F485705
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 919 | 357 | 1838 | 177 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0609357|Ga0373937_0609357_345_944 |
| Length | 199 |
| Sequence | VAAGFADQDMRRPNHILREEVMRRLTVMAGALCLALVTGPGAFAQVPPDPNNPNEAVPETMSPTPYGDPINNETAKKVAAAAVAELQKRNWKGMCISIVDPHGELVYFERDDSCQFASISISQHKARTSARYRRPTVVFERLSGKGPFFGYLATLDDVIMSRGGNPLVVGGKIVGAIGVSGGTGSQDDVISQAGVAALK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 96 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 97 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 98 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 185 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 187 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 196 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 310 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 339 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 342 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 344 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 345 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 348 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 349 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 350 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 351 | 2904699407 | |||
| 352 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 353 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 354 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 355 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 356 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 357 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.91 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.2 |
| Nodule | 0.87 |
| Rhizoplane | 6.53 |
| Rhizosphere | 90.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373937_0609357 | 3300036401 | Bacteria | 1036 |
| 2 | Ga0070658_10048034 | 3300005327 | Bacteria | 3455 |
| 3 | Ga0070676_10117053 | 3300005328 | Bacteria | 1667 |
| 4 | Ga0070676_10179810 | 3300005328 | Unclassified | 1374 |
| 5 | Ga0070683_100198154 | 3300005329 | Bacteria | 1907 |
| 6 | Ga0070690_100378852 | 3300005330 | Unclassified | 1034 |
| 7 | Ga0070690_100393322 | 3300005330 | Bacteria | 1016 |
| 8 | Ga0070670_100894694 | 3300005331 | Bacteria | 804 |
| 9 | Ga0070677_10300184 | 3300005333 | Bacteria | 816 |
| 10 | Ga0068869_100083761 | 3300005334 | Bacteria | 2386 |
| 11 | Ga0068869_100249497 | 3300005334 | Bacteria | 1417 |
| 12 | Ga0070666_10041661 | 3300005335 | Bacteria | 3069 |
| 13 | Ga0070680_100033411 | 3300005336 | Bacteria | 4146 |
| 14 | Ga0070680_100558136 | 3300005336 | Unclassified | 982 |
| 15 | Ga0070682_100066357 | 3300005337 | Bacteria | 2296 |
| 16 | Ga0070682_100132202 | 3300005337 | Bacteria | 1690 |
| 17 | Ga0070682_100190177 | 3300005337 | Unclassified | 1441 |
| 18 | Ga0070682_100515271 | 3300005337 | Bacteria | 929 |
| 19 | Ga0068868_100098480 | 3300005338 | Bacteria | 2364 |
| 20 | Ga0068868_100201844 | 3300005338 | Bacteria | 1658 |
| 21 | Ga0070660_100019325 | 3300005339 | Bacteria | 4990 |
| 22 | Ga0070660_100096656 | 3300005339 | Bacteria | 2336 |
| 23 | Ga0070660_100932346 | 3300005339 | Unclassified | 733 |
| 24 | Ga0070689_100055250 | 3300005340 | Bacteria | 3076 |
| 25 | Ga0070691_10062891 | 3300005341 | Unclassified | 1788 |
| 26 | Ga0070661_100075305 | 3300005344 | Bacteria | 2486 |
| 27 | Ga0070661_100117777 | 3300005344 | Bacteria | 1987 |
| 28 | Ga0070661_100126065 | 3300005344 | Bacteria | 1921 |
| 29 | Ga0070692_10265105 | 3300005345 | Unclassified | 1034 |
| 30 | Ga0070668_100004789 | 3300005347 | Bacteria | 10035 |
| 31 | Ga0070668_100711592 | 3300005347 | Unclassified | 886 |
| 32 | Ga0070669_100651214 | 3300005353 | Bacteria | 886 |
| 33 | Ga0070675_100060415 | 3300005354 | Bacteria | 3130 |
| 34 | Ga0070671_100044203 | 3300005355 | Bacteria | 3701 |
| 35 | Ga0070671_100568140 | 3300005355 | Bacteria | 979 |
| 36 | Ga0070674_100001469 | 3300005356 | Bacteria | 12578 |
| 37 | Ga0070674_100061198 | 3300005356 | Bacteria | 2627 |
| 38 | Ga0070673_100177726 | 3300005364 | Bacteria | 1820 |
| 39 | Ga0070673_100413067 | 3300005364 | Bacteria | 1209 |
| 40 | Ga0070688_100079220 | 3300005365 | Bacteria | 2122 |
| 41 | Ga0070667_100060576 | 3300005367 | Bacteria | 3202 |
| 42 | Ga0070667_100086820 | 3300005367 | Bacteria | 2685 |
| 43 | Ga0070667_100203646 | 3300005367 | Bacteria | 1757 |
| 44 | Ga0070709_10073656 | 3300005434 | Unclassified | 2211 |
| 45 | Ga0070709_10277554 | 3300005434 | Bacteria | 1217 |
| 46 | Ga0070709_10491294 | 3300005434 | Bacteria | 931 |
| 47 | Ga0070714_100031308 | 3300005435 | Bacteria | 4438 |
| 48 | Ga0070714_100173722 | 3300005435 | Bacteria | 1957 |
| 49 | Ga0070714_101220586 | 3300005435 | Bacteria | 734 |
| 50 | Ga0070714_101303072 | 3300005435 | Unclassified | 709 |
| 51 | Ga0070713_100001163 | 3300005436 | Bacteria | 16810 |
| 52 | Ga0070713_100058408 | 3300005436 | Bacteria | 3217 |
| 53 | Ga0070713_100162314 | 3300005436 | Unclassified | 1996 |
| 54 | Ga0070713_100245842 | 3300005436 | Bacteria | 1630 |
| 55 | Ga0070713_100255425 | 3300005436 | Bacteria | 1600 |
| 56 | Ga0070713_100364712 | 3300005436 | Unclassified | 1343 |
| 57 | Ga0070713_100607330 | 3300005436 | Bacteria | 1039 |
| 58 | Ga0070710_10031153 | 3300005437 | Bacteria | 2876 |
| 59 | Ga0070710_10042817 | 3300005437 | Bacteria | 2505 |
| 60 | Ga0070710_10053031 | 3300005437 | Bacteria | 2283 |
| 61 | Ga0070710_10116974 | 3300005437 | Bacteria | 1608 |
| 62 | Ga0070710_10164412 | 3300005437 | Bacteria | 1379 |
| 63 | Ga0070711_100113018 | 3300005439 | Bacteria | 1996 |
| 64 | Ga0070711_100334974 | 3300005439 | Bacteria | 1212 |
| 65 | Ga0070711_100733802 | 3300005439 | Bacteria | 834 |
| 66 | Ga0070711_100895086 | 3300005439 | Bacteria | 757 |
| 67 | Ga0070705_100204781 | 3300005440 | Bacteria | 1356 |
| 68 | Ga0070705_100264637 | 3300005440 | Unclassified | 1215 |
| 69 | Ga0070700_100230156 | 3300005441 | Bacteria | 1319 |
| 70 | Ga0070694_100017310 | 3300005444 | Bacteria | 4552 |
| 71 | Ga0070663_100113478 | 3300005455 | Bacteria | 2039 |
| 72 | Ga0070663_100210240 | 3300005455 | Bacteria | 1523 |
| 73 | Ga0070663_100216087 | 3300005455 | Bacteria | 1503 |
| 74 | Ga0070678_100046002 | 3300005456 | Bacteria | 3126 |
| 75 | Ga0070678_100126009 | 3300005456 | Bacteria | 2027 |
| 76 | Ga0070678_100150882 | 3300005456 | Bacteria | 1872 |
| 77 | Ga0070662_100074327 | 3300005457 | Bacteria | 2514 |
| 78 | Ga0070662_100823778 | 3300005457 | Unclassified | 790 |
| 79 | Ga0070681_10031409 | 3300005458 | Bacteria | 5333 |
| 80 | Ga0070681_10120917 | 3300005458 | Bacteria | 2553 |
| 81 | Ga0070681_10145225 | 3300005458 | Unclassified | 2302 |
| 82 | Ga0070685_10226445 | 3300005466 | Bacteria | 1227 |
| 83 | Ga0070707_100794723 | 3300005468 | Unclassified | 910 |
| 84 | Ga0070707_101048548 | 3300005468 | Bacteria | 781 |
| 85 | Ga0070699_100216448 | 3300005518 | Bacteria | 1706 |
| 86 | Ga0070699_100820360 | 3300005518 | Unclassified | 851 |
| 87 | Ga0070679_100107374 | 3300005530 | Bacteria | 2777 |
| 88 | Ga0070679_100331769 | 3300005530 | Bacteria | 1470 |
| 89 | Ga0070684_100266575 | 3300005535 | Bacteria | 1567 |
| 90 | Ga0070684_100300682 | 3300005535 | Bacteria | 1472 |
| 91 | Ga0070697_100641308 | 3300005536 | Bacteria | 935 |
| 92 | Ga0070697_100976419 | 3300005536 | Unclassified | 753 |
| 93 | Ga0068853_100007119 | 3300005539 | Bacteria | 8945 |
| 94 | Ga0070672_100357426 | 3300005543 | Bacteria | 1246 |
| 95 | Ga0070686_100007712 | 3300005544 | Bacteria | 6016 |
| 96 | Ga0070686_100099825 | 3300005544 | Bacteria | 1959 |
| 97 | Ga0070695_100062288 | 3300005545 | Bacteria | 2422 |
| 98 | Ga0070695_100220588 | 3300005545 | Unclassified | 1366 |
| 99 | Ga0070695_100743715 | 3300005545 | Unclassified | 782 |
| 100 | Ga0070696_100071244 | 3300005546 | Unclassified | 2446 |
| 101 | Ga0070696_100470951 | 3300005546 | Unclassified | 995 |
| 102 | Ga0070696_100525227 | 3300005546 | Unclassified | 945 |
| 103 | Ga0070693_100077404 | 3300005547 | Bacteria | 1974 |
| 104 | Ga0070693_100094520 | 3300005547 | Bacteria | 1809 |
| 105 | Ga0070693_100420457 | 3300005547 | Bacteria | 931 |
| 106 | Ga0070693_100800450 | 3300005547 | Bacteria | 698 |
| 107 | Ga0070665_100325788 | 3300005548 | Bacteria | 1540 |
| 108 | Ga0068855_100011509 | 3300005563 | Bacteria | 10690 |
| 109 | Ga0068855_100053031 | 3300005563 | Bacteria | 4772 |
| 110 | Ga0068855_100963088 | 3300005563 | Unclassified | 898 |
| 111 | Ga0068855_101095254 | 3300005563 | Unclassified | 833 |
| 112 | Ga0068855_101385984 | 3300005563 | Bacteria | 725 |
| 113 | Ga0070664_100193360 | 3300005564 | Bacteria | 1813 |
| 114 | Ga0068857_100014636 | 3300005577 | Bacteria | 6842 |
| 115 | Ga0068854_100524784 | 3300005578 | Bacteria | 1001 |
| 116 | Ga0068856_100171378 | 3300005614 | Bacteria | 2182 |
| 117 | Ga0068856_100280562 | 3300005614 | Bacteria | 1683 |
| 118 | Ga0068856_100285668 | 3300005614 | Bacteria | 1667 |
| 119 | Ga0068852_100099048 | 3300005616 | Bacteria | 2627 |
| 120 | Ga0068859_100075400 | 3300005617 | Bacteria | 3413 |
| 121 | Ga0068859_100968031 | 3300005617 | Bacteria | 934 |
| 122 | Ga0068864_101557316 | 3300005618 | Unclassified | 664 |
| 123 | Ga0068866_10147459 | 3300005718 | Bacteria | 1358 |
| 124 | Ga0068866_10307157 | 3300005718 | Unclassified | 993 |
| 125 | Ga0068861_100030177 | 3300005719 | Bacteria | 3971 |
| 126 | Ga0068851_10123518 | 3300005834 | Bacteria | 1393 |
| 127 | Ga0068870_10435416 | 3300005840 | Unclassified | 861 |
| 128 | Ga0068863_100264537 | 3300005841 | Bacteria | 1663 |
| 129 | Ga0068858_100511684 | 3300005842 | Bacteria | 1160 |
| 130 | Ga0068860_100344094 | 3300005843 | Bacteria | 1466 |
| 131 | Ga0068862_100156322 | 3300005844 | Bacteria | 2033 |
| 132 | Ga0068862_101964968 | 3300005844 | Unclassified | 595 |
| 133 | Ga0081455_10121167 | 3300005937 | Bacteria | 2061 |
| 134 | Ga0070717_10042482 | 3300006028 | Bacteria | 3708 |
| 135 | Ga0070717_10107084 | 3300006028 | Bacteria | 2381 |
| 136 | Ga0070717_10531750 | 3300006028 | Bacteria | 1064 |
| 137 | Ga0070717_10721379 | 3300006028 | Bacteria | 906 |
| 138 | Ga0070716_100007618 | 3300006173 | Bacteria | 5338 |
| 139 | Ga0070712_100089846 | 3300006175 | Bacteria | 2248 |
| 140 | Ga0070712_100224243 | 3300006175 | Bacteria | 1489 |
| 141 | Ga0097621_100056414 | 3300006237 | Bacteria | 3209 |
| 142 | Ga0097621_100149322 | 3300006237 | Bacteria | 2003 |
| 143 | Ga0097621_101127843 | 3300006237 | Bacteria | 737 |
| 144 | Ga0068871_100082713 | 3300006358 | Bacteria | 2662 |
| 145 | Ga0068871_100285126 | 3300006358 | Unclassified | 1446 |
| 146 | Ga0075431_100498611 | 3300006847 | Bacteria | 1209 |
| 147 | Ga0075433_10022802 | 3300006852 | Bacteria | 5260 |
| 148 | Ga0075433_10171471 | 3300006852 | Bacteria | 1931 |
| 149 | Ga0075434_100026486 | 3300006871 | Bacteria | 5682 |
| 150 | Ga0075434_100035076 | 3300006871 | Bacteria | 4958 |
| 151 | Ga0075434_100296107 | 3300006871 | Unclassified | 1638 |
| 152 | Ga0075429_100955911 | 3300006880 | Bacteria | 749 |
| 153 | Ga0068865_100032983 | 3300006881 | Bacteria | 3465 |
| 154 | Ga0068865_100078047 | 3300006881 | Unclassified | 2368 |
| 155 | Ga0075436_100003492 | 3300006914 | Bacteria | 10781 |
| 156 | Ga0075436_100046815 | 3300006914 | Bacteria | 2983 |
| 157 | Ga0075436_100242631 | 3300006914 | Bacteria | 1282 |
| 158 | Ga0075436_100292700 | 3300006914 | Bacteria | 1166 |
| 159 | Ga0075436_100538408 | 3300006914 | Unclassified | 857 |
| 160 | Ga0097620_100075409 | 3300006931 | Bacteria | 3413 |
| 161 | Ga0097620_100968059 | 3300006931 | Bacteria | 934 |
| 162 | Ga0075435_100080890 | 3300007076 | Bacteria | 2668 |
| 163 | Ga0105240_10000945 | 3300009093 | Bacteria | 51693 |
| 164 | Ga0105240_10015366 | 3300009093 | Bacteria | 10409 |
| 165 | Ga0105240_11304750 | 3300009093 | Bacteria | 765 |
| 166 | Ga0111539_10368569 | 3300009094 | Bacteria | 1672 |
| 167 | Ga0111539_11500142 | 3300009094 | Bacteria | 782 |
| 168 | Ga0105245_10109610 | 3300009098 | Bacteria | 2566 |
| 169 | Ga0105245_10641114 | 3300009098 | Bacteria | 1092 |
| 170 | Ga0105247_10305321 | 3300009101 | Bacteria | 1105 |
| 171 | Ga0105247_10503765 | 3300009101 | Unclassified | 883 |
| 172 | Ga0114129_10727753 | 3300009147 | Bacteria | 1272 |
| 173 | Ga0114129_10737017 | 3300009147 | Unclassified | 1263 |
| 174 | Ga0105243_10018265 | 3300009148 | Bacteria | 5310 |
| 175 | Ga0105243_10096863 | 3300009148 | Bacteria | 2441 |
| 176 | Ga0105243_10160005 | 3300009148 | Bacteria | 1941 |
| 177 | Ga0105243_10635693 | 3300009148 | Bacteria | 1032 |
| 178 | Ga0105241_10064194 | 3300009174 | Bacteria | 2834 |
| 179 | Ga0105241_10094845 | 3300009174 | Unclassified | 2361 |
| 180 | Ga0105242_10037799 | 3300009176 | Bacteria | 3880 |
| 181 | Ga0105242_10176663 | 3300009176 | Bacteria | 1881 |
| 182 | Ga0105242_10290613 | 3300009176 | Bacteria | 1488 |
| 183 | Ga0105248_10125176 | 3300009177 | Bacteria | 2899 |
| 184 | Ga0105248_10225736 | 3300009177 | Bacteria | 2108 |
| 185 | Ga0105237_10034579 | 3300009545 | Bacteria | 5116 |
| 186 | Ga0105237_10336568 | 3300009545 | Bacteria | 1514 |
| 187 | Ga0105237_10504820 | 3300009545 | Unclassified | 1216 |
| 188 | Ga0105237_11152209 | 3300009545 | Bacteria | 782 |
| 189 | Ga0105238_10029000 | 3300009551 | Bacteria | 5637 |
| 190 | Ga0105238_10029780 | 3300009551 | Bacteria | 5561 |
| 191 | Ga0105238_10118666 | 3300009551 | Bacteria | 2625 |
| 192 | Ga0105238_10118897 | 3300009551 | Bacteria | 2623 |
| 193 | Ga0105249_10091147 | 3300009553 | Bacteria | 2851 |
| 194 | Ga0105249_10137670 | 3300009553 | Bacteria | 2338 |
| 195 | Ga0105249_10938570 | 3300009553 | Bacteria | 933 |
| 196 | Ga0105249_10997826 | 3300009553 | Bacteria | 906 |
| 197 | Ga0105239_10064158 | 3300010375 | Bacteria | 4032 |
| 198 | Ga0105239_10157693 | 3300010375 | Unclassified | 2535 |
| 199 | Ga0105239_10264428 | 3300010375 | Bacteria | 1934 |
| 200 | Ga0105246_10079217 | 3300011119 | Bacteria | 2335 |
| 201 | Ga0105246_10414250 | 3300011119 | Bacteria | 1123 |
| 202 | Ga0157340_1012301 | 3300012473 | Unclassified | 627 |
| 203 | Ga0157313_1019493 | 3300012503 | Unclassified | 678 |
| 204 | Ga0157315_1006199 | 3300012508 | Bacteria | 927 |
| 205 | Ga0157338_1016045 | 3300012515 | Bacteria | 824 |
| 206 | Ga0157373_10121492 | 3300013100 | Unclassified | 1836 |
| 207 | Ga0157370_10042063 | 3300013104 | Bacteria | 4405 |
| 208 | Ga0157369_10046386 | 3300013105 | Bacteria | 4722 |
| 209 | Ga0157374_10368371 | 3300013296 | Bacteria | 1430 |
| 210 | Ga0157374_10411689 | 3300013296 | Bacteria | 1350 |
| 211 | Ga0157378_10110569 | 3300013297 | Bacteria | 2519 |
| 212 | Ga0157378_10121895 | 3300013297 | Bacteria | 2404 |
| 213 | Ga0157378_10159186 | 3300013297 | Unclassified | 2110 |
| 214 | Ga0163162_10346200 | 3300013306 | Bacteria | 1619 |
| 215 | Ga0163162_10405232 | 3300013306 | Unclassified | 1496 |
| 216 | Ga0157372_10162033 | 3300013307 | Bacteria | 2585 |
| 217 | Ga0157372_10261048 | 3300013307 | Bacteria | 2011 |
| 218 | Ga0157372_10931804 | 3300013307 | Bacteria | 1007 |
| 219 | Ga0157372_11942273 | 3300013307 | Bacteria | 676 |
| 220 | Ga0157375_10301760 | 3300013308 | Bacteria | 1765 |
| 221 | Ga0157375_10304136 | 3300013308 | Bacteria | 1758 |
| 222 | Ga0157375_10725757 | 3300013308 | Bacteria | 1146 |
| 223 | Ga0157375_11155249 | 3300013308 | Bacteria | 907 |
| 224 | Ga0163163_10863862 | 3300014325 | Unclassified | 968 |
| 225 | Ga0163163_12213640 | 3300014325 | Unclassified | 609 |
| 226 | Ga0157380_10946601 | 3300014326 | Bacteria | 891 |
| 227 | Ga0157377_10019144 | 3300014745 | Bacteria | 3574 |
| 228 | Ga0157379_10101729 | 3300014968 | Bacteria | 2579 |
| 229 | Ga0157379_10194829 | 3300014968 | Bacteria | 1831 |
| 230 | Ga0157376_10109934 | 3300014969 | Bacteria | 2424 |
| 231 | Ga0157376_10243738 | 3300014969 | Bacteria | 1675 |
| 232 | Ga0157376_10778846 | 3300014969 | Bacteria | 968 |
| 233 | Ga0182007_10067207 | 3300015262 | Bacteria | 1174 |
| 234 | Ga0163161_10029152 | 3300017792 | Bacteria | 3923 |
| 235 | Ga0184601_125268 | 3300019183 | Unclassified | 594 |
| 236 | Ga0213876_10015945 | 3300021384 | Bacteria | 3976 |
| 237 | Ga0213871_10037160 | 3300021441 | Bacteria | 1295 |
| 238 | Ga0207656_10118051 | 3300025321 | Bacteria | 1232 |
| 239 | Ga0207692_10099211 | 3300025898 | Bacteria | 1595 |
| 240 | Ga0207692_10137347 | 3300025898 | Unclassified | 1387 |
| 241 | Ga0207692_10278460 | 3300025898 | Unclassified | 1011 |
| 242 | Ga0207642_10068578 | 3300025899 | Unclassified | 1678 |
| 243 | Ga0207710_10082468 | 3300025900 | Bacteria | 1494 |
| 244 | Ga0207710_10218930 | 3300025900 | Unclassified | 945 |
| 245 | Ga0207710_10465822 | 3300025900 | Bacteria | 654 |
| 246 | Ga0207688_10032344 | 3300025901 | Bacteria | 2891 |
| 247 | Ga0207680_10047516 | 3300025903 | Bacteria | 2544 |
| 248 | Ga0207699_10100036 | 3300025906 | Unclassified | 1838 |
| 249 | Ga0207699_10185129 | 3300025906 | Bacteria | 1402 |
| 250 | Ga0207699_10229418 | 3300025906 | Bacteria | 1271 |
| 251 | Ga0207699_10938537 | 3300025906 | Unclassified | 639 |
| 252 | Ga0207699_11048787 | 3300025906 | Unclassified | 603 |
| 253 | Ga0207645_10025770 | 3300025907 | Bacteria | 3804 |
| 254 | Ga0207645_10178766 | 3300025907 | Unclassified | 1392 |
| 255 | Ga0207705_10229178 | 3300025909 | Bacteria | 1413 |
| 256 | Ga0207707_10007863 | 3300025912 | Bacteria | 9272 |
| 257 | Ga0207707_10014737 | 3300025912 | Bacteria | 6813 |
| 258 | Ga0207707_10061700 | 3300025912 | Bacteria | 3262 |
| 259 | Ga0207695_10060181 | 3300025913 | Bacteria | 3933 |
| 260 | Ga0207695_10095212 | 3300025913 | Bacteria | 2983 |
| 261 | Ga0207671_10453283 | 3300025914 | Bacteria | 1022 |
| 262 | Ga0207693_10024907 | 3300025915 | Bacteria | 4746 |
| 263 | Ga0207693_10028957 | 3300025915 | Bacteria | 4377 |
| 264 | Ga0207693_10046591 | 3300025915 | Bacteria | 3406 |
| 265 | Ga0207693_10078423 | 3300025915 | Bacteria | 2585 |
| 266 | Ga0207693_10436981 | 3300025915 | Bacteria | 1023 |
| 267 | Ga0207693_10862253 | 3300025915 | Unclassified | 696 |
| 268 | Ga0207663_10128429 | 3300025916 | Bacteria | 1747 |
| 269 | Ga0207663_10156076 | 3300025916 | Bacteria | 1605 |
| 270 | Ga0207663_10294901 | 3300025916 | Bacteria | 1209 |
| 271 | Ga0207663_10749574 | 3300025916 | Bacteria | 775 |
| 272 | Ga0207660_10034342 | 3300025917 | Bacteria | 3514 |
| 273 | Ga0207660_10935045 | 3300025917 | Bacteria | 707 |
| 274 | Ga0207662_10073416 | 3300025918 | Unclassified | 2075 |
| 275 | Ga0207662_10182440 | 3300025918 | Bacteria | 1351 |
| 276 | Ga0207662_10317767 | 3300025918 | Bacteria | 1039 |
| 277 | Ga0207657_10047987 | 3300025919 | Bacteria | 3730 |
| 278 | Ga0207657_10096761 | 3300025919 | Bacteria | 2455 |
| 279 | Ga0207657_10122749 | 3300025919 | Unclassified | 2136 |
| 280 | Ga0207649_10056429 | 3300025920 | Bacteria | 2453 |
| 281 | Ga0207649_10119664 | 3300025920 | Unclassified | 1773 |
| 282 | Ga0207649_10322607 | 3300025920 | Bacteria | 1135 |
| 283 | Ga0207652_10035613 | 3300025921 | Bacteria | 4203 |
| 284 | Ga0207652_10036910 | 3300025921 | Bacteria | 4133 |
| 285 | Ga0207652_10054988 | 3300025921 | Bacteria | 3423 |
| 286 | Ga0207652_10748891 | 3300025921 | Unclassified | 870 |
| 287 | Ga0207646_10128337 | 3300025922 | Bacteria | 2281 |
| 288 | Ga0207646_10975382 | 3300025922 | Unclassified | 750 |
| 289 | Ga0207681_10120958 | 3300025923 | Unclassified | 1920 |
| 290 | Ga0207681_10390779 | 3300025923 | Bacteria | 1122 |
| 291 | Ga0207694_10018798 | 3300025924 | Bacteria | 5223 |
| 292 | Ga0207687_10291798 | 3300025927 | Unclassified | 1311 |
| 293 | Ga0207687_10408122 | 3300025927 | Bacteria | 1119 |
| 294 | Ga0207687_10417652 | 3300025927 | Bacteria | 1106 |
| 295 | Ga0207700_10030110 | 3300025928 | Bacteria | 3839 |
| 296 | Ga0207700_10144162 | 3300025928 | Bacteria | 1961 |
| 297 | Ga0207700_11347643 | 3300025928 | Unclassified | 635 |
| 298 | Ga0207664_10012070 | 3300025929 | Bacteria | 6170 |
| 299 | Ga0207664_10857897 | 3300025929 | Unclassified | 816 |
| 300 | Ga0207644_10016185 | 3300025931 | Bacteria | 5017 |
| 301 | Ga0207644_10243177 | 3300025931 | Bacteria | 1433 |
| 302 | Ga0207644_10590602 | 3300025931 | Bacteria | 921 |
| 303 | Ga0207690_10461659 | 3300025932 | Bacteria | 1022 |
| 304 | Ga0207706_10025659 | 3300025933 | Bacteria | 5280 |
| 305 | Ga0207706_10056068 | 3300025933 | Bacteria | 3475 |
| 306 | Ga0207706_10121631 | 3300025933 | Bacteria | 2295 |
| 307 | Ga0207706_10629472 | 3300025933 | Unclassified | 920 |
| 308 | Ga0207686_10030666 | 3300025934 | Bacteria | 3186 |
| 309 | Ga0207686_10065757 | 3300025934 | Bacteria | 2314 |
| 310 | Ga0207709_10061374 | 3300025935 | Bacteria | 2349 |
| 311 | Ga0207709_10086950 | 3300025935 | Bacteria | 2031 |
| 312 | Ga0207669_10091045 | 3300025937 | Bacteria | 1985 |
| 313 | Ga0207704_10054467 | 3300025938 | Bacteria | 2439 |
| 314 | Ga0207665_10015450 | 3300025939 | Bacteria | 5011 |
| 315 | Ga0207665_11036925 | 3300025939 | Unclassified | 653 |
| 316 | Ga0207711_10323691 | 3300025941 | Bacteria | 1425 |
| 317 | Ga0207689_10099207 | 3300025942 | Bacteria | 2393 |
| 318 | Ga0207661_10187062 | 3300025944 | Bacteria | 1813 |
| 319 | Ga0207661_10188993 | 3300025944 | Bacteria | 1804 |
| 320 | Ga0207667_10046812 | 3300025949 | Bacteria | 4581 |
| 321 | Ga0207667_10052707 | 3300025949 | Bacteria | 4283 |
| 322 | Ga0207651_10466123 | 3300025960 | Bacteria | 1086 |
| 323 | Ga0207651_10551359 | 3300025960 | Bacteria | 1002 |
| 324 | Ga0207651_11667585 | 3300025960 | Unclassified | 574 |
| 325 | Ga0207712_10073704 | 3300025961 | Bacteria | 2463 |
| 326 | Ga0207712_10768277 | 3300025961 | Bacteria | 845 |
| 327 | Ga0207668_10001797 | 3300025972 | Bacteria | 12510 |
| 328 | Ga0207668_10034739 | 3300025972 | Bacteria | 3350 |
| 329 | Ga0207668_10706778 | 3300025972 | Unclassified | 886 |
| 330 | Ga0207668_11155739 | 3300025972 | Unclassified | 695 |
| 331 | Ga0207668_11309442 | 3300025972 | Unclassified | 652 |
| 332 | Ga0207640_10720306 | 3300025981 | Bacteria | 857 |
| 333 | Ga0207658_10046265 | 3300025986 | Bacteria | 3177 |
| 334 | Ga0207658_10299683 | 3300025986 | Bacteria | 1384 |
| 335 | Ga0207658_10304865 | 3300025986 | Bacteria | 1373 |
| 336 | Ga0207677_10694486 | 3300026023 | Unclassified | 902 |
| 337 | Ga0207703_10109011 | 3300026035 | Bacteria | 2359 |
| 338 | Ga0207703_10136860 | 3300026035 | Bacteria | 2121 |
| 339 | Ga0207703_10560243 | 3300026035 | Unclassified | 1078 |
| 340 | Ga0207703_10648231 | 3300026035 | Bacteria | 1002 |
| 341 | Ga0207639_10092092 | 3300026041 | Bacteria | 2429 |
| 342 | Ga0207678_10062758 | 3300026067 | Bacteria | 3193 |
| 343 | Ga0207678_10069402 | 3300026067 | Bacteria | 3022 |
| 344 | Ga0207678_10238827 | 3300026067 | Bacteria | 1556 |
| 345 | Ga0207678_10260779 | 3300026067 | Bacteria | 1485 |
| 346 | Ga0207678_10851340 | 3300026067 | Unclassified | 806 |
| 347 | Ga0207708_10074555 | 3300026075 | Bacteria | 2601 |
| 348 | Ga0207708_10273035 | 3300026075 | Bacteria | 1368 |
| 349 | Ga0207702_10287163 | 3300026078 | Bacteria | 1557 |
| 350 | Ga0207648_10091109 | 3300026089 | Bacteria | 2665 |
| 351 | Ga0207648_11607506 | 3300026089 | Bacteria | 611 |
| 352 | Ga0207676_11051647 | 3300026095 | Unclassified | 803 |
| 353 | Ga0207674_10033519 | 3300026116 | Bacteria | 5376 |
| 354 | Ga0207675_100004169 | 3300026118 | Bacteria | 13990 |
| 355 | Ga0207675_100190743 | 3300026118 | Bacteria | 1966 |
| 356 | Ga0207683_10003484 | 3300026121 | Bacteria | 13733 |
| 357 | Ga0207683_10015950 | 3300026121 | Bacteria | 6394 |
| 358 | Ga0207683_10079244 | 3300026121 | Bacteria | 2912 |
| 359 | Ga0207698_10796413 | 3300026142 | Bacteria | 947 |
| 360 | Ga0207428_10143579 | 3300027907 | Bacteria | 1820 |
| 361 | Ga0207428_10771940 | 3300027907 | Bacteria | 684 |
| 362 | Ga0268266_10108008 | 3300028379 | Bacteria | 2461 |
| 363 | Ga0268266_10621999 | 3300028379 | Bacteria | 1038 |
| 364 | Ga0268266_10657809 | 3300028379 | Bacteria | 1008 |
| 365 | Ga0265334_10014941 | 3300028573 | Bacteria | 3231 |
| 366 | Ga0265338_10276241 | 3300028800 | Bacteria | 1229 |
| 367 | Ga0265338_10367040 | 3300028800 | Bacteria | 1031 |
| 368 | Ga0265324_10191992 | 3300029957 | Bacteria | 694 |
| 369 | Ga0265330_10076631 | 3300031235 | Bacteria | 1443 |
| 370 | Ga0265325_10000048 | 3300031241 | Bacteria | 82899 |
| 371 | Ga0265325_10214295 | 3300031241 | Bacteria | 883 |
| 372 | Ga0265340_10084392 | 3300031247 | Bacteria | 1491 |
| 373 | Ga0265340_10237785 | 3300031247 | Bacteria | 813 |
| 374 | Ga0265340_10255186 | 3300031247 | Bacteria | 781 |
| 375 | Ga0265331_10311169 | 3300031250 | Bacteria | 705 |
| 376 | Ga0265316_10073214 | 3300031344 | Bacteria | 2639 |
| 377 | Ga0265316_10632276 | 3300031344 | Bacteria | 758 |
| 378 | Ga0265314_10009879 | 3300031711 | Bacteria | 8007 |
| 379 | Ga0373930_0016882 | 3300034816 | Bacteria | 1386 |
| 380 | Ga0373948_0019547 | 3300034817 | Unclassified | 1282 |
| 381 | Ga0373958_0019107 | 3300034819 | Bacteria | 1249 |
| 382 | Ga0373959_0119451 | 3300034820 | Bacteria | 643 |
| 383 | Ga0373926_0001058 | 3300035083 | Bacteria | 8091 |
| 384 | Ga0373926_0001601 | 3300035083 | Bacteria | 6971 |
| 385 | Ga0373926_0021511 | 3300035083 | Bacteria | 2234 |
| 386 | Ga0373929_0080683 | 3300035085 | Unclassified | 792 |
| 387 | Ga0373934_0061060 | 3300035086 | Bacteria | 1501 |
| 388 | Ga0373940_0175534 | 3300035088 | Unclassified | 694 |
| 389 | Ga0373944_0010442 | 3300035089 | Unclassified | 2531 |
| 390 | Ga0373944_0026854 | 3300035089 | Bacteria | 1703 |
| 391 | Ga0373951_0012289 | 3300035091 | Bacteria | 1925 |
| 392 | Ga0373951_0047258 | 3300035091 | Bacteria | 1051 |
| 393 | Ga0373952_0007777 | 3300035092 | Bacteria | 2019 |
| 394 | Ga0373923_0015615 | 3300035111 | Bacteria | 2869 |
| 395 | Ga0373923_0076512 | 3300035111 | Bacteria | 1445 |
| 396 | Ga0373936_0012788 | 3300035113 | Bacteria | 3198 |
| 397 | Ga0373936_0015863 | 3300035113 | Bacteria | 2890 |
| 398 | Ga0373936_0017322 | 3300035113 | Unclassified | 2773 |
| 399 | Ga0373936_0097807 | 3300035113 | Unclassified | 1236 |
| 400 | Ga0373936_0133452 | 3300035113 | Bacteria | 1068 |
| 401 | Ga0373939_0010020 | 3300035114 | Bacteria | 2360 |
| 402 | Ga0373941_0129557 | 3300035115 | Unclassified | 907 |
| 403 | Ga0373945_0006535 | 3300035116 | Bacteria | 3766 |
| 404 | Ga0373945_0024643 | 3300035116 | Bacteria | 2086 |
| 405 | Ga0373945_0027116 | 3300035116 | Unclassified | 2000 |
| 406 | Ga0373945_0177440 | 3300035116 | Unclassified | 875 |
| 407 | Ga0373945_0190615 | 3300035116 | Bacteria | 847 |
| 408 | Ga0373953_0025411 | 3300035117 | Bacteria | 2262 |
| 409 | Ga0373953_0026092 | 3300035117 | Unclassified | 2236 |
| 410 | Ga0373953_0170322 | 3300035117 | Unclassified | 937 |
| 411 | Ga0373953_0185976 | 3300035117 | Unclassified | 897 |
| 412 | Ga0373954_0007748 | 3300035118 | Bacteria | 4698 |
| 413 | Ga0373954_0015424 | 3300035118 | Bacteria | 3415 |
| 414 | Ga0373954_0027582 | 3300035118 | Bacteria | 2608 |
| 415 | Ga0373954_0043351 | 3300035118 | Bacteria | 2098 |
| 416 | Ga0373954_0047599 | 3300035118 | Unclassified | 2007 |
| 417 | Ga0373954_0110462 | 3300035118 | Bacteria | 1330 |
| 418 | Ga0373956_0037962 | 3300035119 | Bacteria | 2130 |
| 419 | Ga0373956_0054134 | 3300035119 | Bacteria | 1807 |
| 420 | Ga0373956_0145045 | 3300035119 | Unclassified | 1115 |
| 421 | Ga0373957_0014032 | 3300035120 | Bacteria | 2731 |
| 422 | Ga0373957_0042803 | 3300035120 | Unclassified | 1709 |
| 423 | Ga0373957_0091495 | 3300035120 | Unclassified | 1209 |
| 424 | Ga0373957_0148968 | 3300035120 | Unclassified | 960 |
| 425 | Ga0373960_0095442 | 3300035121 | Bacteria | 957 |
| 426 | Ga0373943_0015289 | 3300035170 | Bacteria | 3485 |
| 427 | Ga0373943_0075650 | 3300035170 | Bacteria | 1715 |
| 428 | Ga0373943_0183747 | 3300035170 | Unclassified | 1150 |
| 429 | Ga0373943_0189945 | 3300035170 | Bacteria | 1132 |
| 430 | Ga0373946_0029747 | 3300035171 | Bacteria | 2176 |
| 431 | Ga0373946_0115220 | 3300035171 | Bacteria | 1221 |
| 432 | Ga0373955_0000294 | 3300035172 | Bacteria | 20614 |
| 433 | Ga0373955_0002670 | 3300035172 | Bacteria | 7801 |
| 434 | Ga0373955_0007232 | 3300035172 | Bacteria | 5093 |
| 435 | Ga0373955_0053493 | 3300035172 | Bacteria | 2204 |
| 436 | Ga0373955_0108656 | 3300035172 | Bacteria | 1601 |
| 437 | Ga0373942_0019741 | 3300035207 | Bacteria | 1685 |
| 438 | Ga0373942_0033815 | 3300035207 | Unclassified | 1365 |
| 439 | Ga0373961_0300322 | 3300035241 | Unclassified | 594 |
| 440 | Ga0373962_0023574 | 3300035242 | Bacteria | 1640 |
| 441 | Ga0373924_0001452 | 3300035410 | Bacteria | 7702 |
| 442 | Ga0373924_0024494 | 3300035410 | Unclassified | 2378 |
| 443 | Ga0373924_0053134 | 3300035410 | Bacteria | 1682 |
| 444 | Ga0373924_0084491 | 3300035410 | Bacteria | 1353 |
| 445 | Ga0373924_0114869 | 3300035410 | Bacteria | 1166 |
| 446 | Ga0373924_0311171 | 3300035410 | Bacteria | 700 |
| 447 | Ga0373931_0006069 | 3300035691 | Bacteria | 5628 |
| 448 | Ga0373931_0178515 | 3300035691 | Unclassified | 1256 |
| 449 | Ga0373931_0184159 | 3300035691 | Bacteria | 1239 |
| 450 | Ga0373935_0007394 | 3300035692 | Bacteria | 6572 |
| 451 | Ga0373935_0024182 | 3300035692 | Bacteria | 3737 |
| 452 | Ga0373935_0027203 | 3300035692 | Bacteria | 3535 |
| 453 | Ga0373935_0038005 | 3300035692 | Bacteria | 3013 |
| 454 | Ga0373935_0194372 | 3300035692 | Bacteria | 1399 |
| 455 | Ga0373935_0606933 | 3300035692 | Unclassified | 800 |
| 456 | Ga0373927_0109948 | 3300035695 | Bacteria | 1795 |
| 457 | Ga0373927_0212865 | 3300035695 | Bacteria | 1269 |
| 458 | Ga0373927_0298459 | 3300035695 | Bacteria | 1060 |
| 459 | Ga0373927_0383759 | 3300035695 | Unclassified | 926 |
| 460 | Ga0373933_0004809 | 3300035724 | Bacteria | 7385 |
| 461 | Ga0373933_0010078 | 3300035724 | Bacteria | 5172 |
| 462 | Ga0373933_0121529 | 3300035724 | Bacteria | 1636 |
| 463 | Ga0373933_0148466 | 3300035724 | Bacteria | 1483 |
| 464 | Ga0373933_0153659 | 3300035724 | Unclassified | 1458 |
| 465 | Ga0373933_0214900 | 3300035724 | Bacteria | 1233 |
| 466 | Ga0373947_0000391 | 3300035725 | Bacteria | 24724 |
| 467 | Ga0373947_0006399 | 3300035725 | Bacteria | 6844 |
| 468 | Ga0373947_0034398 | 3300035725 | Bacteria | 2996 |
| 469 | Ga0373947_0155066 | 3300035725 | Unclassified | 1477 |
| 470 | Ga0373947_0359717 | 3300035725 | Bacteria | 977 |
| 471 | Ga0373947_0388168 | 3300035725 | Unclassified | 940 |
| 472 | Ga0373947_0413898 | 3300035725 | Unclassified | 910 |
| 473 | Ga0373947_0466227 | 3300035725 | Bacteria | 856 |
| 474 | Ga0373947_0507585 | 3300035725 | Bacteria | 820 |
| 475 | Ga0373937_0000081 | 3300036401 | Bacteria | 88009 |
| 476 | Ga0373937_0001398 | 3300036401 | Bacteria | 20148 |
| 477 | Ga0373937_0149359 | 3300036401 | Bacteria | 2188 |
| 478 | Ga0373937_0234445 | 3300036401 | Unclassified | 1728 |
| 479 | Ga0373937_0253492 | 3300036401 | Unclassified | 1659 |
| 480 | Ga0373937_0352978 | 3300036401 | Bacteria | 1393 |
| 481 | Ga0373937_0361561 | 3300036401 | Unclassified | 1375 |
| 482 | Ga0373937_0715730 | 3300036401 | Unclassified | 948 |
| 483 | Ga0373925_0000425 | 3300037068 | Bacteria | 42725 |
| 484 | Ga0373925_0014118 | 3300037068 | Bacteria | 5781 |
| 485 | Ga0373925_0678221 | 3300037068 | Bacteria | 849 |
| 486 | Ga0373925_0859774 | 3300037068 | Unclassified | 747 |
| 487 | Ga0373925_0972397 | 3300037068 | Bacteria | 699 |
| 488 | Ga0436365_1710235 | 3300039437 | Bacteria | 926 |
| 489 | Ga0436360_1328245 | 3300039438 | Bacteria | 3119 |
| 490 | Ga0436362_0185652 | 3300039453 | Bacteria | 1442 |
| 491 | Ga0451577_0071989 | 3300042876 | Bacteria | 3083 |
| 492 | Ga0466963_0352214 | 3300044694 | Bacteria | 1037 |
| 493 | Ga0466971_0038829 | 3300044719 | Bacteria | 2137 |
| 494 | Ga0466957_0221393 | 3300044842 | Bacteria | 1250 |
| 495 | Ga0466959_0565570 | 3300045049 | Bacteria | 766 |
| 496 | Ga0451576_0003473 | 3300045051 | Bacteria | 21579 |
| 497 | Ga0451576_0377738 | 3300045051 | Bacteria | 1485 |
| 498 | Ga0466967_0249655 | 3300045976 | Bacteria | 1695 |
| 499 | Ga0466967_0452865 | 3300045976 | Unclassified | 1254 |
| 500 | Ga0495617_028376 | 3300046452 | Unclassified | 1881 |
| 501 | Ga0495592_0000177 | 3300046454 | Bacteria | 56202 |
| 502 | Ga0495592_0007387 | 3300046454 | Bacteria | 8223 |
| 503 | Ga0495592_0044961 | 3300046454 | Unclassified | 3296 |
| 504 | Ga0495592_0063633 | 3300046454 | Bacteria | 2705 |
| 505 | Ga0495592_0092689 | 3300046454 | Bacteria | 2164 |
| 506 | Ga0495592_0160998 | 3300046454 | Bacteria | 1544 |
| 507 | Ga0495603_0005357 | 3300046455 | Bacteria | 7649 |
| 508 | Ga0495603_0135661 | 3300046455 | Bacteria | 1432 |
| 509 | Ga0495591_034011 | 3300046458 | Bacteria | 1504 |
| 510 | Ga0495629_0013975 | 3300046459 | Bacteria | 5788 |
| 511 | Ga0495629_0014801 | 3300046459 | Bacteria | 5610 |
| 512 | Ga0495629_0064352 | 3300046459 | Bacteria | 2561 |
| 513 | Ga0495629_0110721 | 3300046459 | Bacteria | 1914 |
| 514 | Ga0495629_0119398 | 3300046459 | Bacteria | 1837 |
| 515 | Ga0495629_0172731 | 3300046459 | Bacteria | 1499 |
| 516 | Ga0495629_0417795 | 3300046459 | Unclassified | 910 |
| 517 | Ga0495641_0013945 | 3300046461 | Unclassified | 4377 |
| 518 | Ga0495641_0041779 | 3300046461 | Unclassified | 2128 |
| 519 | Ga0495651_0000210 | 3300046462 | Bacteria | 44718 |
| 520 | Ga0495651_0000979 | 3300046462 | Bacteria | 22156 |
| 521 | Ga0495651_0003153 | 3300046462 | Bacteria | 12701 |
| 522 | Ga0495651_0017937 | 3300046462 | Bacteria | 5481 |
| 523 | Ga0495651_0044115 | 3300046462 | Bacteria | 3456 |
| 524 | Ga0495651_0165330 | 3300046462 | Bacteria | 1581 |
| 525 | Ga0495651_0639071 | 3300046462 | Unclassified | 668 |
| 526 | Ga0495653_0000054 | 3300046463 | Bacteria | 102885 |
| 527 | Ga0495653_0000528 | 3300046463 | Bacteria | 29299 |
| 528 | Ga0495653_0001202 | 3300046463 | Bacteria | 20094 |
| 529 | Ga0495653_0008981 | 3300046463 | Bacteria | 8174 |
| 530 | Ga0495653_0102463 | 3300046463 | Bacteria | 2071 |
| 531 | Ga0495653_0241686 | 3300046463 | Bacteria | 1203 |
| 532 | Ga0495580_0022339 | 3300046472 | Bacteria | 4656 |
| 533 | Ga0495580_0029504 | 3300046472 | Bacteria | 3980 |
| 534 | Ga0495582_0029526 | 3300046473 | Bacteria | 3010 |
| 535 | Ga0495582_0050389 | 3300046473 | Bacteria | 2294 |
| 536 | Ga0495582_0067845 | 3300046473 | Bacteria | 1971 |
| 537 | Ga0495582_0269713 | 3300046473 | Bacteria | 976 |
| 538 | Ga0495582_0272447 | 3300046473 | Unclassified | 971 |
| 539 | Ga0495582_0373097 | 3300046473 | Unclassified | 822 |
| 540 | Ga0495639_0042151 | 3300046475 | Bacteria | 2057 |
| 541 | Ga0495639_0080525 | 3300046475 | Bacteria | 1516 |
| 542 | Ga0495639_0310326 | 3300046475 | Bacteria | 788 |
| 543 | Ga0495639_0364727 | 3300046475 | Unclassified | 726 |
| 544 | Ga0495662_0006393 | 3300046476 | Bacteria | 5886 |
| 545 | Ga0495662_0083117 | 3300046476 | Unclassified | 1558 |
| 546 | Ga0495662_0095906 | 3300046476 | Bacteria | 1449 |
| 547 | Ga0495662_0206390 | 3300046476 | Unclassified | 968 |
| 548 | Ga0495664_0000020 | 3300046477 | Bacteria | 150749 |
| 549 | Ga0495664_0002815 | 3300046477 | Bacteria | 9349 |
| 550 | Ga0495664_0060964 | 3300046477 | Unclassified | 2246 |
| 551 | Ga0495664_0124455 | 3300046477 | Unclassified | 1559 |
| 552 | Ga0495664_0205806 | 3300046477 | Bacteria | 1192 |
| 553 | Ga0495664_0320637 | 3300046477 | Bacteria | 934 |
| 554 | Ga0495664_0413970 | 3300046477 | Unclassified | 809 |
| 555 | Ga0495585_0000995 | 3300046492 | Bacteria | 23693 |
| 556 | Ga0495585_0190857 | 3300046492 | Bacteria | 1048 |
| 557 | Ga0495585_0267215 | 3300046492 | Unclassified | 849 |
| 558 | Ga0495594_0009061 | 3300046499 | Bacteria | 5137 |
| 559 | Ga0495594_0009465 | 3300046499 | Bacteria | 5034 |
| 560 | Ga0495594_0009573 | 3300046499 | Bacteria | 5009 |
| 561 | Ga0495607_0013487 | 3300046501 | Bacteria | 5354 |
| 562 | Ga0495607_0330219 | 3300046501 | Unclassified | 709 |
| 563 | Ga0495608_0000024 | 3300046511 | Bacteria | 159429 |
| 564 | Ga0495608_0000363 | 3300046511 | Bacteria | 31688 |
| 565 | Ga0495608_0025424 | 3300046511 | Bacteria | 4042 |
| 566 | Ga0495608_0026296 | 3300046511 | Bacteria | 3968 |
| 567 | Ga0495608_0037615 | 3300046511 | Bacteria | 3254 |
| 568 | Ga0495608_0047457 | 3300046511 | Bacteria | 2855 |
| 569 | Ga0495608_0055855 | 3300046511 | Bacteria | 2609 |
| 570 | Ga0495616_0270259 | 3300046513 | Bacteria | 725 |
| 571 | Ga0495618_0000020 | 3300046514 | Bacteria | 130661 |
| 572 | Ga0495618_0012894 | 3300046514 | Bacteria | 5080 |
| 573 | Ga0495618_0063650 | 3300046514 | Unclassified | 2342 |
| 574 | Ga0495618_0135188 | 3300046514 | Bacteria | 1577 |
| 575 | Ga0495618_0380630 | 3300046514 | Unclassified | 866 |
| 576 | Ga0495618_0422596 | 3300046514 | Unclassified | 812 |
| 577 | Ga0495628_0000015 | 3300046516 | Bacteria | 198912 |
| 578 | Ga0495628_0001606 | 3300046516 | Bacteria | 20730 |
| 579 | Ga0495628_0022277 | 3300046516 | Bacteria | 5205 |
| 580 | Ga0495628_0051882 | 3300046516 | Bacteria | 3241 |
| 581 | Ga0495628_0179614 | 3300046516 | Bacteria | 1601 |
| 582 | Ga0495628_0220556 | 3300046516 | Bacteria | 1424 |
| 583 | Ga0495628_0414884 | 3300046516 | Bacteria | 982 |
| 584 | Ga0495630_0001403 | 3300046517 | Bacteria | 16663 |
| 585 | Ga0495630_0006847 | 3300046517 | Bacteria | 8124 |
| 586 | Ga0495630_0068880 | 3300046517 | Bacteria | 2661 |
| 587 | Ga0495630_0078947 | 3300046517 | Bacteria | 2482 |
| 588 | Ga0495630_0133399 | 3300046517 | Unclassified | 1886 |
| 589 | Ga0495630_0348429 | 3300046517 | Unclassified | 1133 |
| 590 | Ga0495630_0406623 | 3300046517 | Bacteria | 1043 |
| 591 | Ga0495631_0184306 | 3300046518 | Bacteria | 894 |
| 592 | Ga0495632_0152268 | 3300046519 | Bacteria | 1069 |
| 593 | Ga0495637_0099655 | 3300046520 | Bacteria | 1137 |
| 594 | Ga0495637_0113641 | 3300046520 | Unclassified | 1047 |
| 595 | Ga0495644_0002021 | 3300046523 | Bacteria | 8158 |
| 596 | Ga0495644_0183585 | 3300046523 | Unclassified | 804 |
| 597 | Ga0495663_0038866 | 3300046525 | Unclassified | 1440 |
| 598 | Ga0495666_0010026 | 3300046526 | Bacteria | 4729 |
| 599 | Ga0495666_0019975 | 3300046526 | Bacteria | 3322 |
| 600 | Ga0495666_0285215 | 3300046526 | Unclassified | 748 |
| 601 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 602 | Ga0495652_0021629 | 3300046529 | Bacteria | 5716 |
| 603 | Ga0495652_0028971 | 3300046529 | Bacteria | 4864 |
| 604 | Ga0495652_0037531 | 3300046529 | Bacteria | 4202 |
| 605 | Ga0495652_0052449 | 3300046529 | Bacteria | 3478 |
| 606 | Ga0495652_0214032 | 3300046529 | Bacteria | 1452 |
| 607 | Ga0495665_0013877 | 3300046531 | Bacteria | 4351 |
| 608 | Ga0495665_0029669 | 3300046531 | Bacteria | 2930 |
| 609 | Ga0495665_0300197 | 3300046531 | Unclassified | 822 |
| 610 | Ga0495665_0449839 | 3300046531 | Unclassified | 651 |
| 611 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 612 | Ga0495640_0009366 | 3300046533 | Bacteria | 7625 |
| 613 | Ga0495640_0035429 | 3300046533 | Bacteria | 3532 |
| 614 | Ga0495640_0358325 | 3300046533 | Unclassified | 899 |
| 615 | Ga0495586_0012387 | 3300046535 | Bacteria | 4523 |
| 616 | Ga0495586_0020698 | 3300046535 | Bacteria | 3503 |
| 617 | Ga0495586_0093784 | 3300046535 | Unclassified | 1660 |
| 618 | Ga0495586_0153680 | 3300046535 | Unclassified | 1295 |
| 619 | Ga0495586_0314286 | 3300046535 | Bacteria | 898 |
| 620 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 621 | Ga0495587_0007214 | 3300046536 | Bacteria | 7210 |
| 622 | Ga0495587_0008295 | 3300046536 | Bacteria | 6689 |
| 623 | Ga0495587_0015467 | 3300046536 | Bacteria | 4765 |
| 624 | Ga0495587_0168109 | 3300046536 | Unclassified | 1246 |
| 625 | Ga0495587_0339134 | 3300046536 | Bacteria | 838 |
| 626 | Ga0495598_0001368 | 3300046537 | Bacteria | 4794 |
| 627 | Ga0495609_0023475 | 3300046538 | Bacteria | 2835 |
| 628 | Ga0495621_0185497 | 3300046539 | Bacteria | 832 |
| 629 | Ga0495645_0000013 | 3300046543 | Bacteria | 186399 |
| 630 | Ga0495645_0001389 | 3300046543 | Bacteria | 16360 |
| 631 | Ga0495645_0002241 | 3300046543 | Bacteria | 13151 |
| 632 | Ga0495645_0021101 | 3300046543 | Bacteria | 4707 |
| 633 | Ga0495645_0438028 | 3300046543 | Unclassified | 826 |
| 634 | Ga0495622_0009159 | 3300046557 | Bacteria | 4582 |
| 635 | Ga0495622_0032737 | 3300046557 | Unclassified | 2427 |
| 636 | Ga0495622_0045319 | 3300046557 | Bacteria | 2044 |
| 637 | Ga0495667_0000030 | 3300046559 | Bacteria | 147898 |
| 638 | Ga0495667_0007285 | 3300046559 | Bacteria | 7507 |
| 639 | Ga0495667_0008025 | 3300046559 | Bacteria | 7160 |
| 640 | Ga0495667_0026131 | 3300046559 | Bacteria | 3933 |
| 641 | Ga0495667_0044504 | 3300046559 | Unclassified | 2940 |
| 642 | Ga0495667_0147425 | 3300046559 | Bacteria | 1515 |
| 643 | Ga0495667_0211148 | 3300046559 | Bacteria | 1240 |
| 644 | Ga0495656_0254328 | 3300046615 | Bacteria | 888 |
| 645 | Ga0495634_0000117 | 3300046642 | Bacteria | 67216 |
| 646 | Ga0495634_0002830 | 3300046642 | Bacteria | 14243 |
| 647 | Ga0495634_0078649 | 3300046642 | Bacteria | 2160 |
| 648 | Ga0495634_0089026 | 3300046642 | Bacteria | 2007 |
| 649 | Ga0495634_0120109 | 3300046642 | Bacteria | 1683 |
| 650 | Ga0495634_0123845 | 3300046642 | Unclassified | 1653 |
| 651 | Ga0495634_0211828 | 3300046642 | Unclassified | 1199 |
| 652 | Ga0495634_0390305 | 3300046642 | Unclassified | 828 |
| 653 | Ga0495611_0015454 | 3300046648 | Bacteria | 3264 |
| 654 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 655 | Ga0495635_0000730 | 3300046663 | Bacteria | 21233 |
| 656 | Ga0495635_0017369 | 3300046663 | Bacteria | 5026 |
| 657 | Ga0495635_0052084 | 3300046663 | Bacteria | 2820 |
| 658 | Ga0495635_0058753 | 3300046663 | Unclassified | 2645 |
| 659 | Ga0495635_0082043 | 3300046663 | Bacteria | 2206 |
| 660 | Ga0495635_0116088 | 3300046663 | Unclassified | 1827 |
| 661 | Ga0495635_0185053 | 3300046663 | Bacteria | 1415 |
| 662 | Ga0495635_0238677 | 3300046663 | Bacteria | 1227 |
| 663 | Ga0495635_0408012 | 3300046663 | Unclassified | 902 |
| 664 | Ga0495659_0014801 | 3300046664 | Unclassified | 2558 |
| 665 | Ga0495659_0055651 | 3300046664 | Bacteria | 1450 |
| 666 | Ga0495661_0044492 | 3300046665 | Unclassified | 2721 |
| 667 | Ga0495661_0183843 | 3300046665 | Bacteria | 1106 |
| 668 | Ga0495588_0001656 | 3300046674 | Bacteria | 9523 |
| 669 | Ga0495588_0069820 | 3300046674 | Unclassified | 1826 |
| 670 | Ga0495657_0000028 | 3300046675 | Bacteria | 131008 |
| 671 | Ga0495657_0004124 | 3300046675 | Bacteria | 11637 |
| 672 | Ga0495657_0007370 | 3300046675 | Bacteria | 8501 |
| 673 | Ga0495657_0107600 | 3300046675 | Unclassified | 1769 |
| 674 | Ga0495657_0163773 | 3300046675 | Unclassified | 1374 |
| 675 | Ga0495657_0187632 | 3300046675 | Unclassified | 1265 |
| 676 | Ga0495599_0000050 | 3300046678 | Bacteria | 82601 |
| 677 | Ga0495599_0001421 | 3300046678 | Bacteria | 13703 |
| 678 | Ga0495599_0003607 | 3300046678 | Bacteria | 9079 |
| 679 | Ga0495599_0035288 | 3300046678 | Bacteria | 3139 |
| 680 | Ga0495599_0068968 | 3300046678 | Unclassified | 2207 |
| 681 | Ga0495599_0113628 | 3300046678 | Unclassified | 1685 |
| 682 | Ga0495599_0253523 | 3300046678 | Bacteria | 1070 |
| 683 | Ga0495599_0420429 | 3300046678 | Bacteria | 794 |
| 684 | Ga0495623_0000013 | 3300046679 | Bacteria | 119870 |
| 685 | Ga0495623_0002343 | 3300046679 | Bacteria | 12621 |
| 686 | Ga0495623_0012831 | 3300046679 | Bacteria | 5426 |
| 687 | Ga0495623_0125282 | 3300046679 | Bacteria | 1543 |
| 688 | Ga0495646_0000003 | 3300046680 | Bacteria | 287773 |
| 689 | Ga0495646_0001198 | 3300046680 | Bacteria | 15177 |
| 690 | Ga0495646_0014444 | 3300046680 | Bacteria | 5021 |
| 691 | Ga0495646_0019546 | 3300046680 | Bacteria | 4286 |
| 692 | Ga0495646_0035661 | 3300046680 | Bacteria | 3085 |
| 693 | Ga0495646_0632207 | 3300046680 | Unclassified | 542 |
| 694 | Ga0495647_0003783 | 3300046681 | Bacteria | 4867 |
| 695 | Ga0495647_0043889 | 3300046681 | Bacteria | 1712 |
| 696 | Ga0495647_0329865 | 3300046681 | Unclassified | 692 |
| 697 | Ga0495658_0033382 | 3300046683 | Bacteria | 2817 |
| 698 | Ga0495658_0102964 | 3300046683 | Bacteria | 1706 |
| 699 | Ga0495658_0117891 | 3300046683 | Unclassified | 1602 |
| 700 | Ga0495658_0155192 | 3300046683 | Bacteria | 1408 |
| 701 | Ga0495658_0180135 | 3300046683 | Bacteria | 1311 |
| 702 | Ga0495658_0543346 | 3300046683 | Unclassified | 744 |
| 703 | Ga0495669_0006462 | 3300046684 | Bacteria | 4896 |
| 704 | Ga0495613_0062399 | 3300046689 | Bacteria | 2727 |
| 705 | Ga0495613_0112842 | 3300046689 | Bacteria | 1957 |
| 706 | Ga0495613_0133899 | 3300046689 | Bacteria | 1774 |
| 707 | Ga0495613_0171154 | 3300046689 | Bacteria | 1541 |
| 708 | Ga0495613_0174735 | 3300046689 | Bacteria | 1523 |
| 709 | Ga0495613_0297627 | 3300046689 | Unclassified | 1117 |
| 710 | Ga0495613_0426013 | 3300046689 | Unclassified | 902 |
| 711 | Ga0495624_0009345 | 3300046690 | Bacteria | 6793 |
| 712 | Ga0495624_0055522 | 3300046690 | Bacteria | 2494 |
| 713 | Ga0495624_0203750 | 3300046690 | Bacteria | 1201 |
| 714 | Ga0495670_0001271 | 3300046691 | Bacteria | 12333 |
| 715 | Ga0495600_0000002 | 3300046809 | Bacteria | 186597 |
| 716 | Ga0495600_0002739 | 3300046809 | Bacteria | 10205 |
| 717 | Ga0495600_0003702 | 3300046809 | Bacteria | 9035 |
| 718 | Ga0495600_0011581 | 3300046809 | Bacteria | 5500 |
| 719 | Ga0495600_0050772 | 3300046809 | Unclassified | 2706 |
| 720 | Ga0495581_0069003 | 3300047315 | Bacteria | 2044 |
| 721 | Ga0495581_0072904 | 3300047315 | Unclassified | 1987 |
| 722 | Ga0495581_0116039 | 3300047315 | Bacteria | 1557 |
| 723 | Ga0495581_0390261 | 3300047315 | Unclassified | 812 |
| 724 | Ga0495581_0479639 | 3300047315 | Bacteria | 723 |
| 725 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 726 | Ga0495604_0000186 | 3300047317 | Bacteria | 55450 |
| 727 | Ga0495604_0001606 | 3300047317 | Bacteria | 18631 |
| 728 | Ga0495604_0006423 | 3300047317 | Bacteria | 9332 |
| 729 | Ga0495604_0053395 | 3300047317 | Bacteria | 3123 |
| 730 | Ga0495604_0210861 | 3300047317 | Bacteria | 1342 |
| 731 | Ga0495604_0230178 | 3300047317 | Bacteria | 1271 |
| 732 | Ga0495604_0239635 | 3300047317 | Bacteria | 1241 |
| 733 | Ga0495674_0000018 | 3300047319 | Bacteria | 204024 |
| 734 | Ga0495674_0017517 | 3300047319 | Bacteria | 6668 |
| 735 | Ga0495674_0048394 | 3300047319 | Unclassified | 3762 |
| 736 | Ga0495674_0107696 | 3300047319 | Bacteria | 2365 |
| 737 | Ga0495674_0109689 | 3300047319 | Unclassified | 2340 |
| 738 | Ga0495674_0385549 | 3300047319 | Bacteria | 1133 |
| 739 | Ga0495676_0090294 | 3300047321 | Bacteria | 2293 |
| 740 | Ga0495676_0131656 | 3300047321 | Bacteria | 1804 |
| 741 | Ga0495676_0251202 | 3300047321 | Bacteria | 1206 |
| 742 | Ga0495676_0624437 | 3300047321 | Bacteria | 700 |
| 743 | Ga0495676_0920310 | 3300047321 | Bacteria | 560 |
| 744 | Ga0495680_0000159 | 3300047322 | Bacteria | 68873 |
| 745 | Ga0495680_0005565 | 3300047322 | Bacteria | 11826 |
| 746 | Ga0495680_0014550 | 3300047322 | Bacteria | 6811 |
| 747 | Ga0495680_0018619 | 3300047322 | Bacteria | 5886 |
| 748 | Ga0495680_0023301 | 3300047322 | Bacteria | 5149 |
| 749 | Ga0495680_0099178 | 3300047322 | Bacteria | 2172 |
| 750 | Ga0495680_0117268 | 3300047322 | Bacteria | 1968 |
| 751 | Ga0495675_0000238 | 3300047444 | Bacteria | 39857 |
| 752 | Ga0495675_0005457 | 3300047444 | Bacteria | 7755 |
| 753 | Ga0495675_0014186 | 3300047444 | Bacteria | 5038 |
| 754 | Ga0495675_0035513 | 3300047444 | Bacteria | 3184 |
| 755 | Ga0495677_0069875 | 3300047445 | Bacteria | 1308 |
| 756 | Ga0495679_008677 | 3300047446 | Bacteria | 4115 |
| 757 | Ga0495684_0000010 | 3300047471 | Bacteria | 198915 |
| 758 | Ga0495684_0024373 | 3300047471 | Bacteria | 4658 |
| 759 | Ga0495684_0042639 | 3300047471 | Bacteria | 3475 |
| 760 | Ga0495684_0046067 | 3300047471 | Bacteria | 3336 |
| 761 | Ga0495684_0098856 | 3300047471 | Bacteria | 2206 |
| 762 | Ga0495684_0169378 | 3300047471 | Bacteria | 1625 |
| 763 | Ga0495684_0213523 | 3300047471 | Bacteria | 1417 |
| 764 | Ga0495684_0590862 | 3300047471 | Unclassified | 750 |
| 765 | Ga0495684_0666743 | 3300047471 | Unclassified | 694 |
| 766 | Ga0495593_0005079 | 3300047673 | Bacteria | 7782 |
| 767 | Ga0495593_0010567 | 3300047673 | Bacteria | 5325 |
| 768 | Ga0495593_0091277 | 3300047673 | Bacteria | 1568 |
| 769 | Ga0495593_0169305 | 3300047673 | Unclassified | 1101 |
| 770 | Ga0495593_0233485 | 3300047673 | Unclassified | 922 |
| 771 | Ga0495593_0326109 | 3300047673 | Unclassified | 767 |
| 772 | Ga0495602_0000016 | 3300048088 | Bacteria | 190311 |
| 773 | Ga0495602_0052962 | 3300048088 | Bacteria | 3598 |
| 774 | Ga0495602_0063590 | 3300048088 | Bacteria | 3196 |
| 775 | Ga0495602_0221465 | 3300048088 | Bacteria | 1428 |
| 776 | Ga0495602_0234184 | 3300048088 | Bacteria | 1377 |
| 777 | Ga0495614_0040128 | 3300048089 | Bacteria | 2009 |
| 778 | Ga0495614_0046055 | 3300048089 | Bacteria | 1870 |
| 779 | Ga0495614_0375567 | 3300048089 | Unclassified | 665 |
| 780 | Ga0496100_0402642 | 3300048903 | Unclassified | 1042 |
| 781 | Ga0496101_0051375 | 3300048904 | Bacteria | 2970 |
| 782 | Ga0496101_0166110 | 3300048904 | Bacteria | 1694 |
| 783 | Ga0496101_0293972 | 3300048904 | Unclassified | 1271 |
| 784 | Ga0496101_0462931 | 3300048904 | Unclassified | 1001 |
| 785 | Ga0496102_0017814 | 3300048905 | Bacteria | 6227 |
| 786 | Ga0496102_0060926 | 3300048905 | Bacteria | 3452 |
| 787 | Ga0496102_0267842 | 3300048905 | Unclassified | 1610 |
| 788 | Ga0496103_0055638 | 3300048906 | Bacteria | 2454 |
| 789 | Ga0496103_0151110 | 3300048906 | Bacteria | 1487 |
| 790 | Ga0496104_0032534 | 3300048907 | Bacteria | 4854 |
| 791 | Ga0496104_0058138 | 3300048907 | Bacteria | 3660 |
| 792 | Ga0496104_0085556 | 3300048907 | Bacteria | 3009 |
| 793 | Ga0496104_0462910 | 3300048907 | Bacteria | 1179 |
| 794 | Ga0496104_1175305 | 3300048907 | Bacteria | 670 |
| 795 | Ga0496105_0068036 | 3300048908 | Bacteria | 2941 |
| 796 | Ga0496105_0366952 | 3300048908 | Unclassified | 1147 |
| 797 | Ga0496105_0386842 | 3300048908 | Bacteria | 1112 |
| 798 | Ga0496105_0482193 | 3300048908 | Unclassified | 975 |
| 799 | Ga0496105_0482659 | 3300048908 | Bacteria | 975 |
| 800 | Ga0496105_0499295 | 3300048908 | Bacteria | 955 |
| 801 | Ga0496106_0028455 | 3300048909 | Bacteria | 4163 |
| 802 | Ga0496106_0029719 | 3300048909 | Bacteria | 4074 |
| 803 | Ga0496106_0233882 | 3300048909 | Bacteria | 1467 |
| 804 | Ga0496106_0329034 | 3300048909 | Bacteria | 1227 |
| 805 | Ga0496106_0670663 | 3300048909 | Bacteria | 828 |
| 806 | Ga0496106_0707666 | 3300048909 | Bacteria | 802 |
| 807 | Ga0496107_0025221 | 3300048910 | Bacteria | 4207 |
| 808 | Ga0496107_0097133 | 3300048910 | Bacteria | 2156 |
| 809 | Ga0496107_0422806 | 3300048910 | Unclassified | 990 |
| 810 | Ga0496108_0087058 | 3300048911 | Unclassified | 2653 |
| 811 | Ga0496108_0210262 | 3300048911 | Bacteria | 1689 |
| 812 | Ga0496108_0342899 | 3300048911 | Bacteria | 1303 |
| 813 | Ga0496108_0412543 | 3300048911 | Bacteria | 1179 |
| 814 | Ga0496108_1201883 | 3300048911 | Unclassified | 641 |
| 815 | Ga0496109_0095873 | 3300048912 | Bacteria | 2747 |
| 816 | Ga0496109_0955306 | 3300048912 | Bacteria | 795 |
| 817 | Ga0496110_0004047 | 3300048913 | Bacteria | 11313 |
| 818 | Ga0496111_0396811 | 3300048914 | Unclassified | 1019 |
| 819 | Ga0496111_0700748 | 3300048914 | Bacteria | 736 |
| 820 | Ga0496112_0011548 | 3300048915 | Bacteria | 8072 |
| 821 | Ga0496112_0216209 | 3300048915 | Bacteria | 1873 |
| 822 | Ga0496112_0422766 | 3300048915 | Bacteria | 1271 |
| 823 | Ga0496112_0919140 | 3300048915 | Bacteria | 796 |
| 824 | Ga0496112_0927654 | 3300048915 | Bacteria | 792 |
| 825 | Ga0496113_0300341 | 3300048916 | Bacteria | 1285 |
| 826 | Ga0496113_0378927 | 3300048916 | Bacteria | 1135 |
| 827 | Ga0496114_0023602 | 3300048917 | Bacteria | 5020 |
| 828 | Ga0496114_0067970 | 3300048917 | Bacteria | 2991 |
| 829 | Ga0496114_0150087 | 3300048917 | Unclassified | 2022 |
| 830 | Ga0496114_0847416 | 3300048917 | Unclassified | 794 |
| 831 | Ga0496115_0016906 | 3300048918 | Bacteria | 5564 |
| 832 | Ga0496115_0046719 | 3300048918 | Unclassified | 3461 |
| 833 | Ga0496115_0061104 | 3300048918 | Bacteria | 3037 |
| 834 | Ga0496115_0112722 | 3300048918 | Bacteria | 2234 |
| 835 | Ga0496115_0153388 | 3300048918 | Bacteria | 1902 |
| 836 | Ga0496115_0159672 | 3300048918 | Bacteria | 1863 |
| 837 | Ga0496115_0314246 | 3300048918 | Bacteria | 1282 |
| 838 | Ga0496115_0315733 | 3300048918 | Bacteria | 1279 |
| 839 | Ga0496115_0630997 | 3300048918 | Unclassified | 849 |
| 840 | Ga0496121_0075376 | 3300048924 | Bacteria | 2695 |
| 841 | Ga0496126_0014855 | 3300048929 | Bacteria | 7855 |
| 842 | Ga0501031_0212649 | 3300049568 | Bacteria | 1260 |
| 843 | Ga0501034_0149951 | 3300049571 | Bacteria | 2308 |
| 844 | Ga0501036_0261042 | 3300049572 | Bacteria | 1451 |
| 845 | Ga0501037_0049808 | 3300049573 | Bacteria | 3067 |
| 846 | Ga0501038_0381870 | 3300049574 | Bacteria | 1093 |
| 847 | Ga0501039_0190946 | 3300049575 | Bacteria | 1611 |
| 848 | Ga0501047_0009323 | 3300049581 | Bacteria | 9268 |
| 849 | Ga0501067_0369806 | 3300049583 | Bacteria | 799 |
| 850 | Ga0501072_0250748 | 3300049588 | Unclassified | 1410 |
| 851 | Ga0501073_0067398 | 3300049589 | Bacteria | 2495 |
| 852 | Ga0501076_0226428 | 3300049592 | Bacteria | 1528 |
| 853 | Ga0501079_0536115 | 3300049741 | Bacteria | 920 |
| 854 | Ga0501080_0928928 | 3300049742 | Bacteria | 757 |
| 855 | Ga0501081_0368541 | 3300049743 | Bacteria | 1060 |
| 856 | Ga0501083_0019534 | 3300049744 | Bacteria | 4719 |
| 857 | nmdc:mga05p37_187611_c1 | 3300050507 | Bacteria | 2513 |
| 858 | nmdc:mga06r32_729418_c1 | 3300050510 | Bacteria | 955 |
| 859 | nmdc:mga08y16_290913_c2 | 3300050511 | Bacteria | 1086 |
| 860 | nmdc:mga08y16_950282_c1 | 3300050511 | Bacteria | 843 |
| 861 | nmdc:mga0n895_349846_c1 | 3300050512 | Bacteria | 1497 |
| 862 | nmdc:mga0n895_80324_c1 | 3300050512 | Bacteria | 3249 |
| 863 | nmdc:mga0n895_80582_c1 | 3300050512 | Bacteria | 3244 |
| 864 | nmdc:mga0rr50_96276_c1 | 3300050513 | Bacteria | 2316 |
| 865 | nmdc:mga08x19_173062_c1 | 3300050514 | Bacteria | 1471 |
| 866 | nmdc:mga08x19_3057_c1 | 3300050514 | Bacteria | 10057 |
| 867 | nmdc:mga08x19_40707_c1 | 3300050514 | Bacteria | 2958 |
| 868 | nmdc:mga08x19_96342_c1 | 3300050514 | Bacteria | 1958 |
| 869 | nmdc:mga0a205_63042_c1 | 3300050515 | Bacteria | 3581 |
| 870 | Ga0495601_0000021 | 3300053077 | Bacteria | 159355 |
| 871 | Ga0495601_0002704 | 3300053077 | Bacteria | 10064 |
| 872 | Ga0495601_0011416 | 3300053077 | Bacteria | 5311 |
| 873 | Ga0495601_0023845 | 3300053077 | Bacteria | 3762 |
| 874 | Ga0495601_0152123 | 3300053077 | Bacteria | 1510 |
| 875 | Ga0495601_0728948 | 3300053077 | Unclassified | 631 |
| 876 | Ga0495612_0000018 | 3300053078 | Bacteria | 150870 |
| 877 | Ga0495612_0004668 | 3300053078 | Bacteria | 5673 |
| 878 | Ga0495612_0210851 | 3300053078 | Unclassified | 858 |
| 879 | Ga0495595_0000028 | 3300053084 | Bacteria | 97682 |
| 880 | Ga0495595_0004425 | 3300053084 | Bacteria | 5653 |
| 881 | Ga0495595_0006408 | 3300053084 | Bacteria | 4799 |
| 882 | Ga0495595_0009091 | 3300053084 | Bacteria | 4103 |
| 883 | Ga0495595_0020294 | 3300053084 | Unclassified | 2891 |
| 884 | Ga0495595_0157770 | 3300053084 | Bacteria | 1118 |
| 885 | Ga0495595_0372809 | 3300053084 | Unclassified | 722 |
| 886 | Ga0495619_0000006 | 3300053085 | Bacteria | 384835 |
| 887 | Ga0495619_0006915 | 3300053085 | Bacteria | 7172 |
| 888 | Ga0495619_0008110 | 3300053085 | Bacteria | 6648 |
| 889 | Ga0495619_0013223 | 3300053085 | Bacteria | 5201 |
| 890 | Ga0495619_0013842 | 3300053085 | Bacteria | 5090 |
| 891 | Ga0495619_0051852 | 3300053085 | Bacteria | 2712 |
| 892 | Ga0495619_0109888 | 3300053085 | Bacteria | 1883 |
| 893 | Ga0495619_0227364 | 3300053085 | Unclassified | 1292 |
| 894 | Ga0500651_0004280 | 3300053093 | Bacteria | 7975 |
| 895 | Ga0500651_0105713 | 3300053093 | Bacteria | 1722 |
| 896 | Ga0500651_0537302 | 3300053093 | Bacteria | 641 |
| 897 | Ga0500566_0012615 | 3300053094 | Bacteria | 4972 |
| 898 | Ga0500566_0172487 | 3300053094 | Unclassified | 1117 |
| 899 | Ga0500595_000104 | 3300053119 | Bacteria | 57706 |
| 900 | Ga0500595_008847 | 3300053119 | Bacteria | 4092 |
| 901 | Ga0500655_010212 | 3300053133 | Bacteria | 1694 |
| 902 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 903 | Ga0500657_071628 | 3300053728 | Unclassified | 1517 |
| 904 | Ga0500645_000101 | 3300053730 | Bacteria | 68128 |
| 905 | Ga0501084_0203055 | 3300054114 | Bacteria | 1673 |
| 906 | Ga0501084_1310388 | 3300054114 | Bacteria | 607 |
| 907 | Ga0501082_0013251 | 3300060353 | Bacteria | 7091 |
| 908 | Ga0501082_0662444 | 3300060353 | Bacteria | 914 |
| 909 | Ga0530510_0353341 | 3300061734 | Bacteria | 1104 |
| 910 | 2524538395 | 2524023228 | Bacteria | 10118060 |
| 911 | 2728750124 | 2728368998 | Bacteria | 8720350 |
| 912 | 2793066794 | 2791355197 | Bacteria | 8420563 |
| 913 | 2904704909 | |||
| 914 | 2941510724 | 2941507105 | Bacteria | 8166816 |
| 915 | 2941518108 | 2941515067 | Bacteria | 8166720 |
| 916 | 2941527021 | 2941523033 | Bacteria | 8169134 |
| 917 | 3005481168 | 3005474847 | Bacteria | 9259049 |
| 918 | 8006939539 | 8006933436 | Bacteria | 10410654 |
| 919 | 8006979289 | 8006973647 | Bacteria | 10679141 |
| 920 | Ga0373937_0609357 | |||
| 921 | Ga0070658_10048034 | |||
| 922 | Ga0070676_10117053 | |||
| 923 | Ga0070676_10179810 | |||
| 924 | Ga0070683_100198154 | |||
| 925 | Ga0070690_100378852 | |||
| 926 | Ga0070690_100393322 | |||
| 927 | Ga0070670_100894694 | |||
| 928 | Ga0070677_10300184 | |||
| 929 | Ga0068869_100083761 | |||
| 930 | Ga0068869_100249497 | |||
| 931 | Ga0070666_10041661 | |||
| 932 | Ga0070680_100033411 | |||
| 933 | Ga0070680_100558136 | |||
| 934 | Ga0070682_100066357 | |||
| 935 | Ga0070682_100132202 | |||
| 936 | Ga0070682_100190177 | |||
| 937 | Ga0070682_100515271 | |||
| 938 | Ga0068868_100098480 | |||
| 939 | Ga0068868_100201844 | |||
| 940 | Ga0070660_100019325 | |||
| 941 | Ga0070660_100096656 | |||
| 942 | Ga0070660_100932346 | |||
| 943 | Ga0070689_100055250 | |||
| 944 | Ga0070691_10062891 | |||
| 945 | Ga0070661_100075305 | |||
| 946 | Ga0070661_100117777 | |||
| 947 | Ga0070661_100126065 | |||
| 948 | Ga0070692_10265105 | |||
| 949 | Ga0070668_100004789 | |||
| 950 | Ga0070668_100711592 | |||
| 951 | Ga0070669_100651214 | |||
| 952 | Ga0070675_100060415 | |||
| 953 | Ga0070671_100044203 | |||
| 954 | Ga0070671_100568140 | |||
| 955 | Ga0070674_100001469 | |||
| 956 | Ga0070674_100061198 | |||
| 957 | Ga0070673_100177726 | |||
| 958 | Ga0070673_100413067 | |||
| 959 | Ga0070688_100079220 | |||
| 960 | Ga0070667_100060576 | |||
| 961 | Ga0070667_100086820 | |||
| 962 | Ga0070667_100203646 | |||
| 963 | Ga0070709_10073656 | |||
| 964 | Ga0070709_10277554 | |||
| 965 | Ga0070709_10491294 | |||
| 966 | Ga0070714_100031308 | |||
| 967 | Ga0070714_100173722 | |||
| 968 | Ga0070714_101220586 | |||
| 969 | Ga0070714_101303072 | |||
| 970 | Ga0070713_100001163 | |||
| 971 | Ga0070713_100058408 | |||
| 972 | Ga0070713_100162314 | |||
| 973 | Ga0070713_100245842 | |||
| 974 | Ga0070713_100255425 | |||
| 975 | Ga0070713_100364712 | |||
| 976 | Ga0070713_100607330 | |||
| 977 | Ga0070710_10031153 | |||
| 978 | Ga0070710_10042817 | |||
| 979 | Ga0070710_10053031 | |||
| 980 | Ga0070710_10116974 | |||
| 981 | Ga0070710_10164412 | |||
| 982 | Ga0070711_100113018 | |||
| 983 | Ga0070711_100334974 | |||
| 984 | Ga0070711_100733802 | |||
| 985 | Ga0070711_100895086 | |||
| 986 | Ga0070705_100204781 | |||
| 987 | Ga0070705_100264637 | |||
| 988 | Ga0070700_100230156 | |||
| 989 | Ga0070694_100017310 | |||
| 990 | Ga0070663_100113478 | |||
| 991 | Ga0070663_100210240 | |||
| 992 | Ga0070663_100216087 | |||
| 993 | Ga0070678_100046002 | |||
| 994 | Ga0070678_100126009 | |||
| 995 | Ga0070678_100150882 | |||
| 996 | Ga0070662_100074327 | |||
| 997 | Ga0070662_100823778 | |||
| 998 | Ga0070681_10031409 | |||
| 999 | Ga0070681_10120917 | |||
| 1000 | Ga0070681_10145225 | |||
| 1001 | Ga0070685_10226445 | |||
| 1002 | Ga0070707_100794723 | |||
| 1003 | Ga0070707_101048548 | |||
| 1004 | Ga0070699_100216448 | |||
| 1005 | Ga0070699_100820360 | |||
| 1006 | Ga0070679_100107374 | |||
| 1007 | Ga0070679_100331769 | |||
| 1008 | Ga0070684_100266575 | |||
| 1009 | Ga0070684_100300682 | |||
| 1010 | Ga0070697_100641308 | |||
| 1011 | Ga0070697_100976419 | |||
| 1012 | Ga0068853_100007119 | |||
| 1013 | Ga0070672_100357426 | |||
| 1014 | Ga0070686_100007712 | |||
| 1015 | Ga0070686_100099825 | |||
| 1016 | Ga0070695_100062288 | |||
| 1017 | Ga0070695_100220588 | |||
| 1018 | Ga0070695_100743715 | |||
| 1019 | Ga0070696_100071244 | |||
| 1020 | Ga0070696_100470951 | |||
| 1021 | Ga0070696_100525227 | |||
| 1022 | Ga0070693_100077404 | |||
| 1023 | Ga0070693_100094520 | |||
| 1024 | Ga0070693_100420457 | |||
| 1025 | Ga0070693_100800450 | |||
| 1026 | Ga0070665_100325788 | |||
| 1027 | Ga0068855_100011509 | |||
| 1028 | Ga0068855_100053031 | |||
| 1029 | Ga0068855_100963088 | |||
| 1030 | Ga0068855_101095254 | |||
| 1031 | Ga0068855_101385984 | |||
| 1032 | Ga0070664_100193360 | |||
| 1033 | Ga0068857_100014636 | |||
| 1034 | Ga0068854_100524784 | |||
| 1035 | Ga0068856_100171378 | |||
| 1036 | Ga0068856_100280562 | |||
| 1037 | Ga0068856_100285668 | |||
| 1038 | Ga0068852_100099048 | |||
| 1039 | Ga0068859_100075400 | |||
| 1040 | Ga0068859_100968031 | |||
| 1041 | Ga0068864_101557316 | |||
| 1042 | Ga0068866_10147459 | |||
| 1043 | Ga0068866_10307157 | |||
| 1044 | Ga0068861_100030177 | |||
| 1045 | Ga0068851_10123518 | |||
| 1046 | Ga0068870_10435416 | |||
| 1047 | Ga0068863_100264537 | |||
| 1048 | Ga0068858_100511684 | |||
| 1049 | Ga0068860_100344094 | |||
| 1050 | Ga0068862_100156322 | |||
| 1051 | Ga0068862_101964968 | |||
| 1052 | Ga0081455_10121167 | |||
| 1053 | Ga0070717_10042482 | |||
| 1054 | Ga0070717_10107084 | |||
| 1055 | Ga0070717_10531750 | |||
| 1056 | Ga0070717_10721379 | |||
| 1057 | Ga0070716_100007618 | |||
| 1058 | Ga0070712_100089846 | |||
| 1059 | Ga0070712_100224243 | |||
| 1060 | Ga0097621_100056414 | |||
| 1061 | Ga0097621_100149322 | |||
| 1062 | Ga0097621_101127843 | |||
| 1063 | Ga0068871_100082713 | |||
| 1064 | Ga0068871_100285126 | |||
| 1065 | Ga0075431_100498611 | |||
| 1066 | Ga0075433_10022802 | |||
| 1067 | Ga0075433_10171471 | |||
| 1068 | Ga0075434_100026486 | |||
| 1069 | Ga0075434_100035076 | |||
| 1070 | Ga0075434_100296107 | |||
| 1071 | Ga0075429_100955911 | |||
| 1072 | Ga0068865_100032983 | |||
| 1073 | Ga0068865_100078047 | |||
| 1074 | Ga0075436_100003492 | |||
| 1075 | Ga0075436_100046815 | |||
| 1076 | Ga0075436_100242631 | |||
| 1077 | Ga0075436_100292700 | |||
| 1078 | Ga0075436_100538408 | |||
| 1079 | Ga0097620_100075409 | |||
| 1080 | Ga0097620_100968059 | |||
| 1081 | Ga0075435_100080890 | |||
| 1082 | Ga0105240_10000945 | |||
| 1083 | Ga0105240_10015366 | |||
| 1084 | Ga0105240_11304750 | |||
| 1085 | Ga0111539_10368569 | |||
| 1086 | Ga0111539_11500142 | |||
| 1087 | Ga0105245_10109610 | |||
| 1088 | Ga0105245_10641114 | |||
| 1089 | Ga0105247_10305321 | |||
| 1090 | Ga0105247_10503765 | |||
| 1091 | Ga0114129_10727753 | |||
| 1092 | Ga0114129_10737017 | |||
| 1093 | Ga0105243_10018265 | |||
| 1094 | Ga0105243_10096863 | |||
| 1095 | Ga0105243_10160005 | |||
| 1096 | Ga0105243_10635693 | |||
| 1097 | Ga0105241_10064194 | |||
| 1098 | Ga0105241_10094845 | |||
| 1099 | Ga0105242_10037799 | |||
| 1100 | Ga0105242_10176663 | |||
| 1101 | Ga0105242_10290613 | |||
| 1102 | Ga0105248_10125176 | |||
| 1103 | Ga0105248_10225736 | |||
| 1104 | Ga0105237_10034579 | |||
| 1105 | Ga0105237_10336568 | |||
| 1106 | Ga0105237_10504820 | |||
| 1107 | Ga0105237_11152209 | |||
| 1108 | Ga0105238_10029000 | |||
| 1109 | Ga0105238_10029780 | |||
| 1110 | Ga0105238_10118666 | |||
| 1111 | Ga0105238_10118897 | |||
| 1112 | Ga0105249_10091147 | |||
| 1113 | Ga0105249_10137670 | |||
| 1114 | Ga0105249_10938570 | |||
| 1115 | Ga0105249_10997826 | |||
| 1116 | Ga0105239_10064158 | |||
| 1117 | Ga0105239_10157693 | |||
| 1118 | Ga0105239_10264428 | |||
| 1119 | Ga0105246_10079217 | |||
| 1120 | Ga0105246_10414250 | |||
| 1121 | Ga0157340_1012301 | |||
| 1122 | Ga0157313_1019493 | |||
| 1123 | Ga0157315_1006199 | |||
| 1124 | Ga0157338_1016045 | |||
| 1125 | Ga0157373_10121492 | |||
| 1126 | Ga0157370_10042063 | |||
| 1127 | Ga0157369_10046386 | |||
| 1128 | Ga0157374_10368371 | |||
| 1129 | Ga0157374_10411689 | |||
| 1130 | Ga0157378_10110569 | |||
| 1131 | Ga0157378_10121895 | |||
| 1132 | Ga0157378_10159186 | |||
| 1133 | Ga0163162_10346200 | |||
| 1134 | Ga0163162_10405232 | |||
| 1135 | Ga0157372_10162033 | |||
| 1136 | Ga0157372_10261048 | |||
| 1137 | Ga0157372_10931804 | |||
| 1138 | Ga0157372_11942273 | |||
| 1139 | Ga0157375_10301760 | |||
| 1140 | Ga0157375_10304136 | |||
| 1141 | Ga0157375_10725757 | |||
| 1142 | Ga0157375_11155249 | |||
| 1143 | Ga0163163_10863862 | |||
| 1144 | Ga0163163_12213640 | |||
| 1145 | Ga0157380_10946601 | |||
| 1146 | Ga0157377_10019144 | |||
| 1147 | Ga0157379_10101729 | |||
| 1148 | Ga0157379_10194829 | |||
| 1149 | Ga0157376_10109934 | |||
| 1150 | Ga0157376_10243738 | |||
| 1151 | Ga0157376_10778846 | |||
| 1152 | Ga0182007_10067207 | |||
| 1153 | Ga0163161_10029152 | |||
| 1154 | Ga0184601_125268 | |||
| 1155 | Ga0213876_10015945 | |||
| 1156 | Ga0213871_10037160 | |||
| 1157 | Ga0207656_10118051 | |||
| 1158 | Ga0207692_10099211 | |||
| 1159 | Ga0207692_10137347 | |||
| 1160 | Ga0207692_10278460 | |||
| 1161 | Ga0207642_10068578 | |||
| 1162 | Ga0207710_10082468 | |||
| 1163 | Ga0207710_10218930 | |||
| 1164 | Ga0207710_10465822 | |||
| 1165 | Ga0207688_10032344 | |||
| 1166 | Ga0207680_10047516 | |||
| 1167 | Ga0207699_10100036 | |||
| 1168 | Ga0207699_10185129 | |||
| 1169 | Ga0207699_10229418 | |||
| 1170 | Ga0207699_10938537 | |||
| 1171 | Ga0207699_11048787 | |||
| 1172 | Ga0207645_10025770 | |||
| 1173 | Ga0207645_10178766 | |||
| 1174 | Ga0207705_10229178 | |||
| 1175 | Ga0207707_10007863 | |||
| 1176 | Ga0207707_10014737 | |||
| 1177 | Ga0207707_10061700 | |||
| 1178 | Ga0207695_10060181 | |||
| 1179 | Ga0207695_10095212 | |||
| 1180 | Ga0207671_10453283 | |||
| 1181 | Ga0207693_10024907 | |||
| 1182 | Ga0207693_10028957 | |||
| 1183 | Ga0207693_10046591 | |||
| 1184 | Ga0207693_10078423 | |||
| 1185 | Ga0207693_10436981 | |||
| 1186 | Ga0207693_10862253 | |||
| 1187 | Ga0207663_10128429 | |||
| 1188 | Ga0207663_10156076 | |||
| 1189 | Ga0207663_10294901 | |||
| 1190 | Ga0207663_10749574 | |||
| 1191 | Ga0207660_10034342 | |||
| 1192 | Ga0207660_10935045 | |||
| 1193 | Ga0207662_10073416 | |||
| 1194 | Ga0207662_10182440 | |||
| 1195 | Ga0207662_10317767 | |||
| 1196 | Ga0207657_10047987 | |||
| 1197 | Ga0207657_10096761 | |||
| 1198 | Ga0207657_10122749 | |||
| 1199 | Ga0207649_10056429 | |||
| 1200 | Ga0207649_10119664 | |||
| 1201 | Ga0207649_10322607 | |||
| 1202 | Ga0207652_10035613 | |||
| 1203 | Ga0207652_10036910 | |||
| 1204 | Ga0207652_10054988 | |||
| 1205 | Ga0207652_10748891 | |||
| 1206 | Ga0207646_10128337 | |||
| 1207 | Ga0207646_10975382 | |||
| 1208 | Ga0207681_10120958 | |||
| 1209 | Ga0207681_10390779 | |||
| 1210 | Ga0207694_10018798 | |||
| 1211 | Ga0207687_10291798 | |||
| 1212 | Ga0207687_10408122 | |||
| 1213 | Ga0207687_10417652 | |||
| 1214 | Ga0207700_10030110 | |||
| 1215 | Ga0207700_10144162 | |||
| 1216 | Ga0207700_11347643 | |||
| 1217 | Ga0207664_10012070 | |||
| 1218 | Ga0207664_10857897 | |||
| 1219 | Ga0207644_10016185 | |||
| 1220 | Ga0207644_10243177 | |||
| 1221 | Ga0207644_10590602 | |||
| 1222 | Ga0207690_10461659 | |||
| 1223 | Ga0207706_10025659 | |||
| 1224 | Ga0207706_10056068 | |||
| 1225 | Ga0207706_10121631 | |||
| 1226 | Ga0207706_10629472 | |||
| 1227 | Ga0207686_10030666 | |||
| 1228 | Ga0207686_10065757 | |||
| 1229 | Ga0207709_10061374 | |||
| 1230 | Ga0207709_10086950 | |||
| 1231 | Ga0207669_10091045 | |||
| 1232 | Ga0207704_10054467 | |||
| 1233 | Ga0207665_10015450 | |||
| 1234 | Ga0207665_11036925 | |||
| 1235 | Ga0207711_10323691 | |||
| 1236 | Ga0207689_10099207 | |||
| 1237 | Ga0207661_10187062 | |||
| 1238 | Ga0207661_10188993 | |||
| 1239 | Ga0207667_10046812 | |||
| 1240 | Ga0207667_10052707 | |||
| 1241 | Ga0207651_10466123 | |||
| 1242 | Ga0207651_10551359 | |||
| 1243 | Ga0207651_11667585 | |||
| 1244 | Ga0207712_10073704 | |||
| 1245 | Ga0207712_10768277 | |||
| 1246 | Ga0207668_10001797 | |||
| 1247 | Ga0207668_10034739 | |||
| 1248 | Ga0207668_10706778 | |||
| 1249 | Ga0207668_11155739 | |||
| 1250 | Ga0207668_11309442 | |||
| 1251 | Ga0207640_10720306 | |||
| 1252 | Ga0207658_10046265 | |||
| 1253 | Ga0207658_10299683 | |||
| 1254 | Ga0207658_10304865 | |||
| 1255 | Ga0207677_10694486 | |||
| 1256 | Ga0207703_10109011 | |||
| 1257 | Ga0207703_10136860 | |||
| 1258 | Ga0207703_10560243 | |||
| 1259 | Ga0207703_10648231 | |||
| 1260 | Ga0207639_10092092 | |||
| 1261 | Ga0207678_10062758 | |||
| 1262 | Ga0207678_10069402 | |||
| 1263 | Ga0207678_10238827 | |||
| 1264 | Ga0207678_10260779 | |||
| 1265 | Ga0207678_10851340 | |||
| 1266 | Ga0207708_10074555 | |||
| 1267 | Ga0207708_10273035 | |||
| 1268 | Ga0207702_10287163 | |||
| 1269 | Ga0207648_10091109 | |||
| 1270 | Ga0207648_11607506 | |||
| 1271 | Ga0207676_11051647 | |||
| 1272 | Ga0207674_10033519 | |||
| 1273 | Ga0207675_100004169 | |||
| 1274 | Ga0207675_100190743 | |||
| 1275 | Ga0207683_10003484 | |||
| 1276 | Ga0207683_10015950 | |||
| 1277 | Ga0207683_10079244 | |||
| 1278 | Ga0207698_10796413 | |||
| 1279 | Ga0207428_10143579 | |||
| 1280 | Ga0207428_10771940 | |||
| 1281 | Ga0268266_10108008 | |||
| 1282 | Ga0268266_10621999 | |||
| 1283 | Ga0268266_10657809 | |||
| 1284 | Ga0265334_10014941 | |||
| 1285 | Ga0265338_10276241 | |||
| 1286 | Ga0265338_10367040 | |||
| 1287 | Ga0265324_10191992 | |||
| 1288 | Ga0265330_10076631 | |||
| 1289 | Ga0265325_10000048 | |||
| 1290 | Ga0265325_10214295 | |||
| 1291 | Ga0265340_10084392 | |||
| 1292 | Ga0265340_10237785 | |||
| 1293 | Ga0265340_10255186 | |||
| 1294 | Ga0265331_10311169 | |||
| 1295 | Ga0265316_10073214 | |||
| 1296 | Ga0265316_10632276 | |||
| 1297 | Ga0265314_10009879 | |||
| 1298 | Ga0373930_0016882 | |||
| 1299 | Ga0373948_0019547 | |||
| 1300 | Ga0373958_0019107 | |||
| 1301 | Ga0373959_0119451 | |||
| 1302 | Ga0373926_0001058 | |||
| 1303 | Ga0373926_0001601 | |||
| 1304 | Ga0373926_0021511 | |||
| 1305 | Ga0373929_0080683 | |||
| 1306 | Ga0373934_0061060 | |||
| 1307 | Ga0373940_0175534 | |||
| 1308 | Ga0373944_0010442 | |||
| 1309 | Ga0373944_0026854 | |||
| 1310 | Ga0373951_0012289 | |||
| 1311 | Ga0373951_0047258 | |||
| 1312 | Ga0373952_0007777 | |||
| 1313 | Ga0373923_0015615 | |||
| 1314 | Ga0373923_0076512 | |||
| 1315 | Ga0373936_0012788 | |||
| 1316 | Ga0373936_0015863 | |||
| 1317 | Ga0373936_0017322 | |||
| 1318 | Ga0373936_0097807 | |||
| 1319 | Ga0373936_0133452 | |||
| 1320 | Ga0373939_0010020 | |||
| 1321 | Ga0373941_0129557 | |||
| 1322 | Ga0373945_0006535 | |||
| 1323 | Ga0373945_0024643 | |||
| 1324 | Ga0373945_0027116 | |||
| 1325 | Ga0373945_0177440 | |||
| 1326 | Ga0373945_0190615 | |||
| 1327 | Ga0373953_0025411 | |||
| 1328 | Ga0373953_0026092 | |||
| 1329 | Ga0373953_0170322 | |||
| 1330 | Ga0373953_0185976 | |||
| 1331 | Ga0373954_0007748 | |||
| 1332 | Ga0373954_0015424 | |||
| 1333 | Ga0373954_0027582 | |||
| 1334 | Ga0373954_0043351 | |||
| 1335 | Ga0373954_0047599 | |||
| 1336 | Ga0373954_0110462 | |||
| 1337 | Ga0373956_0037962 | |||
| 1338 | Ga0373956_0054134 | |||
| 1339 | Ga0373956_0145045 | |||
| 1340 | Ga0373957_0014032 | |||
| 1341 | Ga0373957_0042803 | |||
| 1342 | Ga0373957_0091495 | |||
| 1343 | Ga0373957_0148968 | |||
| 1344 | Ga0373960_0095442 | |||
| 1345 | Ga0373943_0015289 | |||
| 1346 | Ga0373943_0075650 | |||
| 1347 | Ga0373943_0183747 | |||
| 1348 | Ga0373943_0189945 | |||
| 1349 | Ga0373946_0029747 | |||
| 1350 | Ga0373946_0115220 | |||
| 1351 | Ga0373955_0000294 | |||
| 1352 | Ga0373955_0002670 | |||
| 1353 | Ga0373955_0007232 | |||
| 1354 | Ga0373955_0053493 | |||
| 1355 | Ga0373955_0108656 | |||
| 1356 | Ga0373942_0019741 | |||
| 1357 | Ga0373942_0033815 | |||
| 1358 | Ga0373961_0300322 | |||
| 1359 | Ga0373962_0023574 | |||
| 1360 | Ga0373924_0001452 | |||
| 1361 | Ga0373924_0024494 | |||
| 1362 | Ga0373924_0053134 | |||
| 1363 | Ga0373924_0084491 | |||
| 1364 | Ga0373924_0114869 | |||
| 1365 | Ga0373924_0311171 | |||
| 1366 | Ga0373931_0006069 | |||
| 1367 | Ga0373931_0178515 | |||
| 1368 | Ga0373931_0184159 | |||
| 1369 | Ga0373935_0007394 | |||
| 1370 | Ga0373935_0024182 | |||
| 1371 | Ga0373935_0027203 | |||
| 1372 | Ga0373935_0038005 | |||
| 1373 | Ga0373935_0194372 | |||
| 1374 | Ga0373935_0606933 | |||
| 1375 | Ga0373927_0109948 | |||
| 1376 | Ga0373927_0212865 | |||
| 1377 | Ga0373927_0298459 | |||
| 1378 | Ga0373927_0383759 | |||
| 1379 | Ga0373933_0004809 | |||
| 1380 | Ga0373933_0010078 | |||
| 1381 | Ga0373933_0121529 | |||
| 1382 | Ga0373933_0148466 | |||
| 1383 | Ga0373933_0153659 | |||
| 1384 | Ga0373933_0214900 | |||
| 1385 | Ga0373947_0000391 | |||
| 1386 | Ga0373947_0006399 | |||
| 1387 | Ga0373947_0034398 | |||
| 1388 | Ga0373947_0155066 | |||
| 1389 | Ga0373947_0359717 | |||
| 1390 | Ga0373947_0388168 | |||
| 1391 | Ga0373947_0413898 | |||
| 1392 | Ga0373947_0466227 | |||
| 1393 | Ga0373947_0507585 | |||
| 1394 | Ga0373937_0000081 | |||
| 1395 | Ga0373937_0001398 | |||
| 1396 | Ga0373937_0149359 | |||
| 1397 | Ga0373937_0234445 | |||
| 1398 | Ga0373937_0253492 | |||
| 1399 | Ga0373937_0352978 | |||
| 1400 | Ga0373937_0361561 | |||
| 1401 | Ga0373937_0715730 | |||
| 1402 | Ga0373925_0000425 | |||
| 1403 | Ga0373925_0014118 | |||
| 1404 | Ga0373925_0678221 | |||
| 1405 | Ga0373925_0859774 | |||
| 1406 | Ga0373925_0972397 | |||
| 1407 | Ga0436365_1710235 | |||
| 1408 | Ga0436360_1328245 | |||
| 1409 | Ga0436362_0185652 | |||
| 1410 | Ga0451577_0071989 | |||
| 1411 | Ga0466963_0352214 | |||
| 1412 | Ga0466971_0038829 | |||
| 1413 | Ga0466957_0221393 | |||
| 1414 | Ga0466959_0565570 | |||
| 1415 | Ga0451576_0003473 | |||
| 1416 | Ga0451576_0377738 | |||
| 1417 | Ga0466967_0249655 | |||
| 1418 | Ga0466967_0452865 | |||
| 1419 | Ga0495617_028376 | |||
| 1420 | Ga0495592_0000177 | |||
| 1421 | Ga0495592_0007387 | |||
| 1422 | Ga0495592_0044961 | |||
| 1423 | Ga0495592_0063633 | |||
| 1424 | Ga0495592_0092689 | |||
| 1425 | Ga0495592_0160998 | |||
| 1426 | Ga0495603_0005357 | |||
| 1427 | Ga0495603_0135661 | |||
| 1428 | Ga0495591_034011 | |||
| 1429 | Ga0495629_0013975 | |||
| 1430 | Ga0495629_0014801 | |||
| 1431 | Ga0495629_0064352 | |||
| 1432 | Ga0495629_0110721 | |||
| 1433 | Ga0495629_0119398 | |||
| 1434 | Ga0495629_0172731 | |||
| 1435 | Ga0495629_0417795 | |||
| 1436 | Ga0495641_0013945 | |||
| 1437 | Ga0495641_0041779 | |||
| 1438 | Ga0495651_0000210 | |||
| 1439 | Ga0495651_0000979 | |||
| 1440 | Ga0495651_0003153 | |||
| 1441 | Ga0495651_0017937 | |||
| 1442 | Ga0495651_0044115 | |||
| 1443 | Ga0495651_0165330 | |||
| 1444 | Ga0495651_0639071 | |||
| 1445 | Ga0495653_0000054 | |||
| 1446 | Ga0495653_0000528 | |||
| 1447 | Ga0495653_0001202 | |||
| 1448 | Ga0495653_0008981 | |||
| 1449 | Ga0495653_0102463 | |||
| 1450 | Ga0495653_0241686 | |||
| 1451 | Ga0495580_0022339 | |||
| 1452 | Ga0495580_0029504 | |||
| 1453 | Ga0495582_0029526 | |||
| 1454 | Ga0495582_0050389 | |||
| 1455 | Ga0495582_0067845 | |||
| 1456 | Ga0495582_0269713 | |||
| 1457 | Ga0495582_0272447 | |||
| 1458 | Ga0495582_0373097 | |||
| 1459 | Ga0495639_0042151 | |||
| 1460 | Ga0495639_0080525 | |||
| 1461 | Ga0495639_0310326 | |||
| 1462 | Ga0495639_0364727 | |||
| 1463 | Ga0495662_0006393 | |||
| 1464 | Ga0495662_0083117 | |||
| 1465 | Ga0495662_0095906 | |||
| 1466 | Ga0495662_0206390 | |||
| 1467 | Ga0495664_0000020 | |||
| 1468 | Ga0495664_0002815 | |||
| 1469 | Ga0495664_0060964 | |||
| 1470 | Ga0495664_0124455 | |||
| 1471 | Ga0495664_0205806 | |||
| 1472 | Ga0495664_0320637 | |||
| 1473 | Ga0495664_0413970 | |||
| 1474 | Ga0495585_0000995 | |||
| 1475 | Ga0495585_0190857 | |||
| 1476 | Ga0495585_0267215 | |||
| 1477 | Ga0495594_0009061 | |||
| 1478 | Ga0495594_0009465 | |||
| 1479 | Ga0495594_0009573 | |||
| 1480 | Ga0495607_0013487 | |||
| 1481 | Ga0495607_0330219 | |||
| 1482 | Ga0495608_0000024 | |||
| 1483 | Ga0495608_0000363 | |||
| 1484 | Ga0495608_0025424 | |||
| 1485 | Ga0495608_0026296 | |||
| 1486 | Ga0495608_0037615 | |||
| 1487 | Ga0495608_0047457 | |||
| 1488 | Ga0495608_0055855 | |||
| 1489 | Ga0495616_0270259 | |||
| 1490 | Ga0495618_0000020 | |||
| 1491 | Ga0495618_0012894 | |||
| 1492 | Ga0495618_0063650 | |||
| 1493 | Ga0495618_0135188 | |||
| 1494 | Ga0495618_0380630 | |||
| 1495 | Ga0495618_0422596 | |||
| 1496 | Ga0495628_0000015 | |||
| 1497 | Ga0495628_0001606 | |||
| 1498 | Ga0495628_0022277 | |||
| 1499 | Ga0495628_0051882 | |||
| 1500 | Ga0495628_0179614 | |||
| 1501 | Ga0495628_0220556 | |||
| 1502 | Ga0495628_0414884 | |||
| 1503 | Ga0495630_0001403 | |||
| 1504 | Ga0495630_0006847 | |||
| 1505 | Ga0495630_0068880 | |||
| 1506 | Ga0495630_0078947 | |||
| 1507 | Ga0495630_0133399 | |||
| 1508 | Ga0495630_0348429 | |||
| 1509 | Ga0495630_0406623 | |||
| 1510 | Ga0495631_0184306 | |||
| 1511 | Ga0495632_0152268 | |||
| 1512 | Ga0495637_0099655 | |||
| 1513 | Ga0495637_0113641 | |||
| 1514 | Ga0495644_0002021 | |||
| 1515 | Ga0495644_0183585 | |||
| 1516 | Ga0495663_0038866 | |||
| 1517 | Ga0495666_0010026 | |||
| 1518 | Ga0495666_0019975 | |||
| 1519 | Ga0495666_0285215 | |||
| 1520 | Ga0495652_0000006 | |||
| 1521 | Ga0495652_0021629 | |||
| 1522 | Ga0495652_0028971 | |||
| 1523 | Ga0495652_0037531 | |||
| 1524 | Ga0495652_0052449 | |||
| 1525 | Ga0495652_0214032 | |||
| 1526 | Ga0495665_0013877 | |||
| 1527 | Ga0495665_0029669 | |||
| 1528 | Ga0495665_0300197 | |||
| 1529 | Ga0495665_0449839 | |||
| 1530 | Ga0495640_0000002 | |||
| 1531 | Ga0495640_0009366 | |||
| 1532 | Ga0495640_0035429 | |||
| 1533 | Ga0495640_0358325 | |||
| 1534 | Ga0495586_0012387 | |||
| 1535 | Ga0495586_0020698 | |||
| 1536 | Ga0495586_0093784 | |||
| 1537 | Ga0495586_0153680 | |||
| 1538 | Ga0495586_0314286 | |||
| 1539 | Ga0495587_0000001 | |||
| 1540 | Ga0495587_0007214 | |||
| 1541 | Ga0495587_0008295 | |||
| 1542 | Ga0495587_0015467 | |||
| 1543 | Ga0495587_0168109 | |||
| 1544 | Ga0495587_0339134 | |||
| 1545 | Ga0495598_0001368 | |||
| 1546 | Ga0495609_0023475 | |||
| 1547 | Ga0495621_0185497 | |||
| 1548 | Ga0495645_0000013 | |||
| 1549 | Ga0495645_0001389 | |||
| 1550 | Ga0495645_0002241 | |||
| 1551 | Ga0495645_0021101 | |||
| 1552 | Ga0495645_0438028 | |||
| 1553 | Ga0495622_0009159 | |||
| 1554 | Ga0495622_0032737 | |||
| 1555 | Ga0495622_0045319 | |||
| 1556 | Ga0495667_0000030 | |||
| 1557 | Ga0495667_0007285 | |||
| 1558 | Ga0495667_0008025 | |||
| 1559 | Ga0495667_0026131 | |||
| 1560 | Ga0495667_0044504 | |||
| 1561 | Ga0495667_0147425 | |||
| 1562 | Ga0495667_0211148 | |||
| 1563 | Ga0495656_0254328 | |||
| 1564 | Ga0495634_0000117 | |||
| 1565 | Ga0495634_0002830 | |||
| 1566 | Ga0495634_0078649 | |||
| 1567 | Ga0495634_0089026 | |||
| 1568 | Ga0495634_0120109 | |||
| 1569 | Ga0495634_0123845 | |||
| 1570 | Ga0495634_0211828 | |||
| 1571 | Ga0495634_0390305 | |||
| 1572 | Ga0495611_0015454 | |||
| 1573 | Ga0495635_0000001 | |||
| 1574 | Ga0495635_0000730 | |||
| 1575 | Ga0495635_0017369 | |||
| 1576 | Ga0495635_0052084 | |||
| 1577 | Ga0495635_0058753 | |||
| 1578 | Ga0495635_0082043 | |||
| 1579 | Ga0495635_0116088 | |||
| 1580 | Ga0495635_0185053 | |||
| 1581 | Ga0495635_0238677 | |||
| 1582 | Ga0495635_0408012 | |||
| 1583 | Ga0495659_0014801 | |||
| 1584 | Ga0495659_0055651 | |||
| 1585 | Ga0495661_0044492 | |||
| 1586 | Ga0495661_0183843 | |||
| 1587 | Ga0495588_0001656 | |||
| 1588 | Ga0495588_0069820 | |||
| 1589 | Ga0495657_0000028 | |||
| 1590 | Ga0495657_0004124 | |||
| 1591 | Ga0495657_0007370 | |||
| 1592 | Ga0495657_0107600 | |||
| 1593 | Ga0495657_0163773 | |||
| 1594 | Ga0495657_0187632 | |||
| 1595 | Ga0495599_0000050 | |||
| 1596 | Ga0495599_0001421 | |||
| 1597 | Ga0495599_0003607 | |||
| 1598 | Ga0495599_0035288 | |||
| 1599 | Ga0495599_0068968 | |||
| 1600 | Ga0495599_0113628 | |||
| 1601 | Ga0495599_0253523 | |||
| 1602 | Ga0495599_0420429 | |||
| 1603 | Ga0495623_0000013 | |||
| 1604 | Ga0495623_0002343 | |||
| 1605 | Ga0495623_0012831 | |||
| 1606 | Ga0495623_0125282 | |||
| 1607 | Ga0495646_0000003 | |||
| 1608 | Ga0495646_0001198 | |||
| 1609 | Ga0495646_0014444 | |||
| 1610 | Ga0495646_0019546 | |||
| 1611 | Ga0495646_0035661 | |||
| 1612 | Ga0495646_0632207 | |||
| 1613 | Ga0495647_0003783 | |||
| 1614 | Ga0495647_0043889 | |||
| 1615 | Ga0495647_0329865 | |||
| 1616 | Ga0495658_0033382 | |||
| 1617 | Ga0495658_0102964 | |||
| 1618 | Ga0495658_0117891 | |||
| 1619 | Ga0495658_0155192 | |||
| 1620 | Ga0495658_0180135 | |||
| 1621 | Ga0495658_0543346 | |||
| 1622 | Ga0495669_0006462 | |||
| 1623 | Ga0495613_0062399 | |||
| 1624 | Ga0495613_0112842 | |||
| 1625 | Ga0495613_0133899 | |||
| 1626 | Ga0495613_0171154 | |||
| 1627 | Ga0495613_0174735 | |||
| 1628 | Ga0495613_0297627 | |||
| 1629 | Ga0495613_0426013 | |||
| 1630 | Ga0495624_0009345 | |||
| 1631 | Ga0495624_0055522 | |||
| 1632 | Ga0495624_0203750 | |||
| 1633 | Ga0495670_0001271 | |||
| 1634 | Ga0495600_0000002 | |||
| 1635 | Ga0495600_0002739 | |||
| 1636 | Ga0495600_0003702 | |||
| 1637 | Ga0495600_0011581 | |||
| 1638 | Ga0495600_0050772 | |||
| 1639 | Ga0495581_0069003 | |||
| 1640 | Ga0495581_0072904 | |||
| 1641 | Ga0495581_0116039 | |||
| 1642 | Ga0495581_0390261 | |||
| 1643 | Ga0495581_0479639 | |||
| 1644 | Ga0495604_0000001 | |||
| 1645 | Ga0495604_0000186 | |||
| 1646 | Ga0495604_0001606 | |||
| 1647 | Ga0495604_0006423 | |||
| 1648 | Ga0495604_0053395 | |||
| 1649 | Ga0495604_0210861 | |||
| 1650 | Ga0495604_0230178 | |||
| 1651 | Ga0495604_0239635 | |||
| 1652 | Ga0495674_0000018 | |||
| 1653 | Ga0495674_0017517 | |||
| 1654 | Ga0495674_0048394 | |||
| 1655 | Ga0495674_0107696 | |||
| 1656 | Ga0495674_0109689 | |||
| 1657 | Ga0495674_0385549 | |||
| 1658 | Ga0495676_0090294 | |||
| 1659 | Ga0495676_0131656 | |||
| 1660 | Ga0495676_0251202 | |||
| 1661 | Ga0495676_0624437 | |||
| 1662 | Ga0495676_0920310 | |||
| 1663 | Ga0495680_0000159 | |||
| 1664 | Ga0495680_0005565 | |||
| 1665 | Ga0495680_0014550 | |||
| 1666 | Ga0495680_0018619 | |||
| 1667 | Ga0495680_0023301 | |||
| 1668 | Ga0495680_0099178 | |||
| 1669 | Ga0495680_0117268 | |||
| 1670 | Ga0495675_0000238 | |||
| 1671 | Ga0495675_0005457 | |||
| 1672 | Ga0495675_0014186 | |||
| 1673 | Ga0495675_0035513 | |||
| 1674 | Ga0495677_0069875 | |||
| 1675 | Ga0495679_008677 | |||
| 1676 | Ga0495684_0000010 | |||
| 1677 | Ga0495684_0024373 | |||
| 1678 | Ga0495684_0042639 | |||
| 1679 | Ga0495684_0046067 | |||
| 1680 | Ga0495684_0098856 | |||
| 1681 | Ga0495684_0169378 | |||
| 1682 | Ga0495684_0213523 | |||
| 1683 | Ga0495684_0590862 | |||
| 1684 | Ga0495684_0666743 | |||
| 1685 | Ga0495593_0005079 | |||
| 1686 | Ga0495593_0010567 | |||
| 1687 | Ga0495593_0091277 | |||
| 1688 | Ga0495593_0169305 | |||
| 1689 | Ga0495593_0233485 | |||
| 1690 | Ga0495593_0326109 | |||
| 1691 | Ga0495602_0000016 | |||
| 1692 | Ga0495602_0052962 | |||
| 1693 | Ga0495602_0063590 | |||
| 1694 | Ga0495602_0221465 | |||
| 1695 | Ga0495602_0234184 | |||
| 1696 | Ga0495614_0040128 | |||
| 1697 | Ga0495614_0046055 | |||
| 1698 | Ga0495614_0375567 | |||
| 1699 | Ga0496100_0402642 | |||
| 1700 | Ga0496101_0051375 | |||
| 1701 | Ga0496101_0166110 | |||
| 1702 | Ga0496101_0293972 | |||
| 1703 | Ga0496101_0462931 | |||
| 1704 | Ga0496102_0017814 | |||
| 1705 | Ga0496102_0060926 | |||
| 1706 | Ga0496102_0267842 | |||
| 1707 | Ga0496103_0055638 | |||
| 1708 | Ga0496103_0151110 | |||
| 1709 | Ga0496104_0032534 | |||
| 1710 | Ga0496104_0058138 | |||
| 1711 | Ga0496104_0085556 | |||
| 1712 | Ga0496104_0462910 | |||
| 1713 | Ga0496104_1175305 | |||
| 1714 | Ga0496105_0068036 | |||
| 1715 | Ga0496105_0366952 | |||
| 1716 | Ga0496105_0386842 | |||
| 1717 | Ga0496105_0482193 | |||
| 1718 | Ga0496105_0482659 | |||
| 1719 | Ga0496105_0499295 | |||
| 1720 | Ga0496106_0028455 | |||
| 1721 | Ga0496106_0029719 | |||
| 1722 | Ga0496106_0233882 | |||
| 1723 | Ga0496106_0329034 | |||
| 1724 | Ga0496106_0670663 | |||
| 1725 | Ga0496106_0707666 | |||
| 1726 | Ga0496107_0025221 | |||
| 1727 | Ga0496107_0097133 | |||
| 1728 | Ga0496107_0422806 | |||
| 1729 | Ga0496108_0087058 | |||
| 1730 | Ga0496108_0210262 | |||
| 1731 | Ga0496108_0342899 | |||
| 1732 | Ga0496108_0412543 | |||
| 1733 | Ga0496108_1201883 | |||
| 1734 | Ga0496109_0095873 | |||
| 1735 | Ga0496109_0955306 | |||
| 1736 | Ga0496110_0004047 | |||
| 1737 | Ga0496111_0396811 | |||
| 1738 | Ga0496111_0700748 | |||
| 1739 | Ga0496112_0011548 | |||
| 1740 | Ga0496112_0216209 | |||
| 1741 | Ga0496112_0422766 | |||
| 1742 | Ga0496112_0919140 | |||
| 1743 | Ga0496112_0927654 | |||
| 1744 | Ga0496113_0300341 | |||
| 1745 | Ga0496113_0378927 | |||
| 1746 | Ga0496114_0023602 | |||
| 1747 | Ga0496114_0067970 | |||
| 1748 | Ga0496114_0150087 | |||
| 1749 | Ga0496114_0847416 | |||
| 1750 | Ga0496115_0016906 | |||
| 1751 | Ga0496115_0046719 | |||
| 1752 | Ga0496115_0061104 | |||
| 1753 | Ga0496115_0112722 | |||
| 1754 | Ga0496115_0153388 | |||
| 1755 | Ga0496115_0159672 | |||
| 1756 | Ga0496115_0314246 | |||
| 1757 | Ga0496115_0315733 | |||
| 1758 | Ga0496115_0630997 | |||
| 1759 | Ga0496121_0075376 | |||
| 1760 | Ga0496126_0014855 | |||
| 1761 | Ga0501031_0212649 | |||
| 1762 | Ga0501034_0149951 | |||
| 1763 | Ga0501036_0261042 | |||
| 1764 | Ga0501037_0049808 | |||
| 1765 | Ga0501038_0381870 | |||
| 1766 | Ga0501039_0190946 | |||
| 1767 | Ga0501047_0009323 | |||
| 1768 | Ga0501067_0369806 | |||
| 1769 | Ga0501072_0250748 | |||
| 1770 | Ga0501073_0067398 | |||
| 1771 | Ga0501076_0226428 | |||
| 1772 | Ga0501079_0536115 | |||
| 1773 | Ga0501080_0928928 | |||
| 1774 | Ga0501081_0368541 | |||
| 1775 | Ga0501083_0019534 | |||
| 1776 | nmdc:mga05p37_187611_c1 | |||
| 1777 | nmdc:mga06r32_729418_c1 | |||
| 1778 | nmdc:mga08y16_290913_c2 | |||
| 1779 | nmdc:mga08y16_950282_c1 | |||
| 1780 | nmdc:mga0n895_349846_c1 | |||
| 1781 | nmdc:mga0n895_80324_c1 | |||
| 1782 | nmdc:mga0n895_80582_c1 | |||
| 1783 | nmdc:mga0rr50_96276_c1 | |||
| 1784 | nmdc:mga08x19_173062_c1 | |||
| 1785 | nmdc:mga08x19_3057_c1 | |||
| 1786 | nmdc:mga08x19_40707_c1 | |||
| 1787 | nmdc:mga08x19_96342_c1 | |||
| 1788 | nmdc:mga0a205_63042_c1 | |||
| 1789 | Ga0495601_0000021 | |||
| 1790 | Ga0495601_0002704 | |||
| 1791 | Ga0495601_0011416 | |||
| 1792 | Ga0495601_0023845 | |||
| 1793 | Ga0495601_0152123 | |||
| 1794 | Ga0495601_0728948 | |||
| 1795 | Ga0495612_0000018 | |||
| 1796 | Ga0495612_0004668 | |||
| 1797 | Ga0495612_0210851 | |||
| 1798 | Ga0495595_0000028 | |||
| 1799 | Ga0495595_0004425 | |||
| 1800 | Ga0495595_0006408 | |||
| 1801 | Ga0495595_0009091 | |||
| 1802 | Ga0495595_0020294 | |||
| 1803 | Ga0495595_0157770 | |||
| 1804 | Ga0495595_0372809 | |||
| 1805 | Ga0495619_0000006 | |||
| 1806 | Ga0495619_0006915 | |||
| 1807 | Ga0495619_0008110 | |||
| 1808 | Ga0495619_0013223 | |||
| 1809 | Ga0495619_0013842 | |||
| 1810 | Ga0495619_0051852 | |||
| 1811 | Ga0495619_0109888 | |||
| 1812 | Ga0495619_0227364 | |||
| 1813 | Ga0500651_0004280 | |||
| 1814 | Ga0500651_0105713 | |||
| 1815 | Ga0500651_0537302 | |||
| 1816 | Ga0500566_0012615 | |||
| 1817 | Ga0500566_0172487 | |||
| 1818 | Ga0500595_000104 | |||
| 1819 | Ga0500595_008847 | |||
| 1820 | Ga0500655_010212 | |||
| 1821 | Ga0500616_0000006 | |||
| 1822 | Ga0500657_071628 | |||
| 1823 | Ga0500645_000101 | |||
| 1824 | Ga0501084_0203055 | |||
| 1825 | Ga0501084_1310388 | |||
| 1826 | Ga0501082_0013251 | |||
| 1827 | Ga0501082_0662444 | |||
| 1828 | Ga0530510_0353341 | |||
| 1829 | 2524538395 | |||
| 1830 | 2728750124 | |||
| 1831 | 2793066794 | |||
| 1832 | 2904704909 | |||
| 1833 | 2941510724 | |||
| 1834 | 2941518108 | |||
| 1835 | 2941527021 | |||
| 1836 | 3005481168 | |||
| 1837 | 8006939539 | |||
| 1838 | 8006979289 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bws-assembly1.cif.gz_B-2 | crystal structure of efga from methylobacterium extorquens | 0.9143 | 48 | 177 |
| 2a2l-assembly1.cif.gz_A | crystal structure of klebsiella pneumoniae protein orfy, pfam duf336 | 0.875 | 35 | 177 |
| 4nkp-assembly1.cif.gz_B | crystal structure of a putative extracellular heme-binding protein (despig_02683) from desulfovibrio piger atcc 29098 at 1.24 a resolution | 0.8697 | 36 | 178 |
| 5cx7-assembly1.cif.gz_B | crystal structure of pduoc:heme complex | 0.8653 | 49 | 178 |
| 6bws-assembly1.cif.gz_B-2 | crystal structure of efga from methylobacterium extorquens | 0.8639 | 48 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEQ1_1_133_3.30.450.150 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain | 0.9644 | 46 | 178 | 3.30.450.150 |
| af_P0AEQ1_1_133_3.30.450.150 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain | 0.9363 | 46 | 178 | 3.30.450.150 |
| 3fpvA01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain | 0.9194 | 50 | 178 | 3.30.450.150 |
| 6c0zB00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain | 0.9139 | 48 | 177 | 3.30.450.150 |
| 4nkpD01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain | 0.9081 | 50 | 178 | 3.30.450.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A843SLF7-F1-model_v4 | Heme-binding protein | 0.9849 | 43 | 178 |
|
| AF-A0A545TUR8-F1-model_v4 | Heme-binding protein | 0.9829 | 49 | 176 |
|
| AF-M6TDE4-F1-model_v4 | deleted | 0.9809 | 74 | 178 |
|
| AF-A0A534PYY5-F1-model_v4 | Heme-binding protein | 0.98 | 42 | 177 |
|
| AF-A0A7Y4TEK8-F1-model_v4 | Heme-binding protein | 0.9799 | 43 | 178 |
|