F485705

General Info

Members Datasets Scaffolds Average Seq Length
919 357 1838 177

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0609357|Ga0373937_0609357_345_944
Length 199
Sequence VAAGFADQDMRRPNHILREEVMRRLTVMAGALCLALVTGPGAFAQVPPDPNNPNEAVPETMSPTPYGDPINNETAKKVAAAAVAELQKRNWKGMCISIVDPHGELVYFERDDSCQFASISISQHKARTSARYRRPTVVFERLSGKGPFFGYLATLDDVIMSRGGNPLVVGGKIVGAIGVSGGTGSQDDVISQAGVAALK

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
96 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
97 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
98 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
183 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
289 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
344 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
348 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
349 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
350 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
351 2904699407
352 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
353 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
354 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
355 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
356 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
357 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0.11
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0.87
Rhizoplane 6.53
Rhizosphere 90.75
Stem 0
Stem Tuber 0
Unclassified 21.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0609357 3300036401 Bacteria 1036
2 Ga0070658_10048034 3300005327 Bacteria 3455
3 Ga0070676_10117053 3300005328 Bacteria 1667
4 Ga0070676_10179810 3300005328 Unclassified 1374
5 Ga0070683_100198154 3300005329 Bacteria 1907
6 Ga0070690_100378852 3300005330 Unclassified 1034
7 Ga0070690_100393322 3300005330 Bacteria 1016
8 Ga0070670_100894694 3300005331 Bacteria 804
9 Ga0070677_10300184 3300005333 Bacteria 816
10 Ga0068869_100083761 3300005334 Bacteria 2386
11 Ga0068869_100249497 3300005334 Bacteria 1417
12 Ga0070666_10041661 3300005335 Bacteria 3069
13 Ga0070680_100033411 3300005336 Bacteria 4146
14 Ga0070680_100558136 3300005336 Unclassified 982
15 Ga0070682_100066357 3300005337 Bacteria 2296
16 Ga0070682_100132202 3300005337 Bacteria 1690
17 Ga0070682_100190177 3300005337 Unclassified 1441
18 Ga0070682_100515271 3300005337 Bacteria 929
19 Ga0068868_100098480 3300005338 Bacteria 2364
20 Ga0068868_100201844 3300005338 Bacteria 1658
21 Ga0070660_100019325 3300005339 Bacteria 4990
22 Ga0070660_100096656 3300005339 Bacteria 2336
23 Ga0070660_100932346 3300005339 Unclassified 733
24 Ga0070689_100055250 3300005340 Bacteria 3076
25 Ga0070691_10062891 3300005341 Unclassified 1788
26 Ga0070661_100075305 3300005344 Bacteria 2486
27 Ga0070661_100117777 3300005344 Bacteria 1987
28 Ga0070661_100126065 3300005344 Bacteria 1921
29 Ga0070692_10265105 3300005345 Unclassified 1034
30 Ga0070668_100004789 3300005347 Bacteria 10035
31 Ga0070668_100711592 3300005347 Unclassified 886
32 Ga0070669_100651214 3300005353 Bacteria 886
33 Ga0070675_100060415 3300005354 Bacteria 3130
34 Ga0070671_100044203 3300005355 Bacteria 3701
35 Ga0070671_100568140 3300005355 Bacteria 979
36 Ga0070674_100001469 3300005356 Bacteria 12578
37 Ga0070674_100061198 3300005356 Bacteria 2627
38 Ga0070673_100177726 3300005364 Bacteria 1820
39 Ga0070673_100413067 3300005364 Bacteria 1209
40 Ga0070688_100079220 3300005365 Bacteria 2122
41 Ga0070667_100060576 3300005367 Bacteria 3202
42 Ga0070667_100086820 3300005367 Bacteria 2685
43 Ga0070667_100203646 3300005367 Bacteria 1757
44 Ga0070709_10073656 3300005434 Unclassified 2211
45 Ga0070709_10277554 3300005434 Bacteria 1217
46 Ga0070709_10491294 3300005434 Bacteria 931
47 Ga0070714_100031308 3300005435 Bacteria 4438
48 Ga0070714_100173722 3300005435 Bacteria 1957
49 Ga0070714_101220586 3300005435 Bacteria 734
50 Ga0070714_101303072 3300005435 Unclassified 709
51 Ga0070713_100001163 3300005436 Bacteria 16810
52 Ga0070713_100058408 3300005436 Bacteria 3217
53 Ga0070713_100162314 3300005436 Unclassified 1996
54 Ga0070713_100245842 3300005436 Bacteria 1630
55 Ga0070713_100255425 3300005436 Bacteria 1600
56 Ga0070713_100364712 3300005436 Unclassified 1343
57 Ga0070713_100607330 3300005436 Bacteria 1039
58 Ga0070710_10031153 3300005437 Bacteria 2876
59 Ga0070710_10042817 3300005437 Bacteria 2505
60 Ga0070710_10053031 3300005437 Bacteria 2283
61 Ga0070710_10116974 3300005437 Bacteria 1608
62 Ga0070710_10164412 3300005437 Bacteria 1379
63 Ga0070711_100113018 3300005439 Bacteria 1996
64 Ga0070711_100334974 3300005439 Bacteria 1212
65 Ga0070711_100733802 3300005439 Bacteria 834
66 Ga0070711_100895086 3300005439 Bacteria 757
67 Ga0070705_100204781 3300005440 Bacteria 1356
68 Ga0070705_100264637 3300005440 Unclassified 1215
69 Ga0070700_100230156 3300005441 Bacteria 1319
70 Ga0070694_100017310 3300005444 Bacteria 4552
71 Ga0070663_100113478 3300005455 Bacteria 2039
72 Ga0070663_100210240 3300005455 Bacteria 1523
73 Ga0070663_100216087 3300005455 Bacteria 1503
74 Ga0070678_100046002 3300005456 Bacteria 3126
75 Ga0070678_100126009 3300005456 Bacteria 2027
76 Ga0070678_100150882 3300005456 Bacteria 1872
77 Ga0070662_100074327 3300005457 Bacteria 2514
78 Ga0070662_100823778 3300005457 Unclassified 790
79 Ga0070681_10031409 3300005458 Bacteria 5333
80 Ga0070681_10120917 3300005458 Bacteria 2553
81 Ga0070681_10145225 3300005458 Unclassified 2302
82 Ga0070685_10226445 3300005466 Bacteria 1227
83 Ga0070707_100794723 3300005468 Unclassified 910
84 Ga0070707_101048548 3300005468 Bacteria 781
85 Ga0070699_100216448 3300005518 Bacteria 1706
86 Ga0070699_100820360 3300005518 Unclassified 851
87 Ga0070679_100107374 3300005530 Bacteria 2777
88 Ga0070679_100331769 3300005530 Bacteria 1470
89 Ga0070684_100266575 3300005535 Bacteria 1567
90 Ga0070684_100300682 3300005535 Bacteria 1472
91 Ga0070697_100641308 3300005536 Bacteria 935
92 Ga0070697_100976419 3300005536 Unclassified 753
93 Ga0068853_100007119 3300005539 Bacteria 8945
94 Ga0070672_100357426 3300005543 Bacteria 1246
95 Ga0070686_100007712 3300005544 Bacteria 6016
96 Ga0070686_100099825 3300005544 Bacteria 1959
97 Ga0070695_100062288 3300005545 Bacteria 2422
98 Ga0070695_100220588 3300005545 Unclassified 1366
99 Ga0070695_100743715 3300005545 Unclassified 782
100 Ga0070696_100071244 3300005546 Unclassified 2446
101 Ga0070696_100470951 3300005546 Unclassified 995
102 Ga0070696_100525227 3300005546 Unclassified 945
103 Ga0070693_100077404 3300005547 Bacteria 1974
104 Ga0070693_100094520 3300005547 Bacteria 1809
105 Ga0070693_100420457 3300005547 Bacteria 931
106 Ga0070693_100800450 3300005547 Bacteria 698
107 Ga0070665_100325788 3300005548 Bacteria 1540
108 Ga0068855_100011509 3300005563 Bacteria 10690
109 Ga0068855_100053031 3300005563 Bacteria 4772
110 Ga0068855_100963088 3300005563 Unclassified 898
111 Ga0068855_101095254 3300005563 Unclassified 833
112 Ga0068855_101385984 3300005563 Bacteria 725
113 Ga0070664_100193360 3300005564 Bacteria 1813
114 Ga0068857_100014636 3300005577 Bacteria 6842
115 Ga0068854_100524784 3300005578 Bacteria 1001
116 Ga0068856_100171378 3300005614 Bacteria 2182
117 Ga0068856_100280562 3300005614 Bacteria 1683
118 Ga0068856_100285668 3300005614 Bacteria 1667
119 Ga0068852_100099048 3300005616 Bacteria 2627
120 Ga0068859_100075400 3300005617 Bacteria 3413
121 Ga0068859_100968031 3300005617 Bacteria 934
122 Ga0068864_101557316 3300005618 Unclassified 664
123 Ga0068866_10147459 3300005718 Bacteria 1358
124 Ga0068866_10307157 3300005718 Unclassified 993
125 Ga0068861_100030177 3300005719 Bacteria 3971
126 Ga0068851_10123518 3300005834 Bacteria 1393
127 Ga0068870_10435416 3300005840 Unclassified 861
128 Ga0068863_100264537 3300005841 Bacteria 1663
129 Ga0068858_100511684 3300005842 Bacteria 1160
130 Ga0068860_100344094 3300005843 Bacteria 1466
131 Ga0068862_100156322 3300005844 Bacteria 2033
132 Ga0068862_101964968 3300005844 Unclassified 595
133 Ga0081455_10121167 3300005937 Bacteria 2061
134 Ga0070717_10042482 3300006028 Bacteria 3708
135 Ga0070717_10107084 3300006028 Bacteria 2381
136 Ga0070717_10531750 3300006028 Bacteria 1064
137 Ga0070717_10721379 3300006028 Bacteria 906
138 Ga0070716_100007618 3300006173 Bacteria 5338
139 Ga0070712_100089846 3300006175 Bacteria 2248
140 Ga0070712_100224243 3300006175 Bacteria 1489
141 Ga0097621_100056414 3300006237 Bacteria 3209
142 Ga0097621_100149322 3300006237 Bacteria 2003
143 Ga0097621_101127843 3300006237 Bacteria 737
144 Ga0068871_100082713 3300006358 Bacteria 2662
145 Ga0068871_100285126 3300006358 Unclassified 1446
146 Ga0075431_100498611 3300006847 Bacteria 1209
147 Ga0075433_10022802 3300006852 Bacteria 5260
148 Ga0075433_10171471 3300006852 Bacteria 1931
149 Ga0075434_100026486 3300006871 Bacteria 5682
150 Ga0075434_100035076 3300006871 Bacteria 4958
151 Ga0075434_100296107 3300006871 Unclassified 1638
152 Ga0075429_100955911 3300006880 Bacteria 749
153 Ga0068865_100032983 3300006881 Bacteria 3465
154 Ga0068865_100078047 3300006881 Unclassified 2368
155 Ga0075436_100003492 3300006914 Bacteria 10781
156 Ga0075436_100046815 3300006914 Bacteria 2983
157 Ga0075436_100242631 3300006914 Bacteria 1282
158 Ga0075436_100292700 3300006914 Bacteria 1166
159 Ga0075436_100538408 3300006914 Unclassified 857
160 Ga0097620_100075409 3300006931 Bacteria 3413
161 Ga0097620_100968059 3300006931 Bacteria 934
162 Ga0075435_100080890 3300007076 Bacteria 2668
163 Ga0105240_10000945 3300009093 Bacteria 51693
164 Ga0105240_10015366 3300009093 Bacteria 10409
165 Ga0105240_11304750 3300009093 Bacteria 765
166 Ga0111539_10368569 3300009094 Bacteria 1672
167 Ga0111539_11500142 3300009094 Bacteria 782
168 Ga0105245_10109610 3300009098 Bacteria 2566
169 Ga0105245_10641114 3300009098 Bacteria 1092
170 Ga0105247_10305321 3300009101 Bacteria 1105
171 Ga0105247_10503765 3300009101 Unclassified 883
172 Ga0114129_10727753 3300009147 Bacteria 1272
173 Ga0114129_10737017 3300009147 Unclassified 1263
174 Ga0105243_10018265 3300009148 Bacteria 5310
175 Ga0105243_10096863 3300009148 Bacteria 2441
176 Ga0105243_10160005 3300009148 Bacteria 1941
177 Ga0105243_10635693 3300009148 Bacteria 1032
178 Ga0105241_10064194 3300009174 Bacteria 2834
179 Ga0105241_10094845 3300009174 Unclassified 2361
180 Ga0105242_10037799 3300009176 Bacteria 3880
181 Ga0105242_10176663 3300009176 Bacteria 1881
182 Ga0105242_10290613 3300009176 Bacteria 1488
183 Ga0105248_10125176 3300009177 Bacteria 2899
184 Ga0105248_10225736 3300009177 Bacteria 2108
185 Ga0105237_10034579 3300009545 Bacteria 5116
186 Ga0105237_10336568 3300009545 Bacteria 1514
187 Ga0105237_10504820 3300009545 Unclassified 1216
188 Ga0105237_11152209 3300009545 Bacteria 782
189 Ga0105238_10029000 3300009551 Bacteria 5637
190 Ga0105238_10029780 3300009551 Bacteria 5561
191 Ga0105238_10118666 3300009551 Bacteria 2625
192 Ga0105238_10118897 3300009551 Bacteria 2623
193 Ga0105249_10091147 3300009553 Bacteria 2851
194 Ga0105249_10137670 3300009553 Bacteria 2338
195 Ga0105249_10938570 3300009553 Bacteria 933
196 Ga0105249_10997826 3300009553 Bacteria 906
197 Ga0105239_10064158 3300010375 Bacteria 4032
198 Ga0105239_10157693 3300010375 Unclassified 2535
199 Ga0105239_10264428 3300010375 Bacteria 1934
200 Ga0105246_10079217 3300011119 Bacteria 2335
201 Ga0105246_10414250 3300011119 Bacteria 1123
202 Ga0157340_1012301 3300012473 Unclassified 627
203 Ga0157313_1019493 3300012503 Unclassified 678
204 Ga0157315_1006199 3300012508 Bacteria 927
205 Ga0157338_1016045 3300012515 Bacteria 824
206 Ga0157373_10121492 3300013100 Unclassified 1836
207 Ga0157370_10042063 3300013104 Bacteria 4405
208 Ga0157369_10046386 3300013105 Bacteria 4722
209 Ga0157374_10368371 3300013296 Bacteria 1430
210 Ga0157374_10411689 3300013296 Bacteria 1350
211 Ga0157378_10110569 3300013297 Bacteria 2519
212 Ga0157378_10121895 3300013297 Bacteria 2404
213 Ga0157378_10159186 3300013297 Unclassified 2110
214 Ga0163162_10346200 3300013306 Bacteria 1619
215 Ga0163162_10405232 3300013306 Unclassified 1496
216 Ga0157372_10162033 3300013307 Bacteria 2585
217 Ga0157372_10261048 3300013307 Bacteria 2011
218 Ga0157372_10931804 3300013307 Bacteria 1007
219 Ga0157372_11942273 3300013307 Bacteria 676
220 Ga0157375_10301760 3300013308 Bacteria 1765
221 Ga0157375_10304136 3300013308 Bacteria 1758
222 Ga0157375_10725757 3300013308 Bacteria 1146
223 Ga0157375_11155249 3300013308 Bacteria 907
224 Ga0163163_10863862 3300014325 Unclassified 968
225 Ga0163163_12213640 3300014325 Unclassified 609
226 Ga0157380_10946601 3300014326 Bacteria 891
227 Ga0157377_10019144 3300014745 Bacteria 3574
228 Ga0157379_10101729 3300014968 Bacteria 2579
229 Ga0157379_10194829 3300014968 Bacteria 1831
230 Ga0157376_10109934 3300014969 Bacteria 2424
231 Ga0157376_10243738 3300014969 Bacteria 1675
232 Ga0157376_10778846 3300014969 Bacteria 968
233 Ga0182007_10067207 3300015262 Bacteria 1174
234 Ga0163161_10029152 3300017792 Bacteria 3923
235 Ga0184601_125268 3300019183 Unclassified 594
236 Ga0213876_10015945 3300021384 Bacteria 3976
237 Ga0213871_10037160 3300021441 Bacteria 1295
238 Ga0207656_10118051 3300025321 Bacteria 1232
239 Ga0207692_10099211 3300025898 Bacteria 1595
240 Ga0207692_10137347 3300025898 Unclassified 1387
241 Ga0207692_10278460 3300025898 Unclassified 1011
242 Ga0207642_10068578 3300025899 Unclassified 1678
243 Ga0207710_10082468 3300025900 Bacteria 1494
244 Ga0207710_10218930 3300025900 Unclassified 945
245 Ga0207710_10465822 3300025900 Bacteria 654
246 Ga0207688_10032344 3300025901 Bacteria 2891
247 Ga0207680_10047516 3300025903 Bacteria 2544
248 Ga0207699_10100036 3300025906 Unclassified 1838
249 Ga0207699_10185129 3300025906 Bacteria 1402
250 Ga0207699_10229418 3300025906 Bacteria 1271
251 Ga0207699_10938537 3300025906 Unclassified 639
252 Ga0207699_11048787 3300025906 Unclassified 603
253 Ga0207645_10025770 3300025907 Bacteria 3804
254 Ga0207645_10178766 3300025907 Unclassified 1392
255 Ga0207705_10229178 3300025909 Bacteria 1413
256 Ga0207707_10007863 3300025912 Bacteria 9272
257 Ga0207707_10014737 3300025912 Bacteria 6813
258 Ga0207707_10061700 3300025912 Bacteria 3262
259 Ga0207695_10060181 3300025913 Bacteria 3933
260 Ga0207695_10095212 3300025913 Bacteria 2983
261 Ga0207671_10453283 3300025914 Bacteria 1022
262 Ga0207693_10024907 3300025915 Bacteria 4746
263 Ga0207693_10028957 3300025915 Bacteria 4377
264 Ga0207693_10046591 3300025915 Bacteria 3406
265 Ga0207693_10078423 3300025915 Bacteria 2585
266 Ga0207693_10436981 3300025915 Bacteria 1023
267 Ga0207693_10862253 3300025915 Unclassified 696
268 Ga0207663_10128429 3300025916 Bacteria 1747
269 Ga0207663_10156076 3300025916 Bacteria 1605
270 Ga0207663_10294901 3300025916 Bacteria 1209
271 Ga0207663_10749574 3300025916 Bacteria 775
272 Ga0207660_10034342 3300025917 Bacteria 3514
273 Ga0207660_10935045 3300025917 Bacteria 707
274 Ga0207662_10073416 3300025918 Unclassified 2075
275 Ga0207662_10182440 3300025918 Bacteria 1351
276 Ga0207662_10317767 3300025918 Bacteria 1039
277 Ga0207657_10047987 3300025919 Bacteria 3730
278 Ga0207657_10096761 3300025919 Bacteria 2455
279 Ga0207657_10122749 3300025919 Unclassified 2136
280 Ga0207649_10056429 3300025920 Bacteria 2453
281 Ga0207649_10119664 3300025920 Unclassified 1773
282 Ga0207649_10322607 3300025920 Bacteria 1135
283 Ga0207652_10035613 3300025921 Bacteria 4203
284 Ga0207652_10036910 3300025921 Bacteria 4133
285 Ga0207652_10054988 3300025921 Bacteria 3423
286 Ga0207652_10748891 3300025921 Unclassified 870
287 Ga0207646_10128337 3300025922 Bacteria 2281
288 Ga0207646_10975382 3300025922 Unclassified 750
289 Ga0207681_10120958 3300025923 Unclassified 1920
290 Ga0207681_10390779 3300025923 Bacteria 1122
291 Ga0207694_10018798 3300025924 Bacteria 5223
292 Ga0207687_10291798 3300025927 Unclassified 1311
293 Ga0207687_10408122 3300025927 Bacteria 1119
294 Ga0207687_10417652 3300025927 Bacteria 1106
295 Ga0207700_10030110 3300025928 Bacteria 3839
296 Ga0207700_10144162 3300025928 Bacteria 1961
297 Ga0207700_11347643 3300025928 Unclassified 635
298 Ga0207664_10012070 3300025929 Bacteria 6170
299 Ga0207664_10857897 3300025929 Unclassified 816
300 Ga0207644_10016185 3300025931 Bacteria 5017
301 Ga0207644_10243177 3300025931 Bacteria 1433
302 Ga0207644_10590602 3300025931 Bacteria 921
303 Ga0207690_10461659 3300025932 Bacteria 1022
304 Ga0207706_10025659 3300025933 Bacteria 5280
305 Ga0207706_10056068 3300025933 Bacteria 3475
306 Ga0207706_10121631 3300025933 Bacteria 2295
307 Ga0207706_10629472 3300025933 Unclassified 920
308 Ga0207686_10030666 3300025934 Bacteria 3186
309 Ga0207686_10065757 3300025934 Bacteria 2314
310 Ga0207709_10061374 3300025935 Bacteria 2349
311 Ga0207709_10086950 3300025935 Bacteria 2031
312 Ga0207669_10091045 3300025937 Bacteria 1985
313 Ga0207704_10054467 3300025938 Bacteria 2439
314 Ga0207665_10015450 3300025939 Bacteria 5011
315 Ga0207665_11036925 3300025939 Unclassified 653
316 Ga0207711_10323691 3300025941 Bacteria 1425
317 Ga0207689_10099207 3300025942 Bacteria 2393
318 Ga0207661_10187062 3300025944 Bacteria 1813
319 Ga0207661_10188993 3300025944 Bacteria 1804
320 Ga0207667_10046812 3300025949 Bacteria 4581
321 Ga0207667_10052707 3300025949 Bacteria 4283
322 Ga0207651_10466123 3300025960 Bacteria 1086
323 Ga0207651_10551359 3300025960 Bacteria 1002
324 Ga0207651_11667585 3300025960 Unclassified 574
325 Ga0207712_10073704 3300025961 Bacteria 2463
326 Ga0207712_10768277 3300025961 Bacteria 845
327 Ga0207668_10001797 3300025972 Bacteria 12510
328 Ga0207668_10034739 3300025972 Bacteria 3350
329 Ga0207668_10706778 3300025972 Unclassified 886
330 Ga0207668_11155739 3300025972 Unclassified 695
331 Ga0207668_11309442 3300025972 Unclassified 652
332 Ga0207640_10720306 3300025981 Bacteria 857
333 Ga0207658_10046265 3300025986 Bacteria 3177
334 Ga0207658_10299683 3300025986 Bacteria 1384
335 Ga0207658_10304865 3300025986 Bacteria 1373
336 Ga0207677_10694486 3300026023 Unclassified 902
337 Ga0207703_10109011 3300026035 Bacteria 2359
338 Ga0207703_10136860 3300026035 Bacteria 2121
339 Ga0207703_10560243 3300026035 Unclassified 1078
340 Ga0207703_10648231 3300026035 Bacteria 1002
341 Ga0207639_10092092 3300026041 Bacteria 2429
342 Ga0207678_10062758 3300026067 Bacteria 3193
343 Ga0207678_10069402 3300026067 Bacteria 3022
344 Ga0207678_10238827 3300026067 Bacteria 1556
345 Ga0207678_10260779 3300026067 Bacteria 1485
346 Ga0207678_10851340 3300026067 Unclassified 806
347 Ga0207708_10074555 3300026075 Bacteria 2601
348 Ga0207708_10273035 3300026075 Bacteria 1368
349 Ga0207702_10287163 3300026078 Bacteria 1557
350 Ga0207648_10091109 3300026089 Bacteria 2665
351 Ga0207648_11607506 3300026089 Bacteria 611
352 Ga0207676_11051647 3300026095 Unclassified 803
353 Ga0207674_10033519 3300026116 Bacteria 5376
354 Ga0207675_100004169 3300026118 Bacteria 13990
355 Ga0207675_100190743 3300026118 Bacteria 1966
356 Ga0207683_10003484 3300026121 Bacteria 13733
357 Ga0207683_10015950 3300026121 Bacteria 6394
358 Ga0207683_10079244 3300026121 Bacteria 2912
359 Ga0207698_10796413 3300026142 Bacteria 947
360 Ga0207428_10143579 3300027907 Bacteria 1820
361 Ga0207428_10771940 3300027907 Bacteria 684
362 Ga0268266_10108008 3300028379 Bacteria 2461
363 Ga0268266_10621999 3300028379 Bacteria 1038
364 Ga0268266_10657809 3300028379 Bacteria 1008
365 Ga0265334_10014941 3300028573 Bacteria 3231
366 Ga0265338_10276241 3300028800 Bacteria 1229
367 Ga0265338_10367040 3300028800 Bacteria 1031
368 Ga0265324_10191992 3300029957 Bacteria 694
369 Ga0265330_10076631 3300031235 Bacteria 1443
370 Ga0265325_10000048 3300031241 Bacteria 82899
371 Ga0265325_10214295 3300031241 Bacteria 883
372 Ga0265340_10084392 3300031247 Bacteria 1491
373 Ga0265340_10237785 3300031247 Bacteria 813
374 Ga0265340_10255186 3300031247 Bacteria 781
375 Ga0265331_10311169 3300031250 Bacteria 705
376 Ga0265316_10073214 3300031344 Bacteria 2639
377 Ga0265316_10632276 3300031344 Bacteria 758
378 Ga0265314_10009879 3300031711 Bacteria 8007
379 Ga0373930_0016882 3300034816 Bacteria 1386
380 Ga0373948_0019547 3300034817 Unclassified 1282
381 Ga0373958_0019107 3300034819 Bacteria 1249
382 Ga0373959_0119451 3300034820 Bacteria 643
383 Ga0373926_0001058 3300035083 Bacteria 8091
384 Ga0373926_0001601 3300035083 Bacteria 6971
385 Ga0373926_0021511 3300035083 Bacteria 2234
386 Ga0373929_0080683 3300035085 Unclassified 792
387 Ga0373934_0061060 3300035086 Bacteria 1501
388 Ga0373940_0175534 3300035088 Unclassified 694
389 Ga0373944_0010442 3300035089 Unclassified 2531
390 Ga0373944_0026854 3300035089 Bacteria 1703
391 Ga0373951_0012289 3300035091 Bacteria 1925
392 Ga0373951_0047258 3300035091 Bacteria 1051
393 Ga0373952_0007777 3300035092 Bacteria 2019
394 Ga0373923_0015615 3300035111 Bacteria 2869
395 Ga0373923_0076512 3300035111 Bacteria 1445
396 Ga0373936_0012788 3300035113 Bacteria 3198
397 Ga0373936_0015863 3300035113 Bacteria 2890
398 Ga0373936_0017322 3300035113 Unclassified 2773
399 Ga0373936_0097807 3300035113 Unclassified 1236
400 Ga0373936_0133452 3300035113 Bacteria 1068
401 Ga0373939_0010020 3300035114 Bacteria 2360
402 Ga0373941_0129557 3300035115 Unclassified 907
403 Ga0373945_0006535 3300035116 Bacteria 3766
404 Ga0373945_0024643 3300035116 Bacteria 2086
405 Ga0373945_0027116 3300035116 Unclassified 2000
406 Ga0373945_0177440 3300035116 Unclassified 875
407 Ga0373945_0190615 3300035116 Bacteria 847
408 Ga0373953_0025411 3300035117 Bacteria 2262
409 Ga0373953_0026092 3300035117 Unclassified 2236
410 Ga0373953_0170322 3300035117 Unclassified 937
411 Ga0373953_0185976 3300035117 Unclassified 897
412 Ga0373954_0007748 3300035118 Bacteria 4698
413 Ga0373954_0015424 3300035118 Bacteria 3415
414 Ga0373954_0027582 3300035118 Bacteria 2608
415 Ga0373954_0043351 3300035118 Bacteria 2098
416 Ga0373954_0047599 3300035118 Unclassified 2007
417 Ga0373954_0110462 3300035118 Bacteria 1330
418 Ga0373956_0037962 3300035119 Bacteria 2130
419 Ga0373956_0054134 3300035119 Bacteria 1807
420 Ga0373956_0145045 3300035119 Unclassified 1115
421 Ga0373957_0014032 3300035120 Bacteria 2731
422 Ga0373957_0042803 3300035120 Unclassified 1709
423 Ga0373957_0091495 3300035120 Unclassified 1209
424 Ga0373957_0148968 3300035120 Unclassified 960
425 Ga0373960_0095442 3300035121 Bacteria 957
426 Ga0373943_0015289 3300035170 Bacteria 3485
427 Ga0373943_0075650 3300035170 Bacteria 1715
428 Ga0373943_0183747 3300035170 Unclassified 1150
429 Ga0373943_0189945 3300035170 Bacteria 1132
430 Ga0373946_0029747 3300035171 Bacteria 2176
431 Ga0373946_0115220 3300035171 Bacteria 1221
432 Ga0373955_0000294 3300035172 Bacteria 20614
433 Ga0373955_0002670 3300035172 Bacteria 7801
434 Ga0373955_0007232 3300035172 Bacteria 5093
435 Ga0373955_0053493 3300035172 Bacteria 2204
436 Ga0373955_0108656 3300035172 Bacteria 1601
437 Ga0373942_0019741 3300035207 Bacteria 1685
438 Ga0373942_0033815 3300035207 Unclassified 1365
439 Ga0373961_0300322 3300035241 Unclassified 594
440 Ga0373962_0023574 3300035242 Bacteria 1640
441 Ga0373924_0001452 3300035410 Bacteria 7702
442 Ga0373924_0024494 3300035410 Unclassified 2378
443 Ga0373924_0053134 3300035410 Bacteria 1682
444 Ga0373924_0084491 3300035410 Bacteria 1353
445 Ga0373924_0114869 3300035410 Bacteria 1166
446 Ga0373924_0311171 3300035410 Bacteria 700
447 Ga0373931_0006069 3300035691 Bacteria 5628
448 Ga0373931_0178515 3300035691 Unclassified 1256
449 Ga0373931_0184159 3300035691 Bacteria 1239
450 Ga0373935_0007394 3300035692 Bacteria 6572
451 Ga0373935_0024182 3300035692 Bacteria 3737
452 Ga0373935_0027203 3300035692 Bacteria 3535
453 Ga0373935_0038005 3300035692 Bacteria 3013
454 Ga0373935_0194372 3300035692 Bacteria 1399
455 Ga0373935_0606933 3300035692 Unclassified 800
456 Ga0373927_0109948 3300035695 Bacteria 1795
457 Ga0373927_0212865 3300035695 Bacteria 1269
458 Ga0373927_0298459 3300035695 Bacteria 1060
459 Ga0373927_0383759 3300035695 Unclassified 926
460 Ga0373933_0004809 3300035724 Bacteria 7385
461 Ga0373933_0010078 3300035724 Bacteria 5172
462 Ga0373933_0121529 3300035724 Bacteria 1636
463 Ga0373933_0148466 3300035724 Bacteria 1483
464 Ga0373933_0153659 3300035724 Unclassified 1458
465 Ga0373933_0214900 3300035724 Bacteria 1233
466 Ga0373947_0000391 3300035725 Bacteria 24724
467 Ga0373947_0006399 3300035725 Bacteria 6844
468 Ga0373947_0034398 3300035725 Bacteria 2996
469 Ga0373947_0155066 3300035725 Unclassified 1477
470 Ga0373947_0359717 3300035725 Bacteria 977
471 Ga0373947_0388168 3300035725 Unclassified 940
472 Ga0373947_0413898 3300035725 Unclassified 910
473 Ga0373947_0466227 3300035725 Bacteria 856
474 Ga0373947_0507585 3300035725 Bacteria 820
475 Ga0373937_0000081 3300036401 Bacteria 88009
476 Ga0373937_0001398 3300036401 Bacteria 20148
477 Ga0373937_0149359 3300036401 Bacteria 2188
478 Ga0373937_0234445 3300036401 Unclassified 1728
479 Ga0373937_0253492 3300036401 Unclassified 1659
480 Ga0373937_0352978 3300036401 Bacteria 1393
481 Ga0373937_0361561 3300036401 Unclassified 1375
482 Ga0373937_0715730 3300036401 Unclassified 948
483 Ga0373925_0000425 3300037068 Bacteria 42725
484 Ga0373925_0014118 3300037068 Bacteria 5781
485 Ga0373925_0678221 3300037068 Bacteria 849
486 Ga0373925_0859774 3300037068 Unclassified 747
487 Ga0373925_0972397 3300037068 Bacteria 699
488 Ga0436365_1710235 3300039437 Bacteria 926
489 Ga0436360_1328245 3300039438 Bacteria 3119
490 Ga0436362_0185652 3300039453 Bacteria 1442
491 Ga0451577_0071989 3300042876 Bacteria 3083
492 Ga0466963_0352214 3300044694 Bacteria 1037
493 Ga0466971_0038829 3300044719 Bacteria 2137
494 Ga0466957_0221393 3300044842 Bacteria 1250
495 Ga0466959_0565570 3300045049 Bacteria 766
496 Ga0451576_0003473 3300045051 Bacteria 21579
497 Ga0451576_0377738 3300045051 Bacteria 1485
498 Ga0466967_0249655 3300045976 Bacteria 1695
499 Ga0466967_0452865 3300045976 Unclassified 1254
500 Ga0495617_028376 3300046452 Unclassified 1881
501 Ga0495592_0000177 3300046454 Bacteria 56202
502 Ga0495592_0007387 3300046454 Bacteria 8223
503 Ga0495592_0044961 3300046454 Unclassified 3296
504 Ga0495592_0063633 3300046454 Bacteria 2705
505 Ga0495592_0092689 3300046454 Bacteria 2164
506 Ga0495592_0160998 3300046454 Bacteria 1544
507 Ga0495603_0005357 3300046455 Bacteria 7649
508 Ga0495603_0135661 3300046455 Bacteria 1432
509 Ga0495591_034011 3300046458 Bacteria 1504
510 Ga0495629_0013975 3300046459 Bacteria 5788
511 Ga0495629_0014801 3300046459 Bacteria 5610
512 Ga0495629_0064352 3300046459 Bacteria 2561
513 Ga0495629_0110721 3300046459 Bacteria 1914
514 Ga0495629_0119398 3300046459 Bacteria 1837
515 Ga0495629_0172731 3300046459 Bacteria 1499
516 Ga0495629_0417795 3300046459 Unclassified 910
517 Ga0495641_0013945 3300046461 Unclassified 4377
518 Ga0495641_0041779 3300046461 Unclassified 2128
519 Ga0495651_0000210 3300046462 Bacteria 44718
520 Ga0495651_0000979 3300046462 Bacteria 22156
521 Ga0495651_0003153 3300046462 Bacteria 12701
522 Ga0495651_0017937 3300046462 Bacteria 5481
523 Ga0495651_0044115 3300046462 Bacteria 3456
524 Ga0495651_0165330 3300046462 Bacteria 1581
525 Ga0495651_0639071 3300046462 Unclassified 668
526 Ga0495653_0000054 3300046463 Bacteria 102885
527 Ga0495653_0000528 3300046463 Bacteria 29299
528 Ga0495653_0001202 3300046463 Bacteria 20094
529 Ga0495653_0008981 3300046463 Bacteria 8174
530 Ga0495653_0102463 3300046463 Bacteria 2071
531 Ga0495653_0241686 3300046463 Bacteria 1203
532 Ga0495580_0022339 3300046472 Bacteria 4656
533 Ga0495580_0029504 3300046472 Bacteria 3980
534 Ga0495582_0029526 3300046473 Bacteria 3010
535 Ga0495582_0050389 3300046473 Bacteria 2294
536 Ga0495582_0067845 3300046473 Bacteria 1971
537 Ga0495582_0269713 3300046473 Bacteria 976
538 Ga0495582_0272447 3300046473 Unclassified 971
539 Ga0495582_0373097 3300046473 Unclassified 822
540 Ga0495639_0042151 3300046475 Bacteria 2057
541 Ga0495639_0080525 3300046475 Bacteria 1516
542 Ga0495639_0310326 3300046475 Bacteria 788
543 Ga0495639_0364727 3300046475 Unclassified 726
544 Ga0495662_0006393 3300046476 Bacteria 5886
545 Ga0495662_0083117 3300046476 Unclassified 1558
546 Ga0495662_0095906 3300046476 Bacteria 1449
547 Ga0495662_0206390 3300046476 Unclassified 968
548 Ga0495664_0000020 3300046477 Bacteria 150749
549 Ga0495664_0002815 3300046477 Bacteria 9349
550 Ga0495664_0060964 3300046477 Unclassified 2246
551 Ga0495664_0124455 3300046477 Unclassified 1559
552 Ga0495664_0205806 3300046477 Bacteria 1192
553 Ga0495664_0320637 3300046477 Bacteria 934
554 Ga0495664_0413970 3300046477 Unclassified 809
555 Ga0495585_0000995 3300046492 Bacteria 23693
556 Ga0495585_0190857 3300046492 Bacteria 1048
557 Ga0495585_0267215 3300046492 Unclassified 849
558 Ga0495594_0009061 3300046499 Bacteria 5137
559 Ga0495594_0009465 3300046499 Bacteria 5034
560 Ga0495594_0009573 3300046499 Bacteria 5009
561 Ga0495607_0013487 3300046501 Bacteria 5354
562 Ga0495607_0330219 3300046501 Unclassified 709
563 Ga0495608_0000024 3300046511 Bacteria 159429
564 Ga0495608_0000363 3300046511 Bacteria 31688
565 Ga0495608_0025424 3300046511 Bacteria 4042
566 Ga0495608_0026296 3300046511 Bacteria 3968
567 Ga0495608_0037615 3300046511 Bacteria 3254
568 Ga0495608_0047457 3300046511 Bacteria 2855
569 Ga0495608_0055855 3300046511 Bacteria 2609
570 Ga0495616_0270259 3300046513 Bacteria 725
571 Ga0495618_0000020 3300046514 Bacteria 130661
572 Ga0495618_0012894 3300046514 Bacteria 5080
573 Ga0495618_0063650 3300046514 Unclassified 2342
574 Ga0495618_0135188 3300046514 Bacteria 1577
575 Ga0495618_0380630 3300046514 Unclassified 866
576 Ga0495618_0422596 3300046514 Unclassified 812
577 Ga0495628_0000015 3300046516 Bacteria 198912
578 Ga0495628_0001606 3300046516 Bacteria 20730
579 Ga0495628_0022277 3300046516 Bacteria 5205
580 Ga0495628_0051882 3300046516 Bacteria 3241
581 Ga0495628_0179614 3300046516 Bacteria 1601
582 Ga0495628_0220556 3300046516 Bacteria 1424
583 Ga0495628_0414884 3300046516 Bacteria 982
584 Ga0495630_0001403 3300046517 Bacteria 16663
585 Ga0495630_0006847 3300046517 Bacteria 8124
586 Ga0495630_0068880 3300046517 Bacteria 2661
587 Ga0495630_0078947 3300046517 Bacteria 2482
588 Ga0495630_0133399 3300046517 Unclassified 1886
589 Ga0495630_0348429 3300046517 Unclassified 1133
590 Ga0495630_0406623 3300046517 Bacteria 1043
591 Ga0495631_0184306 3300046518 Bacteria 894
592 Ga0495632_0152268 3300046519 Bacteria 1069
593 Ga0495637_0099655 3300046520 Bacteria 1137
594 Ga0495637_0113641 3300046520 Unclassified 1047
595 Ga0495644_0002021 3300046523 Bacteria 8158
596 Ga0495644_0183585 3300046523 Unclassified 804
597 Ga0495663_0038866 3300046525 Unclassified 1440
598 Ga0495666_0010026 3300046526 Bacteria 4729
599 Ga0495666_0019975 3300046526 Bacteria 3322
600 Ga0495666_0285215 3300046526 Unclassified 748
601 Ga0495652_0000006 3300046529 Bacteria 459709
602 Ga0495652_0021629 3300046529 Bacteria 5716
603 Ga0495652_0028971 3300046529 Bacteria 4864
604 Ga0495652_0037531 3300046529 Bacteria 4202
605 Ga0495652_0052449 3300046529 Bacteria 3478
606 Ga0495652_0214032 3300046529 Bacteria 1452
607 Ga0495665_0013877 3300046531 Bacteria 4351
608 Ga0495665_0029669 3300046531 Bacteria 2930
609 Ga0495665_0300197 3300046531 Unclassified 822
610 Ga0495665_0449839 3300046531 Unclassified 651
611 Ga0495640_0000002 3300046533 Bacteria 646434
612 Ga0495640_0009366 3300046533 Bacteria 7625
613 Ga0495640_0035429 3300046533 Bacteria 3532
614 Ga0495640_0358325 3300046533 Unclassified 899
615 Ga0495586_0012387 3300046535 Bacteria 4523
616 Ga0495586_0020698 3300046535 Bacteria 3503
617 Ga0495586_0093784 3300046535 Unclassified 1660
618 Ga0495586_0153680 3300046535 Unclassified 1295
619 Ga0495586_0314286 3300046535 Bacteria 898
620 Ga0495587_0000001 3300046536 Bacteria 724132
621 Ga0495587_0007214 3300046536 Bacteria 7210
622 Ga0495587_0008295 3300046536 Bacteria 6689
623 Ga0495587_0015467 3300046536 Bacteria 4765
624 Ga0495587_0168109 3300046536 Unclassified 1246
625 Ga0495587_0339134 3300046536 Bacteria 838
626 Ga0495598_0001368 3300046537 Bacteria 4794
627 Ga0495609_0023475 3300046538 Bacteria 2835
628 Ga0495621_0185497 3300046539 Bacteria 832
629 Ga0495645_0000013 3300046543 Bacteria 186399
630 Ga0495645_0001389 3300046543 Bacteria 16360
631 Ga0495645_0002241 3300046543 Bacteria 13151
632 Ga0495645_0021101 3300046543 Bacteria 4707
633 Ga0495645_0438028 3300046543 Unclassified 826
634 Ga0495622_0009159 3300046557 Bacteria 4582
635 Ga0495622_0032737 3300046557 Unclassified 2427
636 Ga0495622_0045319 3300046557 Bacteria 2044
637 Ga0495667_0000030 3300046559 Bacteria 147898
638 Ga0495667_0007285 3300046559 Bacteria 7507
639 Ga0495667_0008025 3300046559 Bacteria 7160
640 Ga0495667_0026131 3300046559 Bacteria 3933
641 Ga0495667_0044504 3300046559 Unclassified 2940
642 Ga0495667_0147425 3300046559 Bacteria 1515
643 Ga0495667_0211148 3300046559 Bacteria 1240
644 Ga0495656_0254328 3300046615 Bacteria 888
645 Ga0495634_0000117 3300046642 Bacteria 67216
646 Ga0495634_0002830 3300046642 Bacteria 14243
647 Ga0495634_0078649 3300046642 Bacteria 2160
648 Ga0495634_0089026 3300046642 Bacteria 2007
649 Ga0495634_0120109 3300046642 Bacteria 1683
650 Ga0495634_0123845 3300046642 Unclassified 1653
651 Ga0495634_0211828 3300046642 Unclassified 1199
652 Ga0495634_0390305 3300046642 Unclassified 828
653 Ga0495611_0015454 3300046648 Bacteria 3264
654 Ga0495635_0000001 3300046663 Bacteria 704901
655 Ga0495635_0000730 3300046663 Bacteria 21233
656 Ga0495635_0017369 3300046663 Bacteria 5026
657 Ga0495635_0052084 3300046663 Bacteria 2820
658 Ga0495635_0058753 3300046663 Unclassified 2645
659 Ga0495635_0082043 3300046663 Bacteria 2206
660 Ga0495635_0116088 3300046663 Unclassified 1827
661 Ga0495635_0185053 3300046663 Bacteria 1415
662 Ga0495635_0238677 3300046663 Bacteria 1227
663 Ga0495635_0408012 3300046663 Unclassified 902
664 Ga0495659_0014801 3300046664 Unclassified 2558
665 Ga0495659_0055651 3300046664 Bacteria 1450
666 Ga0495661_0044492 3300046665 Unclassified 2721
667 Ga0495661_0183843 3300046665 Bacteria 1106
668 Ga0495588_0001656 3300046674 Bacteria 9523
669 Ga0495588_0069820 3300046674 Unclassified 1826
670 Ga0495657_0000028 3300046675 Bacteria 131008
671 Ga0495657_0004124 3300046675 Bacteria 11637
672 Ga0495657_0007370 3300046675 Bacteria 8501
673 Ga0495657_0107600 3300046675 Unclassified 1769
674 Ga0495657_0163773 3300046675 Unclassified 1374
675 Ga0495657_0187632 3300046675 Unclassified 1265
676 Ga0495599_0000050 3300046678 Bacteria 82601
677 Ga0495599_0001421 3300046678 Bacteria 13703
678 Ga0495599_0003607 3300046678 Bacteria 9079
679 Ga0495599_0035288 3300046678 Bacteria 3139
680 Ga0495599_0068968 3300046678 Unclassified 2207
681 Ga0495599_0113628 3300046678 Unclassified 1685
682 Ga0495599_0253523 3300046678 Bacteria 1070
683 Ga0495599_0420429 3300046678 Bacteria 794
684 Ga0495623_0000013 3300046679 Bacteria 119870
685 Ga0495623_0002343 3300046679 Bacteria 12621
686 Ga0495623_0012831 3300046679 Bacteria 5426
687 Ga0495623_0125282 3300046679 Bacteria 1543
688 Ga0495646_0000003 3300046680 Bacteria 287773
689 Ga0495646_0001198 3300046680 Bacteria 15177
690 Ga0495646_0014444 3300046680 Bacteria 5021
691 Ga0495646_0019546 3300046680 Bacteria 4286
692 Ga0495646_0035661 3300046680 Bacteria 3085
693 Ga0495646_0632207 3300046680 Unclassified 542
694 Ga0495647_0003783 3300046681 Bacteria 4867
695 Ga0495647_0043889 3300046681 Bacteria 1712
696 Ga0495647_0329865 3300046681 Unclassified 692
697 Ga0495658_0033382 3300046683 Bacteria 2817
698 Ga0495658_0102964 3300046683 Bacteria 1706
699 Ga0495658_0117891 3300046683 Unclassified 1602
700 Ga0495658_0155192 3300046683 Bacteria 1408
701 Ga0495658_0180135 3300046683 Bacteria 1311
702 Ga0495658_0543346 3300046683 Unclassified 744
703 Ga0495669_0006462 3300046684 Bacteria 4896
704 Ga0495613_0062399 3300046689 Bacteria 2727
705 Ga0495613_0112842 3300046689 Bacteria 1957
706 Ga0495613_0133899 3300046689 Bacteria 1774
707 Ga0495613_0171154 3300046689 Bacteria 1541
708 Ga0495613_0174735 3300046689 Bacteria 1523
709 Ga0495613_0297627 3300046689 Unclassified 1117
710 Ga0495613_0426013 3300046689 Unclassified 902
711 Ga0495624_0009345 3300046690 Bacteria 6793
712 Ga0495624_0055522 3300046690 Bacteria 2494
713 Ga0495624_0203750 3300046690 Bacteria 1201
714 Ga0495670_0001271 3300046691 Bacteria 12333
715 Ga0495600_0000002 3300046809 Bacteria 186597
716 Ga0495600_0002739 3300046809 Bacteria 10205
717 Ga0495600_0003702 3300046809 Bacteria 9035
718 Ga0495600_0011581 3300046809 Bacteria 5500
719 Ga0495600_0050772 3300046809 Unclassified 2706
720 Ga0495581_0069003 3300047315 Bacteria 2044
721 Ga0495581_0072904 3300047315 Unclassified 1987
722 Ga0495581_0116039 3300047315 Bacteria 1557
723 Ga0495581_0390261 3300047315 Unclassified 812
724 Ga0495581_0479639 3300047315 Bacteria 723
725 Ga0495604_0000001 3300047317 Bacteria 708627
726 Ga0495604_0000186 3300047317 Bacteria 55450
727 Ga0495604_0001606 3300047317 Bacteria 18631
728 Ga0495604_0006423 3300047317 Bacteria 9332
729 Ga0495604_0053395 3300047317 Bacteria 3123
730 Ga0495604_0210861 3300047317 Bacteria 1342
731 Ga0495604_0230178 3300047317 Bacteria 1271
732 Ga0495604_0239635 3300047317 Bacteria 1241
733 Ga0495674_0000018 3300047319 Bacteria 204024
734 Ga0495674_0017517 3300047319 Bacteria 6668
735 Ga0495674_0048394 3300047319 Unclassified 3762
736 Ga0495674_0107696 3300047319 Bacteria 2365
737 Ga0495674_0109689 3300047319 Unclassified 2340
738 Ga0495674_0385549 3300047319 Bacteria 1133
739 Ga0495676_0090294 3300047321 Bacteria 2293
740 Ga0495676_0131656 3300047321 Bacteria 1804
741 Ga0495676_0251202 3300047321 Bacteria 1206
742 Ga0495676_0624437 3300047321 Bacteria 700
743 Ga0495676_0920310 3300047321 Bacteria 560
744 Ga0495680_0000159 3300047322 Bacteria 68873
745 Ga0495680_0005565 3300047322 Bacteria 11826
746 Ga0495680_0014550 3300047322 Bacteria 6811
747 Ga0495680_0018619 3300047322 Bacteria 5886
748 Ga0495680_0023301 3300047322 Bacteria 5149
749 Ga0495680_0099178 3300047322 Bacteria 2172
750 Ga0495680_0117268 3300047322 Bacteria 1968
751 Ga0495675_0000238 3300047444 Bacteria 39857
752 Ga0495675_0005457 3300047444 Bacteria 7755
753 Ga0495675_0014186 3300047444 Bacteria 5038
754 Ga0495675_0035513 3300047444 Bacteria 3184
755 Ga0495677_0069875 3300047445 Bacteria 1308
756 Ga0495679_008677 3300047446 Bacteria 4115
757 Ga0495684_0000010 3300047471 Bacteria 198915
758 Ga0495684_0024373 3300047471 Bacteria 4658
759 Ga0495684_0042639 3300047471 Bacteria 3475
760 Ga0495684_0046067 3300047471 Bacteria 3336
761 Ga0495684_0098856 3300047471 Bacteria 2206
762 Ga0495684_0169378 3300047471 Bacteria 1625
763 Ga0495684_0213523 3300047471 Bacteria 1417
764 Ga0495684_0590862 3300047471 Unclassified 750
765 Ga0495684_0666743 3300047471 Unclassified 694
766 Ga0495593_0005079 3300047673 Bacteria 7782
767 Ga0495593_0010567 3300047673 Bacteria 5325
768 Ga0495593_0091277 3300047673 Bacteria 1568
769 Ga0495593_0169305 3300047673 Unclassified 1101
770 Ga0495593_0233485 3300047673 Unclassified 922
771 Ga0495593_0326109 3300047673 Unclassified 767
772 Ga0495602_0000016 3300048088 Bacteria 190311
773 Ga0495602_0052962 3300048088 Bacteria 3598
774 Ga0495602_0063590 3300048088 Bacteria 3196
775 Ga0495602_0221465 3300048088 Bacteria 1428
776 Ga0495602_0234184 3300048088 Bacteria 1377
777 Ga0495614_0040128 3300048089 Bacteria 2009
778 Ga0495614_0046055 3300048089 Bacteria 1870
779 Ga0495614_0375567 3300048089 Unclassified 665
780 Ga0496100_0402642 3300048903 Unclassified 1042
781 Ga0496101_0051375 3300048904 Bacteria 2970
782 Ga0496101_0166110 3300048904 Bacteria 1694
783 Ga0496101_0293972 3300048904 Unclassified 1271
784 Ga0496101_0462931 3300048904 Unclassified 1001
785 Ga0496102_0017814 3300048905 Bacteria 6227
786 Ga0496102_0060926 3300048905 Bacteria 3452
787 Ga0496102_0267842 3300048905 Unclassified 1610
788 Ga0496103_0055638 3300048906 Bacteria 2454
789 Ga0496103_0151110 3300048906 Bacteria 1487
790 Ga0496104_0032534 3300048907 Bacteria 4854
791 Ga0496104_0058138 3300048907 Bacteria 3660
792 Ga0496104_0085556 3300048907 Bacteria 3009
793 Ga0496104_0462910 3300048907 Bacteria 1179
794 Ga0496104_1175305 3300048907 Bacteria 670
795 Ga0496105_0068036 3300048908 Bacteria 2941
796 Ga0496105_0366952 3300048908 Unclassified 1147
797 Ga0496105_0386842 3300048908 Bacteria 1112
798 Ga0496105_0482193 3300048908 Unclassified 975
799 Ga0496105_0482659 3300048908 Bacteria 975
800 Ga0496105_0499295 3300048908 Bacteria 955
801 Ga0496106_0028455 3300048909 Bacteria 4163
802 Ga0496106_0029719 3300048909 Bacteria 4074
803 Ga0496106_0233882 3300048909 Bacteria 1467
804 Ga0496106_0329034 3300048909 Bacteria 1227
805 Ga0496106_0670663 3300048909 Bacteria 828
806 Ga0496106_0707666 3300048909 Bacteria 802
807 Ga0496107_0025221 3300048910 Bacteria 4207
808 Ga0496107_0097133 3300048910 Bacteria 2156
809 Ga0496107_0422806 3300048910 Unclassified 990
810 Ga0496108_0087058 3300048911 Unclassified 2653
811 Ga0496108_0210262 3300048911 Bacteria 1689
812 Ga0496108_0342899 3300048911 Bacteria 1303
813 Ga0496108_0412543 3300048911 Bacteria 1179
814 Ga0496108_1201883 3300048911 Unclassified 641
815 Ga0496109_0095873 3300048912 Bacteria 2747
816 Ga0496109_0955306 3300048912 Bacteria 795
817 Ga0496110_0004047 3300048913 Bacteria 11313
818 Ga0496111_0396811 3300048914 Unclassified 1019
819 Ga0496111_0700748 3300048914 Bacteria 736
820 Ga0496112_0011548 3300048915 Bacteria 8072
821 Ga0496112_0216209 3300048915 Bacteria 1873
822 Ga0496112_0422766 3300048915 Bacteria 1271
823 Ga0496112_0919140 3300048915 Bacteria 796
824 Ga0496112_0927654 3300048915 Bacteria 792
825 Ga0496113_0300341 3300048916 Bacteria 1285
826 Ga0496113_0378927 3300048916 Bacteria 1135
827 Ga0496114_0023602 3300048917 Bacteria 5020
828 Ga0496114_0067970 3300048917 Bacteria 2991
829 Ga0496114_0150087 3300048917 Unclassified 2022
830 Ga0496114_0847416 3300048917 Unclassified 794
831 Ga0496115_0016906 3300048918 Bacteria 5564
832 Ga0496115_0046719 3300048918 Unclassified 3461
833 Ga0496115_0061104 3300048918 Bacteria 3037
834 Ga0496115_0112722 3300048918 Bacteria 2234
835 Ga0496115_0153388 3300048918 Bacteria 1902
836 Ga0496115_0159672 3300048918 Bacteria 1863
837 Ga0496115_0314246 3300048918 Bacteria 1282
838 Ga0496115_0315733 3300048918 Bacteria 1279
839 Ga0496115_0630997 3300048918 Unclassified 849
840 Ga0496121_0075376 3300048924 Bacteria 2695
841 Ga0496126_0014855 3300048929 Bacteria 7855
842 Ga0501031_0212649 3300049568 Bacteria 1260
843 Ga0501034_0149951 3300049571 Bacteria 2308
844 Ga0501036_0261042 3300049572 Bacteria 1451
845 Ga0501037_0049808 3300049573 Bacteria 3067
846 Ga0501038_0381870 3300049574 Bacteria 1093
847 Ga0501039_0190946 3300049575 Bacteria 1611
848 Ga0501047_0009323 3300049581 Bacteria 9268
849 Ga0501067_0369806 3300049583 Bacteria 799
850 Ga0501072_0250748 3300049588 Unclassified 1410
851 Ga0501073_0067398 3300049589 Bacteria 2495
852 Ga0501076_0226428 3300049592 Bacteria 1528
853 Ga0501079_0536115 3300049741 Bacteria 920
854 Ga0501080_0928928 3300049742 Bacteria 757
855 Ga0501081_0368541 3300049743 Bacteria 1060
856 Ga0501083_0019534 3300049744 Bacteria 4719
857 nmdc:mga05p37_187611_c1 3300050507 Bacteria 2513
858 nmdc:mga06r32_729418_c1 3300050510 Bacteria 955
859 nmdc:mga08y16_290913_c2 3300050511 Bacteria 1086
860 nmdc:mga08y16_950282_c1 3300050511 Bacteria 843
861 nmdc:mga0n895_349846_c1 3300050512 Bacteria 1497
862 nmdc:mga0n895_80324_c1 3300050512 Bacteria 3249
863 nmdc:mga0n895_80582_c1 3300050512 Bacteria 3244
864 nmdc:mga0rr50_96276_c1 3300050513 Bacteria 2316
865 nmdc:mga08x19_173062_c1 3300050514 Bacteria 1471
866 nmdc:mga08x19_3057_c1 3300050514 Bacteria 10057
867 nmdc:mga08x19_40707_c1 3300050514 Bacteria 2958
868 nmdc:mga08x19_96342_c1 3300050514 Bacteria 1958
869 nmdc:mga0a205_63042_c1 3300050515 Bacteria 3581
870 Ga0495601_0000021 3300053077 Bacteria 159355
871 Ga0495601_0002704 3300053077 Bacteria 10064
872 Ga0495601_0011416 3300053077 Bacteria 5311
873 Ga0495601_0023845 3300053077 Bacteria 3762
874 Ga0495601_0152123 3300053077 Bacteria 1510
875 Ga0495601_0728948 3300053077 Unclassified 631
876 Ga0495612_0000018 3300053078 Bacteria 150870
877 Ga0495612_0004668 3300053078 Bacteria 5673
878 Ga0495612_0210851 3300053078 Unclassified 858
879 Ga0495595_0000028 3300053084 Bacteria 97682
880 Ga0495595_0004425 3300053084 Bacteria 5653
881 Ga0495595_0006408 3300053084 Bacteria 4799
882 Ga0495595_0009091 3300053084 Bacteria 4103
883 Ga0495595_0020294 3300053084 Unclassified 2891
884 Ga0495595_0157770 3300053084 Bacteria 1118
885 Ga0495595_0372809 3300053084 Unclassified 722
886 Ga0495619_0000006 3300053085 Bacteria 384835
887 Ga0495619_0006915 3300053085 Bacteria 7172
888 Ga0495619_0008110 3300053085 Bacteria 6648
889 Ga0495619_0013223 3300053085 Bacteria 5201
890 Ga0495619_0013842 3300053085 Bacteria 5090
891 Ga0495619_0051852 3300053085 Bacteria 2712
892 Ga0495619_0109888 3300053085 Bacteria 1883
893 Ga0495619_0227364 3300053085 Unclassified 1292
894 Ga0500651_0004280 3300053093 Bacteria 7975
895 Ga0500651_0105713 3300053093 Bacteria 1722
896 Ga0500651_0537302 3300053093 Bacteria 641
897 Ga0500566_0012615 3300053094 Bacteria 4972
898 Ga0500566_0172487 3300053094 Unclassified 1117
899 Ga0500595_000104 3300053119 Bacteria 57706
900 Ga0500595_008847 3300053119 Bacteria 4092
901 Ga0500655_010212 3300053133 Bacteria 1694
902 Ga0500616_0000006 3300053153 Bacteria 944738
903 Ga0500657_071628 3300053728 Unclassified 1517
904 Ga0500645_000101 3300053730 Bacteria 68128
905 Ga0501084_0203055 3300054114 Bacteria 1673
906 Ga0501084_1310388 3300054114 Bacteria 607
907 Ga0501082_0013251 3300060353 Bacteria 7091
908 Ga0501082_0662444 3300060353 Bacteria 914
909 Ga0530510_0353341 3300061734 Bacteria 1104
910 2524538395 2524023228 Bacteria 10118060
911 2728750124 2728368998 Bacteria 8720350
912 2793066794 2791355197 Bacteria 8420563
913 2904704909
914 2941510724 2941507105 Bacteria 8166816
915 2941518108 2941515067 Bacteria 8166720
916 2941527021 2941523033 Bacteria 8169134
917 3005481168 3005474847 Bacteria 9259049
918 8006939539 8006933436 Bacteria 10410654
919 8006979289 8006973647 Bacteria 10679141
920 Ga0373937_0609357
921 Ga0070658_10048034
922 Ga0070676_10117053
923 Ga0070676_10179810
924 Ga0070683_100198154
925 Ga0070690_100378852
926 Ga0070690_100393322
927 Ga0070670_100894694
928 Ga0070677_10300184
929 Ga0068869_100083761
930 Ga0068869_100249497
931 Ga0070666_10041661
932 Ga0070680_100033411
933 Ga0070680_100558136
934 Ga0070682_100066357
935 Ga0070682_100132202
936 Ga0070682_100190177
937 Ga0070682_100515271
938 Ga0068868_100098480
939 Ga0068868_100201844
940 Ga0070660_100019325
941 Ga0070660_100096656
942 Ga0070660_100932346
943 Ga0070689_100055250
944 Ga0070691_10062891
945 Ga0070661_100075305
946 Ga0070661_100117777
947 Ga0070661_100126065
948 Ga0070692_10265105
949 Ga0070668_100004789
950 Ga0070668_100711592
951 Ga0070669_100651214
952 Ga0070675_100060415
953 Ga0070671_100044203
954 Ga0070671_100568140
955 Ga0070674_100001469
956 Ga0070674_100061198
957 Ga0070673_100177726
958 Ga0070673_100413067
959 Ga0070688_100079220
960 Ga0070667_100060576
961 Ga0070667_100086820
962 Ga0070667_100203646
963 Ga0070709_10073656
964 Ga0070709_10277554
965 Ga0070709_10491294
966 Ga0070714_100031308
967 Ga0070714_100173722
968 Ga0070714_101220586
969 Ga0070714_101303072
970 Ga0070713_100001163
971 Ga0070713_100058408
972 Ga0070713_100162314
973 Ga0070713_100245842
974 Ga0070713_100255425
975 Ga0070713_100364712
976 Ga0070713_100607330
977 Ga0070710_10031153
978 Ga0070710_10042817
979 Ga0070710_10053031
980 Ga0070710_10116974
981 Ga0070710_10164412
982 Ga0070711_100113018
983 Ga0070711_100334974
984 Ga0070711_100733802
985 Ga0070711_100895086
986 Ga0070705_100204781
987 Ga0070705_100264637
988 Ga0070700_100230156
989 Ga0070694_100017310
990 Ga0070663_100113478
991 Ga0070663_100210240
992 Ga0070663_100216087
993 Ga0070678_100046002
994 Ga0070678_100126009
995 Ga0070678_100150882
996 Ga0070662_100074327
997 Ga0070662_100823778
998 Ga0070681_10031409
999 Ga0070681_10120917
1000 Ga0070681_10145225
1001 Ga0070685_10226445
1002 Ga0070707_100794723
1003 Ga0070707_101048548
1004 Ga0070699_100216448
1005 Ga0070699_100820360
1006 Ga0070679_100107374
1007 Ga0070679_100331769
1008 Ga0070684_100266575
1009 Ga0070684_100300682
1010 Ga0070697_100641308
1011 Ga0070697_100976419
1012 Ga0068853_100007119
1013 Ga0070672_100357426
1014 Ga0070686_100007712
1015 Ga0070686_100099825
1016 Ga0070695_100062288
1017 Ga0070695_100220588
1018 Ga0070695_100743715
1019 Ga0070696_100071244
1020 Ga0070696_100470951
1021 Ga0070696_100525227
1022 Ga0070693_100077404
1023 Ga0070693_100094520
1024 Ga0070693_100420457
1025 Ga0070693_100800450
1026 Ga0070665_100325788
1027 Ga0068855_100011509
1028 Ga0068855_100053031
1029 Ga0068855_100963088
1030 Ga0068855_101095254
1031 Ga0068855_101385984
1032 Ga0070664_100193360
1033 Ga0068857_100014636
1034 Ga0068854_100524784
1035 Ga0068856_100171378
1036 Ga0068856_100280562
1037 Ga0068856_100285668
1038 Ga0068852_100099048
1039 Ga0068859_100075400
1040 Ga0068859_100968031
1041 Ga0068864_101557316
1042 Ga0068866_10147459
1043 Ga0068866_10307157
1044 Ga0068861_100030177
1045 Ga0068851_10123518
1046 Ga0068870_10435416
1047 Ga0068863_100264537
1048 Ga0068858_100511684
1049 Ga0068860_100344094
1050 Ga0068862_100156322
1051 Ga0068862_101964968
1052 Ga0081455_10121167
1053 Ga0070717_10042482
1054 Ga0070717_10107084
1055 Ga0070717_10531750
1056 Ga0070717_10721379
1057 Ga0070716_100007618
1058 Ga0070712_100089846
1059 Ga0070712_100224243
1060 Ga0097621_100056414
1061 Ga0097621_100149322
1062 Ga0097621_101127843
1063 Ga0068871_100082713
1064 Ga0068871_100285126
1065 Ga0075431_100498611
1066 Ga0075433_10022802
1067 Ga0075433_10171471
1068 Ga0075434_100026486
1069 Ga0075434_100035076
1070 Ga0075434_100296107
1071 Ga0075429_100955911
1072 Ga0068865_100032983
1073 Ga0068865_100078047
1074 Ga0075436_100003492
1075 Ga0075436_100046815
1076 Ga0075436_100242631
1077 Ga0075436_100292700
1078 Ga0075436_100538408
1079 Ga0097620_100075409
1080 Ga0097620_100968059
1081 Ga0075435_100080890
1082 Ga0105240_10000945
1083 Ga0105240_10015366
1084 Ga0105240_11304750
1085 Ga0111539_10368569
1086 Ga0111539_11500142
1087 Ga0105245_10109610
1088 Ga0105245_10641114
1089 Ga0105247_10305321
1090 Ga0105247_10503765
1091 Ga0114129_10727753
1092 Ga0114129_10737017
1093 Ga0105243_10018265
1094 Ga0105243_10096863
1095 Ga0105243_10160005
1096 Ga0105243_10635693
1097 Ga0105241_10064194
1098 Ga0105241_10094845
1099 Ga0105242_10037799
1100 Ga0105242_10176663
1101 Ga0105242_10290613
1102 Ga0105248_10125176
1103 Ga0105248_10225736
1104 Ga0105237_10034579
1105 Ga0105237_10336568
1106 Ga0105237_10504820
1107 Ga0105237_11152209
1108 Ga0105238_10029000
1109 Ga0105238_10029780
1110 Ga0105238_10118666
1111 Ga0105238_10118897
1112 Ga0105249_10091147
1113 Ga0105249_10137670
1114 Ga0105249_10938570
1115 Ga0105249_10997826
1116 Ga0105239_10064158
1117 Ga0105239_10157693
1118 Ga0105239_10264428
1119 Ga0105246_10079217
1120 Ga0105246_10414250
1121 Ga0157340_1012301
1122 Ga0157313_1019493
1123 Ga0157315_1006199
1124 Ga0157338_1016045
1125 Ga0157373_10121492
1126 Ga0157370_10042063
1127 Ga0157369_10046386
1128 Ga0157374_10368371
1129 Ga0157374_10411689
1130 Ga0157378_10110569
1131 Ga0157378_10121895
1132 Ga0157378_10159186
1133 Ga0163162_10346200
1134 Ga0163162_10405232
1135 Ga0157372_10162033
1136 Ga0157372_10261048
1137 Ga0157372_10931804
1138 Ga0157372_11942273
1139 Ga0157375_10301760
1140 Ga0157375_10304136
1141 Ga0157375_10725757
1142 Ga0157375_11155249
1143 Ga0163163_10863862
1144 Ga0163163_12213640
1145 Ga0157380_10946601
1146 Ga0157377_10019144
1147 Ga0157379_10101729
1148 Ga0157379_10194829
1149 Ga0157376_10109934
1150 Ga0157376_10243738
1151 Ga0157376_10778846
1152 Ga0182007_10067207
1153 Ga0163161_10029152
1154 Ga0184601_125268
1155 Ga0213876_10015945
1156 Ga0213871_10037160
1157 Ga0207656_10118051
1158 Ga0207692_10099211
1159 Ga0207692_10137347
1160 Ga0207692_10278460
1161 Ga0207642_10068578
1162 Ga0207710_10082468
1163 Ga0207710_10218930
1164 Ga0207710_10465822
1165 Ga0207688_10032344
1166 Ga0207680_10047516
1167 Ga0207699_10100036
1168 Ga0207699_10185129
1169 Ga0207699_10229418
1170 Ga0207699_10938537
1171 Ga0207699_11048787
1172 Ga0207645_10025770
1173 Ga0207645_10178766
1174 Ga0207705_10229178
1175 Ga0207707_10007863
1176 Ga0207707_10014737
1177 Ga0207707_10061700
1178 Ga0207695_10060181
1179 Ga0207695_10095212
1180 Ga0207671_10453283
1181 Ga0207693_10024907
1182 Ga0207693_10028957
1183 Ga0207693_10046591
1184 Ga0207693_10078423
1185 Ga0207693_10436981
1186 Ga0207693_10862253
1187 Ga0207663_10128429
1188 Ga0207663_10156076
1189 Ga0207663_10294901
1190 Ga0207663_10749574
1191 Ga0207660_10034342
1192 Ga0207660_10935045
1193 Ga0207662_10073416
1194 Ga0207662_10182440
1195 Ga0207662_10317767
1196 Ga0207657_10047987
1197 Ga0207657_10096761
1198 Ga0207657_10122749
1199 Ga0207649_10056429
1200 Ga0207649_10119664
1201 Ga0207649_10322607
1202 Ga0207652_10035613
1203 Ga0207652_10036910
1204 Ga0207652_10054988
1205 Ga0207652_10748891
1206 Ga0207646_10128337
1207 Ga0207646_10975382
1208 Ga0207681_10120958
1209 Ga0207681_10390779
1210 Ga0207694_10018798
1211 Ga0207687_10291798
1212 Ga0207687_10408122
1213 Ga0207687_10417652
1214 Ga0207700_10030110
1215 Ga0207700_10144162
1216 Ga0207700_11347643
1217 Ga0207664_10012070
1218 Ga0207664_10857897
1219 Ga0207644_10016185
1220 Ga0207644_10243177
1221 Ga0207644_10590602
1222 Ga0207690_10461659
1223 Ga0207706_10025659
1224 Ga0207706_10056068
1225 Ga0207706_10121631
1226 Ga0207706_10629472
1227 Ga0207686_10030666
1228 Ga0207686_10065757
1229 Ga0207709_10061374
1230 Ga0207709_10086950
1231 Ga0207669_10091045
1232 Ga0207704_10054467
1233 Ga0207665_10015450
1234 Ga0207665_11036925
1235 Ga0207711_10323691
1236 Ga0207689_10099207
1237 Ga0207661_10187062
1238 Ga0207661_10188993
1239 Ga0207667_10046812
1240 Ga0207667_10052707
1241 Ga0207651_10466123
1242 Ga0207651_10551359
1243 Ga0207651_11667585
1244 Ga0207712_10073704
1245 Ga0207712_10768277
1246 Ga0207668_10001797
1247 Ga0207668_10034739
1248 Ga0207668_10706778
1249 Ga0207668_11155739
1250 Ga0207668_11309442
1251 Ga0207640_10720306
1252 Ga0207658_10046265
1253 Ga0207658_10299683
1254 Ga0207658_10304865
1255 Ga0207677_10694486
1256 Ga0207703_10109011
1257 Ga0207703_10136860
1258 Ga0207703_10560243
1259 Ga0207703_10648231
1260 Ga0207639_10092092
1261 Ga0207678_10062758
1262 Ga0207678_10069402
1263 Ga0207678_10238827
1264 Ga0207678_10260779
1265 Ga0207678_10851340
1266 Ga0207708_10074555
1267 Ga0207708_10273035
1268 Ga0207702_10287163
1269 Ga0207648_10091109
1270 Ga0207648_11607506
1271 Ga0207676_11051647
1272 Ga0207674_10033519
1273 Ga0207675_100004169
1274 Ga0207675_100190743
1275 Ga0207683_10003484
1276 Ga0207683_10015950
1277 Ga0207683_10079244
1278 Ga0207698_10796413
1279 Ga0207428_10143579
1280 Ga0207428_10771940
1281 Ga0268266_10108008
1282 Ga0268266_10621999
1283 Ga0268266_10657809
1284 Ga0265334_10014941
1285 Ga0265338_10276241
1286 Ga0265338_10367040
1287 Ga0265324_10191992
1288 Ga0265330_10076631
1289 Ga0265325_10000048
1290 Ga0265325_10214295
1291 Ga0265340_10084392
1292 Ga0265340_10237785
1293 Ga0265340_10255186
1294 Ga0265331_10311169
1295 Ga0265316_10073214
1296 Ga0265316_10632276
1297 Ga0265314_10009879
1298 Ga0373930_0016882
1299 Ga0373948_0019547
1300 Ga0373958_0019107
1301 Ga0373959_0119451
1302 Ga0373926_0001058
1303 Ga0373926_0001601
1304 Ga0373926_0021511
1305 Ga0373929_0080683
1306 Ga0373934_0061060
1307 Ga0373940_0175534
1308 Ga0373944_0010442
1309 Ga0373944_0026854
1310 Ga0373951_0012289
1311 Ga0373951_0047258
1312 Ga0373952_0007777
1313 Ga0373923_0015615
1314 Ga0373923_0076512
1315 Ga0373936_0012788
1316 Ga0373936_0015863
1317 Ga0373936_0017322
1318 Ga0373936_0097807
1319 Ga0373936_0133452
1320 Ga0373939_0010020
1321 Ga0373941_0129557
1322 Ga0373945_0006535
1323 Ga0373945_0024643
1324 Ga0373945_0027116
1325 Ga0373945_0177440
1326 Ga0373945_0190615
1327 Ga0373953_0025411
1328 Ga0373953_0026092
1329 Ga0373953_0170322
1330 Ga0373953_0185976
1331 Ga0373954_0007748
1332 Ga0373954_0015424
1333 Ga0373954_0027582
1334 Ga0373954_0043351
1335 Ga0373954_0047599
1336 Ga0373954_0110462
1337 Ga0373956_0037962
1338 Ga0373956_0054134
1339 Ga0373956_0145045
1340 Ga0373957_0014032
1341 Ga0373957_0042803
1342 Ga0373957_0091495
1343 Ga0373957_0148968
1344 Ga0373960_0095442
1345 Ga0373943_0015289
1346 Ga0373943_0075650
1347 Ga0373943_0183747
1348 Ga0373943_0189945
1349 Ga0373946_0029747
1350 Ga0373946_0115220
1351 Ga0373955_0000294
1352 Ga0373955_0002670
1353 Ga0373955_0007232
1354 Ga0373955_0053493
1355 Ga0373955_0108656
1356 Ga0373942_0019741
1357 Ga0373942_0033815
1358 Ga0373961_0300322
1359 Ga0373962_0023574
1360 Ga0373924_0001452
1361 Ga0373924_0024494
1362 Ga0373924_0053134
1363 Ga0373924_0084491
1364 Ga0373924_0114869
1365 Ga0373924_0311171
1366 Ga0373931_0006069
1367 Ga0373931_0178515
1368 Ga0373931_0184159
1369 Ga0373935_0007394
1370 Ga0373935_0024182
1371 Ga0373935_0027203
1372 Ga0373935_0038005
1373 Ga0373935_0194372
1374 Ga0373935_0606933
1375 Ga0373927_0109948
1376 Ga0373927_0212865
1377 Ga0373927_0298459
1378 Ga0373927_0383759
1379 Ga0373933_0004809
1380 Ga0373933_0010078
1381 Ga0373933_0121529
1382 Ga0373933_0148466
1383 Ga0373933_0153659
1384 Ga0373933_0214900
1385 Ga0373947_0000391
1386 Ga0373947_0006399
1387 Ga0373947_0034398
1388 Ga0373947_0155066
1389 Ga0373947_0359717
1390 Ga0373947_0388168
1391 Ga0373947_0413898
1392 Ga0373947_0466227
1393 Ga0373947_0507585
1394 Ga0373937_0000081
1395 Ga0373937_0001398
1396 Ga0373937_0149359
1397 Ga0373937_0234445
1398 Ga0373937_0253492
1399 Ga0373937_0352978
1400 Ga0373937_0361561
1401 Ga0373937_0715730
1402 Ga0373925_0000425
1403 Ga0373925_0014118
1404 Ga0373925_0678221
1405 Ga0373925_0859774
1406 Ga0373925_0972397
1407 Ga0436365_1710235
1408 Ga0436360_1328245
1409 Ga0436362_0185652
1410 Ga0451577_0071989
1411 Ga0466963_0352214
1412 Ga0466971_0038829
1413 Ga0466957_0221393
1414 Ga0466959_0565570
1415 Ga0451576_0003473
1416 Ga0451576_0377738
1417 Ga0466967_0249655
1418 Ga0466967_0452865
1419 Ga0495617_028376
1420 Ga0495592_0000177
1421 Ga0495592_0007387
1422 Ga0495592_0044961
1423 Ga0495592_0063633
1424 Ga0495592_0092689
1425 Ga0495592_0160998
1426 Ga0495603_0005357
1427 Ga0495603_0135661
1428 Ga0495591_034011
1429 Ga0495629_0013975
1430 Ga0495629_0014801
1431 Ga0495629_0064352
1432 Ga0495629_0110721
1433 Ga0495629_0119398
1434 Ga0495629_0172731
1435 Ga0495629_0417795
1436 Ga0495641_0013945
1437 Ga0495641_0041779
1438 Ga0495651_0000210
1439 Ga0495651_0000979
1440 Ga0495651_0003153
1441 Ga0495651_0017937
1442 Ga0495651_0044115
1443 Ga0495651_0165330
1444 Ga0495651_0639071
1445 Ga0495653_0000054
1446 Ga0495653_0000528
1447 Ga0495653_0001202
1448 Ga0495653_0008981
1449 Ga0495653_0102463
1450 Ga0495653_0241686
1451 Ga0495580_0022339
1452 Ga0495580_0029504
1453 Ga0495582_0029526
1454 Ga0495582_0050389
1455 Ga0495582_0067845
1456 Ga0495582_0269713
1457 Ga0495582_0272447
1458 Ga0495582_0373097
1459 Ga0495639_0042151
1460 Ga0495639_0080525
1461 Ga0495639_0310326
1462 Ga0495639_0364727
1463 Ga0495662_0006393
1464 Ga0495662_0083117
1465 Ga0495662_0095906
1466 Ga0495662_0206390
1467 Ga0495664_0000020
1468 Ga0495664_0002815
1469 Ga0495664_0060964
1470 Ga0495664_0124455
1471 Ga0495664_0205806
1472 Ga0495664_0320637
1473 Ga0495664_0413970
1474 Ga0495585_0000995
1475 Ga0495585_0190857
1476 Ga0495585_0267215
1477 Ga0495594_0009061
1478 Ga0495594_0009465
1479 Ga0495594_0009573
1480 Ga0495607_0013487
1481 Ga0495607_0330219
1482 Ga0495608_0000024
1483 Ga0495608_0000363
1484 Ga0495608_0025424
1485 Ga0495608_0026296
1486 Ga0495608_0037615
1487 Ga0495608_0047457
1488 Ga0495608_0055855
1489 Ga0495616_0270259
1490 Ga0495618_0000020
1491 Ga0495618_0012894
1492 Ga0495618_0063650
1493 Ga0495618_0135188
1494 Ga0495618_0380630
1495 Ga0495618_0422596
1496 Ga0495628_0000015
1497 Ga0495628_0001606
1498 Ga0495628_0022277
1499 Ga0495628_0051882
1500 Ga0495628_0179614
1501 Ga0495628_0220556
1502 Ga0495628_0414884
1503 Ga0495630_0001403
1504 Ga0495630_0006847
1505 Ga0495630_0068880
1506 Ga0495630_0078947
1507 Ga0495630_0133399
1508 Ga0495630_0348429
1509 Ga0495630_0406623
1510 Ga0495631_0184306
1511 Ga0495632_0152268
1512 Ga0495637_0099655
1513 Ga0495637_0113641
1514 Ga0495644_0002021
1515 Ga0495644_0183585
1516 Ga0495663_0038866
1517 Ga0495666_0010026
1518 Ga0495666_0019975
1519 Ga0495666_0285215
1520 Ga0495652_0000006
1521 Ga0495652_0021629
1522 Ga0495652_0028971
1523 Ga0495652_0037531
1524 Ga0495652_0052449
1525 Ga0495652_0214032
1526 Ga0495665_0013877
1527 Ga0495665_0029669
1528 Ga0495665_0300197
1529 Ga0495665_0449839
1530 Ga0495640_0000002
1531 Ga0495640_0009366
1532 Ga0495640_0035429
1533 Ga0495640_0358325
1534 Ga0495586_0012387
1535 Ga0495586_0020698
1536 Ga0495586_0093784
1537 Ga0495586_0153680
1538 Ga0495586_0314286
1539 Ga0495587_0000001
1540 Ga0495587_0007214
1541 Ga0495587_0008295
1542 Ga0495587_0015467
1543 Ga0495587_0168109
1544 Ga0495587_0339134
1545 Ga0495598_0001368
1546 Ga0495609_0023475
1547 Ga0495621_0185497
1548 Ga0495645_0000013
1549 Ga0495645_0001389
1550 Ga0495645_0002241
1551 Ga0495645_0021101
1552 Ga0495645_0438028
1553 Ga0495622_0009159
1554 Ga0495622_0032737
1555 Ga0495622_0045319
1556 Ga0495667_0000030
1557 Ga0495667_0007285
1558 Ga0495667_0008025
1559 Ga0495667_0026131
1560 Ga0495667_0044504
1561 Ga0495667_0147425
1562 Ga0495667_0211148
1563 Ga0495656_0254328
1564 Ga0495634_0000117
1565 Ga0495634_0002830
1566 Ga0495634_0078649
1567 Ga0495634_0089026
1568 Ga0495634_0120109
1569 Ga0495634_0123845
1570 Ga0495634_0211828
1571 Ga0495634_0390305
1572 Ga0495611_0015454
1573 Ga0495635_0000001
1574 Ga0495635_0000730
1575 Ga0495635_0017369
1576 Ga0495635_0052084
1577 Ga0495635_0058753
1578 Ga0495635_0082043
1579 Ga0495635_0116088
1580 Ga0495635_0185053
1581 Ga0495635_0238677
1582 Ga0495635_0408012
1583 Ga0495659_0014801
1584 Ga0495659_0055651
1585 Ga0495661_0044492
1586 Ga0495661_0183843
1587 Ga0495588_0001656
1588 Ga0495588_0069820
1589 Ga0495657_0000028
1590 Ga0495657_0004124
1591 Ga0495657_0007370
1592 Ga0495657_0107600
1593 Ga0495657_0163773
1594 Ga0495657_0187632
1595 Ga0495599_0000050
1596 Ga0495599_0001421
1597 Ga0495599_0003607
1598 Ga0495599_0035288
1599 Ga0495599_0068968
1600 Ga0495599_0113628
1601 Ga0495599_0253523
1602 Ga0495599_0420429
1603 Ga0495623_0000013
1604 Ga0495623_0002343
1605 Ga0495623_0012831
1606 Ga0495623_0125282
1607 Ga0495646_0000003
1608 Ga0495646_0001198
1609 Ga0495646_0014444
1610 Ga0495646_0019546
1611 Ga0495646_0035661
1612 Ga0495646_0632207
1613 Ga0495647_0003783
1614 Ga0495647_0043889
1615 Ga0495647_0329865
1616 Ga0495658_0033382
1617 Ga0495658_0102964
1618 Ga0495658_0117891
1619 Ga0495658_0155192
1620 Ga0495658_0180135
1621 Ga0495658_0543346
1622 Ga0495669_0006462
1623 Ga0495613_0062399
1624 Ga0495613_0112842
1625 Ga0495613_0133899
1626 Ga0495613_0171154
1627 Ga0495613_0174735
1628 Ga0495613_0297627
1629 Ga0495613_0426013
1630 Ga0495624_0009345
1631 Ga0495624_0055522
1632 Ga0495624_0203750
1633 Ga0495670_0001271
1634 Ga0495600_0000002
1635 Ga0495600_0002739
1636 Ga0495600_0003702
1637 Ga0495600_0011581
1638 Ga0495600_0050772
1639 Ga0495581_0069003
1640 Ga0495581_0072904
1641 Ga0495581_0116039
1642 Ga0495581_0390261
1643 Ga0495581_0479639
1644 Ga0495604_0000001
1645 Ga0495604_0000186
1646 Ga0495604_0001606
1647 Ga0495604_0006423
1648 Ga0495604_0053395
1649 Ga0495604_0210861
1650 Ga0495604_0230178
1651 Ga0495604_0239635
1652 Ga0495674_0000018
1653 Ga0495674_0017517
1654 Ga0495674_0048394
1655 Ga0495674_0107696
1656 Ga0495674_0109689
1657 Ga0495674_0385549
1658 Ga0495676_0090294
1659 Ga0495676_0131656
1660 Ga0495676_0251202
1661 Ga0495676_0624437
1662 Ga0495676_0920310
1663 Ga0495680_0000159
1664 Ga0495680_0005565
1665 Ga0495680_0014550
1666 Ga0495680_0018619
1667 Ga0495680_0023301
1668 Ga0495680_0099178
1669 Ga0495680_0117268
1670 Ga0495675_0000238
1671 Ga0495675_0005457
1672 Ga0495675_0014186
1673 Ga0495675_0035513
1674 Ga0495677_0069875
1675 Ga0495679_008677
1676 Ga0495684_0000010
1677 Ga0495684_0024373
1678 Ga0495684_0042639
1679 Ga0495684_0046067
1680 Ga0495684_0098856
1681 Ga0495684_0169378
1682 Ga0495684_0213523
1683 Ga0495684_0590862
1684 Ga0495684_0666743
1685 Ga0495593_0005079
1686 Ga0495593_0010567
1687 Ga0495593_0091277
1688 Ga0495593_0169305
1689 Ga0495593_0233485
1690 Ga0495593_0326109
1691 Ga0495602_0000016
1692 Ga0495602_0052962
1693 Ga0495602_0063590
1694 Ga0495602_0221465
1695 Ga0495602_0234184
1696 Ga0495614_0040128
1697 Ga0495614_0046055
1698 Ga0495614_0375567
1699 Ga0496100_0402642
1700 Ga0496101_0051375
1701 Ga0496101_0166110
1702 Ga0496101_0293972
1703 Ga0496101_0462931
1704 Ga0496102_0017814
1705 Ga0496102_0060926
1706 Ga0496102_0267842
1707 Ga0496103_0055638
1708 Ga0496103_0151110
1709 Ga0496104_0032534
1710 Ga0496104_0058138
1711 Ga0496104_0085556
1712 Ga0496104_0462910
1713 Ga0496104_1175305
1714 Ga0496105_0068036
1715 Ga0496105_0366952
1716 Ga0496105_0386842
1717 Ga0496105_0482193
1718 Ga0496105_0482659
1719 Ga0496105_0499295
1720 Ga0496106_0028455
1721 Ga0496106_0029719
1722 Ga0496106_0233882
1723 Ga0496106_0329034
1724 Ga0496106_0670663
1725 Ga0496106_0707666
1726 Ga0496107_0025221
1727 Ga0496107_0097133
1728 Ga0496107_0422806
1729 Ga0496108_0087058
1730 Ga0496108_0210262
1731 Ga0496108_0342899
1732 Ga0496108_0412543
1733 Ga0496108_1201883
1734 Ga0496109_0095873
1735 Ga0496109_0955306
1736 Ga0496110_0004047
1737 Ga0496111_0396811
1738 Ga0496111_0700748
1739 Ga0496112_0011548
1740 Ga0496112_0216209
1741 Ga0496112_0422766
1742 Ga0496112_0919140
1743 Ga0496112_0927654
1744 Ga0496113_0300341
1745 Ga0496113_0378927
1746 Ga0496114_0023602
1747 Ga0496114_0067970
1748 Ga0496114_0150087
1749 Ga0496114_0847416
1750 Ga0496115_0016906
1751 Ga0496115_0046719
1752 Ga0496115_0061104
1753 Ga0496115_0112722
1754 Ga0496115_0153388
1755 Ga0496115_0159672
1756 Ga0496115_0314246
1757 Ga0496115_0315733
1758 Ga0496115_0630997
1759 Ga0496121_0075376
1760 Ga0496126_0014855
1761 Ga0501031_0212649
1762 Ga0501034_0149951
1763 Ga0501036_0261042
1764 Ga0501037_0049808
1765 Ga0501038_0381870
1766 Ga0501039_0190946
1767 Ga0501047_0009323
1768 Ga0501067_0369806
1769 Ga0501072_0250748
1770 Ga0501073_0067398
1771 Ga0501076_0226428
1772 Ga0501079_0536115
1773 Ga0501080_0928928
1774 Ga0501081_0368541
1775 Ga0501083_0019534
1776 nmdc:mga05p37_187611_c1
1777 nmdc:mga06r32_729418_c1
1778 nmdc:mga08y16_290913_c2
1779 nmdc:mga08y16_950282_c1
1780 nmdc:mga0n895_349846_c1
1781 nmdc:mga0n895_80324_c1
1782 nmdc:mga0n895_80582_c1
1783 nmdc:mga0rr50_96276_c1
1784 nmdc:mga08x19_173062_c1
1785 nmdc:mga08x19_3057_c1
1786 nmdc:mga08x19_40707_c1
1787 nmdc:mga08x19_96342_c1
1788 nmdc:mga0a205_63042_c1
1789 Ga0495601_0000021
1790 Ga0495601_0002704
1791 Ga0495601_0011416
1792 Ga0495601_0023845
1793 Ga0495601_0152123
1794 Ga0495601_0728948
1795 Ga0495612_0000018
1796 Ga0495612_0004668
1797 Ga0495612_0210851
1798 Ga0495595_0000028
1799 Ga0495595_0004425
1800 Ga0495595_0006408
1801 Ga0495595_0009091
1802 Ga0495595_0020294
1803 Ga0495595_0157770
1804 Ga0495595_0372809
1805 Ga0495619_0000006
1806 Ga0495619_0006915
1807 Ga0495619_0008110
1808 Ga0495619_0013223
1809 Ga0495619_0013842
1810 Ga0495619_0051852
1811 Ga0495619_0109888
1812 Ga0495619_0227364
1813 Ga0500651_0004280
1814 Ga0500651_0105713
1815 Ga0500651_0537302
1816 Ga0500566_0012615
1817 Ga0500566_0172487
1818 Ga0500595_000104
1819 Ga0500595_008847
1820 Ga0500655_010212
1821 Ga0500616_0000006
1822 Ga0500657_071628
1823 Ga0500645_000101
1824 Ga0501084_0203055
1825 Ga0501084_1310388
1826 Ga0501082_0013251
1827 Ga0501082_0662444
1828 Ga0530510_0353341
1829 2524538395
1830 2728750124
1831 2793066794
1832 2904704909
1833 2941510724
1834 2941518108
1835 2941527021
1836 3005481168
1837 8006939539
1838 8006979289

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03928

HbpS-like

Haem degrading protein HbpS-like

70

196

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bws-assembly1.cif.gz_B-2 crystal structure of efga from methylobacterium extorquens 0.9143 48 177
2a2l-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae protein orfy, pfam duf336 0.875 35 177
4nkp-assembly1.cif.gz_B crystal structure of a putative extracellular heme-binding protein (despig_02683) from desulfovibrio piger atcc 29098 at 1.24 a resolution 0.8697 36 178
5cx7-assembly1.cif.gz_B crystal structure of pduoc:heme complex 0.8653 49 178
6bws-assembly1.cif.gz_B-2 crystal structure of efga from methylobacterium extorquens 0.8639 48 177
ID Description Score Start End Superfamily
af_P0AEQ1_1_133_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9644 46 178 3.30.450.150
af_P0AEQ1_1_133_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9363 46 178 3.30.450.150
3fpvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9194 50 178 3.30.450.150
6c0zB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9139 48 177 3.30.450.150
4nkpD01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9081 50 178 3.30.450.150
ID Description Score Start End GO Terms
AF-A0A843SLF7-F1-model_v4 Heme-binding protein 0.9849 43 178
AF-A0A545TUR8-F1-model_v4 Heme-binding protein 0.9829 49 176
AF-M6TDE4-F1-model_v4 deleted 0.9809 74 178
AF-A0A534PYY5-F1-model_v4 Heme-binding protein 0.98 42 177
AF-A0A7Y4TEK8-F1-model_v4 Heme-binding protein 0.9799 43 178

Map