10901211 3300014969 Bacteria 902
381 Ga0163161_10009996 3300017792 Bacteria 6572
382 Ga0163161_10560200 3300017792 Bacteria 938
383 Ga0213873_10073762 3300021358 Bacteria 944
384 Ga0213876_10035678 3300021384 Bacteria 2622
385 Ga0224572_1002253 3300024225 Bacteria 3078
386 Ga0209233_1026522 3300025261 Bacteria 1415
387 Ga0209758_1000008 3300025297 Bacteria 1215263
388 Ga0207656_10205059 3300025321 Bacteria 954
389 Ga0207653_10006922 3300025885 Bacteria 3537
390 Ga0207682_10003677 3300025893 Bacteria 6609
391 Ga0207692_10099510 3300025898 Bacteria 1593
392 Ga0207642_10068340 3300025899 Bacteria 1681
393 Ga0207642_10098651 3300025899 Bacteria 1461
394 Ga0207642_10182477 3300025899 Bacteria 1145
395 Ga0207710_10069499 3300025900 Bacteria 1612
396 Ga0207688_10050342 3300025901 Bacteria 2331
397 Ga0207680_10045544 3300025903 Bacteria 2587
398 Ga0207680_10130634 3300025903 Bacteria 1655
399 Ga0207680_10201535 3300025903 Bacteria 1356
400 Ga0207647_10091959 3300025904 Bacteria 1809
401 Ga0207647_10479794 3300025904 Bacteria 695
402 Ga0207685_10016865 3300025905 Bacteria 2347
403 Ga0207685_10329861 3300025905 Bacteria 763
404 Ga0207699_10199349 3300025906 Bacteria 1355
405 Ga0207645_10005852 3300025907 Bacteria 8860
406 Ga0207645_10056700 3300025907 Bacteria 2501
407 Ga0207643_10067995 3300025908 Bacteria 2046
408 Ga0207705_10000058 3300025909 Bacteria 155967
409 Ga0207705_10005577 3300025909 Bacteria 9405
410 Ga0207705_11074937 3300025909 Bacteria 620
411 Ga0207705_11459277 3300025909 Bacteria 519
412 Ga0207684_10007412 3300025910 Bacteria 9880
413 Ga0207654_10046216 3300025911 Bacteria 2482
414 Ga0207654_10090985 3300025911 Bacteria 1860
415 Ga0207654_10095977 3300025911 Bacteria 1817
416 Ga0207654_10184261 3300025911 Bacteria 1364
417 Ga0207654_10250016 3300025911 Bacteria 1188
418 Ga0207707_10000001 3300025912 Bacteria 1212482
419 Ga0207707_10003186 3300025912 Bacteria 14568
420 Ga0207707_10364923 3300025912 Bacteria 1243
421 Ga0207707_10570517 3300025912 Unclassified 960
422 Ga0207707_10872443 3300025912 Bacteria 745
423 Ga0207695_10000004 3300025913 Bacteria 1288665
424 Ga0207695_10007642 3300025913 Bacteria 13697
425 Ga0207695_10039081 3300025913 Bacteria 5102
426 Ga0207695_10122620 3300025913 Bacteria 2565
427 Ga0207695_10170666 3300025913 Bacteria 2101
428 Ga0207695_10304075 3300025913 Bacteria 1486
429 Ga0207695_11297328 3300025913 Bacteria 608
430 Ga0207671_10114546 3300025914 Bacteria 2055
431 Ga0207671_10152458 3300025914 Bacteria 1786
432 Ga0207671_10201050 3300025914 Bacteria 1556
433 Ga0207671_10222509 3300025914 Bacteria 1479
434 Ga0207671_10355424 3300025914 Bacteria 1162
435 Ga0207671_10427267 3300025914 Bacteria 1054
436 Ga0207671_10482427 3300025914 Bacteria 988
437 Ga0207671_10919972 3300025914 Bacteria 691
438 Ga0207693_10551394 3300025915 Bacteria 899
439 Ga0207693_10552227 3300025915 Bacteria 898
440 Ga0207693_10826533 3300025915 Bacteria 713
441 Ga0207693_11403897 3300025915 Bacteria 518
442 Ga0207663_10347048 3300025916 Bacteria 1123
443 Ga0207660_10000422 3300025917 Bacteria 27929
444 Ga0207660_10000806 3300025917 Bacteria 20699
445 Ga0207660_10005150 3300025917 Bacteria 8501
446 Ga0207660_10413517 3300025917 Bacteria 1087
447 Ga0207660_11009334 3300025917 Bacteria 679
448 Ga0207662_10144906 3300025918 Bacteria 1507
449 Ga0207657_10000671 3300025919 Bacteria 36483
450 Ga0207657_10006000 3300025919 Bacteria 12639
451 Ga0207657_11252922 3300025919 Bacteria 562
452 Ga0207649_10000790 3300025920 Bacteria 20471
453 Ga0207649_10130382 3300025920 Bacteria 1707
454 Ga0207649_10169381 3300025920 Bacteria 1520
455 Ga0207649_10487902 3300025920 Bacteria 935
456 Ga0207649_10582700 3300025920 Bacteria 859
457 Ga0207649_10868900 3300025920 Bacteria 706
458 Ga0207652_10000094 3300025921 Bacteria 98207
459 Ga0207652_10000205 3300025921 Bacteria 62657
460 Ga0207652_10037804 3300025921 Bacteria 4087
461 Ga0207652_10053875 3300025921 Bacteria 3456
462 Ga0207652_10077981 3300025921 Bacteria 2892
463 Ga0207652_10279304 3300025921 Bacteria 1506
464 Ga0207652_10729127 3300025921 Bacteria 883
465 Ga0207681_11732726 3300025923 Bacteria 522
466 Ga0207694_10000014 3300025924 Bacteria 374435
467 Ga0207694_10037281 3300025924 Bacteria 3733
468 Ga0207694_10110727 3300025924 Unclassified 2184
469 Ga0207694_10298972 3300025924 Bacteria 1325
470 Ga0207694_10335550 3300025924 Bacteria 1250
471 Ga0207694_10349208 3300025924 Bacteria 1224
472 Ga0207694_10352390 3300025924 Bacteria 1219
473 Ga0207694_10569681 3300025924 Unclassified 951
474 Ga0207694_10916926 3300025924 Bacteria 741
475 Ga0207694_11753733 3300025924 Bacteria 522
476 Ga0207650_10524960 3300025925 Bacteria 991
477 Ga0207650_11403024 3300025925 Bacteria 594
478 Ga0207659_10264823 3300025926 Bacteria 1400
479 Ga0207659_10453520 3300025926 Bacteria 1080
480 Ga0207659_10550971 3300025926 Bacteria 980
481 Ga0207687_10009450 3300025927 Bacteria 6378
482 Ga0207687_10059579 3300025927 Bacteria 2690
483 Ga0207687_10179853 3300025927 Bacteria 1638
484 Ga0207687_10311853 3300025927 Bacteria 1270
485 Ga0207687_10636078 3300025927 Bacteria 902
486 Ga0207700_10017035 3300025928 Bacteria 4842
487 Ga0207700_10111792 3300025928 Bacteria 2199
488 Ga0207700_10308439 3300025928 Bacteria 1368
489 Ga0207700_11744420 3300025928 Bacteria 548
490 Ga0207664_10003615 3300025929 Bacteria 10347
491 Ga0207664_10253895 3300025929 Bacteria 1535
492 Ga0207664_11763955 3300025929 Bacteria 541
493 Ga0207644_10012996 3300025931 Bacteria 5541
494 Ga0207644_11492488 3300025931 Bacteria 567
495 Ga0207690_10016813 3300025932 Bacteria 4457
496 Ga0207690_11701722 3300025932 Bacteria 527
497 Ga0207690_11848173 3300025932 Bacteria 504
498 Ga0207706_10235245 3300025933 Bacteria 1602
499 Ga0207686_10095580 3300025934 Bacteria 1972
500 Ga0207686_10130749 3300025934 Bacteria 1721
501 Ga0207686_10216741 3300025934 Bacteria 1379
502 Ga0207686_10293054 3300025934 Bacteria 1206
503 Ga0207709_10002705 3300025935 Bacteria 10964
504 Ga0207709_10183252 3300025935 Bacteria 1480
505 Ga0207709_10185055 3300025935 Bacteria 1474
506 Ga0207709_11341259 3300025935 Bacteria 592
507 Ga0207670_10089403 3300025936 Bacteria 2174
508 Ga0207669_10027946 3300025937 Bacteria 3096
509 Ga0207704_11003224 3300025938 Unclassified 706
510 Ga0207665_10047825 3300025939 Bacteria 2869
511 Ga0207691_10007777 3300025940 Bacteria 10322
512 Ga0207691_10195828 3300025940 Bacteria 1761
513 Ga0207691_10408866 3300025940 Bacteria 1157
514 Ga0207711_10000001 3300025941 Bacteria 1325674
515 Ga0207711_10077012 3300025941 Bacteria 2906
516 Ga0207711_12127793 3300025941 Bacteria 504
517 Ga0207689_10007775 3300025942 Bacteria 9382
518 Ga0207689_10026794 3300025942 Bacteria 4827
519 Ga0207689_10033429 3300025942 Bacteria 4273
520 Ga0207689_10361741 3300025942 Bacteria 1207
521 Ga0207689_10492994 3300025942 Bacteria 1026
522 Ga0207661_10155314 3300025944 Bacteria 1981
523 Ga0207661_10191774 3300025944 Bacteria 1792
524 Ga0207661_10248898 3300025944 Bacteria 1579
525 Ga0207661_10496640 3300025944 Bacteria 1115
526 Ga0207679_10143072 3300025945 Bacteria 1936
527 Ga0207679_11535018 3300025945 Bacteria 611
528 Ga0207667_10000051 3300025949 Bacteria 233836
529 Ga0207667_10017783 3300025949 Bacteria 7994
530 Ga0207667_10118436 3300025949 Bacteria 2729
531 Ga0207667_10139592 3300025949 Bacteria 2495
532 Ga0207667_10367010 3300025949 Bacteria 1468
533 Ga0207667_10650908 3300025949 Bacteria 1059
534 Ga0207667_10860369 3300025949 Bacteria 900
535 Ga0207667_11811301 3300025949 Unclassified 574
536 Ga0207651_10007574 3300025960 Bacteria 5793
537 Ga0207651_10306523 3300025960 Bacteria 1322
538 Ga0207651_10387425 3300025960 Bacteria 1186
539 Ga0207712_10010348 3300025961 Bacteria 5920
540 Ga0207712_10469035 3300025961 Bacteria 1071
541 Ga0207668_10223390 3300025972 Bacteria 1514
542 Ga0207640_10388766 3300025981 Bacteria 1133
543 Ga0207640_11135492 3300025981 Bacteria 692
544 Ga0207658_10073545 3300025986 Bacteria 2595
545 Ga0207658_10105958 3300025986 Bacteria 2212
546 Ga0207658_10593127 3300025986 Bacteria 995
547 Ga0207658_11950902 3300025986 Bacteria 535
548 Ga0207677_10060254 3300026023 Bacteria 2622
549 Ga0207677_10403166 3300026023 Bacteria 1160
550 Ga0207677_10764536 3300026023 Bacteria 862
551 Ga0207677_11431125 3300026023 Bacteria 637
552 Ga0207703_10089094 3300026035 Bacteria 2591
553 Ga0207703_10254279 3300026035 Bacteria 1585
554 Ga0207703_10257365 3300026035 Bacteria 1576
555 Ga0207703_10951509 3300026035 Bacteria 823
556 Ga0207703_11678630 3300026035 Bacteria 611
557 Ga0207703_11737821 3300026035 Bacteria 600
558 Ga0207639_10002016 3300026041 Bacteria 13684
559 Ga0207639_10141995 3300026041 Bacteria 2002
560 Ga0207639_10169406 3300026041 Bacteria 1848
561 Ga0207639_10500134 3300026041 Unclassified 1110
562 Ga0207639_10512823 3300026041 Bacteria 1097
563 Ga0207639_10542334 3300026041 Bacteria 1067
564 Ga0207678_10094515 3300026067 Bacteria 2554
565 Ga0207678_10227845 3300026067 Bacteria 1595
566 Ga0207678_10971269 3300026067 Bacteria 752
567 Ga0207708_10012221 3300026075 Bacteria 6404
568 Ga0207708_10358670 3300026075 Bacteria 1198
569 Ga0207702_10015969 3300026078 Bacteria 6216
570 Ga0207702_10114750 3300026078 Bacteria 2401
571 Ga0207702_10225307 3300026078 Bacteria 1749
572 Ga0207702_10366310 3300026078 Bacteria 1382
573 Ga0207702_10434029 3300026078 Bacteria 1272
574 Ga0207641_10058459 3300026088 Bacteria 3281
575 Ga0207641_10165586 3300026088 Bacteria 2013
576 Ga0207641_10439615 3300026088 Bacteria 1259
577 Ga0207648_10010545 3300026089 Bacteria 8750
578 Ga0207648_10027126 3300026089 Bacteria 5087
579 Ga0207648_10030863 3300026089 Bacteria 4742
580 Ga0207676_10015346 3300026095 Bacteria 5522
581 Ga0207676_10034834 3300026095 Bacteria 3814
582 Ga0207676_10156050 3300026095 Bacteria 1972
583 Ga0207676_11264406 3300026095 Bacteria 732
584 Ga0207676_11304125 3300026095 Bacteria 721
585 Ga0207674_10006957 3300026116 Bacteria 13240
586 Ga0207674_10008675 3300026116 Bacteria 11703
587 Ga0207674_10072304 3300026116 Bacteria 3464
588 Ga0207674_10208077 3300026116 Bacteria 1905
589 Ga0207674_10263903 3300026116 Bacteria 1669
590 Ga0207674_10385447 3300026116 Bacteria 1355
591 Ga0207674_10529153 3300026116 Bacteria 1139
592 Ga0207674_10648036 3300026116 Bacteria 1020
593 Ga0207675_100107178 3300026118 Bacteria 2635
594 Ga0207675_100755658 3300026118 Bacteria 984
595 Ga0207683_10004087 3300026121 Bacteria 12598
596 Ga0207683_10006190 3300026121 Bacteria 10253
597 Ga0207683_10026425 3300026121 Bacteria 5010
598 Ga0207683_10032769 3300026121 Bacteria 4514
599 Ga0207698_10015074 3300026142 Bacteria 5165
600 Ga0207698_10015100 3300026142 Bacteria 5161
601 Ga0207698_10117609 3300026142 Bacteria 2243
602 Ga0207698_11133841 3300026142 Bacteria 795
603 Ga0207698_11669588 3300026142 Bacteria 652
604 Ga0209983_1024898 3300027665 Bacteria 1262
605 Ga0209974_10240378 3300027876 Bacteria 679
606 Ga0265357_1002037 3300028023 Bacteria 1596
607 Ga0268266_10000357 3300028379 Bacteria 70858
608 Ga0268266_10008467 3300028379 Bacteria 9143
609 Ga0268266_10063704 3300028379 Bacteria 3183
610 Ga0268266_10095991 3300028379 Bacteria 2604
611 Ga0268266_10647901 3300028379 Bacteria 1016
612 Ga0268266_10668489 3300028379 Bacteria 1000
613 Ga0268265_10768284 3300028380 Bacteria 937
614 Ga0268265_11156438 3300028380 Bacteria 770
615 Ga0268264_10002054 3300028381 Bacteria 17951
616 Ga0268264_10368206 3300028381 Bacteria 1373
617 Ga0265337_1049868 3300028556 Bacteria 1181
618 Ga0265334_10001214 3300028573 Bacteria 12600
619 Ga0265318_10001334 3300028577 Bacteria 14766
620 Ga0265336_10189073 3300028666 Bacteria 612
621 Ga0265338_10001374 3300028800 Bacteria 39593
622 Ga0265338_10052650 3300028800 Bacteria 3650
623 Ga0265760_10083027 3300031090 Bacteria 994
624 Ga0265330_10018196 3300031235 Bacteria 3230
625 Ga0265330_10106512 3300031235 Bacteria 1199
626 Ga0265330_10296898 3300031235 Bacteria 681
627 Ga0265332_10013437 3300031238 Bacteria 3628
628 Ga0265320_10189630 3300031240 Bacteria 920
629 Ga0265325_10166152 3300031241 Bacteria 1035
630 Ga0265325_10266635 3300031241 Bacteria 771
631 Ga0265340_10000586 3300031247 Bacteria 20219
632 Ga0265340_10000758 3300031247 Bacteria 18360
633 Ga0265340_10115534 3300031247 Bacteria 1237
634 Ga0265340_10386607 3300031247 Bacteria 617
635 Ga0265339_10571923 3300031249 Bacteria 519
636 Ga0265331_10000009 3300031250 Bacteria 314950
637 Ga0265331_10013968 3300031250 Bacteria 4295
638 Ga0265331_10035719 3300031250 Bacteria 2444
639 Ga0265331_10251699 3300031250 Bacteria 792
640 Ga0265327_10136505 3300031251 Bacteria 1150
641 Ga0265316_10260027 3300031344 Bacteria 1273
642 Ga0265316_10661356 3300031344 Bacteria 738
643 Ga0265313_10008051 3300031595 Bacteria 7059
644 Ga0265313_10025881 3300031595 Bacteria 3101
645 Ga0265313_10075663 3300031595 Bacteria 1540
646 Ga0265313_10154251 3300031595 Bacteria 979
647 Ga0265313_10190764 3300031595 Bacteria 857
648 Ga0265314_10005220 3300031711 Bacteria 11783
649 Ga0265314_10006452 3300031711 Bacteria 10384
650 Ga0265314_10008386 3300031711 Bacteria 8855
651 Ga0265314_10015415 3300031711 Bacteria 6068
652 Ga0265314_10042637 3300031711 Bacteria 3235
653 Ga0265314_10262901 3300031711 Bacteria 984
654 Ga0265314_10362960 3300031711 Bacteria 793
655 Ga0265342_10086063 3300031712 Bacteria 1808
656 Ga0265342_10099714 3300031712 Bacteria 1656
657 Ga0265342_10172220 3300031712 Bacteria 1190
658 Ga0307516_10041385 3300031730 Bacteria 4580
659 Ga0307406_10510870 3300031901 Bacteria 976
660 Ga0307415_100087219 3300032126 Bacteria 2248
661 Ga0316583_10000432 3300032133 Bacteria 12280
662 Ga0373941_0247870 3300035115 Bacteria 694
663 Ga0373945_0014828 3300035116 Bacteria 2616
664 Ga0373954_0036536 3300035118 Unclassified 2281
665 Ga0373956_0062480 3300035119 Bacteria 1688
666 Ga0373957_0421649 3300035120 Bacteria 576
667 Ga0373943_0005944 3300035170 Bacteria 5475
668 Ga0373946_0048006 3300035171 Bacteria 1775
669 Ga0373955_0515948 3300035172 Unclassified 730
670 Ga0373931_0059246 3300035691 Bacteria 2059
671 Ga0373935_0001434 3300035692 Bacteria 13205
672 Ga0373935_0212545 3300035692 Unclassified 1341
673 Ga0373927_0480298 3300035695 Unclassified 821
674 Ga0373933_0077284 3300035724 Unclassified 2035
675 Ga0373933_0223801 3300035724 Bacteria 1207
676 Ga0373947_0021187 3300035725 Unclassified 3761
677 Ga0373937_0016077 3300036401 Bacteria 6638
678 Ga0373937_0032256 3300036401 Bacteria 4751
679 Ga0373937_0162819 3300036401 Bacteria 2092
680 Ga0373925_0009141 3300037068 Bacteria 7211
681 Ga0395899_0310553 3300037312 Bacteria 1065
682 Ga0395898_0201990 3300037466 Unclassified 1897
683 Ga0395901_0016503 3300038443 Bacteria 7526
684 Ga0395901_0887548 3300038443 Bacteria 874
685 Ga0436365_0111300 3300039437 Bacteria 37065
686 Ga0436365_0446335 3300039437 Bacteria 22989
687 Ga0436365_0651029 3300039437 Bacteria 4658
688 Ga0436365_1168772 3300039437 Bacteria 186262
689 Ga0436365_1601582 3300039437 Bacteria 905
690 Ga0436360_0610900 3300039438 Unclassified 709
691 Ga0436360_0862647 3300039438 Bacteria 1559
692 Ga0436361_0869536 3300039447 Bacteria 4068
693 Ga0436363_0749651 3300039450 Bacteria 957
694 Ga0436363_0759980 3300039450 Bacteria 636
695 Ga0436363_0794256 3300039450 Bacteria 1964
696 Ga0436363_1543905 3300039450 Bacteria 560
697 Ga0436362_0015304 3300039453 Bacteria 1150
698 Ga0436362_0298885 3300039453 Unclassified 625
699 Ga0436362_0553904 3300039453 Bacteria 591
700 Ga0436362_0624758 3300039453 Bacteria 4681
701 Ga0451802_0738605 3300041460 Bacteria 507
702 Ga0466963_0417293 3300044694 Bacteria 947
703 Ga0466957_0179392 3300044842 Bacteria 1383
704 Ga0466967_0217004 3300045976 Bacteria 1816
705 Ga0495592_0530391 3300046454 Bacteria 727
706 Ga0495651_0317952 3300046462 Bacteria 1039
707 Ga0495650_0239876 3300046471 Bacteria 619
708 Ga0495662_0408538 3300046476 Bacteria 667
709 Ga0495664_0042536 3300046477 Bacteria 2691
710 Ga0495664_0361870 3300046477 Bacteria 873
711 Ga0495606_0067523 3300046507 Bacteria 2264
712 Ga0495606_0164118 3300046507 Bacteria 1294
713 Ga0495616_0305819 3300046513 Unclassified 670
714 Ga0495648_0101705 3300046524 Bacteria 1585
715 Ga0495663_0180259 3300046525 Bacteria 731
716 Ga0495652_0073202 3300046529 Bacteria 2854
717 Ga0495652_0182146 3300046529 Unclassified 1611
718 Ga0495586_0559645 3300046535 Bacteria 660
719 Ga0495587_0140827 3300046536 Bacteria 1377
720 Ga0495609_0044023 3300046538 Bacteria 2003
721 Ga0495621_0009190 3300046539 Bacteria 2993
722 Ga0495645_0005974 3300046543 Bacteria 8419
723 Ga0495622_0001507 3300046557 Bacteria 11631
724 Ga0495667_0217113 3300046559 Bacteria 1221
725 Ga0495656_0638857 3300046615 Bacteria 571
726 Ga0495656_0777410 3300046615 Bacteria 517
727 Ga0495668_0219648 3300046616 Bacteria 1041
728 Ga0495634_0585109 3300046642 Unclassified 649
729 Ga0495611_0067201 3300046648 Bacteria 1636
730 Ga0495625_0299360 3300046660 Unclassified 1030
731 Ga0495657_0106756 3300046675 Bacteria 1778
732 Ga0495657_0706431 3300046675 Bacteria 579
733 Ga0495658_0271926 3300046683 Bacteria 1068
734 Ga0495613_0505084 3300046689 Unclassified 814
735 Ga0495670_0633548 3300046691 Bacteria 583
736 Ga0495649_0151514 3300046694 Bacteria 1218
737 Ga0495604_0148681 3300047317 Bacteria 1667
738 Ga0495604_0671528 3300047317 Bacteria 660
739 Ga0495674_0028412 3300047319 Bacteria 5099
740 Ga0495672_0058095 3300047320 Bacteria 2244
741 Ga0495672_0210233 3300047320 Bacteria 967
742 Ga0495675_0025725 3300047444 Bacteria 3751
743 Ga0495675_0591437 3300047444 Bacteria 630
744 Ga0495615_0020855 3300048090 Bacteria 1473
745 Ga0496100_0016131 3300048903 Bacteria 4379
746 Ga0496100_0562174 3300048903 Bacteria 883
747 Ga0496101_0003231 3300048904 Bacteria 10113
748 Ga0496101_0091581 3300048904 Bacteria 2263
749 Ga0496102_0002294 3300048905 Bacteria 16341
750 Ga0496102_0002583 3300048905 Bacteria 15442
751 Ga0496103_0116880 3300048906 Bacteria 1697
752 Ga0496104_0039864 3300048907 Bacteria 4399
753 Ga0496104_0089362 3300048907 Bacteria 2943
754 Ga0496104_0117477 3300048907 Bacteria 2553
755 Ga0496104_0647086 3300048907 Bacteria 966
756 Ga0496105_0602261 3300048908 Bacteria 852
757 Ga0496106_0006644 3300048909 Bacteria 8562
758 Ga0496106_0007053 3300048909 Bacteria 8298
759 Ga0496107_0003889 3300048910 Bacteria 10041
760 Ga0496107_0022003 3300048910 Bacteria 4503
761 Ga0496107_0473984 3300048910 Bacteria 929
762 Ga0496108_0116245 3300048911 Bacteria 2291
763 Ga0496108_0629631 3300048911 Bacteria 933
764 Ga0496109_0062193 3300048912 Bacteria 3413
765 Ga0496109_0064899 3300048912 Bacteria 3342
766 Ga0496109_1000755 3300048912 Bacteria 773
767 Ga0496111_0132925 3300048914 Bacteria 1842
768 Ga0496112_0147087 3300048915 Bacteria 2324
769 Ga0496114_0028520 3300048917 Bacteria 4581
770 Ga0496115_0042081 3300048918 Bacteria 3639
771 Ga0496115_0078575 3300048918 Bacteria 2684
772 Ga0496120_0211348 3300048923 Bacteria 933
773 Ga0496121_0000342 3300048924 Bacteria 97267
774 Ga0496126_0002607 3300048929 Bacteria 24020
775 Ga0495682_0002708 3300049460 Bacteria 8223
776 Ga0501031_0053461 3300049568 Bacteria 2632
777 Ga0501031_0104463 3300049568 Bacteria 1849
778 Ga0501031_0170600 3300049568 Bacteria 1422
779 Ga0501032_0098298 3300049569 Bacteria 1940
780 Ga0501032_0217858 3300049569 Bacteria 1243
781 Ga0501032_0315053 3300049569 Bacteria 1010
782 Ga0501032_0600674 3300049569 Bacteria 700
783 Ga0501033_0009896 3300049570 Bacteria 7320
784 Ga0501033_0013658 3300049570 Bacteria 6179
785 Ga0501033_0018280 3300049570 Bacteria 5296
786 Ga0501033_0018750 3300049570 Bacteria 5229
787 Ga0501033_0158086 3300049570 Bacteria 1632
788 Ga0501033_0640998 3300049570 Bacteria 726
789 Ga0501034_0137410 3300049571 Bacteria 2425
790 Ga0501034_0222793 3300049571 Bacteria 1838
791 Ga0501034_0425438 3300049571 Bacteria 1248
792 Ga0501036_0345936 3300049572 Bacteria 1242
793 Ga0501036_0359823 3300049572 Bacteria 1215
794 Ga0501036_1292000 3300049572 Bacteria 593
795 Ga0501037_0009765 3300049573 Bacteria 7047
796 Ga0501037_0062504 3300049573 Bacteria 2715
797 Ga0501037_0066437 3300049573 Bacteria 2627
798 Ga0501037_0213189 3300049573 Bacteria 1361
799 Ga0501038_0342146 3300049574 Bacteria 1166
800 Ga0501038_0347630 3300049574 Bacteria 1155
801 Ga0501038_1161629 3300049574 Bacteria 562
802 Ga0501039_0530072 3300049575 Bacteria 924
803 Ga0501040_0122192 3300049576 Bacteria 1828
804 Ga0501043_0114298 3300049579 Bacteria 2119
805 Ga0501043_0285856 3300049579 Bacteria 1263
806 Ga0501046_0010825 3300049580 Bacteria 7819
807 Ga0501046_0016712 3300049580 Bacteria 6138
808 Ga0501046_0051967 3300049580 Bacteria 3232
809 Ga0501046_0143420 3300049580 Bacteria 1806
810 Ga0501046_0236367 3300049580 Bacteria 1349
811 Ga0501046_0348702 3300049580 Bacteria 1075
812 Ga0501047_0002340 3300049581 Bacteria 18119
813 Ga0501047_0027509 3300049581 Bacteria 5479
814 Ga0501047_0048451 3300049581 Bacteria 4103
815 Ga0501047_0075096 3300049581 Bacteria 3253
816 Ga0501047_0082612 3300049581 Bacteria 3088
817 Ga0501047_0092939 3300049581 Bacteria 2895
818 Ga0501047_0131672 3300049581 Bacteria 2381
819 Ga0501047_0319280 3300049581 Bacteria 1393
820 Ga0501047_0359864 3300049581 Bacteria 1291
821 Ga0501048_0157714 3300049582 Bacteria 1605
822 Ga0501048_0207760 3300049582 Bacteria 1389
823 Ga0501048_0363219 3300049582 Unclassified 1033
824 Ga0501067_0086991 3300049583 Bacteria 1734
825 Ga0501068_0026351 3300049584 Bacteria 3424
826 Ga0501068_0346197 3300049584 Bacteria 955
827 Ga0501069_0277261 3300049585 Bacteria 981
828 Ga0501070_0000017 3300049586 Bacteria 173127
829 Ga0501070_0102310 3300049586 Bacteria 2369
830 Ga0501070_0118515 3300049586 Bacteria 2188
831 Ga0501070_0226903 3300049586 Bacteria 1531
832 Ga0501072_0001370 3300049588 Bacteria 18287
833 Ga0501073_0009211 3300049589 Bacteria 7280
834 Ga0501073_0028609 3300049589 Bacteria 3982
835 Ga0501073_0154745 3300049589 Bacteria 1589
836 Ga0501073_0410908 3300049589 Unclassified 935
837 Ga0501073_0625633 3300049589 Bacteria 743
838 Ga0501074_0150457 3300049590 Bacteria 1664
839 Ga0501075_0307227 3300049591 Bacteria 1208
840 Ga0501079_0025539 3300049741 Bacteria 4529
841 Ga0501080_0000444 3300049742 Bacteria 32129
842 Ga0501080_0014351 3300049742 Bacteria 7294
843 Ga0501080_0027224 3300049742 Bacteria 5317
844 Ga0501080_0074393 3300049742 Bacteria 3160
845 Ga0501080_0108117 3300049742 Bacteria 2578
846 Ga0501080_0135359 3300049742 Bacteria 2280
847 Ga0501080_0907441 3300049742 Bacteria 768
848 Ga0501080_1166102 3300049742 Bacteria 663
849 Ga0501083_0009460 3300049744 Bacteria 6884
850 Ga0501083_0055695 3300049744 Bacteria 2651
851 Ga0501083_0093405 3300049744 Bacteria 1986
852 Ga0501083_0110388 3300049744 Bacteria 1809
853 Ga0501083_0171809 3300049744 Bacteria 1416
854 Ga0501083_0548748 3300049744 Bacteria 752
855 Ga0501035_0001450 3300049822 Bacteria 24304
856 Ga0501035_0009163 3300049822 Bacteria 9205
857 Ga0501035_0029790 3300049822 Bacteria 4978
858 Ga0501035_0119638 3300049822 Bacteria 2303
859 Ga0501035_0197889 3300049822 Bacteria 1725
860 Ga0501035_0510039 3300049822 Bacteria 989
861 Ga0501035_0622194 3300049822 Unclassified 878
862 Ga0501035_0753496 3300049822 Bacteria 781
863 Ga0501044_0003825 3300049823 Bacteria 16895
864 Ga0501044_0004434 3300049823 Bacteria 15704
865 Ga0501044_0008303 3300049823 Bacteria 11382
866 Ga0501044_0057274 3300049823 Bacteria 3999
867 Ga0501044_0157281 3300049823 Bacteria 2251
868 Ga0501044_0257932 3300049823 Bacteria 1682
869 Ga0501044_0346378 3300049823 Bacteria 1406
870 Ga0501044_0359093 3300049823 Bacteria 1375
871 Ga0501044_0415092 3300049823 Bacteria 1257
872 Ga0501044_0628634 3300049823 Bacteria 964
873 Ga0501044_0876333 3300049823 Bacteria 773
874 Ga0501044_1020567 3300049823 Bacteria 698
875 nmdc:mga00v17_52217_c1 3300050491 Bacteria 2486
876 nmdc:mga0yw44_919343_c1 3300050492 Bacteria 593
877 nmdc:mga05p37_320261_c1 3300050507 Bacteria 1835
878 nmdc:mga05p37_960314_c1 3300050507 Bacteria 913
879 nmdc:mga0qj67_282664_c1 3300050509 Bacteria 1345
880 nmdc:mga0qj67_412_c1 3300050509 Bacteria 29289
881 nmdc:mga06r32_1512315_c1 3300050510 Bacteria 611
882 nmdc:mga06r32_17051_c1 3300050510 Bacteria 6629
883 nmdc:mga06r32_539305_c1 3300050510 Bacteria 1141
884 nmdc:mga0n895_1773762_c1 3300050512 Bacteria 578
885 nmdc:mga0n895_2189544_c1 3300050512 Bacteria 508
886 nmdc:mga0n895_323714_c1 3300050512 Bacteria 1562
887 nmdc:mga0n895_32695_c1 3300050512 Bacteria 4994
888 nmdc:mga08x19_1278715_c1 3300050514 Unclassified 520
889 nmdc:mga0a205_257139_c1 3300050515 Bacteria 1624
890 Ga0495612_0077319 3300053078 Bacteria 1395
891 Ga0500635_0035794 3300053080 Bacteria 1633
892 Ga0495619_0072033 3300053085 Bacteria 2313
893 Ga0500643_000006 3300053087 Bacteria 479605
894 Ga0500555_050398 3300053103 Bacteria 1140
895 Ga0500562_006158 3300053108 Bacteria 3025
896 Ga0500562_047815 3300053108 Bacteria 1142
897 Ga0500593_007195 3300053117 Bacteria 4512
898 Ga0500595_005740 3300053119 Bacteria 5374
899 Ga0500595_008167 3300053119 Bacteria 4293
900 Ga0500595_020506 3300053119 Bacteria 2378
901 Ga0500642_0104995 3300053130 Bacteria 1317
902 Ga0500655_006993 3300053133 Bacteria 2028
903 Ga0500573_0000009 3300053140 Bacteria 230823
904 Ga0500616_0281507 3300053153 Bacteria 698
905 Ga0500616_0318860 3300053153 Bacteria 640
906 Ga0500619_004449 3300053154 Bacteria 3010
907 Ga0500633_0361834 3300053160 Bacteria 527
908 Ga0500639_126243 3300053163 Bacteria 1220
909 Ga0500639_223852 3300053163 Bacteria 782
910 Ga0500611_071217 3300053727 Unclassified 847
911 Ga0500645_061846 3300053730 Bacteria 1082
912 Ga0500596_009664 3300053735 Bacteria 1501
913 Ga0501084_0007509 3300054114 Bacteria 8986
914 Ga0501084_0742321 3300054114 Bacteria 827
915 Ga0501084_0834389 3300054114 Bacteria 776
916 Ga0501082_0000028 3300060353 Bacteria 100580
917 Ga0501082_0016977 3300060353 Bacteria 6268
918 Ga0501082_0143400 3300060353 Bacteria 2073
919 Ga0501082_0190970 3300060353 Bacteria 1782
920 Ga0068869_100022034
921 rootH2_10003615
922 rootH1_10086183
923 Ga0065715_10013462
924 Ga0070658_10485055
925 Ga0070676_10054296
926 Ga0070683_100066738
927 Ga0070683_100174094
928 Ga0070690_100098017
929 Ga0070670_100328713
930 Ga0070670_100816579
931 Ga0070677_10081362
932 Ga0070677_10466887
933 Ga0068869_100007911
934 Ga0070666_10012507
935 Ga0070666_10054557
936 Ga0070666_10059713
937 Ga0070680_100001296
938 Ga0070680_100032951
939 Ga0070680_100052097
940 Ga0070680_100191007
941 Ga0070680_100255639
942 Ga0070680_100501288
943 Ga0070680_101424195
944 Ga0070682_100694785
945 Ga0068868_100115734
946 Ga0068868_100192988
947 Ga0068868_100661447
948 Ga0068868_101127523
949 Ga0070660_100001022
950 Ga0070660_100112340
951 Ga0070660_100290881
952 Ga0070689_100065867
953 Ga0070689_100635132
954 Ga0070691_10002229
955 Ga0070691_10044283
956 Ga0070687_100849807
957 Ga0070687_101281319
958 Ga0070661_100000165
959 Ga0070661_100034735
960 Ga0070661_100131627
961 Ga0070661_100619896
962 Ga0070661_100740898
963 Ga0070692_10435158
964 Ga0070669_100101408
965 Ga0070669_100129491
966 Ga0070675_100023390
967 Ga0070675_100136133
968 Ga0070675_100344275
969 Ga0070671_100182861
970 Ga0070671_101519245
971 Ga0070674_100084604
972 Ga0070674_100087670
973 Ga0070674_100114579
974 Ga0070674_100201583
975 Ga0070673_100019561
976 Ga0070673_100105365
977 Ga0070673_100370472
978 Ga0070673_101184424
979 Ga0070673_102269622
980 Ga0070688_100292161
981 Ga0070688_100530041
982 Ga0070659_100062634
983 Ga0070659_100970347
984 Ga0070659_101107463
985 Ga0070667_100114912
986 Ga0070667_100267394
987 Ga0070667_100647373
988 Ga0070703_10022299
989 Ga0070709_11567477
990 Ga0070714_100197705
991 Ga0070714_100312480
992 Ga0070713_100059694
993 Ga0070713_100289434
994 Ga0070713_100696024
995 Ga0070713_100916827
996 Ga0070701_10156247
997 Ga0070711_100426532
998 Ga0070705_100000594
999 Ga0070700_100001488
1000 Ga0070694_100016877
1001 Ga0070708_100003124
1002 Ga0070708_100184018
1003 Ga0070708_100339566
1004 Ga0070708_100612013
1005 Ga0070663_100020033
1006 Ga0070663_100216909
1007 Ga0070678_100012205
1008 Ga0070678_100198397
1009 Ga0070678_100476592
1010 Ga0070678_101231309
1011 Ga0070662_100092995
1012 Ga0070681_10000003
1013 Ga0070681_10028766
1014 Ga0070681_10076253
1015 Ga0070681_10126394
1016 Ga0070681_11490583
1017 Ga0068867_100014115
1018 Ga0068867_100087383
1019 Ga0068867_100095047
1020 Ga0070685_10875820
1021 Ga0070706_100189758
1022 Ga0070707_100067177
1023 Ga0070698_100092500
1024 Ga0070698_100225911
1025 Ga0070699_100120054
1026 Ga0070699_100365374
1027 Ga0070699_100641472
1028 Ga0070679_100000756
1029 Ga0070679_100050682
1030 Ga0070679_100076318
1031 Ga0070679_100081002
1032 Ga0070679_100141922
1033 Ga0070679_100143342
1034 Ga0070679_100463913
1035 Ga0070679_101219228
1036 Ga0070679_101280620
1037 Ga0070684_100124749
1038 Ga0070684_100619242
1039 Ga0070684_100711268
1040 Ga0070697_100073546
1041 Ga0070697_100108355
1042 Ga0068853_100006714
1043 Ga0068853_100062368
1044 Ga0068853_100114216
1045 Ga0068853_100377313
1046 Ga0068853_100492415
1047 Ga0068853_100545233
1048 Ga0068853_101299859
1049 Ga0070672_100016318
1050 Ga0070672_100958815
1051 Ga0070695_100002480
1052 Ga0070696_100000216
1053 Ga0070693_100100257
1054 Ga0070693_100770422
1055 Ga0070665_100002717
1056 Ga0070665_100022762
1057 Ga0070665_100185572
1058 Ga0070665_100301417
1059 Ga0070665_100515959
1060 Ga0070704_100001646
1061 Ga0068855_100000006
1062 Ga0068855_100004642
1063 Ga0068855_100076667
1064 Ga0068855_100093176
1065 Ga0068855_100286597
1066 Ga0068855_100366855
1067 Ga0068855_100692223
1068 Ga0068855_100753470
1069 Ga0068855_102009133
1070 Ga0070664_100166897
1071 Ga0070664_100530078
1072 Ga0068857_100015358
1073 Ga0068857_100078796
1074 Ga0068857_100185385
1075 Ga0068857_100282852
1076 Ga0068857_100314631
1077 Ga0068857_100380164
1078 Ga0068857_100438525
1079 Ga0068857_101053505
1080 Ga0068854_100692409
1081 Ga0068856_100026166
1082 Ga0068856_100161515
1083 Ga0068856_100172249
1084 Ga0068856_100418150
1085 Ga0070702_100032649
1086 Ga0068852_100072660
1087 Ga0068852_100075037
1088 Ga0068852_100132382
1089 Ga0068852_100303293
1090 Ga0068859_100025836
1091 Ga0068859_100101276
1092 Ga0068859_100899509
1093 Ga0068864_100036513
1094 Ga0068864_100199211
1095 Ga0068864_100481978
1096 Ga0068864_100864724
1097 Ga0068866_10019794
1098 Ga0068866_10095399
1099 Ga0068866_10129210
1100 Ga0068861_100758975
1101 Ga0068861_102336781
1102 Ga0068870_11078072
1103 Ga0068863_100017820
1104 Ga0068863_100685858
1105 Ga0068863_100899101
1106 Ga0068858_100324204
1107 Ga0068858_100655988
1108 Ga0068858_100757036
1109 Ga0068858_100846763
1110 Ga0068860_100003742
1111 Ga0068860_100072608
1112 Ga0068860_101001374
1113 Ga0068860_101005294
1114 Ga0068862_102290653
1115 Ga0081455_10477553
1116 Ga0081540_1030413
1117 Ga0081539_10035135
1118 Ga0070717_10082530
1119 Ga0070717_10114133
1120 Ga0075364_10515020
1121 Ga0070715_10054399
1122 Ga0070712_100147389
1123 Ga0070712_100883946
1124 Ga0070712_100908690
1125 Ga0097621_100002395
1126 Ga0097621_100009652
1127 Ga0097621_100027693
1128 Ga0097621_100081479
1129 Ga0097621_100113447
1130 Ga0097621_100592055
1131 Ga0097621_101087986
1132 Ga0068871_100002867
1133 Ga0068871_100024326
1134 Ga0068871_100025966
1135 Ga0068871_100055975
1136 Ga0068871_100111526
1137 Ga0068871_100115069
1138 Ga0068871_101143501
1139 Ga0075428_100056440
1140 Ga0075430_100000509
1141 Ga0075430_100023775
1142 Ga0075431_100023178
1143 Ga0075433_10944150
1144 Ga0075433_11354987
1145 Ga0075434_100413580
1146 Ga0075434_100508385
1147 Ga0068865_100013600
1148 Ga0068865_101112535
1149 Ga0075436_100291622
1150 Ga0097620_100025835
1151 Ga0097620_100101273
1152 Ga0097620_100899479
1153 Ga0075435_100285344
1154 Ga0105240_10000357
1155 Ga0105240_10016205
1156 Ga0105240_10088510
1157 Ga0105240_10103311
1158 Ga0105240_10117267
1159 Ga0105240_10291751
1160 Ga0105240_10338697
1161 Ga0105240_10503387
1162 Ga0105240_10694431
1163 Ga0105240_10720875
1164 Ga0105240_10789891
1165 Ga0105240_10917951
1166 Ga0105240_11358490
1167 Ga0105240_11702806
1168 Ga0105245_10003180
1169 Ga0105245_10044614
1170 Ga0105245_10149813
1171 Ga0105245_10210118
1172 Ga0105247_10053097
1173 Ga0105247_10059924
1174 Ga0105247_10407980
1175 Ga0105247_10453941
1176 Ga0114129_10225577
1177 Ga0114129_10330447
1178 Ga0105243_10001197
1179 Ga0105243_10368041
1180 Ga0105243_10524480
1181 Ga0105241_10076378
1182 Ga0105241_10080356
1183 Ga0105241_10140264
1184 Ga0105241_10323329
1185 Ga0105241_10394210
1186 Ga0105242_10007711
1187 Ga0105242_10061809
1188 Ga0105242_10164754
1189 Ga0105242_10605430
1190 Ga0105242_11888230
1191 Ga0105242_12336331
1192 Ga0105248_10000001
1193 Ga0105248_10042026
1194 Ga0105248_11135654
1195 Ga0105248_11659855
1196 Ga0105237_10032985
1197 Ga0105237_10039524
1198 Ga0105237_10152857
1199 Ga0105237_10269493
1200 Ga0105237_10623240
1201 Ga0105237_10748996
1202 Ga0105237_10851684
1203 Ga0105237_11423354
1204 Ga0105238_10003553
1205 Ga0105238_10033198
1206 Ga0105238_10053777
1207 Ga0105238_10065161
1208 Ga0105238_10086512
1209 Ga0105238_10427453
1210 Ga0105238_10474101
1211 Ga0105238_10500881
1212 Ga0105238_10552613
1213 Ga0105238_10818503
1214 Ga0105238_10836130
1215 Ga0105238_10967405
1216 Ga0105238_11204778
1217 Ga0105238_11272880
1218 Ga0105238_11516223
1219 Ga0105238_12206223
1220 Ga0105238_12316927
1221 Ga0105249_10003967
1222 Ga0105249_10092579
1223 Ga0105249_10691902
1224 Ga0105249_11790004
1225 Ga0105249_13134002
1226 Ga0105239_10003772
1227 Ga0105239_10007112
1228 Ga0105239_10014498
1229 Ga0105239_10072562
1230 Ga0105239_10131570
1231 Ga0105239_10168720
1232 Ga0105239_10346538
1233 Ga0105239_10356377
1234 Ga0105239_10665509
1235 Ga0105239_11620324
1236 Ga0105239_12259738
1237 Ga0105239_12519122
1238 Ga0105246_10048332
1239 Ga0105246_10089227
1240 Ga0105246_10111406
1241 Ga0105246_10187770
1242 Ga0157373_10148125
1243 Ga0157373_10328689
1244 Ga0157370_10016907
1245 Ga0157370_10228514
1246 Ga0157370_10342192
1247 Ga0157370_10458252
1248 Ga0157369_10015039
1249 Ga0157369_10052510
1250 Ga0157369_10141962
1251 Ga0157369_10169785
1252 Ga0157369_10377536
1253 Ga0157369_10455278
1254 Ga0157369_10657823
1255 Ga0157374_10081841
1256 Ga0157374_10431954
1257 Ga0157374_10574531
1258 Ga0157374_10631717
1259 Ga0157374_10790483
1260 Ga0157378_10048467
1261 Ga0157378_10094659
1262 Ga0157378_10178622
1263 Ga0157378_10207387
1264 Ga0157378_10334136
1265 Ga0157378_10515273
1266 Ga0163162_10024684
1267 Ga0163162_10315994
1268 Ga0163162_10567689
1269 Ga0157372_10040697
1270 Ga0157372_10352344
1271 Ga0157372_10378279
1272 Ga0157372_10519786
1273 Ga0157372_11063141
1274 Ga0157372_11088339
1275 Ga0157375_11178851
1276 Ga0157375_11840440
1277 Ga0157375_13125574
1278 Ga0163163_10000555
1279 Ga0163163_10129694
1280 Ga0163163_10136936
1281 Ga0163163_10233690
1282 Ga0163163_10307794
1283 Ga0163163_10849285
1284 Ga0163163_11431533
1285 Ga0163163_12273724
1286 Ga0157380_10135250
1287 Ga0157380_10146916
1288 Ga0182008_10448225
1289 Ga0157377_10761588
1290 Ga0157379_10002872
1291 Ga0157379_10011144
1292 Ga0157379_10165538
1293 Ga0157379_10502540
1294 Ga0157376_10113904
1295 Ga0157376_10139409
1296 Ga0157376_10160778
1297 Ga0157376_10227101
1298 Ga0157376_10529593
1299 Ga0157376_10901211
1300 Ga0163161_10009996
1301 Ga0163161_10560200
1302 Ga0213873_10073762
1303 Ga0213876_10035678
1304 Ga0224572_1002253
1305 Ga0209233_1026522
1306 Ga0209758_1000008
1307 Ga0207656_10205059
1308 Ga0207653_10006922
1309 Ga0207682_10003677
1310 Ga0207692_10099510
1311 Ga0207642_10068340
1312 Ga0207642_10098651
1313 Ga0207642_10182477
1314 Ga0207710_10069499
1315 Ga0207688_10050342
1316 Ga0207680_10045544
1317 Ga0207680_10130634
1318 Ga0207680_10201535
1319 Ga0207647_10091959
1320 Ga0207647_10479794
1321 Ga0207685_10016865
1322 Ga0207685_10329861
1323 Ga0207699_10199349
1324 Ga0207645_10005852
1325 Ga0207645_10056700
1326 Ga0207643_10067995
1327 Ga0207705_10000058
1328 Ga0207705_10005577
1329 Ga0207705_11074937
1330 Ga0207705_11459277
1331 Ga0207684_10007412
1332 Ga0207654_10046216
1333 Ga0207654_10090985
1334 Ga0207654_10095977
1335 Ga0207654_10184261
1336 Ga0207654_10250016
1337 Ga0207707_10000001
1338 Ga0207707_10003186
1339 Ga0207707_10364923
1340 Ga0207707_10570517
1341 Ga0207707_10872443
1342 Ga0207695_10000004
1343 Ga0207695_10007642
1344 Ga0207695_10039081
1345 Ga0207695_10122620
1346 Ga0207695_10170666
1347 Ga0207695_10304075
1348 Ga0207695_11297328
1349 Ga0207671_10114546
1350 Ga0207671_10152458
1351 Ga0207671_10201050
1352 Ga0207671_10222509
1353 Ga0207671_10355424
1354 Ga0207671_10427267
1355 Ga0207671_10482427
1356 Ga0207671_10919972
1357 Ga0207693_10551394
1358 Ga0207693_10552227
1359 Ga0207693_10826533
1360 Ga0207693_11403897
1361 Ga0207663_10347048
1362 Ga0207660_10000422
1363 Ga0207660_10000806
1364 Ga0207660_10005150
1365 Ga0207660_10413517
1366 Ga0207660_11009334
1367 Ga0207662_10144906
1368 Ga0207657_10000671
1369 Ga0207657_10006000
1370 Ga0207657_11252922
1371 Ga0207649_10000790
1372 Ga0207649_10130382
1373 Ga0207649_10169381
1374 Ga0207649_10487902
1375 Ga0207649_10582700
1376 Ga0207649_10868900
1377 Ga0207652_10000094
1378 Ga0207652_10000205
1379 Ga0207652_10037804
1380 Ga0207652_10053875
1381 Ga0207652_10077981
1382 Ga0207652_10279304
1383 Ga0207652_10729127
1384 Ga0207681_11732726
1385 Ga0207694_10000014
1386 Ga0207694_10037281
1387 Ga0207694_10110727
1388 Ga0207694_10298972
1389 Ga0207694_10335550
1390 Ga0207694_10349208
1391 Ga0207694_10352390
1392 Ga0207694_10569681
1393 Ga0207694_10916926
1394 Ga0207694_11753733
1395 Ga0207650_10524960
1396 Ga0207650_11403024
1397 Ga0207659_10264823
1398 Ga0207659_10453520
1399 Ga0207659_10550971
1400 Ga0207687_10009450
1401 Ga0207687_10059579
1402 Ga0207687_10179853
1403 Ga0207687_10311853
1404 Ga0207687_10636078
1405 Ga0207700_10017035
1406 Ga0207700_10111792
1407 Ga0207700_10308439
1408 Ga0207700_11744420
1409 Ga0207664_10003615
1410 Ga0207664_10253895
1411 Ga0207664_11763955
1412 Ga0207644_10012996
1413 Ga0207644_11492488
1414 Ga0207690_10016813
1415 Ga0207690_11701722
1416 Ga0207690_11848173
1417 Ga0207706_10235245
1418 Ga0207686_10095580
1419 Ga0207686_10130749
1420 Ga0207686_10216741
1421 Ga0207686_10293054
1422 Ga0207709_10002705
1423 Ga0207709_10183252
1424 Ga0207709_10185055
1425 Ga0207709_11341259
1426 Ga0207670_10089403
1427 Ga0207669_10027946
1428 Ga0207704_11003224
1429 Ga0207665_10047825
1430 Ga0207691_10007777
1431 Ga0207691_10195828
1432 Ga0207691_10408866
1433 Ga0207711_10000001
1434 Ga0207711_10077012
1435 Ga0207711_12127793
1436 Ga0207689_10007775
1437 Ga0207689_10026794
1438 Ga0207689_10033429
1439 Ga0207689_10361741
1440 Ga0207689_10492994
1441 Ga0207661_10155314
1442 Ga0207661_10191774
1443 Ga0207661_10248898
1444 Ga0207661_10496640
1445 Ga0207679_10143072
1446 Ga0207679_11535018
1447 Ga0207667_10000051
1448 Ga0207667_10017783
1449 Ga0207667_10118436
1450 Ga0207667_10139592
1451 Ga0207667_10367010
1452 Ga0207667_10650908
1453 Ga0207667_10860369
1454 Ga0207667_11811301
1455 Ga0207651_10007574
1456 Ga0207651_10306523
1457 Ga0207651_10387425
1458 Ga0207712_10010348
1459 Ga0207712_10469035
1460 Ga0207668_10223390
1461 Ga0207640_10388766
1462 Ga0207640_11135492
1463 Ga0207658_10073545
1464 Ga0207658_10105958
1465 Ga0207658_10593127
1466 Ga0207658_11950902
1467 Ga0207677_10060254
1468 Ga0207677_10403166
1469 Ga0207677_10764536
1470 Ga0207677_11431125
1471 Ga0207703_10089094
1472 Ga0207703_10254279
1473 Ga0207703_10257365
1474 Ga0207703_10951509
1475 Ga0207703_11678630
1476 Ga0207703_11737821
1477 Ga0207639_10002016
1478 Ga0207639_10141995
1479 Ga0207639_10169406
1480 Ga0207639_10500134
1481 Ga0207639_10512823
1482 Ga0207639_10542334
1483 Ga0207678_10094515
1484 Ga0207678_10227845
1485 Ga0207678_10971269
1486 Ga0207708_10012221
1487 Ga0207708_10358670
1488 Ga0207702_10015969
1489 Ga0207702_10114750
1490 Ga0207702_10225307
1491 Ga0207702_10366310
1492 Ga0207702_10434029
1493 Ga0207641_10058459
1494 Ga0207641_10165586
1495 Ga0207641_10439615
1496 Ga0207648_10010545
1497 Ga0207648_10027126
1498 Ga0207648_10030863
1499 Ga0207676_10015346
1500 Ga0207676_10034834
1501 Ga0207676_10156050
1502 Ga0207676_11264406
1503 Ga0207676_11304125
1504 Ga0207674_10006957
1505 Ga0207674_10008675
1506 Ga0207674_10072304
1507 Ga0207674_10208077
1508 Ga0207674_10263903
1509 Ga0207674_10385447
1510 Ga0207674_10529153
1511 Ga0207674_10648036
1512 Ga0207675_100107178
1513 Ga0207675_100755658
1514 Ga0207683_10004087
1515 Ga0207683_10006190
1516 Ga0207683_10026425
1517 Ga0207683_10032769
1518 Ga0207698_10015074
1519 Ga0207698_10015100
1520 Ga0207698_10117609
1521 Ga0207698_11133841
1522 Ga0207698_11669588
1523 Ga0209983_1024898
1524 Ga0209974_10240378
1525 Ga0265357_1002037
1526 Ga0268266_10000357
1527 Ga0268266_10008467
1528 Ga0268266_10063704
1529 Ga0268266_10095991
1530 Ga0268266_10647901
1531 Ga0268266_10668489
1532 Ga0268265_10768284
1533 Ga0268265_11156438
1534 Ga0268264_10002054
1535 Ga0268264_10368206
1536 Ga0265337_1049868
1537 Ga0265334_10001214
1538 Ga0265318_10001334
1539 Ga0265336_10189073
1540 Ga0265338_10001374
1541 Ga0265338_10052650
1542 Ga0265760_10083027
1543 Ga0265330_10018196
1544 Ga0265330_10106512
1545 Ga0265330_10296898
1546 Ga0265332_10013437
1547 Ga0265320_10189630
1548 Ga0265325_10166152
1549 Ga0265325_10266635
1550 Ga0265340_10000586
1551 Ga0265340_10000758
1552 Ga0265340_10115534
1553 Ga0265340_10386607
1554 Ga0265339_10571923
1555 Ga0265331_10000009
1556 Ga0265331_10013968
1557 Ga0265331_10035719
1558 Ga0265331_10251699
1559 Ga0265327_10136505
1560 Ga0265316_10260027
1561 Ga0265316_10661356
1562 Ga0265313_10008051
1563 Ga0265313_10025881
1564 Ga0265313_10075663
1565 Ga0265313_10154251
1566 Ga0265313_10190764
1567 Ga0265314_10005220
1568 Ga0265314_10006452
1569 Ga0265314_10008386
1570 Ga0265314_10015415
1571 Ga0265314_10042637
1572 Ga0265314_10262901
1573 Ga0265314_10362960
1574 Ga0265342_10086063
1575 Ga0265342_10099714
1576 Ga0265342_10172220
1577 Ga0307516_10041385
1578 Ga0307406_10510870
1579 Ga0307415_100087219
1580 Ga0316583_10000432
1581 Ga0373941_0247870
1582 Ga0373945_0014828
1583 Ga0373954_0036536
1584 Ga0373956_0062480
1585 Ga0373957_0421649
1586 Ga0373943_0005944
1587 Ga0373946_0048006
1588 Ga0373955_0515948
1589 Ga0373931_0059246
1590 Ga0373935_0001434
1591 Ga0373935_0212545
1592 Ga0373927_0480298
1593 Ga0373933_0077284
1594 Ga0373933_0223801
1595 Ga0373947_0021187
1596 Ga0373937_0016077
1597 Ga0373937_0032256
1598 Ga0373937_0162819
1599 Ga0373925_0009141
1600 Ga0395899_0310553
1601 Ga0395898_0201990
1602 Ga0395901_0016503
1603 Ga0395901_0887548
1604 Ga0436365_0111300
1605 Ga0436365_0446335
1606 Ga0436365_0651029
1607 Ga0436365_1168772
1608 Ga0436365_1601582
1609 Ga0436360_0610900
1610 Ga0436360_0862647
1611 Ga0436361_0869536
1612 Ga0436363_0749651
1613 Ga0436363_0759980
1614 Ga0436363_0794256
1615 Ga0436363_1543905
1616 Ga0436362_0015304
1617 Ga0436362_0298885
1618 Ga0436362_0553904
1619 Ga0436362_0624758
1620 Ga0451802_0738605
1621 Ga0466963_0417293
1622 Ga0466957_0179392
1623 Ga0466967_0217004
1624 Ga0495592_0530391
1625 Ga0495651_0317952
1626 Ga0495650_0239876
1627 Ga0495662_0408538
1628 Ga0495664_0042536
1629 Ga0495664_0361870
1630 Ga0495606_0067523
1631 Ga0495606_0164118
1632 Ga0495616_0305819
1633 Ga0495648_0101705
1634 Ga0495663_0180259
1635 Ga0495652_0073202
1636 Ga0495652_0182146
1637 Ga0495586_0559645
1638 Ga0495587_0140827
1639 Ga0495609_0044023
1640 Ga0495621_0009190
1641 Ga0495645_0005974
1642 Ga0495622_0001507
1643 Ga0495667_0217113
1644 Ga0495656_0638857
1645 Ga0495656_0777410
1646 Ga0495668_0219648
1647 Ga0495634_0585109
1648 Ga0495611_0067201
1649 Ga0495625_0299360
1650 Ga0495657_0106756
1651 Ga0495657_0706431
1652 Ga0495658_0271926
1653 Ga0495613_0505084
1654 Ga0495670_0633548
1655 Ga0495649_0151514
1656 Ga0495604_0148681
1657 Ga0495604_0671528
1658 Ga0495674_0028412
1659 Ga0495672_0058095
1660 Ga0495672_0210233
1661 Ga0495675_0025725
1662 Ga0495675_0591437
1663 Ga0495615_0020855
1664 Ga0496100_0016131
1665 Ga0496100_0562174
1666 Ga0496101_0003231
1667 Ga0496101_0091581
1668 Ga0496102_0002294
1669 Ga0496102_0002583
1670 Ga0496103_0116880
1671 Ga0496104_0039864
1672 Ga0496104_0089362
1673 Ga0496104_0117477
1674 Ga0496104_0647086
1675 Ga0496105_0602261
1676 Ga0496106_0006644
1677 Ga0496106_0007053
1678 Ga0496107_0003889
1679 Ga0496107_0022003
1680 Ga0496107_0473984
1681 Ga0496108_0116245
1682 Ga0496108_0629631
1683 Ga0496109_0062193
1684 Ga0496109_0064899
1685 Ga0496109_1000755
1686 Ga0496111_0132925
1687 Ga0496112_0147087
1688 Ga0496114_0028520
1689 Ga0496115_0042081
1690 Ga0496115_0078575
1691 Ga0496120_0211348
1692 Ga0496121_0000342
1693 Ga0496126_0002607
1694 Ga0495682_0002708
1695 Ga0501031_0053461
1696 Ga0501031_0104463
1697 Ga0501031_0170600
1698 Ga0501032_0098298
1699 Ga0501032_0217858
1700 Ga0501032_0315053
1701 Ga0501032_0600674
1702 Ga0501033_0009896
1703 Ga0501033_0013658
1704 Ga0501033_0018280
1705 Ga0501033_0018750
1706 Ga0501033_0158086
1707 Ga0501033_0640998
1708 Ga0501034_0137410
1709 Ga0501034_0222793
1710 Ga0501034_0425438
1711 Ga0501036_0345936
1712 Ga0501036_0359823
1713 Ga0501036_1292000
1714 Ga0501037_0009765
1715 Ga0501037_0062504
1716 Ga0501037_0066437
1717 Ga0501037_0213189
1718 Ga0501038_0342146
1719 Ga0501038_0347630
1720 Ga0501038_1161629
1721 Ga0501039_0530072
1722 Ga0501040_0122192
1723 Ga0501043_0114298
1724 Ga0501043_0285856
1725 Ga0501046_0010825
1726 Ga0501046_0016712
1727 Ga0501046_0051967
1728 Ga0501046_0143420
1729 Ga0501046_0236367
1730 Ga0501046_0348702
1731 Ga0501047_0002340
1732 Ga0501047_0027509
1733 Ga0501047_0048451
1734 Ga0501047_0075096
1735 Ga0501047_0082612
1736 Ga0501047_0092939
1737 Ga0501047_0131672
1738 Ga0501047_0319280
1739 Ga0501047_0359864
1740 Ga0501048_0157714
1741 Ga0501048_0207760
1742 Ga0501048_0363219
1743 Ga0501067_0086991
1744 Ga0501068_0026351
1745 Ga0501068_0346197
1746 Ga0501069_0277261
1747 Ga0501070_0000017
1748 Ga0501070_0102310
1749 Ga0501070_0118515
1750 Ga0501070_0226903
1751 Ga0501072_0001370
1752 Ga0501073_0009211
1753 Ga0501073_0028609
1754 Ga0501073_0154745
1755 Ga0501073_0410908
1756 Ga0501073_0625633
1757 Ga0501074_0150457
1758 Ga0501075_0307227
1759 Ga0501079_0025539
1760 Ga0501080_0000444
1761 Ga0501080_0014351
1762 Ga0501080_0027224
1763 Ga0501080_0074393
1764 Ga0501080_0108117
1765 Ga0501080_0135359
1766 Ga0501080_0907441
1767 Ga0501080_1166102
1768 Ga0501083_0009460
1769 Ga0501083_0055695
1770 Ga0501083_0093405
1771 Ga0501083_0110388
1772 Ga0501083_0171809
1773 Ga0501083_0548748
1774 Ga0501035_0001450
1775 Ga0501035_0009163
1776 Ga0501035_0029790
1777 Ga0501035_0119638
1778 Ga0501035_0197889
1779 Ga0501035_0510039
1780 Ga0501035_0622194
1781 Ga0501035_0753496
1782 Ga0501044_0003825
1783 Ga0501044_0004434
1784 Ga0501044_0008303
1785 Ga0501044_0057274
1786 Ga0501044_0157281
1787 Ga0501044_0257932
1788 Ga0501044_0346378
1789 Ga0501044_0359093
1790 Ga0501044_0415092
1791 Ga0501044_0628634
1792 Ga0501044_0876333
1793 Ga0501044_1020567
1794 nmdc:mga00v17_52217_c1
1795 nmdc:mga0yw44_919343_c1
1796 nmdc:mga05p37_320261_c1
1797 nmdc:mga05p37_960314_c1
1798 nmdc:mga0qj67_282664_c1
1799 nmdc:mga0qj67_412_c1
1800 nmdc:mga06r32_1512315_c1
1801 nmdc:mga06r32_17051_c1
1802 nmdc:mga06r32_539305_c1
1803 nmdc:mga0n895_1773762_c1
1804 nmdc:mga0n895_2189544_c1
1805 nmdc:mga0n895_323714_c1
1806 nmdc:mga0n895_32695_c1
1807 nmdc:mga08x19_1278715_c1
1808 nmdc:mga0a205_257139_c1
1809 Ga0495612_0077319
1810 Ga0500635_0035794
1811 Ga0495619_0072033
1812 Ga0500643_000006
1813 Ga0500555_050398
1814 Ga0500562_006158
1815 Ga0500562_047815
1816 Ga0500593_007195
1817 Ga0500595_005740
1818 Ga0500595_008167
1819 Ga0500595_020506
1820 Ga0500642_0104995
1821 Ga0500655_006993
1822 Ga0500573_0000009
1823 Ga0500616_0281507
1824 Ga0500616_0318860
1825 Ga0500619_004449
1826 Ga0500633_0361834
1827 Ga0500639_126243
1828 Ga0500639_223852
1829 Ga0500611_071217
1830 Ga0500645_061846
1831 Ga0500596_009664
1832 Ga0501084_0007509
1833 Ga0501084_0742321
1834 Ga0501084_0834389
1835 Ga0501082_0000028
1836 Ga0501082_0016977
1837 Ga0501082_0143400
1838 Ga0501082_0190970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

24

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9442 1 136
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9432 1 137
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9302 1 137
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9243 1 136
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.9023 1 136
ID Description Score Start End Superfamily
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9219 1 136 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9214 2 136 3.10.590.10
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9171 3 73 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9104 1 136 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9071 1 135 3.10.590.10
ID Description Score Start End GO Terms
AF-F8JGB9-F1-model_v4 Conserved hypothethical protein (DUF589) 0.9824 1 138
AF-A0A833D5U8-F1-model_v4 EVE domain-containing protein 0.9806 1 138
AF-A0A2U2CVA4-F1-model_v4 deleted 0.9802 1 138
AF-A0A1L3I9L8-F1-model_v4 EVE domain-containing protein 0.9792 1 138
AF-A0A3D9HF31-F1-model_v4 Putative RNA-binding protein with PUA-like domain 0.9791 1 138

Map