F485745
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 920 | 413 | 1840 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300053092|Ga0500583_0063513|Ga0500583_0063513_734_1492 |
| Length | 247 |
| Sequence | MQRLKDTLPPLAVIGLLIVMXXAAVVATRSMIFPTPWGVVAGTFELLKDGTLWRHIGASLLRVGTGFGLAVCVAVPLGLWMGWVRGAYYTLNPVFQILRPISPIAWIPIAILWFGVGNASPIYLIFISSVFPMIVQTTAGVHTIEKRYLRAAENFGVSRATLFKQVVIPAVVGMRIGLGVAWLVVVAAEMIALRSGLGYMIMDSRNAGNRYDLVIAGMIIIGVIGLSLDGLMRMLEKAKWVRWRYAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 220 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 234 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 238 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 252 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 253 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 254 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 255 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 256 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 257 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 258 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 259 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 260 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 261 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 262 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 263 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 264 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 265 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 266 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 267 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 268 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 269 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 270 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 271 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 272 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 275 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 276 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 277 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 278 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 279 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 280 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 283 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 284 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 285 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 286 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 287 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 288 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 292 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 293 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 356 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 357 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 358 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 359 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 360 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 361 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 374 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 387 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 388 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 390 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 391 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 395 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 396 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 397 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 399 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 401 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 402 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 403 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 404 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 405 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 406 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 407 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 408 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 409 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 410 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 411 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 412 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 413 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.37 |
| Metatranscriptomes | 0.22 |
| Isolates | 1.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.61 |
| Nodule | 0 |
| Rhizoplane | 1.63 |
| Rhizosphere | 81.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500583_0063513 | 3300053092 | Bacteria | 1749 |
| 2 | JGI25154J39366_1001224 | 3300002738 | Bacteria | 9678 |
| 3 | JGI25158J39367_1000466 | 3300002739 | Bacteria | 8290 |
| 4 | JGI25158J39367_1000534 | 3300002739 | Bacteria | 7656 |
| 5 | JGI25152J39213_1000105 | 3300002773 | Bacteria | 58863 |
| 6 | JGI25150J39212_1000943 | 3300002774 | Bacteria | 9322 |
| 7 | JGI25150J39212_1001335 | 3300002774 | Bacteria | 7006 |
| 8 | JGI25159J45721_1000922 | 3300002987 | Bacteria | 12782 |
| 9 | JGI25159J45721_1001932 | 3300002987 | Bacteria | 8269 |
| 10 | JGI25159J45721_1002414 | 3300002987 | Bacteria | 7107 |
| 11 | JGI25406J46586_10010080 | 3300003203 | Bacteria | 4209 |
| 12 | JGI25153J46596_10001671 | 3300003215 | Bacteria | 13152 |
| 13 | rootL2_10025624 | 3300003322 | Bacteria | 5565 |
| 14 | JGI25160J50197_1002498 | 3300003354 | Bacteria | 8550 |
| 15 | JGI25161J50226_1000852 | 3300003374 | Bacteria | 11337 |
| 16 | JGI25161J50226_1001208 | 3300003374 | Bacteria | 8453 |
| 17 | Ga0055539_1000424 | 3300003752 | Bacteria | 15400 |
| 18 | Ga0055533_1000053 | 3300003756 | Bacteria | 199478 |
| 19 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 20 | Ga0055535_1000231 | 3300003761 | Bacteria | 58583 |
| 21 | Ga0055529_1000146 | 3300003763 | Bacteria | 100947 |
| 22 | Ga0055529_1000385 | 3300003763 | Bacteria | 47717 |
| 23 | Ga0055529_1000410 | 3300003763 | Bacteria | 45041 |
| 24 | Ga0055526_1000121 | 3300003771 | Bacteria | 68852 |
| 25 | Ga0055526_1000136 | 3300003771 | Bacteria | 65004 |
| 26 | Ga0055526_1000152 | 3300003771 | Bacteria | 61430 |
| 27 | Ga0055526_1003133 | 3300003771 | Bacteria | 10714 |
| 28 | Ga0055537_1000099 | 3300003773 | Bacteria | 65218 |
| 29 | Ga0055537_1001156 | 3300003773 | Bacteria | 11287 |
| 30 | Ga0055524_1000222 | 3300003775 | Bacteria | 60317 |
| 31 | Ga0055524_1002051 | 3300003775 | Bacteria | 10710 |
| 32 | Ga0055524_1017502 | 3300003775 | Bacteria | 2527 |
| 33 | Ga0055534_1000023 | 3300003784 | Bacteria | 135301 |
| 34 | Ga0055534_1001189 | 3300003784 | Bacteria | 10935 |
| 35 | Ga0055528_1000119 | 3300003790 | Bacteria | 62428 |
| 36 | Ga0055528_1002187 | 3300003790 | Bacteria | 10689 |
| 37 | Ga0055530_10000125 | 3300003791 | Bacteria | 66757 |
| 38 | Ga0055530_10009012 | 3300003791 | Bacteria | 3897 |
| 39 | Ga0055530_10009038 | 3300003791 | Bacteria | 3885 |
| 40 | Ga0055531_10000019 | 3300003794 | Bacteria | 170825 |
| 41 | Ga0055531_10000577 | 3300003794 | Bacteria | 31960 |
| 42 | Ga0055531_10011253 | 3300003794 | Bacteria | 4341 |
| 43 | Ga0055543_1000072 | 3300004625 | Bacteria | 88781 |
| 44 | Ga0055543_1001583 | 3300004625 | Bacteria | 8778 |
| 45 | Ga0065165_1000039 | 3300005262 | Bacteria | 208372 |
| 46 | Ga0065165_1000269 | 3300005262 | Bacteria | 88841 |
| 47 | Ga0065707_10110726 | 3300005295 | Bacteria | 2419 |
| 48 | Ga0065707_10134002 | 3300005295 | Bacteria | 1872 |
| 49 | Ga0065707_10137714 | 3300005295 | Bacteria | 1816 |
| 50 | Ga0070658_10015986 | 3300005327 | Bacteria | 6003 |
| 51 | Ga0070658_10397369 | 3300005327 | Bacteria | 1184 |
| 52 | Ga0070676_10343378 | 3300005328 | Bacteria | 1024 |
| 53 | Ga0070676_10345944 | 3300005328 | Bacteria | 1021 |
| 54 | Ga0070683_100023859 | 3300005329 | Bacteria | 5475 |
| 55 | Ga0070683_100305645 | 3300005329 | Bacteria | 1513 |
| 56 | Ga0070670_100017935 | 3300005331 | Bacteria | 6075 |
| 57 | Ga0070670_100062682 | 3300005331 | Bacteria | 3192 |
| 58 | Ga0068869_100282140 | 3300005334 | Bacteria | 1336 |
| 59 | Ga0070666_10004170 | 3300005335 | Bacteria | 8774 |
| 60 | Ga0070680_100015253 | 3300005336 | Bacteria | 6020 |
| 61 | Ga0070680_100229986 | 3300005336 | Bacteria | 1566 |
| 62 | Ga0068868_100516988 | 3300005338 | Bacteria | 1048 |
| 63 | Ga0070660_100105712 | 3300005339 | Bacteria | 2234 |
| 64 | Ga0070689_100007082 | 3300005340 | Bacteria | 7810 |
| 65 | Ga0070691_10105251 | 3300005341 | Bacteria | 1405 |
| 66 | Ga0070691_10315439 | 3300005341 | Bacteria | 858 |
| 67 | Ga0070661_100005584 | 3300005344 | Bacteria | 8668 |
| 68 | Ga0070692_10005578 | 3300005345 | Bacteria | 5383 |
| 69 | Ga0070668_100042596 | 3300005347 | Bacteria | 3480 |
| 70 | Ga0070669_100060057 | 3300005353 | Bacteria | 2792 |
| 71 | Ga0070669_100259013 | 3300005353 | Bacteria | 1387 |
| 72 | Ga0070675_100053133 | 3300005354 | Bacteria | 3332 |
| 73 | Ga0070675_100058423 | 3300005354 | Bacteria | 3181 |
| 74 | Ga0070675_100181916 | 3300005354 | Bacteria | 1818 |
| 75 | Ga0070671_100030234 | 3300005355 | Bacteria | 4470 |
| 76 | Ga0070671_100438432 | 3300005355 | Bacteria | 1120 |
| 77 | Ga0070674_100362137 | 3300005356 | Bacteria | 1174 |
| 78 | Ga0070673_100200178 | 3300005364 | Bacteria | 1720 |
| 79 | Ga0070659_100024389 | 3300005366 | Bacteria | 4636 |
| 80 | Ga0070659_100037190 | 3300005366 | Bacteria | 3795 |
| 81 | Ga0070659_100262255 | 3300005366 | Bacteria | 1434 |
| 82 | Ga0070659_100321020 | 3300005366 | Bacteria | 1294 |
| 83 | Ga0070667_100161787 | 3300005367 | Bacteria | 1972 |
| 84 | Ga0070701_10004672 | 3300005438 | Bacteria | 5578 |
| 85 | Ga0070701_10132198 | 3300005438 | Bacteria | 1419 |
| 86 | Ga0070701_10469717 | 3300005438 | Bacteria | 811 |
| 87 | Ga0070711_100162786 | 3300005439 | Bacteria | 1693 |
| 88 | Ga0070705_100018660 | 3300005440 | Bacteria | 3639 |
| 89 | Ga0070705_100098734 | 3300005440 | Bacteria | 1838 |
| 90 | Ga0070700_100078129 | 3300005441 | Bacteria | 2130 |
| 91 | Ga0070700_100353671 | 3300005441 | Unclassified | 1090 |
| 92 | Ga0070694_100010085 | 3300005444 | Bacteria | 5811 |
| 93 | Ga0070694_100061184 | 3300005444 | Bacteria | 2569 |
| 94 | Ga0070694_100428894 | 3300005444 | Bacteria | 1040 |
| 95 | Ga0070678_100010891 | 3300005456 | Bacteria | 5578 |
| 96 | Ga0070678_100012871 | 3300005456 | Bacteria | 5219 |
| 97 | Ga0070678_100103578 | 3300005456 | Bacteria | 2211 |
| 98 | Ga0070662_100254393 | 3300005457 | Bacteria | 1413 |
| 99 | Ga0070662_100438393 | 3300005457 | Bacteria | 1083 |
| 100 | Ga0070681_10176741 | 3300005458 | Bacteria | 2057 |
| 101 | Ga0070681_10194675 | 3300005458 | Bacteria | 1946 |
| 102 | Ga0068867_100030441 | 3300005459 | Bacteria | 3894 |
| 103 | Ga0068867_100668330 | 3300005459 | Bacteria | 913 |
| 104 | Ga0068867_100789963 | 3300005459 | Bacteria | 845 |
| 105 | Ga0070685_10468655 | 3300005466 | Bacteria | 886 |
| 106 | Ga0070707_100298740 | 3300005468 | Bacteria | 1565 |
| 107 | Ga0070698_100097943 | 3300005471 | Bacteria | 2908 |
| 108 | Ga0070698_100582505 | 3300005471 | Bacteria | 1059 |
| 109 | Ga0070679_100154176 | 3300005530 | Bacteria | 2273 |
| 110 | Ga0070679_100493908 | 3300005530 | Bacteria | 1168 |
| 111 | Ga0070684_100015656 | 3300005535 | Bacteria | 6185 |
| 112 | Ga0070684_100045432 | 3300005535 | Bacteria | 3803 |
| 113 | Ga0070697_100190836 | 3300005536 | Bacteria | 1739 |
| 114 | Ga0070697_100778027 | 3300005536 | Bacteria | 846 |
| 115 | Ga0068853_100028936 | 3300005539 | Bacteria | 4664 |
| 116 | Ga0070672_100022151 | 3300005543 | Bacteria | 4661 |
| 117 | Ga0070672_100154663 | 3300005543 | Bacteria | 1899 |
| 118 | Ga0070672_100185099 | 3300005543 | Bacteria | 1737 |
| 119 | Ga0070672_100422105 | 3300005543 | Bacteria | 1146 |
| 120 | Ga0070686_100035917 | 3300005544 | Bacteria | 3064 |
| 121 | Ga0070686_100042747 | 3300005544 | Bacteria | 2840 |
| 122 | Ga0070686_100087855 | 3300005544 | Unclassified | 2073 |
| 123 | Ga0070695_100484018 | 3300005545 | Bacteria | 954 |
| 124 | Ga0070693_100017268 | 3300005547 | Bacteria | 3748 |
| 125 | Ga0070693_100053573 | 3300005547 | Bacteria | 2317 |
| 126 | Ga0070665_100003603 | 3300005548 | Bacteria | 16402 |
| 127 | Ga0070665_100027519 | 3300005548 | Bacteria | 5727 |
| 128 | Ga0070665_100299575 | 3300005548 | Bacteria | 1611 |
| 129 | Ga0070704_100021477 | 3300005549 | Bacteria | 4186 |
| 130 | Ga0070704_100034212 | 3300005549 | Bacteria | 3443 |
| 131 | Ga0070704_100214547 | 3300005549 | Bacteria | 1561 |
| 132 | Ga0070704_100438648 | 3300005549 | Bacteria | 1122 |
| 133 | Ga0068855_100000063 | 3300005563 | Bacteria | 131058 |
| 134 | Ga0068855_100009185 | 3300005563 | Bacteria | 11938 |
| 135 | Ga0068855_100113713 | 3300005563 | Bacteria | 3105 |
| 136 | Ga0068855_100164904 | 3300005563 | Bacteria | 2512 |
| 137 | Ga0070664_100010472 | 3300005564 | Bacteria | 7516 |
| 138 | Ga0070664_100014575 | 3300005564 | Bacteria | 6413 |
| 139 | Ga0070664_100014919 | 3300005564 | Bacteria | 6339 |
| 140 | Ga0070664_100089497 | 3300005564 | Bacteria | 2663 |
| 141 | Ga0068857_100096315 | 3300005577 | Bacteria | 2652 |
| 142 | Ga0068857_100521350 | 3300005577 | Bacteria | 1117 |
| 143 | Ga0068854_100056508 | 3300005578 | Bacteria | 2829 |
| 144 | Ga0068856_100003740 | 3300005614 | Bacteria | 15249 |
| 145 | Ga0068856_100036785 | 3300005614 | Bacteria | 4801 |
| 146 | Ga0070702_100000568 | 3300005615 | Bacteria | 13456 |
| 147 | Ga0068852_100002933 | 3300005616 | Bacteria | 11850 |
| 148 | Ga0068852_100012151 | 3300005616 | Bacteria | 6522 |
| 149 | Ga0068859_100000441 | 3300005617 | Bacteria | 41723 |
| 150 | Ga0068859_100003795 | 3300005617 | Bacteria | 15414 |
| 151 | Ga0068859_100022271 | 3300005617 | Bacteria | 6353 |
| 152 | Ga0068859_100025928 | 3300005617 | Bacteria | 5880 |
| 153 | Ga0068859_100191375 | 3300005617 | Bacteria | 2130 |
| 154 | Ga0068859_100459198 | 3300005617 | Bacteria | 1370 |
| 155 | Ga0068859_100561160 | 3300005617 | Bacteria | 1236 |
| 156 | Ga0068864_100048705 | 3300005618 | Bacteria | 3644 |
| 157 | Ga0068864_100334450 | 3300005618 | Unclassified | 1426 |
| 158 | Ga0068866_10163789 | 3300005718 | Bacteria | 1299 |
| 159 | Ga0068861_100000008 | 3300005719 | Bacteria | 85041 |
| 160 | Ga0068861_100115257 | 3300005719 | Bacteria | 2159 |
| 161 | Ga0068861_100144959 | 3300005719 | Bacteria | 1942 |
| 162 | Ga0068861_100424961 | 3300005719 | Bacteria | 1185 |
| 163 | Ga0068861_100589324 | 3300005719 | Bacteria | 1019 |
| 164 | Ga0068851_10010122 | 3300005834 | Bacteria | 4394 |
| 165 | Ga0068863_100012404 | 3300005841 | Bacteria | 8228 |
| 166 | Ga0068863_100014402 | 3300005841 | Bacteria | 7616 |
| 167 | Ga0068863_100048554 | 3300005841 | Bacteria | 4025 |
| 168 | Ga0068863_100216891 | 3300005841 | Bacteria | 1843 |
| 169 | Ga0068858_100002170 | 3300005842 | Bacteria | 19909 |
| 170 | Ga0068858_100064087 | 3300005842 | Bacteria | 3401 |
| 171 | Ga0068858_100301281 | 3300005842 | Bacteria | 1529 |
| 172 | Ga0068858_100742802 | 3300005842 | Bacteria | 956 |
| 173 | Ga0068860_100011984 | 3300005843 | Bacteria | 8541 |
| 174 | Ga0068860_100107393 | 3300005843 | Bacteria | 2667 |
| 175 | Ga0068860_100204460 | 3300005843 | Bacteria | 1914 |
| 176 | Ga0068860_100219936 | 3300005843 | Bacteria | 1844 |
| 177 | Ga0068860_100924484 | 3300005843 | Bacteria | 889 |
| 178 | Ga0068862_100020814 | 3300005844 | Bacteria | 5480 |
| 179 | Ga0068862_100040994 | 3300005844 | Bacteria | 3938 |
| 180 | Ga0068862_100350855 | 3300005844 | Bacteria | 1369 |
| 181 | Ga0068862_100363470 | 3300005844 | Bacteria | 1346 |
| 182 | Ga0081455_10002207 | 3300005937 | Bacteria | 23184 |
| 183 | Ga0081455_10012865 | 3300005937 | Bacteria | 8308 |
| 184 | Ga0081538_10030003 | 3300005981 | Bacteria | 3701 |
| 185 | Ga0081539_10000028 | 3300005985 | Bacteria | 328182 |
| 186 | Ga0070716_100061539 | 3300006173 | Bacteria | 2173 |
| 187 | Ga0097621_100000841 | 3300006237 | Bacteria | 21627 |
| 188 | Ga0097621_100022866 | 3300006237 | Bacteria | 4857 |
| 189 | Ga0097621_100030587 | 3300006237 | Bacteria | 4263 |
| 190 | Ga0097621_100541583 | 3300006237 | Bacteria | 1059 |
| 191 | Ga0075370_10002481 | 3300006353 | Bacteria | 8555 |
| 192 | Ga0068871_100000019 | 3300006358 | Bacteria | 86487 |
| 193 | Ga0068871_100028262 | 3300006358 | Bacteria | 4395 |
| 194 | Ga0068871_100031654 | 3300006358 | Bacteria | 4173 |
| 195 | Ga0075428_100078847 | 3300006844 | Bacteria | 3595 |
| 196 | Ga0075428_100092983 | 3300006844 | Bacteria | 3288 |
| 197 | Ga0075428_100108639 | 3300006844 | Bacteria | 3023 |
| 198 | Ga0075428_100448540 | 3300006844 | Bacteria | 1382 |
| 199 | Ga0075428_100511036 | 3300006844 | Bacteria | 1285 |
| 200 | Ga0075428_100609356 | 3300006844 | Bacteria | 1166 |
| 201 | Ga0075428_100734809 | 3300006844 | Bacteria | 1051 |
| 202 | Ga0075430_100010028 | 3300006846 | Bacteria | 8016 |
| 203 | Ga0075430_100010127 | 3300006846 | Bacteria | 7977 |
| 204 | Ga0075431_100003452 | 3300006847 | Bacteria | 15337 |
| 205 | Ga0075433_10000411 | 3300006852 | Bacteria | 27322 |
| 206 | Ga0075433_10003752 | 3300006852 | Bacteria | 11756 |
| 207 | Ga0075433_10005518 | 3300006852 | Bacteria | 9933 |
| 208 | Ga0075433_10036020 | 3300006852 | Bacteria | 4259 |
| 209 | Ga0075433_10037238 | 3300006852 | Bacteria | 4195 |
| 210 | Ga0075433_10105012 | 3300006852 | Bacteria | 2503 |
| 211 | Ga0075434_100001953 | 3300006871 | Bacteria | 17878 |
| 212 | Ga0075434_100154989 | 3300006871 | Bacteria | 2310 |
| 213 | Ga0075434_100324508 | 3300006871 | Bacteria | 1560 |
| 214 | Ga0075429_100008741 | 3300006880 | Bacteria | 8807 |
| 215 | Ga0075429_100034820 | 3300006880 | Bacteria | 4376 |
| 216 | Ga0075429_100036067 | 3300006880 | Bacteria | 4301 |
| 217 | Ga0075429_100120324 | 3300006880 | Bacteria | 2295 |
| 218 | Ga0068865_100080691 | 3300006881 | Bacteria | 2334 |
| 219 | Ga0068865_100106730 | 3300006881 | Bacteria | 2059 |
| 220 | Ga0068865_100129906 | 3300006881 | Bacteria | 1886 |
| 221 | Ga0068865_100244313 | 3300006881 | Bacteria | 1414 |
| 222 | Ga0068865_100524776 | 3300006881 | Bacteria | 991 |
| 223 | Ga0097620_100000441 | 3300006931 | Bacteria | 41723 |
| 224 | Ga0097620_100003795 | 3300006931 | Bacteria | 15414 |
| 225 | Ga0097620_100022271 | 3300006931 | Bacteria | 6353 |
| 226 | Ga0097620_100025927 | 3300006931 | Bacteria | 5880 |
| 227 | Ga0097620_100191380 | 3300006931 | Bacteria | 2130 |
| 228 | Ga0097620_100459183 | 3300006931 | Bacteria | 1370 |
| 229 | Ga0097620_100561214 | 3300006931 | Bacteria | 1236 |
| 230 | Ga0075435_100015509 | 3300007076 | Bacteria | 5730 |
| 231 | Ga0099795_10000067 | 3300007788 | Bacteria | 18331 |
| 232 | Ga0105244_10012434 | 3300009036 | Bacteria | 5029 |
| 233 | Ga0105240_10001628 | 3300009093 | Bacteria | 38096 |
| 234 | Ga0105240_10007565 | 3300009093 | Bacteria | 15741 |
| 235 | Ga0105240_10021958 | 3300009093 | Bacteria | 8477 |
| 236 | Ga0105240_10131188 | 3300009093 | Bacteria | 3006 |
| 237 | Ga0105240_10406884 | 3300009093 | Bacteria | 1531 |
| 238 | Ga0105240_10443349 | 3300009093 | Bacteria | 1454 |
| 239 | Ga0111539_10002045 | 3300009094 | Bacteria | 26976 |
| 240 | Ga0111539_10002579 | 3300009094 | Bacteria | 23990 |
| 241 | Ga0111539_10007328 | 3300009094 | Bacteria | 14125 |
| 242 | Ga0111539_10013501 | 3300009094 | Bacteria | 10208 |
| 243 | Ga0111539_10028444 | 3300009094 | Bacteria | 6819 |
| 244 | Ga0111539_10149002 | 3300009094 | Bacteria | 2739 |
| 245 | Ga0111539_10423880 | 3300009094 | Bacteria | 1550 |
| 246 | Ga0111539_10441345 | 3300009094 | Unclassified | 1515 |
| 247 | Ga0105245_10588831 | 3300009098 | Bacteria | 1138 |
| 248 | Ga0105247_10000867 | 3300009101 | Bacteria | 22861 |
| 249 | Ga0105247_10072183 | 3300009101 | Bacteria | 2160 |
| 250 | Ga0105247_10126455 | 3300009101 | Bacteria | 1662 |
| 251 | Ga0114129_10003612 | 3300009147 | Bacteria | 21750 |
| 252 | Ga0114129_10009126 | 3300009147 | Bacteria | 14136 |
| 253 | Ga0114129_10036200 | 3300009147 | Bacteria | 6971 |
| 254 | Ga0114129_10055243 | 3300009147 | Bacteria | 5566 |
| 255 | Ga0114129_10141465 | 3300009147 | Bacteria | 3297 |
| 256 | Ga0114129_10263567 | 3300009147 | Bacteria | 2308 |
| 257 | Ga0114129_10361398 | 3300009147 | Bacteria | 1921 |
| 258 | Ga0114129_10398002 | 3300009147 | Bacteria | 1815 |
| 259 | Ga0105243_10006083 | 3300009148 | Bacteria | 9331 |
| 260 | Ga0105243_10052843 | 3300009148 | Bacteria | 3220 |
| 261 | Ga0105243_10222627 | 3300009148 | Bacteria | 1669 |
| 262 | Ga0105241_10024325 | 3300009174 | Bacteria | 4498 |
| 263 | Ga0105241_10135604 | 3300009174 | Bacteria | 1998 |
| 264 | Ga0105241_10148882 | 3300009174 | Bacteria | 1913 |
| 265 | Ga0105242_10035918 | 3300009176 | Bacteria | 3973 |
| 266 | Ga0105242_10199411 | 3300009176 | Bacteria | 1777 |
| 267 | Ga0105248_10005552 | 3300009177 | Bacteria | 13858 |
| 268 | Ga0105237_10090329 | 3300009545 | Bacteria | 3052 |
| 269 | Ga0105237_10210934 | 3300009545 | Bacteria | 1942 |
| 270 | Ga0105238_10005735 | 3300009551 | Bacteria | 12278 |
| 271 | Ga0105238_10022723 | 3300009551 | Bacteria | 6392 |
| 272 | Ga0105238_10144024 | 3300009551 | Bacteria | 2360 |
| 273 | Ga0105238_10172259 | 3300009551 | Bacteria | 2141 |
| 274 | Ga0105238_10244762 | 3300009551 | Bacteria | 1771 |
| 275 | Ga0105249_10123845 | 3300009553 | Bacteria | 2460 |
| 276 | Ga0105249_10239636 | 3300009553 | Bacteria | 1793 |
| 277 | Ga0105249_10443150 | 3300009553 | Bacteria | 1336 |
| 278 | Ga0105249_10719240 | 3300009553 | Unclassified | 1059 |
| 279 | Ga0099796_10000050 | 3300010159 | Bacteria | 21279 |
| 280 | Ga0105239_10003698 | 3300010375 | Bacteria | 18630 |
| 281 | Ga0105239_10048257 | 3300010375 | Bacteria | 4669 |
| 282 | Ga0105239_10448154 | 3300010375 | Bacteria | 1464 |
| 283 | Ga0157373_10106539 | 3300013100 | Bacteria | 1971 |
| 284 | Ga0157371_10379110 | 3300013102 | Bacteria | 1032 |
| 285 | Ga0157370_10449027 | 3300013104 | Bacteria | 1185 |
| 286 | Ga0157369_10007931 | 3300013105 | Bacteria | 12208 |
| 287 | Ga0157369_10021678 | 3300013105 | Bacteria | 7184 |
| 288 | Ga0157369_10041753 | 3300013105 | Bacteria | 5006 |
| 289 | Ga0157369_10051231 | 3300013105 | Bacteria | 4467 |
| 290 | Ga0157374_10078646 | 3300013296 | Bacteria | 3124 |
| 291 | Ga0157374_10084191 | 3300013296 | Bacteria | 3023 |
| 292 | Ga0157374_10519622 | 3300013296 | Bacteria | 1196 |
| 293 | Ga0157378_10109210 | 3300013297 | Bacteria | 2534 |
| 294 | Ga0163162_10000021 | 3300013306 | Bacteria | 214873 |
| 295 | Ga0163162_10089481 | 3300013306 | Bacteria | 3159 |
| 296 | Ga0157372_10006490 | 3300013307 | Bacteria | 12448 |
| 297 | Ga0157372_10089173 | 3300013307 | Bacteria | 3503 |
| 298 | Ga0157372_10346842 | 3300013307 | Bacteria | 1730 |
| 299 | Ga0157372_10386870 | 3300013307 | Bacteria | 1630 |
| 300 | Ga0157375_10012567 | 3300013308 | Bacteria | 7514 |
| 301 | Ga0157375_10313699 | 3300013308 | Unclassified | 1732 |
| 302 | Ga0157375_10707575 | 3300013308 | Bacteria | 1161 |
| 303 | Ga0163163_10023119 | 3300014325 | Bacteria | 5896 |
| 304 | Ga0157377_10000030 | 3300014745 | Bacteria | 124439 |
| 305 | Ga0157379_10146708 | 3300014968 | Bacteria | 2128 |
| 306 | Ga0157379_10165118 | 3300014968 | Bacteria | 1998 |
| 307 | Ga0157376_10010196 | 3300014969 | Bacteria | 6861 |
| 308 | Ga0213872_10000733 | 3300021361 | Bacteria | 24466 |
| 309 | Ga0213872_10001492 | 3300021361 | Bacteria | 15102 |
| 310 | Ga0213872_10032703 | 3300021361 | Bacteria | 2383 |
| 311 | Ga0209436_100049 | 3300025208 | Bacteria | 66162 |
| 312 | Ga0209436_100093 | 3300025208 | Bacteria | 44019 |
| 313 | Ga0209436_112250 | 3300025208 | Bacteria | 1465 |
| 314 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 315 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 316 | Ga0209563_100080 | 3300025230 | Bacteria | 199504 |
| 317 | Ga0209437_108461 | 3300025233 | Bacteria | 1644 |
| 318 | Ga0209258_100305 | 3300025242 | Bacteria | 78801 |
| 319 | Ga0209258_100419 | 3300025242 | Bacteria | 50513 |
| 320 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 321 | Ga0207425_1000033 | 3300025245 | Bacteria | 245540 |
| 322 | Ga0207425_1000536 | 3300025245 | Bacteria | 22859 |
| 323 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 324 | Ga0209646_1000249 | 3300025246 | Bacteria | 54511 |
| 325 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 326 | Ga0209677_100086 | 3300025253 | Bacteria | 112759 |
| 327 | Ga0209677_100160 | 3300025253 | Bacteria | 60301 |
| 328 | Ga0209759_1000034 | 3300025256 | Bacteria | 271209 |
| 329 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 330 | Ga0209129_1001164 | 3300025258 | Bacteria | 15177 |
| 331 | Ga0209233_1000104 | 3300025261 | Bacteria | 272675 |
| 332 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 333 | Ga0209565_1000162 | 3300025263 | Bacteria | 89049 |
| 334 | Ga0209565_1000305 | 3300025263 | Bacteria | 45984 |
| 335 | Ga0209565_1000474 | 3300025263 | Bacteria | 29679 |
| 336 | Ga0209565_1003162 | 3300025263 | Bacteria | 5477 |
| 337 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 338 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 339 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 340 | Ga0209673_1018570 | 3300025273 | Bacteria | 2523 |
| 341 | Ga0209130_1000084 | 3300025284 | Bacteria | 160070 |
| 342 | Ga0209130_1000236 | 3300025284 | Bacteria | 71244 |
| 343 | Ga0209130_1001409 | 3300025284 | Bacteria | 16043 |
| 344 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 345 | Ga0209675_1001160 | 3300025291 | Bacteria | 16000 |
| 346 | Ga0209025_1002882 | 3300025294 | Bacteria | 17233 |
| 347 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 348 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 349 | Ga0209564_1000068 | 3300025295 | Bacteria | 311171 |
| 350 | Ga0209564_1000748 | 3300025295 | Bacteria | 45984 |
| 351 | Ga0209564_1006494 | 3300025295 | Bacteria | 6289 |
| 352 | Ga0209758_1000041 | 3300025297 | Bacteria | 410328 |
| 353 | Ga0209758_1001010 | 3300025297 | Bacteria | 37319 |
| 354 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 355 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 356 | Ga0209050_1001581 | 3300025298 | Bacteria | 23591 |
| 357 | Ga0209256_1000255 | 3300025299 | Bacteria | 94783 |
| 358 | Ga0209256_1000295 | 3300025299 | Bacteria | 87239 |
| 359 | Ga0209256_1000402 | 3300025299 | Bacteria | 68470 |
| 360 | Ga0207426_1002123 | 3300025302 | Bacteria | 13591 |
| 361 | Ga0207426_1016115 | 3300025302 | Bacteria | 2693 |
| 362 | Ga0209051_1008346 | 3300025303 | Bacteria | 5495 |
| 363 | Ga0209051_1013496 | 3300025303 | Bacteria | 3886 |
| 364 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 365 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 366 | Ga0209257_1000117 | 3300025304 | Bacteria | 227328 |
| 367 | Ga0209257_1006037 | 3300025304 | Bacteria | 8085 |
| 368 | Ga0207642_10086036 | 3300025899 | Bacteria | 1540 |
| 369 | Ga0207710_10000520 | 3300025900 | Bacteria | 23614 |
| 370 | Ga0207645_10004509 | 3300025907 | Bacteria | 10291 |
| 371 | Ga0207643_10009264 | 3300025908 | Bacteria | 5290 |
| 372 | Ga0207643_10050180 | 3300025908 | Bacteria | 2366 |
| 373 | Ga0207705_10270853 | 3300025909 | Bacteria | 1298 |
| 374 | Ga0207705_10354108 | 3300025909 | Bacteria | 1131 |
| 375 | Ga0207684_10483051 | 3300025910 | Bacteria | 1062 |
| 376 | Ga0207654_10001508 | 3300025911 | Bacteria | 12274 |
| 377 | Ga0207654_10136592 | 3300025911 | Bacteria | 1558 |
| 378 | Ga0207654_10347936 | 3300025911 | Bacteria | 1020 |
| 379 | Ga0207707_10274620 | 3300025912 | Bacteria | 1460 |
| 380 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 381 | Ga0207695_10102135 | 3300025913 | Bacteria | 2861 |
| 382 | Ga0207695_10526231 | 3300025913 | Bacteria | 1064 |
| 383 | Ga0207663_10026383 | 3300025916 | Bacteria | 3372 |
| 384 | Ga0207660_10069659 | 3300025917 | Bacteria | 2555 |
| 385 | Ga0207660_10117847 | 3300025917 | Bacteria | 2008 |
| 386 | Ga0207657_10043116 | 3300025919 | Bacteria | 3976 |
| 387 | Ga0207657_10050430 | 3300025919 | Bacteria | 3623 |
| 388 | Ga0207649_10010529 | 3300025920 | Bacteria | 5084 |
| 389 | Ga0207652_10124500 | 3300025921 | Bacteria | 2296 |
| 390 | Ga0207652_10442566 | 3300025921 | Bacteria | 1172 |
| 391 | Ga0207646_10594937 | 3300025922 | Bacteria | 993 |
| 392 | Ga0207694_10000005 | 3300025924 | Bacteria | 823704 |
| 393 | Ga0207694_10005647 | 3300025924 | Bacteria | 9597 |
| 394 | Ga0207694_10057255 | 3300025924 | Bacteria | 3030 |
| 395 | Ga0207694_10145650 | 3300025924 | Bacteria | 1906 |
| 396 | Ga0207650_10029590 | 3300025925 | Bacteria | 3939 |
| 397 | Ga0207650_10053235 | 3300025925 | Bacteria | 2999 |
| 398 | Ga0207650_10064382 | 3300025925 | Bacteria | 2744 |
| 399 | Ga0207659_10274022 | 3300025926 | Bacteria | 1377 |
| 400 | Ga0207644_10013538 | 3300025931 | Bacteria | 5441 |
| 401 | Ga0207644_10017860 | 3300025931 | Bacteria | 4797 |
| 402 | Ga0207644_10132998 | 3300025931 | Bacteria | 1907 |
| 403 | Ga0207644_10489317 | 3300025931 | Bacteria | 1014 |
| 404 | Ga0207690_10043019 | 3300025932 | Bacteria | 2970 |
| 405 | Ga0207690_10139473 | 3300025932 | Bacteria | 1785 |
| 406 | Ga0207706_10045942 | 3300025933 | Bacteria | 3867 |
| 407 | Ga0207706_10115444 | 3300025933 | Bacteria | 2361 |
| 408 | Ga0207706_10195689 | 3300025933 | Bacteria | 1773 |
| 409 | Ga0207706_10241782 | 3300025933 | Bacteria | 1578 |
| 410 | Ga0207706_10279300 | 3300025933 | Bacteria | 1457 |
| 411 | Ga0207686_10030730 | 3300025934 | Bacteria | 3184 |
| 412 | Ga0207686_10102739 | 3300025934 | Bacteria | 1911 |
| 413 | Ga0207709_10034206 | 3300025935 | Bacteria | 2993 |
| 414 | Ga0207669_10154207 | 3300025937 | Bacteria | 1613 |
| 415 | Ga0207704_10021405 | 3300025938 | Bacteria | 3443 |
| 416 | Ga0207704_10092790 | 3300025938 | Bacteria | 1988 |
| 417 | Ga0207704_10106185 | 3300025938 | Bacteria | 1886 |
| 418 | Ga0207665_10422426 | 3300025939 | Bacteria | 1019 |
| 419 | Ga0207691_10005747 | 3300025940 | Bacteria | 12000 |
| 420 | Ga0207691_10006707 | 3300025940 | Bacteria | 11105 |
| 421 | Ga0207691_10021117 | 3300025940 | Bacteria | 6151 |
| 422 | Ga0207691_10046396 | 3300025940 | Bacteria | 3993 |
| 423 | Ga0207691_10235335 | 3300025940 | Bacteria | 1585 |
| 424 | Ga0207691_10293541 | 3300025940 | Bacteria | 1398 |
| 425 | Ga0207711_10008227 | 3300025941 | Bacteria | 8732 |
| 426 | Ga0207711_10160469 | 3300025941 | Bacteria | 2034 |
| 427 | Ga0207711_10399152 | 3300025941 | Bacteria | 1277 |
| 428 | Ga0207689_10101624 | 3300025942 | Bacteria | 2362 |
| 429 | Ga0207661_10008898 | 3300025944 | Bacteria | 7188 |
| 430 | Ga0207661_10410466 | 3300025944 | Bacteria | 1229 |
| 431 | Ga0207679_10009038 | 3300025945 | Bacteria | 6367 |
| 432 | Ga0207667_10000041 | 3300025949 | Bacteria | 272265 |
| 433 | Ga0207667_10004608 | 3300025949 | Bacteria | 16907 |
| 434 | Ga0207651_10138514 | 3300025960 | Bacteria | 1876 |
| 435 | Ga0207712_10076109 | 3300025961 | Bacteria | 2428 |
| 436 | Ga0207712_10083361 | 3300025961 | Bacteria | 2333 |
| 437 | Ga0207712_10218653 | 3300025961 | Bacteria | 1522 |
| 438 | Ga0207668_10037273 | 3300025972 | Bacteria | 3253 |
| 439 | Ga0207668_10192992 | 3300025972 | Bacteria | 1615 |
| 440 | Ga0207640_10076416 | 3300025981 | Bacteria | 2273 |
| 441 | Ga0207658_10019359 | 3300025986 | Bacteria | 4707 |
| 442 | Ga0207658_10432985 | 3300025986 | Bacteria | 1162 |
| 443 | Ga0207677_10139141 | 3300026023 | Unclassified | 1856 |
| 444 | Ga0207703_10005109 | 3300026035 | Bacteria | 10616 |
| 445 | Ga0207703_10416986 | 3300026035 | Bacteria | 1249 |
| 446 | Ga0207703_10458875 | 3300026035 | Bacteria | 1191 |
| 447 | Ga0207639_10116592 | 3300026041 | Bacteria | 2187 |
| 448 | Ga0207639_10151373 | 3300026041 | Bacteria | 1943 |
| 449 | Ga0207678_10090939 | 3300026067 | Bacteria | 2608 |
| 450 | Ga0207678_10165557 | 3300026067 | Bacteria | 1888 |
| 451 | Ga0207678_10333065 | 3300026067 | Bacteria | 1307 |
| 452 | Ga0207708_10086901 | 3300026075 | Bacteria | 2407 |
| 453 | Ga0207702_10075642 | 3300026078 | Bacteria | 2909 |
| 454 | Ga0207702_10196720 | 3300026078 | Bacteria | 1866 |
| 455 | Ga0207702_10297543 | 3300026078 | Bacteria | 1531 |
| 456 | Ga0207641_10002059 | 3300026088 | Bacteria | 19097 |
| 457 | Ga0207641_10094874 | 3300026088 | Bacteria | 2617 |
| 458 | Ga0207641_10247621 | 3300026088 | Bacteria | 1663 |
| 459 | Ga0207641_10449365 | 3300026088 | Bacteria | 1245 |
| 460 | Ga0207641_10608306 | 3300026088 | Bacteria | 1071 |
| 461 | Ga0207648_10013121 | 3300026089 | Bacteria | 7724 |
| 462 | Ga0207648_10092179 | 3300026089 | Bacteria | 2649 |
| 463 | Ga0207648_10168452 | 3300026089 | Bacteria | 1936 |
| 464 | Ga0207676_10177679 | 3300026095 | Bacteria | 1861 |
| 465 | Ga0207674_10010607 | 3300026116 | Bacteria | 10425 |
| 466 | Ga0207674_10067102 | 3300026116 | Bacteria | 3612 |
| 467 | Ga0207674_10114241 | 3300026116 | Bacteria | 2672 |
| 468 | Ga0207674_10393732 | 3300026116 | Bacteria | 1339 |
| 469 | Ga0207674_10660920 | 3300026116 | Bacteria | 1009 |
| 470 | Ga0207675_100000105 | 3300026118 | Bacteria | 67191 |
| 471 | Ga0207675_100008556 | 3300026118 | Bacteria | 9626 |
| 472 | Ga0207675_100032293 | 3300026118 | Bacteria | 4876 |
| 473 | Ga0207675_100152227 | 3300026118 | Bacteria | 2202 |
| 474 | Ga0207675_100900754 | 3300026118 | Bacteria | 901 |
| 475 | Ga0207675_100925587 | 3300026118 | Bacteria | 888 |
| 476 | Ga0207683_10069401 | 3300026121 | Bacteria | 3112 |
| 477 | Ga0207683_10127741 | 3300026121 | Bacteria | 2286 |
| 478 | Ga0207698_10004816 | 3300026142 | Bacteria | 8264 |
| 479 | Ga0207698_10007532 | 3300026142 | Bacteria | 6822 |
| 480 | Ga0210000_1028632 | 3300027462 | Bacteria | 867 |
| 481 | Ga0209179_1000051 | 3300027512 | Bacteria | 22662 |
| 482 | Ga0209982_1006246 | 3300027552 | Bacteria | 1731 |
| 483 | Ga0209588_1019505 | 3300027671 | Bacteria | 2117 |
| 484 | Ga0209971_1016335 | 3300027682 | Bacteria | 1760 |
| 485 | Ga0209998_10021740 | 3300027717 | Bacteria | 1379 |
| 486 | Ga0207428_10000336 | 3300027907 | Bacteria | 61182 |
| 487 | Ga0207428_10027041 | 3300027907 | Bacteria | 4778 |
| 488 | Ga0207428_10166364 | 3300027907 | Bacteria | 1672 |
| 489 | Ga0207428_10372081 | 3300027907 | Bacteria | 1049 |
| 490 | Ga0268266_10004864 | 3300028379 | Bacteria | 12745 |
| 491 | Ga0268266_10104295 | 3300028379 | Bacteria | 2503 |
| 492 | Ga0268265_10000554 | 3300028380 | Bacteria | 38099 |
| 493 | Ga0268265_10043693 | 3300028380 | Bacteria | 3333 |
| 494 | Ga0268265_10083441 | 3300028380 | Bacteria | 2530 |
| 495 | Ga0268264_10010310 | 3300028381 | Bacteria | 7732 |
| 496 | Ga0268264_10075873 | 3300028381 | Bacteria | 2859 |
| 497 | Ga0268264_10193905 | 3300028381 | Bacteria | 1854 |
| 498 | Ga0268264_10508480 | 3300028381 | Bacteria | 1176 |
| 499 | Ga0268264_10909220 | 3300028381 | Bacteria | 884 |
| 500 | Ga0307517_10138605 | 3300028786 | Bacteria | 1718 |
| 501 | Ga0307515_10000358 | 3300028794 | Bacteria | 112133 |
| 502 | Ga0307515_10003592 | 3300028794 | Bacteria | 32598 |
| 503 | Ga0307515_10068791 | 3300028794 | Bacteria | 4856 |
| 504 | Ga0307515_10098920 | 3300028794 | Bacteria | 3547 |
| 505 | Ga0307511_10000260 | 3300030521 | Bacteria | 54540 |
| 506 | Ga0307511_10022959 | 3300030521 | Bacteria | 5829 |
| 507 | Ga0265770_1000368 | 3300030878 | Bacteria | 6101 |
| 508 | Ga0265760_10000354 | 3300031090 | Bacteria | 12825 |
| 509 | Ga0265340_10001593 | 3300031247 | Bacteria | 13018 |
| 510 | Ga0265316_10010858 | 3300031344 | Bacteria | 8269 |
| 511 | Ga0307513_10060565 | 3300031456 | Bacteria | 4013 |
| 512 | Ga0307509_10031569 | 3300031507 | Bacteria | 5849 |
| 513 | Ga0307408_100000076 | 3300031548 | Bacteria | 110987 |
| 514 | Ga0307408_100000936 | 3300031548 | Bacteria | 22717 |
| 515 | Ga0307408_100001516 | 3300031548 | Bacteria | 17276 |
| 516 | Ga0307408_100001827 | 3300031548 | Bacteria | 15510 |
| 517 | Ga0307408_100036171 | 3300031548 | Bacteria | 3470 |
| 518 | Ga0307408_100049655 | 3300031548 | Bacteria | 3014 |
| 519 | Ga0307408_100408391 | 3300031548 | Bacteria | 1168 |
| 520 | Ga0265314_10027975 | 3300031711 | Bacteria | 4212 |
| 521 | Ga0307516_10000678 | 3300031730 | Bacteria | 46164 |
| 522 | Ga0307516_10144758 | 3300031730 | Bacteria | 2142 |
| 523 | Ga0307405_10006554 | 3300031731 | Bacteria | 5736 |
| 524 | Ga0307405_10062255 | 3300031731 | Bacteria | 2362 |
| 525 | Ga0307413_10046651 | 3300031824 | Bacteria | 2578 |
| 526 | Ga0307410_10007781 | 3300031852 | Bacteria | 5892 |
| 527 | Ga0307406_10000321 | 3300031901 | Bacteria | 27859 |
| 528 | Ga0307406_10010098 | 3300031901 | Bacteria | 5318 |
| 529 | Ga0307406_10010348 | 3300031901 | Bacteria | 5257 |
| 530 | Ga0307407_10017795 | 3300031903 | Bacteria | 3577 |
| 531 | Ga0307407_10035454 | 3300031903 | Bacteria | 2741 |
| 532 | Ga0307412_10003280 | 3300031911 | Bacteria | 8981 |
| 533 | Ga0307412_10296339 | 3300031911 | Bacteria | 1276 |
| 534 | Ga0307412_10609069 | 3300031911 | Bacteria | 926 |
| 535 | Ga0307409_100022869 | 3300031995 | Bacteria | 4317 |
| 536 | Ga0307409_100050842 | 3300031995 | Bacteria | 3168 |
| 537 | Ga0307409_100061382 | 3300031995 | Bacteria | 2937 |
| 538 | Ga0307416_100226811 | 3300032002 | Bacteria | 1797 |
| 539 | Ga0307416_100325315 | 3300032002 | Bacteria | 1542 |
| 540 | Ga0307414_10295198 | 3300032004 | Bacteria | 1368 |
| 541 | Ga0307411_10000884 | 3300032005 | Bacteria | 11352 |
| 542 | Ga0307411_10002614 | 3300032005 | Bacteria | 8050 |
| 543 | Ga0307411_10009738 | 3300032005 | Bacteria | 5076 |
| 544 | Ga0307411_10011406 | 3300032005 | Bacteria | 4796 |
| 545 | Ga0307411_10110195 | 3300032005 | Bacteria | 1968 |
| 546 | Ga0307411_10749658 | 3300032005 | Bacteria | 855 |
| 547 | Ga0307415_100015070 | 3300032126 | Bacteria | 4566 |
| 548 | Ga0307415_100117423 | 3300032126 | Bacteria | 1987 |
| 549 | Ga0373959_0004980 | 3300034820 | Bacteria | 2167 |
| 550 | Ga0373940_0001957 | 3300035088 | Bacteria | 3888 |
| 551 | Ga0373939_0000534 | 3300035114 | Bacteria | 9569 |
| 552 | Ga0373939_0017039 | 3300035114 | Bacteria | 1925 |
| 553 | Ga0373943_0016546 | 3300035170 | Bacteria | 3365 |
| 554 | Ga0373955_0259144 | 3300035172 | Bacteria | 1044 |
| 555 | Ga0373931_0000993 | 3300035691 | Bacteria | 11992 |
| 556 | Ga0373925_0019837 | 3300037068 | Bacteria | 4891 |
| 557 | Ga0373925_0135356 | 3300037068 | Bacteria | 1925 |
| 558 | Ga0395900_0188225 | 3300037418 | Bacteria | 2094 |
| 559 | Ga0395900_0280209 | 3300037418 | Bacteria | 1659 |
| 560 | Ga0395898_0017815 | 3300037466 | Bacteria | 7248 |
| 561 | Ga0395898_0263165 | 3300037466 | Bacteria | 1645 |
| 562 | Ga0395901_0025595 | 3300038443 | Bacteria | 6057 |
| 563 | Ga0436361_0136250 | 3300039447 | Bacteria | 5625 |
| 564 | Ga0436361_0264437 | 3300039447 | Bacteria | 60444 |
| 565 | Ga0436361_1082582 | 3300039447 | Bacteria | 32081 |
| 566 | Ga0451847_0648660 | 3300041503 | Bacteria | 1039 |
| 567 | Ga0451849_0265266 | 3300041505 | Bacteria | 6000 |
| 568 | Ga0451853_0496377 | 3300041512 | Bacteria | 8699 |
| 569 | Ga0451853_0713182 | 3300041512 | Bacteria | 1248 |
| 570 | Ga0439431_0001940 | 3300041997 | Bacteria | 4581 |
| 571 | Ga0439445_0005008 | 3300042004 | Bacteria | 3008 |
| 572 | Ga0439445_0005678 | 3300042004 | Bacteria | 2851 |
| 573 | Ga0439448_0002316 | 3300042005 | Bacteria | 5154 |
| 574 | Ga0439432_001055 | 3300042006 | Bacteria | 10477 |
| 575 | Ga0439449_0032722 | 3300042007 | Bacteria | 1938 |
| 576 | Ga0439455_0001981 | 3300042012 | Bacteria | 3617 |
| 577 | Ga0439462_0004063 | 3300042015 | Bacteria | 3549 |
| 578 | Ga0450911_014669 | 3300042115 | Bacteria | 1040 |
| 579 | Ga0450912_001028 | 3300042116 | Bacteria | 1596 |
| 580 | Ga0450888_002547 | 3300042126 | Bacteria | 1809 |
| 581 | Ga0450890_001913 | 3300042127 | Bacteria | 2947 |
| 582 | Ga0450891_000388 | 3300042129 | Bacteria | 4601 |
| 583 | Ga0450892_000867 | 3300042130 | Bacteria | 3288 |
| 584 | Ga0450898_000813 | 3300042134 | Bacteria | 3864 |
| 585 | Ga0450903_005968 | 3300042138 | Bacteria | 2033 |
| 586 | Ga0450889_000728 | 3300042144 | Bacteria | 3537 |
| 587 | Ga0439458_0005193 | 3300042157 | Bacteria | 2932 |
| 588 | Ga0439458_0032609 | 3300042157 | Bacteria | 1246 |
| 589 | Ga0439434_0001142 | 3300042435 | Bacteria | 7677 |
| 590 | Ga0450893_0019236 | 3300042532 | Bacteria | 1167 |
| 591 | Ga0451577_0005324 | 3300042876 | Bacteria | 13223 |
| 592 | Ga0466969_0000005 | 3300044656 | Bacteria | 167170 |
| 593 | Ga0466969_0005826 | 3300044656 | Bacteria | 6548 |
| 594 | Ga0466969_0058212 | 3300044656 | Bacteria | 1881 |
| 595 | Ga0466972_0000106 | 3300044658 | Bacteria | 72246 |
| 596 | Ga0466982_0015008 | 3300044672 | Bacteria | 4221 |
| 597 | Ga0453683_0002236 | 3300044673 | Bacteria | 15304 |
| 598 | Ga0466965_0000091 | 3300044683 | Bacteria | 26412 |
| 599 | Ga0466965_0001063 | 3300044683 | Bacteria | 10654 |
| 600 | Ga0466965_0041189 | 3300044683 | Bacteria | 2275 |
| 601 | Ga0466966_0000955 | 3300044684 | Bacteria | 18511 |
| 602 | Ga0466966_0001186 | 3300044684 | Bacteria | 16728 |
| 603 | Ga0466966_0028121 | 3300044684 | Bacteria | 3663 |
| 604 | Ga0466961_0010937 | 3300044693 | Bacteria | 5797 |
| 605 | Ga0466961_0017431 | 3300044693 | Bacteria | 4613 |
| 606 | Ga0466961_0056893 | 3300044693 | Bacteria | 2491 |
| 607 | Ga0466961_0164015 | 3300044693 | Bacteria | 1384 |
| 608 | Ga0466963_0027954 | 3300044694 | Bacteria | 3616 |
| 609 | Ga0466963_0213204 | 3300044694 | Bacteria | 1352 |
| 610 | Ga0466963_0265594 | 3300044694 | Bacteria | 1205 |
| 611 | Ga0466964_0001409 | 3300044706 | Bacteria | 8206 |
| 612 | Ga0466964_0002828 | 3300044706 | Bacteria | 6253 |
| 613 | Ga0466964_0003102 | 3300044706 | Bacteria | 6046 |
| 614 | Ga0466964_0013712 | 3300044706 | Bacteria | 3075 |
| 615 | Ga0466964_0018958 | 3300044706 | Bacteria | 2643 |
| 616 | Ga0453684_0010080 | 3300044712 | Bacteria | 16237 |
| 617 | Ga0466971_0000535 | 3300044719 | Bacteria | 15053 |
| 618 | Ga0466971_0009762 | 3300044719 | Bacteria | 4190 |
| 619 | Ga0466968_0006005 | 3300044735 | Bacteria | 4556 |
| 620 | Ga0466968_0021144 | 3300044735 | Bacteria | 2633 |
| 621 | Ga0466968_0192889 | 3300044735 | Bacteria | 951 |
| 622 | Ga0466970_0002673 | 3300044765 | Bacteria | 8600 |
| 623 | Ga0466970_0006799 | 3300044765 | Bacteria | 5726 |
| 624 | Ga0466970_0083921 | 3300044765 | Bacteria | 1724 |
| 625 | Ga0466970_0132273 | 3300044765 | Bacteria | 1371 |
| 626 | Ga0466970_0140398 | 3300044765 | Bacteria | 1330 |
| 627 | Ga0466957_0002468 | 3300044842 | Bacteria | 9934 |
| 628 | Ga0466957_0015984 | 3300044842 | Bacteria | 4386 |
| 629 | Ga0466960_0113285 | 3300044901 | Bacteria | 1412 |
| 630 | Ga0466959_0010650 | 3300045049 | Bacteria | 6584 |
| 631 | Ga0466959_0013362 | 3300045049 | Bacteria | 5952 |
| 632 | Ga0466959_0068087 | 3300045049 | Bacteria | 2580 |
| 633 | Ga0451576_0021732 | 3300045051 | Bacteria | 6967 |
| 634 | Ga0451576_0058062 | 3300045051 | Bacteria | 4044 |
| 635 | Ga0466958_0275115 | 3300045836 | Bacteria | 1079 |
| 636 | Ga0466967_0013916 | 3300045976 | Bacteria | 6241 |
| 637 | Ga0466967_0014787 | 3300045976 | Bacteria | 6096 |
| 638 | Ga0495617_005190 | 3300046452 | Bacteria | 4649 |
| 639 | Ga0495627_018520 | 3300046453 | Bacteria | 2346 |
| 640 | Ga0495603_0282698 | 3300046455 | Bacteria | 954 |
| 641 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 642 | Ga0495590_0010101 | 3300046457 | Bacteria | 3563 |
| 643 | Ga0495590_0035151 | 3300046457 | Bacteria | 1750 |
| 644 | Ga0495638_0000086 | 3300046460 | Bacteria | 152781 |
| 645 | Ga0495638_0000350 | 3300046460 | Bacteria | 57915 |
| 646 | Ga0495638_0014595 | 3300046460 | Bacteria | 5302 |
| 647 | Ga0495638_0014709 | 3300046460 | Bacteria | 5278 |
| 648 | Ga0495638_0019958 | 3300046460 | Bacteria | 4431 |
| 649 | Ga0495638_0020072 | 3300046460 | Bacteria | 4417 |
| 650 | Ga0495638_0028670 | 3300046460 | Bacteria | 3592 |
| 651 | Ga0495638_0176500 | 3300046460 | Bacteria | 1222 |
| 652 | Ga0495650_0000118 | 3300046471 | Bacteria | 187358 |
| 653 | Ga0495650_0000891 | 3300046471 | Bacteria | 35192 |
| 654 | Ga0495650_0001458 | 3300046471 | Bacteria | 22665 |
| 655 | Ga0495605_0000168 | 3300046474 | Bacteria | 82889 |
| 656 | Ga0495605_0019305 | 3300046474 | Bacteria | 3644 |
| 657 | Ga0495605_0122918 | 3300046474 | Bacteria | 1175 |
| 658 | Ga0495639_0007427 | 3300046475 | Bacteria | 4705 |
| 659 | Ga0495584_0000010 | 3300046491 | Bacteria | 225095 |
| 660 | Ga0495584_0028771 | 3300046491 | Bacteria | 2817 |
| 661 | Ga0495584_0040472 | 3300046491 | Bacteria | 2353 |
| 662 | Ga0495584_0067677 | 3300046491 | Bacteria | 1794 |
| 663 | Ga0495584_0246846 | 3300046491 | Bacteria | 907 |
| 664 | Ga0495585_0000004 | 3300046492 | Bacteria | 348260 |
| 665 | Ga0495585_0001618 | 3300046492 | Bacteria | 17318 |
| 666 | Ga0495585_0010200 | 3300046492 | Bacteria | 5608 |
| 667 | Ga0495585_0023561 | 3300046492 | Bacteria | 3532 |
| 668 | Ga0495596_0001315 | 3300046500 | Bacteria | 14321 |
| 669 | Ga0495596_0120301 | 3300046500 | Bacteria | 1019 |
| 670 | Ga0495607_0000958 | 3300046501 | Bacteria | 26666 |
| 671 | Ga0495607_0002458 | 3300046501 | Bacteria | 15061 |
| 672 | Ga0495607_0023658 | 3300046501 | Bacteria | 3842 |
| 673 | Ga0495607_0043655 | 3300046501 | Bacteria | 2649 |
| 674 | Ga0495607_0212527 | 3300046501 | Bacteria | 951 |
| 675 | Ga0495583_0000084 | 3300046506 | Bacteria | 165375 |
| 676 | Ga0495583_0000532 | 3300046506 | Bacteria | 53953 |
| 677 | Ga0495583_0019922 | 3300046506 | Bacteria | 3490 |
| 678 | Ga0495606_0000064 | 3300046507 | Bacteria | 183631 |
| 679 | Ga0495606_0000451 | 3300046507 | Bacteria | 67193 |
| 680 | Ga0495606_0001143 | 3300046507 | Bacteria | 37675 |
| 681 | Ga0495606_0002544 | 3300046507 | Bacteria | 20979 |
| 682 | Ga0495606_0004112 | 3300046507 | Bacteria | 14780 |
| 683 | Ga0495606_0007012 | 3300046507 | Bacteria | 10225 |
| 684 | Ga0495606_0012451 | 3300046507 | Bacteria | 6818 |
| 685 | Ga0495606_0141829 | 3300046507 | Bacteria | 1418 |
| 686 | Ga0495606_0202092 | 3300046507 | Bacteria | 1131 |
| 687 | Ga0495610_0002903 | 3300046512 | Bacteria | 13870 |
| 688 | Ga0495610_0011359 | 3300046512 | Bacteria | 5452 |
| 689 | Ga0495610_0049968 | 3300046512 | Bacteria | 2044 |
| 690 | Ga0495610_0111048 | 3300046512 | Bacteria | 1214 |
| 691 | Ga0495616_0000344 | 3300046513 | Bacteria | 36907 |
| 692 | Ga0495616_0001031 | 3300046513 | Bacteria | 19971 |
| 693 | Ga0495616_0011373 | 3300046513 | Bacteria | 5105 |
| 694 | Ga0495616_0035441 | 3300046513 | Bacteria | 2582 |
| 695 | Ga0495616_0119360 | 3300046513 | Bacteria | 1219 |
| 696 | Ga0495631_0007133 | 3300046518 | Bacteria | 5711 |
| 697 | Ga0495631_0010371 | 3300046518 | Bacteria | 4612 |
| 698 | Ga0495631_0023975 | 3300046518 | Bacteria | 2822 |
| 699 | Ga0495632_0006637 | 3300046519 | Bacteria | 7402 |
| 700 | Ga0495632_0034251 | 3300046519 | Bacteria | 2601 |
| 701 | Ga0495637_0002319 | 3300046520 | Bacteria | 10530 |
| 702 | Ga0495643_0000123 | 3300046522 | Bacteria | 124936 |
| 703 | Ga0495643_0000603 | 3300046522 | Bacteria | 43324 |
| 704 | Ga0495643_0004621 | 3300046522 | Bacteria | 9584 |
| 705 | Ga0495643_0079979 | 3300046522 | Bacteria | 1702 |
| 706 | Ga0495643_0080583 | 3300046522 | Bacteria | 1694 |
| 707 | Ga0495644_0026437 | 3300046523 | Bacteria | 2202 |
| 708 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 709 | Ga0495648_0000007 | 3300046524 | Bacteria | 347305 |
| 710 | Ga0495648_0002814 | 3300046524 | Bacteria | 15649 |
| 711 | Ga0495648_0015680 | 3300046524 | Bacteria | 5489 |
| 712 | Ga0495642_0000715 | 3300046528 | Bacteria | 16522 |
| 713 | Ga0495642_0006269 | 3300046528 | Bacteria | 4564 |
| 714 | Ga0495642_0014751 | 3300046528 | Bacteria | 3031 |
| 715 | Ga0495654_0120518 | 3300046530 | Bacteria | 1188 |
| 716 | Ga0495654_0169673 | 3300046530 | Bacteria | 952 |
| 717 | Ga0495609_0000250 | 3300046538 | Bacteria | 50865 |
| 718 | Ga0495609_0000444 | 3300046538 | Bacteria | 34134 |
| 719 | Ga0495609_0002728 | 3300046538 | Bacteria | 10651 |
| 720 | Ga0495609_0010584 | 3300046538 | Bacteria | 4420 |
| 721 | Ga0495609_0012550 | 3300046538 | Bacteria | 4017 |
| 722 | Ga0495609_0023686 | 3300046538 | Bacteria | 2820 |
| 723 | Ga0495597_0000208 | 3300046542 | Bacteria | 53439 |
| 724 | Ga0495597_0000419 | 3300046542 | Bacteria | 36574 |
| 725 | Ga0495597_0038714 | 3300046542 | Bacteria | 2136 |
| 726 | Ga0495597_0049354 | 3300046542 | Bacteria | 1860 |
| 727 | Ga0495597_0053297 | 3300046542 | Bacteria | 1779 |
| 728 | Ga0495597_0110686 | 3300046542 | Bacteria | 1151 |
| 729 | Ga0495597_0121928 | 3300046542 | Bacteria | 1086 |
| 730 | Ga0495622_0000028 | 3300046557 | Bacteria | 133197 |
| 731 | Ga0495622_0000223 | 3300046557 | Bacteria | 44967 |
| 732 | Ga0495622_0020952 | 3300046557 | Bacteria | 3044 |
| 733 | Ga0495622_0032111 | 3300046557 | Bacteria | 2452 |
| 734 | Ga0495633_0000272 | 3300046558 | Bacteria | 60512 |
| 735 | Ga0495633_0000390 | 3300046558 | Bacteria | 46254 |
| 736 | Ga0495633_0000528 | 3300046558 | Bacteria | 38185 |
| 737 | Ga0495633_0000908 | 3300046558 | Bacteria | 25245 |
| 738 | Ga0495633_0063448 | 3300046558 | Bacteria | 1729 |
| 739 | Ga0495656_0000303 | 3300046615 | Bacteria | 17067 |
| 740 | Ga0495668_0000006 | 3300046616 | Bacteria | 553404 |
| 741 | Ga0495668_0000533 | 3300046616 | Bacteria | 47352 |
| 742 | Ga0495668_0001777 | 3300046616 | Bacteria | 19707 |
| 743 | Ga0495668_0014988 | 3300046616 | Bacteria | 4535 |
| 744 | Ga0495668_0040073 | 3300046616 | Bacteria | 2613 |
| 745 | Ga0495668_0049414 | 3300046616 | Bacteria | 2333 |
| 746 | Ga0495668_0056455 | 3300046616 | Bacteria | 2167 |
| 747 | Ga0495668_0111350 | 3300046616 | Bacteria | 1497 |
| 748 | Ga0495611_0004369 | 3300046648 | Bacteria | 6126 |
| 749 | Ga0495611_0157734 | 3300046648 | Bacteria | 1060 |
| 750 | Ga0495625_0000318 | 3300046660 | Bacteria | 73498 |
| 751 | Ga0495625_0000480 | 3300046660 | Bacteria | 59788 |
| 752 | Ga0495625_0018179 | 3300046660 | Bacteria | 5494 |
| 753 | Ga0495625_0020750 | 3300046660 | Bacteria | 5065 |
| 754 | Ga0495625_0045672 | 3300046660 | Bacteria | 3164 |
| 755 | Ga0495625_0050310 | 3300046660 | Bacteria | 2991 |
| 756 | Ga0495625_0069597 | 3300046660 | Bacteria | 2472 |
| 757 | Ga0495625_0180154 | 3300046660 | Bacteria | 1406 |
| 758 | Ga0495659_0005351 | 3300046664 | Bacteria | 4037 |
| 759 | Ga0495661_0002540 | 3300046665 | Bacteria | 14001 |
| 760 | Ga0495661_0005328 | 3300046665 | Bacteria | 9150 |
| 761 | Ga0495661_0024111 | 3300046665 | Bacteria | 3940 |
| 762 | Ga0495661_0034274 | 3300046665 | Bacteria | 3195 |
| 763 | Ga0495661_0162676 | 3300046665 | Bacteria | 1196 |
| 764 | Ga0495588_0064020 | 3300046674 | Bacteria | 1907 |
| 765 | Ga0495588_0165978 | 3300046674 | Bacteria | 1167 |
| 766 | Ga0495588_0232553 | 3300046674 | Bacteria | 972 |
| 767 | Ga0495670_0036579 | 3300046691 | Bacteria | 2446 |
| 768 | Ga0495670_0064437 | 3300046691 | Bacteria | 1846 |
| 769 | Ga0495670_0081718 | 3300046691 | Bacteria | 1646 |
| 770 | Ga0495670_0135354 | 3300046691 | Bacteria | 1286 |
| 771 | Ga0495671_0016085 | 3300046692 | Bacteria | 4000 |
| 772 | Ga0495671_0017712 | 3300046692 | Bacteria | 3789 |
| 773 | Ga0495649_0019717 | 3300046694 | Bacteria | 3786 |
| 774 | Ga0495649_0027532 | 3300046694 | Bacteria | 3153 |
| 775 | Ga0495649_0099329 | 3300046694 | Bacteria | 1548 |
| 776 | Ga0495649_0146971 | 3300046694 | Bacteria | 1239 |
| 777 | Ga0495649_0191458 | 3300046694 | Bacteria | 1065 |
| 778 | Ga0495589_0000376 | 3300046794 | Bacteria | 34281 |
| 779 | Ga0495589_0010597 | 3300046794 | Bacteria | 4794 |
| 780 | Ga0495660_0035867 | 3300046810 | Bacteria | 2768 |
| 781 | Ga0495660_0087708 | 3300046810 | Bacteria | 1622 |
| 782 | Ga0495581_0015444 | 3300047315 | Bacteria | 4433 |
| 783 | Ga0495604_0020386 | 3300047317 | Bacteria | 5295 |
| 784 | Ga0495672_0000429 | 3300047320 | Bacteria | 50347 |
| 785 | Ga0495672_0083853 | 3300047320 | Bacteria | 1769 |
| 786 | Ga0495672_0091994 | 3300047320 | Bacteria | 1663 |
| 787 | Ga0495680_0293573 | 3300047322 | Bacteria | 1143 |
| 788 | Ga0495683_0023317 | 3300047323 | Bacteria | 3180 |
| 789 | Ga0495687_000054 | 3300047443 | Bacteria | 194607 |
| 790 | Ga0495687_000779 | 3300047443 | Bacteria | 34361 |
| 791 | Ga0495687_000817 | 3300047443 | Bacteria | 33358 |
| 792 | Ga0495687_064590 | 3300047443 | Bacteria | 1493 |
| 793 | Ga0495677_0000012 | 3300047445 | Bacteria | 146763 |
| 794 | Ga0495677_0006316 | 3300047445 | Bacteria | 4476 |
| 795 | Ga0495677_0037851 | 3300047445 | Bacteria | 1762 |
| 796 | Ga0495677_0040610 | 3300047445 | Bacteria | 1701 |
| 797 | Ga0495677_0111423 | 3300047445 | Bacteria | 1040 |
| 798 | Ga0495679_016243 | 3300047446 | Bacteria | 2697 |
| 799 | Ga0495685_027116 | 3300047447 | Bacteria | 1970 |
| 800 | Ga0495681_0009145 | 3300047470 | Bacteria | 6132 |
| 801 | Ga0495681_0059052 | 3300047470 | Bacteria | 1775 |
| 802 | Ga0495686_0020170 | 3300047472 | Bacteria | 4447 |
| 803 | Ga0495686_0130037 | 3300047472 | Bacteria | 1494 |
| 804 | Ga0495686_0131234 | 3300047472 | Bacteria | 1485 |
| 805 | Ga0495626_0002106 | 3300048091 | Bacteria | 14464 |
| 806 | Ga0495626_0025644 | 3300048091 | Bacteria | 2880 |
| 807 | Ga0495626_0079012 | 3300048091 | Bacteria | 1464 |
| 808 | Ga0496100_0282290 | 3300048903 | Bacteria | 1238 |
| 809 | Ga0496102_0002316 | 3300048905 | Bacteria | 16258 |
| 810 | Ga0496102_0091702 | 3300048905 | Bacteria | 2813 |
| 811 | Ga0496102_0176673 | 3300048905 | Bacteria | 2011 |
| 812 | Ga0496103_0108383 | 3300048906 | Bacteria | 1763 |
| 813 | Ga0496104_0012260 | 3300048907 | Bacteria | 7703 |
| 814 | Ga0496105_0000979 | 3300048908 | Bacteria | 19645 |
| 815 | Ga0496109_0166548 | 3300048912 | Bacteria | 2067 |
| 816 | Ga0496111_0189330 | 3300048914 | Bacteria | 1530 |
| 817 | Ga0496112_0045626 | 3300048915 | Bacteria | 4297 |
| 818 | Ga0496113_0215457 | 3300048916 | Bacteria | 1529 |
| 819 | Ga0496114_0014851 | 3300048917 | Bacteria | 6258 |
| 820 | Ga0496114_0173236 | 3300048917 | Bacteria | 1882 |
| 821 | Ga0496115_0008139 | 3300048918 | Bacteria | 7746 |
| 822 | Ga0496115_0009205 | 3300048918 | Bacteria | 7332 |
| 823 | Ga0496121_0006502 | 3300048924 | Bacteria | 14456 |
| 824 | Ga0496122_0018277 | 3300048925 | Bacteria | 6489 |
| 825 | Ga0496123_0015723 | 3300048926 | Bacteria | 6190 |
| 826 | Ga0496124_0028236 | 3300048927 | Bacteria | 5022 |
| 827 | Ga0496124_0059867 | 3300048927 | Bacteria | 3197 |
| 828 | Ga0496125_0023876 | 3300048928 | Bacteria | 5634 |
| 829 | Ga0495678_000313 | 3300049459 | Bacteria | 51964 |
| 830 | Ga0495678_004914 | 3300049459 | Bacteria | 7554 |
| 831 | Ga0495682_0000775 | 3300049460 | Bacteria | 20330 |
| 832 | Ga0495682_0013628 | 3300049460 | Bacteria | 3092 |
| 833 | Ga0495682_0123480 | 3300049460 | Bacteria | 927 |
| 834 | Ga0501034_0150550 | 3300049571 | Bacteria | 2303 |
| 835 | Ga0501034_0173737 | 3300049571 | Bacteria | 2121 |
| 836 | Ga0501042_0161158 | 3300049578 | Bacteria | 1619 |
| 837 | Ga0501042_0377206 | 3300049578 | Bacteria | 1027 |
| 838 | Ga0501068_0001338 | 3300049584 | Bacteria | 13060 |
| 839 | Ga0501070_0017362 | 3300049586 | Bacteria | 6041 |
| 840 | Ga0501071_0009268 | 3300049587 | Bacteria | 6549 |
| 841 | Ga0501073_0006004 | 3300049589 | Bacteria | 9060 |
| 842 | Ga0501073_0103726 | 3300049589 | Bacteria | 1974 |
| 843 | Ga0501077_0239070 | 3300049593 | Bacteria | 1154 |
| 844 | Ga0501080_0009316 | 3300049742 | Bacteria | 8952 |
| 845 | Ga0501081_0109829 | 3300049743 | Bacteria | 1957 |
| 846 | Ga0501083_0063536 | 3300049744 | Bacteria | 2462 |
| 847 | Ga0501262_003322 | 3300049759 | Bacteria | 1839 |
| 848 | nmdc:mga03683_171805_c1 | 3300050489 | Bacteria | 985 |
| 849 | nmdc:mga0yw44_128417_c1 | 3300050492 | Bacteria | 1639 |
| 850 | nmdc:mga0k408_11650_c1 | 3300050493 | Bacteria | 4792 |
| 851 | nmdc:mga07m45_11077_c2 | 3300050496 | Bacteria | 2359 |
| 852 | nmdc:mga07m45_3734_c1 | 3300050496 | Bacteria | 7370 |
| 853 | nmdc:mga05p37_142741_c1 | 3300050507 | Bacteria | 2933 |
| 854 | nmdc:mga05p37_164319_c1 | 3300050507 | Bacteria | 2710 |
| 855 | nmdc:mga05p37_189147_c1 | 3300050507 | Bacteria | 2501 |
| 856 | nmdc:mga05p37_210095_c1 | 3300050507 | Bacteria | 2353 |
| 857 | nmdc:mga05p37_21554_c2 | 3300050507 | Bacteria | 5798 |
| 858 | nmdc:mga05p37_26674_c1 | 3300050507 | Bacteria | 7026 |
| 859 | nmdc:mga05p37_37384_c1 | 3300050507 | Bacteria | 5952 |
| 860 | nmdc:mga05p37_9416_c1 | 3300050507 | Bacteria | 11564 |
| 861 | nmdc:mga09592_209928_c1 | 3300050508 | Bacteria | 1687 |
| 862 | nmdc:mga09592_215924_c1 | 3300050508 | Bacteria | 1662 |
| 863 | nmdc:mga09592_8693_c1 | 3300050508 | Bacteria | 8261 |
| 864 | nmdc:mga0qj67_18796_c1 | 3300050509 | Bacteria | 5270 |
| 865 | nmdc:mga0qj67_205445_c1 | 3300050509 | Bacteria | 1600 |
| 866 | nmdc:mga0qj67_67446_c1 | 3300050509 | Bacteria | 2851 |
| 867 | nmdc:mga0qj67_75031_c1 | 3300050509 | Bacteria | 2703 |
| 868 | nmdc:mga06r32_127585_c1 | 3300050510 | Bacteria | 2514 |
| 869 | nmdc:mga06r32_17606_c1 | 3300050510 | Bacteria | 6526 |
| 870 | nmdc:mga06r32_252069_c1 | 3300050510 | Bacteria | 1753 |
| 871 | nmdc:mga06r32_35663_c1 | 3300050510 | Bacteria | 2983 |
| 872 | nmdc:mga06r32_4475_c1 | 3300050510 | Bacteria | 12519 |
| 873 | nmdc:mga06r32_699547_c1 | 3300050510 | Bacteria | 979 |
| 874 | nmdc:mga08y16_39163_c1 | 3300050511 | Bacteria | 4973 |
| 875 | nmdc:mga08y16_480949_c1 | 3300050511 | Bacteria | 1264 |
| 876 | nmdc:mga08y16_617137_c1 | 3300050511 | Bacteria | 1092 |
| 877 | nmdc:mga08y16_6759_c1 | 3300050511 | Bacteria | 12033 |
| 878 | nmdc:mga08y16_824_c1 | 3300050511 | Bacteria | 29748 |
| 879 | nmdc:mga08y16_86496_c1 | 3300050511 | Bacteria | 3267 |
| 880 | nmdc:mga0n895_172594_c1 | 3300050512 | Bacteria | 2194 |
| 881 | nmdc:mga0n895_205490_c1 | 3300050512 | Bacteria | 2000 |
| 882 | nmdc:mga0n895_35708_c1 | 3300050512 | Bacteria | 4794 |
| 883 | nmdc:mga0rr50_3726_c1 | 3300050513 | Bacteria | 8831 |
| 884 | nmdc:mga0a205_10890_c1 | 3300050515 | Bacteria | 8368 |
| 885 | nmdc:mga0a205_13539_c1 | 3300050515 | Bacteria | 7598 |
| 886 | nmdc:mga0a205_50861_c1 | 3300050515 | Bacteria | 4000 |
| 887 | nmdc:mga0a205_65721_c1 | 3300050515 | Bacteria | 3505 |
| 888 | nmdc:mga0a205_68177_c1 | 3300050515 | Bacteria | 3436 |
| 889 | nmdc:mga0a205_7269_c1 | 3300050515 | Bacteria | 10016 |
| 890 | Ga0500651_0328442 | 3300053093 | Bacteria | 872 |
| 891 | Ga0500641_0011703 | 3300053096 | Bacteria | 3190 |
| 892 | Ga0500555_012434 | 3300053103 | Bacteria | 2451 |
| 893 | Ga0500591_095109 | 3300053115 | Bacteria | 1289 |
| 894 | Ga0500655_005441 | 3300053133 | Bacteria | 2298 |
| 895 | Ga0500658_0002068 | 3300053134 | Bacteria | 7807 |
| 896 | Ga0500658_0029713 | 3300053134 | Bacteria | 2128 |
| 897 | Ga0500561_0066041 | 3300053137 | Bacteria | 1025 |
| 898 | Ga0500564_028213 | 3300053138 | Bacteria | 2585 |
| 899 | Ga0500586_000049 | 3300053145 | Bacteria | 20851 |
| 900 | Ga0500588_0000373 | 3300053146 | Bacteria | 6929 |
| 901 | Ga0500622_0002411 | 3300053156 | Bacteria | 13511 |
| 902 | Ga0500636_0003904 | 3300053177 | Bacteria | 8406 |
| 903 | Ga0500611_006847 | 3300053727 | Bacteria | 1683 |
| 904 | Ga0501084_0292993 | 3300054114 | Bacteria | 1374 |
| 905 | Ga0466962_0007150 | 3300061719 | Bacteria | 5347 |
| 906 | Ga0466962_0012908 | 3300061719 | Bacteria | 4017 |
| 907 | Ga0466962_0024933 | 3300061719 | Bacteria | 2871 |
| 908 | 2643744597 | 2643221544 | Bacteria | 5886209 |
| 909 | 2643787890 | 2643221554 | Bacteria | 6603920 |
| 910 | 2643800361 | 2643221556 | Bacteria | 7251154 |
| 911 | 2643934601 | 2643221585 | Bacteria | 5812563 |
| 912 | 2644219131 | 2643221639 | Bacteria | 6649903 |
| 913 | 2644255645 | 2643221646 | Bacteria | 6433402 |
| 914 | 2644303223 | 2643221654 | Bacteria | 5273570 |
| 915 | 2644316087 | 2643221656 | Bacteria | 5809961 |
| 916 | 2644470270 | 2643221684 | Bacteria | 7145183 |
| 917 | 2739054111 | 2738541337 | Bacteria | 6183410 |
| 918 | 2842717789 | 2842711865 | Bacteria | 7155354 |
| 919 | 2857563809 | 2857558681 | Bacteria | 6617694 |
| 920 | 8047678658 | 8047673197 | Bacteria | 7395230 |
| 921 | Ga0500583_0063513 | |||
| 922 | JGI25154J39366_1001224 | |||
| 923 | JGI25158J39367_1000466 | |||
| 924 | JGI25158J39367_1000534 | |||
| 925 | JGI25152J39213_1000105 | |||
| 926 | JGI25150J39212_1000943 | |||
| 927 | JGI25150J39212_1001335 | |||
| 928 | JGI25159J45721_1000922 | |||
| 929 | JGI25159J45721_1001932 | |||
| 930 | JGI25159J45721_1002414 | |||
| 931 | JGI25406J46586_10010080 | |||
| 932 | JGI25153J46596_10001671 | |||
| 933 | rootL2_10025624 | |||
| 934 | JGI25160J50197_1002498 | |||
| 935 | JGI25161J50226_1000852 | |||
| 936 | JGI25161J50226_1001208 | |||
| 937 | Ga0055539_1000424 | |||
| 938 | Ga0055533_1000053 | |||
| 939 | Ga0055525_1000004 | |||
| 940 | Ga0055535_1000231 | |||
| 941 | Ga0055529_1000146 | |||
| 942 | Ga0055529_1000385 | |||
| 943 | Ga0055529_1000410 | |||
| 944 | Ga0055526_1000121 | |||
| 945 | Ga0055526_1000136 | |||
| 946 | Ga0055526_1000152 | |||
| 947 | Ga0055526_1003133 | |||
| 948 | Ga0055537_1000099 | |||
| 949 | Ga0055537_1001156 | |||
| 950 | Ga0055524_1000222 | |||
| 951 | Ga0055524_1002051 | |||
| 952 | Ga0055524_1017502 | |||
| 953 | Ga0055534_1000023 | |||
| 954 | Ga0055534_1001189 | |||
| 955 | Ga0055528_1000119 | |||
| 956 | Ga0055528_1002187 | |||
| 957 | Ga0055530_10000125 | |||
| 958 | Ga0055530_10009012 | |||
| 959 | Ga0055530_10009038 | |||
| 960 | Ga0055531_10000019 | |||
| 961 | Ga0055531_10000577 | |||
| 962 | Ga0055531_10011253 | |||
| 963 | Ga0055543_1000072 | |||
| 964 | Ga0055543_1001583 | |||
| 965 | Ga0065165_1000039 | |||
| 966 | Ga0065165_1000269 | |||
| 967 | Ga0065707_10110726 | |||
| 968 | Ga0065707_10134002 | |||
| 969 | Ga0065707_10137714 | |||
| 970 | Ga0070658_10015986 | |||
| 971 | Ga0070658_10397369 | |||
| 972 | Ga0070676_10343378 | |||
| 973 | Ga0070676_10345944 | |||
| 974 | Ga0070683_100023859 | |||
| 975 | Ga0070683_100305645 | |||
| 976 | Ga0070670_100017935 | |||
| 977 | Ga0070670_100062682 | |||
| 978 | Ga0068869_100282140 | |||
| 979 | Ga0070666_10004170 | |||
| 980 | Ga0070680_100015253 | |||
| 981 | Ga0070680_100229986 | |||
| 982 | Ga0068868_100516988 | |||
| 983 | Ga0070660_100105712 | |||
| 984 | Ga0070689_100007082 | |||
| 985 | Ga0070691_10105251 | |||
| 986 | Ga0070691_10315439 | |||
| 987 | Ga0070661_100005584 | |||
| 988 | Ga0070692_10005578 | |||
| 989 | Ga0070668_100042596 | |||
| 990 | Ga0070669_100060057 | |||
| 991 | Ga0070669_100259013 | |||
| 992 | Ga0070675_100053133 | |||
| 993 | Ga0070675_100058423 | |||
| 994 | Ga0070675_100181916 | |||
| 995 | Ga0070671_100030234 | |||
| 996 | Ga0070671_100438432 | |||
| 997 | Ga0070674_100362137 | |||
| 998 | Ga0070673_100200178 | |||
| 999 | Ga0070659_100024389 | |||
| 1000 | Ga0070659_100037190 | |||
| 1001 | Ga0070659_100262255 | |||
| 1002 | Ga0070659_100321020 | |||
| 1003 | Ga0070667_100161787 | |||
| 1004 | Ga0070701_10004672 | |||
| 1005 | Ga0070701_10132198 | |||
| 1006 | Ga0070701_10469717 | |||
| 1007 | Ga0070711_100162786 | |||
| 1008 | Ga0070705_100018660 | |||
| 1009 | Ga0070705_100098734 | |||
| 1010 | Ga0070700_100078129 | |||
| 1011 | Ga0070700_100353671 | |||
| 1012 | Ga0070694_100010085 | |||
| 1013 | Ga0070694_100061184 | |||
| 1014 | Ga0070694_100428894 | |||
| 1015 | Ga0070678_100010891 | |||
| 1016 | Ga0070678_100012871 | |||
| 1017 | Ga0070678_100103578 | |||
| 1018 | Ga0070662_100254393 | |||
| 1019 | Ga0070662_100438393 | |||
| 1020 | Ga0070681_10176741 | |||
| 1021 | Ga0070681_10194675 | |||
| 1022 | Ga0068867_100030441 | |||
| 1023 | Ga0068867_100668330 | |||
| 1024 | Ga0068867_100789963 | |||
| 1025 | Ga0070685_10468655 | |||
| 1026 | Ga0070707_100298740 | |||
| 1027 | Ga0070698_100097943 | |||
| 1028 | Ga0070698_100582505 | |||
| 1029 | Ga0070679_100154176 | |||
| 1030 | Ga0070679_100493908 | |||
| 1031 | Ga0070684_100015656 | |||
| 1032 | Ga0070684_100045432 | |||
| 1033 | Ga0070697_100190836 | |||
| 1034 | Ga0070697_100778027 | |||
| 1035 | Ga0068853_100028936 | |||
| 1036 | Ga0070672_100022151 | |||
| 1037 | Ga0070672_100154663 | |||
| 1038 | Ga0070672_100185099 | |||
| 1039 | Ga0070672_100422105 | |||
| 1040 | Ga0070686_100035917 | |||
| 1041 | Ga0070686_100042747 | |||
| 1042 | Ga0070686_100087855 | |||
| 1043 | Ga0070695_100484018 | |||
| 1044 | Ga0070693_100017268 | |||
| 1045 | Ga0070693_100053573 | |||
| 1046 | Ga0070665_100003603 | |||
| 1047 | Ga0070665_100027519 | |||
| 1048 | Ga0070665_100299575 | |||
| 1049 | Ga0070704_100021477 | |||
| 1050 | Ga0070704_100034212 | |||
| 1051 | Ga0070704_100214547 | |||
| 1052 | Ga0070704_100438648 | |||
| 1053 | Ga0068855_100000063 | |||
| 1054 | Ga0068855_100009185 | |||
| 1055 | Ga0068855_100113713 | |||
| 1056 | Ga0068855_100164904 | |||
| 1057 | Ga0070664_100010472 | |||
| 1058 | Ga0070664_100014575 | |||
| 1059 | Ga0070664_100014919 | |||
| 1060 | Ga0070664_100089497 | |||
| 1061 | Ga0068857_100096315 | |||
| 1062 | Ga0068857_100521350 | |||
| 1063 | Ga0068854_100056508 | |||
| 1064 | Ga0068856_100003740 | |||
| 1065 | Ga0068856_100036785 | |||
| 1066 | Ga0070702_100000568 | |||
| 1067 | Ga0068852_100002933 | |||
| 1068 | Ga0068852_100012151 | |||
| 1069 | Ga0068859_100000441 | |||
| 1070 | Ga0068859_100003795 | |||
| 1071 | Ga0068859_100022271 | |||
| 1072 | Ga0068859_100025928 | |||
| 1073 | Ga0068859_100191375 | |||
| 1074 | Ga0068859_100459198 | |||
| 1075 | Ga0068859_100561160 | |||
| 1076 | Ga0068864_100048705 | |||
| 1077 | Ga0068864_100334450 | |||
| 1078 | Ga0068866_10163789 | |||
| 1079 | Ga0068861_100000008 | |||
| 1080 | Ga0068861_100115257 | |||
| 1081 | Ga0068861_100144959 | |||
| 1082 | Ga0068861_100424961 | |||
| 1083 | Ga0068861_100589324 | |||
| 1084 | Ga0068851_10010122 | |||
| 1085 | Ga0068863_100012404 | |||
| 1086 | Ga0068863_100014402 | |||
| 1087 | Ga0068863_100048554 | |||
| 1088 | Ga0068863_100216891 | |||
| 1089 | Ga0068858_100002170 | |||
| 1090 | Ga0068858_100064087 | |||
| 1091 | Ga0068858_100301281 | |||
| 1092 | Ga0068858_100742802 | |||
| 1093 | Ga0068860_100011984 | |||
| 1094 | Ga0068860_100107393 | |||
| 1095 | Ga0068860_100204460 | |||
| 1096 | Ga0068860_100219936 | |||
| 1097 | Ga0068860_100924484 | |||
| 1098 | Ga0068862_100020814 | |||
| 1099 | Ga0068862_100040994 | |||
| 1100 | Ga0068862_100350855 | |||
| 1101 | Ga0068862_100363470 | |||
| 1102 | Ga0081455_10002207 | |||
| 1103 | Ga0081455_10012865 | |||
| 1104 | Ga0081538_10030003 | |||
| 1105 | Ga0081539_10000028 | |||
| 1106 | Ga0070716_100061539 | |||
| 1107 | Ga0097621_100000841 | |||
| 1108 | Ga0097621_100022866 | |||
| 1109 | Ga0097621_100030587 | |||
| 1110 | Ga0097621_100541583 | |||
| 1111 | Ga0075370_10002481 | |||
| 1112 | Ga0068871_100000019 | |||
| 1113 | Ga0068871_100028262 | |||
| 1114 | Ga0068871_100031654 | |||
| 1115 | Ga0075428_100078847 | |||
| 1116 | Ga0075428_100092983 | |||
| 1117 | Ga0075428_100108639 | |||
| 1118 | Ga0075428_100448540 | |||
| 1119 | Ga0075428_100511036 | |||
| 1120 | Ga0075428_100609356 | |||
| 1121 | Ga0075428_100734809 | |||
| 1122 | Ga0075430_100010028 | |||
| 1123 | Ga0075430_100010127 | |||
| 1124 | Ga0075431_100003452 | |||
| 1125 | Ga0075433_10000411 | |||
| 1126 | Ga0075433_10003752 | |||
| 1127 | Ga0075433_10005518 | |||
| 1128 | Ga0075433_10036020 | |||
| 1129 | Ga0075433_10037238 | |||
| 1130 | Ga0075433_10105012 | |||
| 1131 | Ga0075434_100001953 | |||
| 1132 | Ga0075434_100154989 | |||
| 1133 | Ga0075434_100324508 | |||
| 1134 | Ga0075429_100008741 | |||
| 1135 | Ga0075429_100034820 | |||
| 1136 | Ga0075429_100036067 | |||
| 1137 | Ga0075429_100120324 | |||
| 1138 | Ga0068865_100080691 | |||
| 1139 | Ga0068865_100106730 | |||
| 1140 | Ga0068865_100129906 | |||
| 1141 | Ga0068865_100244313 | |||
| 1142 | Ga0068865_100524776 | |||
| 1143 | Ga0097620_100000441 | |||
| 1144 | Ga0097620_100003795 | |||
| 1145 | Ga0097620_100022271 | |||
| 1146 | Ga0097620_100025927 | |||
| 1147 | Ga0097620_100191380 | |||
| 1148 | Ga0097620_100459183 | |||
| 1149 | Ga0097620_100561214 | |||
| 1150 | Ga0075435_100015509 | |||
| 1151 | Ga0099795_10000067 | |||
| 1152 | Ga0105244_10012434 | |||
| 1153 | Ga0105240_10001628 | |||
| 1154 | Ga0105240_10007565 | |||
| 1155 | Ga0105240_10021958 | |||
| 1156 | Ga0105240_10131188 | |||
| 1157 | Ga0105240_10406884 | |||
| 1158 | Ga0105240_10443349 | |||
| 1159 | Ga0111539_10002045 | |||
| 1160 | Ga0111539_10002579 | |||
| 1161 | Ga0111539_10007328 | |||
| 1162 | Ga0111539_10013501 | |||
| 1163 | Ga0111539_10028444 | |||
| 1164 | Ga0111539_10149002 | |||
| 1165 | Ga0111539_10423880 | |||
| 1166 | Ga0111539_10441345 | |||
| 1167 | Ga0105245_10588831 | |||
| 1168 | Ga0105247_10000867 | |||
| 1169 | Ga0105247_10072183 | |||
| 1170 | Ga0105247_10126455 | |||
| 1171 | Ga0114129_10003612 | |||
| 1172 | Ga0114129_10009126 | |||
| 1173 | Ga0114129_10036200 | |||
| 1174 | Ga0114129_10055243 | |||
| 1175 | Ga0114129_10141465 | |||
| 1176 | Ga0114129_10263567 | |||
| 1177 | Ga0114129_10361398 | |||
| 1178 | Ga0114129_10398002 | |||
| 1179 | Ga0105243_10006083 | |||
| 1180 | Ga0105243_10052843 | |||
| 1181 | Ga0105243_10222627 | |||
| 1182 | Ga0105241_10024325 | |||
| 1183 | Ga0105241_10135604 | |||
| 1184 | Ga0105241_10148882 | |||
| 1185 | Ga0105242_10035918 | |||
| 1186 | Ga0105242_10199411 | |||
| 1187 | Ga0105248_10005552 | |||
| 1188 | Ga0105237_10090329 | |||
| 1189 | Ga0105237_10210934 | |||
| 1190 | Ga0105238_10005735 | |||
| 1191 | Ga0105238_10022723 | |||
| 1192 | Ga0105238_10144024 | |||
| 1193 | Ga0105238_10172259 | |||
| 1194 | Ga0105238_10244762 | |||
| 1195 | Ga0105249_10123845 | |||
| 1196 | Ga0105249_10239636 | |||
| 1197 | Ga0105249_10443150 | |||
| 1198 | Ga0105249_10719240 | |||
| 1199 | Ga0099796_10000050 | |||
| 1200 | Ga0105239_10003698 | |||
| 1201 | Ga0105239_10048257 | |||
| 1202 | Ga0105239_10448154 | |||
| 1203 | Ga0157373_10106539 | |||
| 1204 | Ga0157371_10379110 | |||
| 1205 | Ga0157370_10449027 | |||
| 1206 | Ga0157369_10007931 | |||
| 1207 | Ga0157369_10021678 | |||
| 1208 | Ga0157369_10041753 | |||
| 1209 | Ga0157369_10051231 | |||
| 1210 | Ga0157374_10078646 | |||
| 1211 | Ga0157374_10084191 | |||
| 1212 | Ga0157374_10519622 | |||
| 1213 | Ga0157378_10109210 | |||
| 1214 | Ga0163162_10000021 | |||
| 1215 | Ga0163162_10089481 | |||
| 1216 | Ga0157372_10006490 | |||
| 1217 | Ga0157372_10089173 | |||
| 1218 | Ga0157372_10346842 | |||
| 1219 | Ga0157372_10386870 | |||
| 1220 | Ga0157375_10012567 | |||
| 1221 | Ga0157375_10313699 | |||
| 1222 | Ga0157375_10707575 | |||
| 1223 | Ga0163163_10023119 | |||
| 1224 | Ga0157377_10000030 | |||
| 1225 | Ga0157379_10146708 | |||
| 1226 | Ga0157379_10165118 | |||
| 1227 | Ga0157376_10010196 | |||
| 1228 | Ga0213872_10000733 | |||
| 1229 | Ga0213872_10001492 | |||
| 1230 | Ga0213872_10032703 | |||
| 1231 | Ga0209436_100049 | |||
| 1232 | Ga0209436_100093 | |||
| 1233 | Ga0209436_112250 | |||
| 1234 | Ga0209674_100039 | |||
| 1235 | Ga0209563_100013 | |||
| 1236 | Ga0209563_100080 | |||
| 1237 | Ga0209437_108461 | |||
| 1238 | Ga0209258_100305 | |||
| 1239 | Ga0209258_100419 | |||
| 1240 | Ga0207425_1000001 | |||
| 1241 | Ga0207425_1000033 | |||
| 1242 | Ga0207425_1000536 | |||
| 1243 | Ga0209646_1000010 | |||
| 1244 | Ga0209646_1000249 | |||
| 1245 | Ga0209026_1000011 | |||
| 1246 | Ga0209677_100086 | |||
| 1247 | Ga0209677_100160 | |||
| 1248 | Ga0209759_1000034 | |||
| 1249 | Ga0209129_1000003 | |||
| 1250 | Ga0209129_1001164 | |||
| 1251 | Ga0209233_1000104 | |||
| 1252 | Ga0209565_1000003 | |||
| 1253 | Ga0209565_1000162 | |||
| 1254 | Ga0209565_1000305 | |||
| 1255 | Ga0209565_1000474 | |||
| 1256 | Ga0209565_1003162 | |||
| 1257 | Ga0209455_1000037 | |||
| 1258 | Ga0209455_1000053 | |||
| 1259 | Ga0209673_1000003 | |||
| 1260 | Ga0209673_1018570 | |||
| 1261 | Ga0209130_1000084 | |||
| 1262 | Ga0209130_1000236 | |||
| 1263 | Ga0209130_1001409 | |||
| 1264 | Ga0209675_1000003 | |||
| 1265 | Ga0209675_1001160 | |||
| 1266 | Ga0209025_1002882 | |||
| 1267 | Ga0209564_1000009 | |||
| 1268 | Ga0209564_1000012 | |||
| 1269 | Ga0209564_1000068 | |||
| 1270 | Ga0209564_1000748 | |||
| 1271 | Ga0209564_1006494 | |||
| 1272 | Ga0209758_1000041 | |||
| 1273 | Ga0209758_1001010 | |||
| 1274 | Ga0209050_1000010 | |||
| 1275 | Ga0209050_1000011 | |||
| 1276 | Ga0209050_1001581 | |||
| 1277 | Ga0209256_1000255 | |||
| 1278 | Ga0209256_1000295 | |||
| 1279 | Ga0209256_1000402 | |||
| 1280 | Ga0207426_1002123 | |||
| 1281 | Ga0207426_1016115 | |||
| 1282 | Ga0209051_1008346 | |||
| 1283 | Ga0209051_1013496 | |||
| 1284 | Ga0209257_1000003 | |||
| 1285 | Ga0209257_1000009 | |||
| 1286 | Ga0209257_1000117 | |||
| 1287 | Ga0209257_1006037 | |||
| 1288 | Ga0207642_10086036 | |||
| 1289 | Ga0207710_10000520 | |||
| 1290 | Ga0207645_10004509 | |||
| 1291 | Ga0207643_10009264 | |||
| 1292 | Ga0207643_10050180 | |||
| 1293 | Ga0207705_10270853 | |||
| 1294 | Ga0207705_10354108 | |||
| 1295 | Ga0207684_10483051 | |||
| 1296 | Ga0207654_10001508 | |||
| 1297 | Ga0207654_10136592 | |||
| 1298 | Ga0207654_10347936 | |||
| 1299 | Ga0207707_10274620 | |||
| 1300 | Ga0207695_10000003 | |||
| 1301 | Ga0207695_10102135 | |||
| 1302 | Ga0207695_10526231 | |||
| 1303 | Ga0207663_10026383 | |||
| 1304 | Ga0207660_10069659 | |||
| 1305 | Ga0207660_10117847 | |||
| 1306 | Ga0207657_10043116 | |||
| 1307 | Ga0207657_10050430 | |||
| 1308 | Ga0207649_10010529 | |||
| 1309 | Ga0207652_10124500 | |||
| 1310 | Ga0207652_10442566 | |||
| 1311 | Ga0207646_10594937 | |||
| 1312 | Ga0207694_10000005 | |||
| 1313 | Ga0207694_10005647 | |||
| 1314 | Ga0207694_10057255 | |||
| 1315 | Ga0207694_10145650 | |||
| 1316 | Ga0207650_10029590 | |||
| 1317 | Ga0207650_10053235 | |||
| 1318 | Ga0207650_10064382 | |||
| 1319 | Ga0207659_10274022 | |||
| 1320 | Ga0207644_10013538 | |||
| 1321 | Ga0207644_10017860 | |||
| 1322 | Ga0207644_10132998 | |||
| 1323 | Ga0207644_10489317 | |||
| 1324 | Ga0207690_10043019 | |||
| 1325 | Ga0207690_10139473 | |||
| 1326 | Ga0207706_10045942 | |||
| 1327 | Ga0207706_10115444 | |||
| 1328 | Ga0207706_10195689 | |||
| 1329 | Ga0207706_10241782 | |||
| 1330 | Ga0207706_10279300 | |||
| 1331 | Ga0207686_10030730 | |||
| 1332 | Ga0207686_10102739 | |||
| 1333 | Ga0207709_10034206 | |||
| 1334 | Ga0207669_10154207 | |||
| 1335 | Ga0207704_10021405 | |||
| 1336 | Ga0207704_10092790 | |||
| 1337 | Ga0207704_10106185 | |||
| 1338 | Ga0207665_10422426 | |||
| 1339 | Ga0207691_10005747 | |||
| 1340 | Ga0207691_10006707 | |||
| 1341 | Ga0207691_10021117 | |||
| 1342 | Ga0207691_10046396 | |||
| 1343 | Ga0207691_10235335 | |||
| 1344 | Ga0207691_10293541 | |||
| 1345 | Ga0207711_10008227 | |||
| 1346 | Ga0207711_10160469 | |||
| 1347 | Ga0207711_10399152 | |||
| 1348 | Ga0207689_10101624 | |||
| 1349 | Ga0207661_10008898 | |||
| 1350 | Ga0207661_10410466 | |||
| 1351 | Ga0207679_10009038 | |||
| 1352 | Ga0207667_10000041 | |||
| 1353 | Ga0207667_10004608 | |||
| 1354 | Ga0207651_10138514 | |||
| 1355 | Ga0207712_10076109 | |||
| 1356 | Ga0207712_10083361 | |||
| 1357 | Ga0207712_10218653 | |||
| 1358 | Ga0207668_10037273 | |||
| 1359 | Ga0207668_10192992 | |||
| 1360 | Ga0207640_10076416 | |||
| 1361 | Ga0207658_10019359 | |||
| 1362 | Ga0207658_10432985 | |||
| 1363 | Ga0207677_10139141 | |||
| 1364 | Ga0207703_10005109 | |||
| 1365 | Ga0207703_10416986 | |||
| 1366 | Ga0207703_10458875 | |||
| 1367 | Ga0207639_10116592 | |||
| 1368 | Ga0207639_10151373 | |||
| 1369 | Ga0207678_10090939 | |||
| 1370 | Ga0207678_10165557 | |||
| 1371 | Ga0207678_10333065 | |||
| 1372 | Ga0207708_10086901 | |||
| 1373 | Ga0207702_10075642 | |||
| 1374 | Ga0207702_10196720 | |||
| 1375 | Ga0207702_10297543 | |||
| 1376 | Ga0207641_10002059 | |||
| 1377 | Ga0207641_10094874 | |||
| 1378 | Ga0207641_10247621 | |||
| 1379 | Ga0207641_10449365 | |||
| 1380 | Ga0207641_10608306 | |||
| 1381 | Ga0207648_10013121 | |||
| 1382 | Ga0207648_10092179 | |||
| 1383 | Ga0207648_10168452 | |||
| 1384 | Ga0207676_10177679 | |||
| 1385 | Ga0207674_10010607 | |||
| 1386 | Ga0207674_10067102 | |||
| 1387 | Ga0207674_10114241 | |||
| 1388 | Ga0207674_10393732 | |||
| 1389 | Ga0207674_10660920 | |||
| 1390 | Ga0207675_100000105 | |||
| 1391 | Ga0207675_100008556 | |||
| 1392 | Ga0207675_100032293 | |||
| 1393 | Ga0207675_100152227 | |||
| 1394 | Ga0207675_100900754 | |||
| 1395 | Ga0207675_100925587 | |||
| 1396 | Ga0207683_10069401 | |||
| 1397 | Ga0207683_10127741 | |||
| 1398 | Ga0207698_10004816 | |||
| 1399 | Ga0207698_10007532 | |||
| 1400 | Ga0210000_1028632 | |||
| 1401 | Ga0209179_1000051 | |||
| 1402 | Ga0209982_1006246 | |||
| 1403 | Ga0209588_1019505 | |||
| 1404 | Ga0209971_1016335 | |||
| 1405 | Ga0209998_10021740 | |||
| 1406 | Ga0207428_10000336 | |||
| 1407 | Ga0207428_10027041 | |||
| 1408 | Ga0207428_10166364 | |||
| 1409 | Ga0207428_10372081 | |||
| 1410 | Ga0268266_10004864 | |||
| 1411 | Ga0268266_10104295 | |||
| 1412 | Ga0268265_10000554 | |||
| 1413 | Ga0268265_10043693 | |||
| 1414 | Ga0268265_10083441 | |||
| 1415 | Ga0268264_10010310 | |||
| 1416 | Ga0268264_10075873 | |||
| 1417 | Ga0268264_10193905 | |||
| 1418 | Ga0268264_10508480 | |||
| 1419 | Ga0268264_10909220 | |||
| 1420 | Ga0307517_10138605 | |||
| 1421 | Ga0307515_10000358 | |||
| 1422 | Ga0307515_10003592 | |||
| 1423 | Ga0307515_10068791 | |||
| 1424 | Ga0307515_10098920 | |||
| 1425 | Ga0307511_10000260 | |||
| 1426 | Ga0307511_10022959 | |||
| 1427 | Ga0265770_1000368 | |||
| 1428 | Ga0265760_10000354 | |||
| 1429 | Ga0265340_10001593 | |||
| 1430 | Ga0265316_10010858 | |||
| 1431 | Ga0307513_10060565 | |||
| 1432 | Ga0307509_10031569 | |||
| 1433 | Ga0307408_100000076 | |||
| 1434 | Ga0307408_100000936 | |||
| 1435 | Ga0307408_100001516 | |||
| 1436 | Ga0307408_100001827 | |||
| 1437 | Ga0307408_100036171 | |||
| 1438 | Ga0307408_100049655 | |||
| 1439 | Ga0307408_100408391 | |||
| 1440 | Ga0265314_10027975 | |||
| 1441 | Ga0307516_10000678 | |||
| 1442 | Ga0307516_10144758 | |||
| 1443 | Ga0307405_10006554 | |||
| 1444 | Ga0307405_10062255 | |||
| 1445 | Ga0307413_10046651 | |||
| 1446 | Ga0307410_10007781 | |||
| 1447 | Ga0307406_10000321 | |||
| 1448 | Ga0307406_10010098 | |||
| 1449 | Ga0307406_10010348 | |||
| 1450 | Ga0307407_10017795 | |||
| 1451 | Ga0307407_10035454 | |||
| 1452 | Ga0307412_10003280 | |||
| 1453 | Ga0307412_10296339 | |||
| 1454 | Ga0307412_10609069 | |||
| 1455 | Ga0307409_100022869 | |||
| 1456 | Ga0307409_100050842 | |||
| 1457 | Ga0307409_100061382 | |||
| 1458 | Ga0307416_100226811 | |||
| 1459 | Ga0307416_100325315 | |||
| 1460 | Ga0307414_10295198 | |||
| 1461 | Ga0307411_10000884 | |||
| 1462 | Ga0307411_10002614 | |||
| 1463 | Ga0307411_10009738 | |||
| 1464 | Ga0307411_10011406 | |||
| 1465 | Ga0307411_10110195 | |||
| 1466 | Ga0307411_10749658 | |||
| 1467 | Ga0307415_100015070 | |||
| 1468 | Ga0307415_100117423 | |||
| 1469 | Ga0373959_0004980 | |||
| 1470 | Ga0373940_0001957 | |||
| 1471 | Ga0373939_0000534 | |||
| 1472 | Ga0373939_0017039 | |||
| 1473 | Ga0373943_0016546 | |||
| 1474 | Ga0373955_0259144 | |||
| 1475 | Ga0373931_0000993 | |||
| 1476 | Ga0373925_0019837 | |||
| 1477 | Ga0373925_0135356 | |||
| 1478 | Ga0395900_0188225 | |||
| 1479 | Ga0395900_0280209 | |||
| 1480 | Ga0395898_0017815 | |||
| 1481 | Ga0395898_0263165 | |||
| 1482 | Ga0395901_0025595 | |||
| 1483 | Ga0436361_0136250 | |||
| 1484 | Ga0436361_0264437 | |||
| 1485 | Ga0436361_1082582 | |||
| 1486 | Ga0451847_0648660 | |||
| 1487 | Ga0451849_0265266 | |||
| 1488 | Ga0451853_0496377 | |||
| 1489 | Ga0451853_0713182 | |||
| 1490 | Ga0439431_0001940 | |||
| 1491 | Ga0439445_0005008 | |||
| 1492 | Ga0439445_0005678 | |||
| 1493 | Ga0439448_0002316 | |||
| 1494 | Ga0439432_001055 | |||
| 1495 | Ga0439449_0032722 | |||
| 1496 | Ga0439455_0001981 | |||
| 1497 | Ga0439462_0004063 | |||
| 1498 | Ga0450911_014669 | |||
| 1499 | Ga0450912_001028 | |||
| 1500 | Ga0450888_002547 | |||
| 1501 | Ga0450890_001913 | |||
| 1502 | Ga0450891_000388 | |||
| 1503 | Ga0450892_000867 | |||
| 1504 | Ga0450898_000813 | |||
| 1505 | Ga0450903_005968 | |||
| 1506 | Ga0450889_000728 | |||
| 1507 | Ga0439458_0005193 | |||
| 1508 | Ga0439458_0032609 | |||
| 1509 | Ga0439434_0001142 | |||
| 1510 | Ga0450893_0019236 | |||
| 1511 | Ga0451577_0005324 | |||
| 1512 | Ga0466969_0000005 | |||
| 1513 | Ga0466969_0005826 | |||
| 1514 | Ga0466969_0058212 | |||
| 1515 | Ga0466972_0000106 | |||
| 1516 | Ga0466982_0015008 | |||
| 1517 | Ga0453683_0002236 | |||
| 1518 | Ga0466965_0000091 | |||
| 1519 | Ga0466965_0001063 | |||
| 1520 | Ga0466965_0041189 | |||
| 1521 | Ga0466966_0000955 | |||
| 1522 | Ga0466966_0001186 | |||
| 1523 | Ga0466966_0028121 | |||
| 1524 | Ga0466961_0010937 | |||
| 1525 | Ga0466961_0017431 | |||
| 1526 | Ga0466961_0056893 | |||
| 1527 | Ga0466961_0164015 | |||
| 1528 | Ga0466963_0027954 | |||
| 1529 | Ga0466963_0213204 | |||
| 1530 | Ga0466963_0265594 | |||
| 1531 | Ga0466964_0001409 | |||
| 1532 | Ga0466964_0002828 | |||
| 1533 | Ga0466964_0003102 | |||
| 1534 | Ga0466964_0013712 | |||
| 1535 | Ga0466964_0018958 | |||
| 1536 | Ga0453684_0010080 | |||
| 1537 | Ga0466971_0000535 | |||
| 1538 | Ga0466971_0009762 | |||
| 1539 | Ga0466968_0006005 | |||
| 1540 | Ga0466968_0021144 | |||
| 1541 | Ga0466968_0192889 | |||
| 1542 | Ga0466970_0002673 | |||
| 1543 | Ga0466970_0006799 | |||
| 1544 | Ga0466970_0083921 | |||
| 1545 | Ga0466970_0132273 | |||
| 1546 | Ga0466970_0140398 | |||
| 1547 | Ga0466957_0002468 | |||
| 1548 | Ga0466957_0015984 | |||
| 1549 | Ga0466960_0113285 | |||
| 1550 | Ga0466959_0010650 | |||
| 1551 | Ga0466959_0013362 | |||
| 1552 | Ga0466959_0068087 | |||
| 1553 | Ga0451576_0021732 | |||
| 1554 | Ga0451576_0058062 | |||
| 1555 | Ga0466958_0275115 | |||
| 1556 | Ga0466967_0013916 | |||
| 1557 | Ga0466967_0014787 | |||
| 1558 | Ga0495617_005190 | |||
| 1559 | Ga0495627_018520 | |||
| 1560 | Ga0495603_0282698 | |||
| 1561 | Ga0495590_0000001 | |||
| 1562 | Ga0495590_0010101 | |||
| 1563 | Ga0495590_0035151 | |||
| 1564 | Ga0495638_0000086 | |||
| 1565 | Ga0495638_0000350 | |||
| 1566 | Ga0495638_0014595 | |||
| 1567 | Ga0495638_0014709 | |||
| 1568 | Ga0495638_0019958 | |||
| 1569 | Ga0495638_0020072 | |||
| 1570 | Ga0495638_0028670 | |||
| 1571 | Ga0495638_0176500 | |||
| 1572 | Ga0495650_0000118 | |||
| 1573 | Ga0495650_0000891 | |||
| 1574 | Ga0495650_0001458 | |||
| 1575 | Ga0495605_0000168 | |||
| 1576 | Ga0495605_0019305 | |||
| 1577 | Ga0495605_0122918 | |||
| 1578 | Ga0495639_0007427 | |||
| 1579 | Ga0495584_0000010 | |||
| 1580 | Ga0495584_0028771 | |||
| 1581 | Ga0495584_0040472 | |||
| 1582 | Ga0495584_0067677 | |||
| 1583 | Ga0495584_0246846 | |||
| 1584 | Ga0495585_0000004 | |||
| 1585 | Ga0495585_0001618 | |||
| 1586 | Ga0495585_0010200 | |||
| 1587 | Ga0495585_0023561 | |||
| 1588 | Ga0495596_0001315 | |||
| 1589 | Ga0495596_0120301 | |||
| 1590 | Ga0495607_0000958 | |||
| 1591 | Ga0495607_0002458 | |||
| 1592 | Ga0495607_0023658 | |||
| 1593 | Ga0495607_0043655 | |||
| 1594 | Ga0495607_0212527 | |||
| 1595 | Ga0495583_0000084 | |||
| 1596 | Ga0495583_0000532 | |||
| 1597 | Ga0495583_0019922 | |||
| 1598 | Ga0495606_0000064 | |||
| 1599 | Ga0495606_0000451 | |||
| 1600 | Ga0495606_0001143 | |||
| 1601 | Ga0495606_0002544 | |||
| 1602 | Ga0495606_0004112 | |||
| 1603 | Ga0495606_0007012 | |||
| 1604 | Ga0495606_0012451 | |||
| 1605 | Ga0495606_0141829 | |||
| 1606 | Ga0495606_0202092 | |||
| 1607 | Ga0495610_0002903 | |||
| 1608 | Ga0495610_0011359 | |||
| 1609 | Ga0495610_0049968 | |||
| 1610 | Ga0495610_0111048 | |||
| 1611 | Ga0495616_0000344 | |||
| 1612 | Ga0495616_0001031 | |||
| 1613 | Ga0495616_0011373 | |||
| 1614 | Ga0495616_0035441 | |||
| 1615 | Ga0495616_0119360 | |||
| 1616 | Ga0495631_0007133 | |||
| 1617 | Ga0495631_0010371 | |||
| 1618 | Ga0495631_0023975 | |||
| 1619 | Ga0495632_0006637 | |||
| 1620 | Ga0495632_0034251 | |||
| 1621 | Ga0495637_0002319 | |||
| 1622 | Ga0495643_0000123 | |||
| 1623 | Ga0495643_0000603 | |||
| 1624 | Ga0495643_0004621 | |||
| 1625 | Ga0495643_0079979 | |||
| 1626 | Ga0495643_0080583 | |||
| 1627 | Ga0495644_0026437 | |||
| 1628 | Ga0495648_0000001 | |||
| 1629 | Ga0495648_0000007 | |||
| 1630 | Ga0495648_0002814 | |||
| 1631 | Ga0495648_0015680 | |||
| 1632 | Ga0495642_0000715 | |||
| 1633 | Ga0495642_0006269 | |||
| 1634 | Ga0495642_0014751 | |||
| 1635 | Ga0495654_0120518 | |||
| 1636 | Ga0495654_0169673 | |||
| 1637 | Ga0495609_0000250 | |||
| 1638 | Ga0495609_0000444 | |||
| 1639 | Ga0495609_0002728 | |||
| 1640 | Ga0495609_0010584 | |||
| 1641 | Ga0495609_0012550 | |||
| 1642 | Ga0495609_0023686 | |||
| 1643 | Ga0495597_0000208 | |||
| 1644 | Ga0495597_0000419 | |||
| 1645 | Ga0495597_0038714 | |||
| 1646 | Ga0495597_0049354 | |||
| 1647 | Ga0495597_0053297 | |||
| 1648 | Ga0495597_0110686 | |||
| 1649 | Ga0495597_0121928 | |||
| 1650 | Ga0495622_0000028 | |||
| 1651 | Ga0495622_0000223 | |||
| 1652 | Ga0495622_0020952 | |||
| 1653 | Ga0495622_0032111 | |||
| 1654 | Ga0495633_0000272 | |||
| 1655 | Ga0495633_0000390 | |||
| 1656 | Ga0495633_0000528 | |||
| 1657 | Ga0495633_0000908 | |||
| 1658 | Ga0495633_0063448 | |||
| 1659 | Ga0495656_0000303 | |||
| 1660 | Ga0495668_0000006 | |||
| 1661 | Ga0495668_0000533 | |||
| 1662 | Ga0495668_0001777 | |||
| 1663 | Ga0495668_0014988 | |||
| 1664 | Ga0495668_0040073 | |||
| 1665 | Ga0495668_0049414 | |||
| 1666 | Ga0495668_0056455 | |||
| 1667 | Ga0495668_0111350 | |||
| 1668 | Ga0495611_0004369 | |||
| 1669 | Ga0495611_0157734 | |||
| 1670 | Ga0495625_0000318 | |||
| 1671 | Ga0495625_0000480 | |||
| 1672 | Ga0495625_0018179 | |||
| 1673 | Ga0495625_0020750 | |||
| 1674 | Ga0495625_0045672 | |||
| 1675 | Ga0495625_0050310 | |||
| 1676 | Ga0495625_0069597 | |||
| 1677 | Ga0495625_0180154 | |||
| 1678 | Ga0495659_0005351 | |||
| 1679 | Ga0495661_0002540 | |||
| 1680 | Ga0495661_0005328 | |||
| 1681 | Ga0495661_0024111 | |||
| 1682 | Ga0495661_0034274 | |||
| 1683 | Ga0495661_0162676 | |||
| 1684 | Ga0495588_0064020 | |||
| 1685 | Ga0495588_0165978 | |||
| 1686 | Ga0495588_0232553 | |||
| 1687 | Ga0495670_0036579 | |||
| 1688 | Ga0495670_0064437 | |||
| 1689 | Ga0495670_0081718 | |||
| 1690 | Ga0495670_0135354 | |||
| 1691 | Ga0495671_0016085 | |||
| 1692 | Ga0495671_0017712 | |||
| 1693 | Ga0495649_0019717 | |||
| 1694 | Ga0495649_0027532 | |||
| 1695 | Ga0495649_0099329 | |||
| 1696 | Ga0495649_0146971 | |||
| 1697 | Ga0495649_0191458 | |||
| 1698 | Ga0495589_0000376 | |||
| 1699 | Ga0495589_0010597 | |||
| 1700 | Ga0495660_0035867 | |||
| 1701 | Ga0495660_0087708 | |||
| 1702 | Ga0495581_0015444 | |||
| 1703 | Ga0495604_0020386 | |||
| 1704 | Ga0495672_0000429 | |||
| 1705 | Ga0495672_0083853 | |||
| 1706 | Ga0495672_0091994 | |||
| 1707 | Ga0495680_0293573 | |||
| 1708 | Ga0495683_0023317 | |||
| 1709 | Ga0495687_000054 | |||
| 1710 | Ga0495687_000779 | |||
| 1711 | Ga0495687_000817 | |||
| 1712 | Ga0495687_064590 | |||
| 1713 | Ga0495677_0000012 | |||
| 1714 | Ga0495677_0006316 | |||
| 1715 | Ga0495677_0037851 | |||
| 1716 | Ga0495677_0040610 | |||
| 1717 | Ga0495677_0111423 | |||
| 1718 | Ga0495679_016243 | |||
| 1719 | Ga0495685_027116 | |||
| 1720 | Ga0495681_0009145 | |||
| 1721 | Ga0495681_0059052 | |||
| 1722 | Ga0495686_0020170 | |||
| 1723 | Ga0495686_0130037 | |||
| 1724 | Ga0495686_0131234 | |||
| 1725 | Ga0495626_0002106 | |||
| 1726 | Ga0495626_0025644 | |||
| 1727 | Ga0495626_0079012 | |||
| 1728 | Ga0496100_0282290 | |||
| 1729 | Ga0496102_0002316 | |||
| 1730 | Ga0496102_0091702 | |||
| 1731 | Ga0496102_0176673 | |||
| 1732 | Ga0496103_0108383 | |||
| 1733 | Ga0496104_0012260 | |||
| 1734 | Ga0496105_0000979 | |||
| 1735 | Ga0496109_0166548 | |||
| 1736 | Ga0496111_0189330 | |||
| 1737 | Ga0496112_0045626 | |||
| 1738 | Ga0496113_0215457 | |||
| 1739 | Ga0496114_0014851 | |||
| 1740 | Ga0496114_0173236 | |||
| 1741 | Ga0496115_0008139 | |||
| 1742 | Ga0496115_0009205 | |||
| 1743 | Ga0496121_0006502 | |||
| 1744 | Ga0496122_0018277 | |||
| 1745 | Ga0496123_0015723 | |||
| 1746 | Ga0496124_0028236 | |||
| 1747 | Ga0496124_0059867 | |||
| 1748 | Ga0496125_0023876 | |||
| 1749 | Ga0495678_000313 | |||
| 1750 | Ga0495678_004914 | |||
| 1751 | Ga0495682_0000775 | |||
| 1752 | Ga0495682_0013628 | |||
| 1753 | Ga0495682_0123480 | |||
| 1754 | Ga0501034_0150550 | |||
| 1755 | Ga0501034_0173737 | |||
| 1756 | Ga0501042_0161158 | |||
| 1757 | Ga0501042_0377206 | |||
| 1758 | Ga0501068_0001338 | |||
| 1759 | Ga0501070_0017362 | |||
| 1760 | Ga0501071_0009268 | |||
| 1761 | Ga0501073_0006004 | |||
| 1762 | Ga0501073_0103726 | |||
| 1763 | Ga0501077_0239070 | |||
| 1764 | Ga0501080_0009316 | |||
| 1765 | Ga0501081_0109829 | |||
| 1766 | Ga0501083_0063536 | |||
| 1767 | Ga0501262_003322 | |||
| 1768 | nmdc:mga03683_171805_c1 | |||
| 1769 | nmdc:mga0yw44_128417_c1 | |||
| 1770 | nmdc:mga0k408_11650_c1 | |||
| 1771 | nmdc:mga07m45_11077_c2 | |||
| 1772 | nmdc:mga07m45_3734_c1 | |||
| 1773 | nmdc:mga05p37_142741_c1 | |||
| 1774 | nmdc:mga05p37_164319_c1 | |||
| 1775 | nmdc:mga05p37_189147_c1 | |||
| 1776 | nmdc:mga05p37_210095_c1 | |||
| 1777 | nmdc:mga05p37_21554_c2 | |||
| 1778 | nmdc:mga05p37_26674_c1 | |||
| 1779 | nmdc:mga05p37_37384_c1 | |||
| 1780 | nmdc:mga05p37_9416_c1 | |||
| 1781 | nmdc:mga09592_209928_c1 | |||
| 1782 | nmdc:mga09592_215924_c1 | |||
| 1783 | nmdc:mga09592_8693_c1 | |||
| 1784 | nmdc:mga0qj67_18796_c1 | |||
| 1785 | nmdc:mga0qj67_205445_c1 | |||
| 1786 | nmdc:mga0qj67_67446_c1 | |||
| 1787 | nmdc:mga0qj67_75031_c1 | |||
| 1788 | nmdc:mga06r32_127585_c1 | |||
| 1789 | nmdc:mga06r32_17606_c1 | |||
| 1790 | nmdc:mga06r32_252069_c1 | |||
| 1791 | nmdc:mga06r32_35663_c1 | |||
| 1792 | nmdc:mga06r32_4475_c1 | |||
| 1793 | nmdc:mga06r32_699547_c1 | |||
| 1794 | nmdc:mga08y16_39163_c1 | |||
| 1795 | nmdc:mga08y16_480949_c1 | |||
| 1796 | nmdc:mga08y16_617137_c1 | |||
| 1797 | nmdc:mga08y16_6759_c1 | |||
| 1798 | nmdc:mga08y16_824_c1 | |||
| 1799 | nmdc:mga08y16_86496_c1 | |||
| 1800 | nmdc:mga0n895_172594_c1 | |||
| 1801 | nmdc:mga0n895_205490_c1 | |||
| 1802 | nmdc:mga0n895_35708_c1 | |||
| 1803 | nmdc:mga0rr50_3726_c1 | |||
| 1804 | nmdc:mga0a205_10890_c1 | |||
| 1805 | nmdc:mga0a205_13539_c1 | |||
| 1806 | nmdc:mga0a205_50861_c1 | |||
| 1807 | nmdc:mga0a205_65721_c1 | |||
| 1808 | nmdc:mga0a205_68177_c1 | |||
| 1809 | nmdc:mga0a205_7269_c1 | |||
| 1810 | Ga0500651_0328442 | |||
| 1811 | Ga0500641_0011703 | |||
| 1812 | Ga0500555_012434 | |||
| 1813 | Ga0500591_095109 | |||
| 1814 | Ga0500655_005441 | |||
| 1815 | Ga0500658_0002068 | |||
| 1816 | Ga0500658_0029713 | |||
| 1817 | Ga0500561_0066041 | |||
| 1818 | Ga0500564_028213 | |||
| 1819 | Ga0500586_000049 | |||
| 1820 | Ga0500588_0000373 | |||
| 1821 | Ga0500622_0002411 | |||
| 1822 | Ga0500636_0003904 | |||
| 1823 | Ga0500611_006847 | |||
| 1824 | Ga0501084_0292993 | |||
| 1825 | Ga0466962_0007150 | |||
| 1826 | Ga0466962_0012908 | |||
| 1827 | Ga0466962_0024933 | |||
| 1828 | 2643744597 | |||
| 1829 | 2643787890 | |||
| 1830 | 2643800361 | |||
| 1831 | 2643934601 | |||
| 1832 | 2644219131 | |||
| 1833 | 2644255645 | |||
| 1834 | 2644303223 | |||
| 1835 | 2644316087 | |||
| 1836 | 2644470270 | |||
| 1837 | 2739054111 | |||
| 1838 | 2842717789 | |||
| 1839 | 2857563809 | |||
| 1840 | 8047678658 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
74
241
0.93
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.8104 | 52 | 240 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7722 | 55 | 236 |
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.7711 | 16 | 240 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.76 | 55 | 236 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.7542 | 33 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9575 | 48 | 241 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9474 | 49 | 241 | 1.10.3720.10 |
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9433 | 48 | 241 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9397 | 59 | 242 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9269 | 50 | 248 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3E1S0H6-F1-model_v4 | deleted | 0.9805 | 1 | 252 |
|
| AF-A0A4Q7XHW9-F1-model_v4 | deleted | 0.9695 | 1 | 252 |
|
| AF-A0A7Y6NKH6-F1-model_v4 | ABC transporter permease | 0.9643 | 4 | 252 |
GO:0005886
GO:0055085 |
| AF-A0A7X3G667-F1-model_v4 | ABC transporter permease subunit | 0.963 | 2 | 252 |
GO:0005886
GO:0055085 |
| AF-A0A2Z5G2Z7-F1-model_v4 | ABC-type nitrate/sulfonate/bicarbonate transport system, permease component | 0.962 | 52 | 249 |
GO:0005886
GO:0055085 |