F485779
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 922 | 362 | 1844 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300001904|JGI24736J21556_1003065|JGI24736J21556_10030652 |
| Length | 306 |
| Sequence | MNVGDTSITRFRATQATASRFVPGMHQLTVYSGWAKLEAQVTTEPMSDPIQARGPRHRGIYLLPNLFTTGAMFAGFYAIVSAFHGDFRTAALAVFVAGILDGMDGRVARLTNTQSEFGVQFDSLSDLVSFGLAPALVMYTWSLSSLAEYGRTWGKIGWAAAFIYAVCAALRLARFNTQVGVADKRYFQGLASPAAAALCMSFVWTMTKFDITGAEVAFFTLPLAVIAGLLMVSNVRYYSFKAWPKGDRVPFIWLITAVLIVVLLFIDPARVLFAGTVIYTISGPVMTLWGRAAHRRRARRHARSVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 110 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 195 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 196 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 215 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 216 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 217 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 218 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 219 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 220 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 221 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 222 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 223 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 224 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 233 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 234 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 293 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 296 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 333 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 334 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 336 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 340 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 341 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 342 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 343 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 344 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 345 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 346 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 347 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 348 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 349 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 350 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 351 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 352 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 353 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 354 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 355 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 356 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 357 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 358 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 359 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 360 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 361 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 362 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.85 |
| Metatranscriptomes | 0.65 |
| Isolates | 2.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.8 |
| Nodule | 0 |
| Rhizoplane | 1.74 |
| Rhizosphere | 74.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003065 | 3300001904 | Bacteria | 2919 |
| 2 | JGI24740J21852_10002516 | 3300001979 | Bacteria | 8274 |
| 3 | JGI24740J21852_10004620 | 3300001979 | Bacteria | 5910 |
| 4 | JGI24739J22299_10002555 | 3300001989 | Bacteria | 7020 |
| 5 | JGI24737J22298_10003819 | 3300001990 | Bacteria | 5301 |
| 6 | JGI24735J21928_10017069 | 3300002067 | Bacteria | 2246 |
| 7 | JGI24738J21930_10016184 | 3300002075 | Bacteria | 1578 |
| 8 | JGI25156J39149_1002499 | 3300002705 | Bacteria | 6551 |
| 9 | JGI25162J39368_1000997 | 3300002737 | Bacteria | 17858 |
| 10 | JGI25162J39368_1001016 | 3300002737 | Bacteria | 17505 |
| 11 | JGI25162J39368_1001293 | 3300002737 | Bacteria | 14142 |
| 12 | JGI25162J39368_1003388 | 3300002737 | Bacteria | 4677 |
| 13 | JGI25162J39368_1010519 | 3300002737 | Bacteria | 1164 |
| 14 | JGI25157J39369_1001296 | 3300002741 | Bacteria | 10019 |
| 15 | JGI25157J39369_1003130 | 3300002741 | Bacteria | 3548 |
| 16 | JGI25157J39369_1003163 | 3300002741 | Bacteria | 3511 |
| 17 | JGI25163J39215_1000604 | 3300002771 | Bacteria | 9991 |
| 18 | JGI25163J39215_1000836 | 3300002771 | Bacteria | 7374 |
| 19 | JGI25164J39214_1000169 | 3300002772 | Bacteria | 61173 |
| 20 | JGI25164J39214_1000510 | 3300002772 | Bacteria | 18642 |
| 21 | JGI25164J39214_1000517 | 3300002772 | Bacteria | 18479 |
| 22 | JGI25164J39214_1000877 | 3300002772 | Bacteria | 10211 |
| 23 | JGI25165J46597_1000360 | 3300003214 | Bacteria | 51032 |
| 24 | JGI25165J46597_1000562 | 3300003214 | Bacteria | 33635 |
| 25 | JGI25165J46597_1001043 | 3300003214 | Bacteria | 18071 |
| 26 | JGI25165J46597_1004619 | 3300003214 | Bacteria | 2890 |
| 27 | JGI25153J46596_10009316 | 3300003215 | Bacteria | 4586 |
| 28 | rootH1_10051601 | 3300003316 | Bacteria | 2448 |
| 29 | rootH1_10145377 | 3300003316 | Bacteria | 3106 |
| 30 | rootH2_10021538 | 3300003320 | Bacteria | 3925 |
| 31 | Ga0006562J51391_1028147 | 3300003578 | Bacteria | 4987 |
| 32 | Ga0006562J51391_1057626 | 3300003578 | Bacteria | 2490 |
| 33 | Ga0055539_1001724 | 3300003752 | Bacteria | 3827 |
| 34 | Ga0055525_1000464 | 3300003759 | Bacteria | 22607 |
| 35 | Ga0055527_1000053 | 3300003760 | Bacteria | 100725 |
| 36 | Ga0055527_1000116 | 3300003760 | Bacteria | 57355 |
| 37 | Ga0055535_1000296 | 3300003761 | Bacteria | 51261 |
| 38 | Ga0055535_1000298 | 3300003761 | Bacteria | 50927 |
| 39 | Ga0055535_1000667 | 3300003761 | Bacteria | 27105 |
| 40 | Ga0055535_1001282 | 3300003761 | Bacteria | 13649 |
| 41 | Ga0055535_1001752 | 3300003761 | Bacteria | 9684 |
| 42 | Ga0055542_1000056 | 3300003762 | Bacteria | 167483 |
| 43 | Ga0055542_1000187 | 3300003762 | Bacteria | 76099 |
| 44 | Ga0055542_1000277 | 3300003762 | Bacteria | 57355 |
| 45 | Ga0055542_1000323 | 3300003762 | Bacteria | 50926 |
| 46 | Ga0055542_1000387 | 3300003762 | Bacteria | 44412 |
| 47 | Ga0055542_1001002 | 3300003762 | Bacteria | 18071 |
| 48 | Ga0055529_1000264 | 3300003763 | Bacteria | 62197 |
| 49 | Ga0055529_1000298 | 3300003763 | Bacteria | 57355 |
| 50 | Ga0055529_1000415 | 3300003763 | Bacteria | 44412 |
| 51 | Ga0055529_1001224 | 3300003763 | Bacteria | 9842 |
| 52 | Ga0055526_1028093 | 3300003771 | Bacteria | 1712 |
| 53 | Ga0055536_1019305 | 3300003781 | Bacteria | 2149 |
| 54 | Ga0055530_10010387 | 3300003791 | Bacteria | 3444 |
| 55 | Ga0055531_10010638 | 3300003794 | Bacteria | 4547 |
| 56 | Ga0055531_10023299 | 3300003794 | Bacteria | 2327 |
| 57 | Ga0065165_1000700 | 3300005262 | Bacteria | 47662 |
| 58 | Ga0065165_1019690 | 3300005262 | Bacteria | 2399 |
| 59 | Ga0065714_10089290 | 3300005288 | Bacteria | 1959 |
| 60 | Ga0070658_10001497 | 3300005327 | Bacteria | 19822 |
| 61 | Ga0070676_10159477 | 3300005328 | Bacteria | 1450 |
| 62 | Ga0070670_100014157 | 3300005331 | Bacteria | 6842 |
| 63 | Ga0068869_100235721 | 3300005334 | Bacteria | 1456 |
| 64 | Ga0070666_10000013 | 3300005335 | Bacteria | 230442 |
| 65 | Ga0070666_10002022 | 3300005335 | Bacteria | 12330 |
| 66 | Ga0070666_10036820 | 3300005335 | Bacteria | 3250 |
| 67 | Ga0070680_100000291 | 3300005336 | Bacteria | 33556 |
| 68 | Ga0070680_100034991 | 3300005336 | Bacteria | 4053 |
| 69 | Ga0070680_100065827 | 3300005336 | Bacteria | 2970 |
| 70 | Ga0070680_100187766 | 3300005336 | Bacteria | 1741 |
| 71 | Ga0070680_100705842 | 3300005336 | Bacteria | 868 |
| 72 | Ga0070682_100001023 | 3300005337 | Bacteria | 16152 |
| 73 | Ga0070682_100003056 | 3300005337 | Bacteria | 9265 |
| 74 | Ga0070682_100047125 | 3300005337 | Bacteria | 2678 |
| 75 | Ga0068868_100060167 | 3300005338 | Bacteria | 3006 |
| 76 | Ga0070660_100046238 | 3300005339 | Bacteria | 3336 |
| 77 | Ga0070660_100225080 | 3300005339 | Bacteria | 1525 |
| 78 | Ga0070689_100002032 | 3300005340 | Bacteria | 13125 |
| 79 | Ga0070691_10077010 | 3300005341 | Bacteria | 1627 |
| 80 | Ga0070661_100014293 | 3300005344 | Bacteria | 5592 |
| 81 | Ga0070661_100018614 | 3300005344 | Bacteria | 4940 |
| 82 | Ga0070661_100027727 | 3300005344 | Bacteria | 4081 |
| 83 | Ga0070661_100054393 | 3300005344 | Bacteria | 2931 |
| 84 | Ga0070661_100085715 | 3300005344 | Bacteria | 2328 |
| 85 | Ga0070661_100217364 | 3300005344 | Bacteria | 1465 |
| 86 | Ga0070661_100374397 | 3300005344 | Bacteria | 1121 |
| 87 | Ga0070692_10033272 | 3300005345 | Bacteria | 2597 |
| 88 | Ga0070668_100123170 | 3300005347 | Bacteria | 2075 |
| 89 | Ga0070674_100431921 | 3300005356 | Bacteria | 1083 |
| 90 | Ga0070673_100129337 | 3300005364 | Bacteria | 2116 |
| 91 | Ga0070659_100002227 | 3300005366 | Bacteria | 13777 |
| 92 | Ga0070659_100063344 | 3300005366 | Bacteria | 2925 |
| 93 | Ga0070659_100116351 | 3300005366 | Bacteria | 2161 |
| 94 | Ga0070659_100184188 | 3300005366 | Bacteria | 1714 |
| 95 | Ga0070667_100049159 | 3300005367 | Bacteria | 3551 |
| 96 | Ga0070667_100347652 | 3300005367 | Bacteria | 1342 |
| 97 | Ga0070667_100674886 | 3300005367 | Bacteria | 955 |
| 98 | Ga0070714_100000020 | 3300005435 | Bacteria | 169262 |
| 99 | Ga0070714_100015093 | 3300005435 | Bacteria | 6211 |
| 100 | Ga0070714_100019341 | 3300005435 | Bacteria | 5545 |
| 101 | Ga0070714_100050368 | 3300005435 | Bacteria | 3547 |
| 102 | Ga0070713_100001409 | 3300005436 | Bacteria | 15418 |
| 103 | Ga0070713_100161252 | 3300005436 | Bacteria | 2002 |
| 104 | Ga0070711_100203830 | 3300005439 | Bacteria | 1528 |
| 105 | Ga0070711_100453511 | 3300005439 | Bacteria | 1050 |
| 106 | Ga0070700_100247848 | 3300005441 | Bacteria | 1276 |
| 107 | Ga0070694_100027486 | 3300005444 | Bacteria | 3695 |
| 108 | Ga0070663_100022581 | 3300005455 | Bacteria | 4208 |
| 109 | Ga0070663_100073934 | 3300005455 | Bacteria | 2487 |
| 110 | Ga0070663_100180617 | 3300005455 | Bacteria | 1636 |
| 111 | Ga0070678_100060529 | 3300005456 | Bacteria | 2788 |
| 112 | Ga0070678_100154504 | 3300005456 | Bacteria | 1852 |
| 113 | Ga0070662_100083262 | 3300005457 | Bacteria | 2387 |
| 114 | Ga0070662_100314460 | 3300005457 | Bacteria | 1276 |
| 115 | Ga0070681_10000006 | 3300005458 | Bacteria | 169066 |
| 116 | Ga0070681_10007337 | 3300005458 | Bacteria | 10770 |
| 117 | Ga0070681_10011412 | 3300005458 | Bacteria | 8794 |
| 118 | Ga0070681_10019530 | 3300005458 | Bacteria | 6785 |
| 119 | Ga0070681_10051145 | 3300005458 | Bacteria | 4122 |
| 120 | Ga0070681_10066806 | 3300005458 | Bacteria | 3565 |
| 121 | Ga0070681_10145470 | 3300005458 | Bacteria | 2299 |
| 122 | Ga0068867_100195727 | 3300005459 | Bacteria | 1616 |
| 123 | Ga0070685_10010301 | 3300005466 | Bacteria | 4854 |
| 124 | Ga0070679_100000207 | 3300005530 | Bacteria | 47969 |
| 125 | Ga0070684_100186482 | 3300005535 | Bacteria | 1887 |
| 126 | Ga0068853_100002190 | 3300005539 | Bacteria | 14571 |
| 127 | Ga0068853_100104364 | 3300005539 | Bacteria | 2509 |
| 128 | Ga0068853_100111514 | 3300005539 | Bacteria | 2430 |
| 129 | Ga0068853_100140414 | 3300005539 | Bacteria | 2168 |
| 130 | Ga0068853_100167334 | 3300005539 | Bacteria | 1987 |
| 131 | Ga0070672_100073410 | 3300005543 | Bacteria | 2726 |
| 132 | Ga0070686_100060673 | 3300005544 | Bacteria | 2441 |
| 133 | Ga0070696_100007413 | 3300005546 | Bacteria | 7334 |
| 134 | Ga0070696_100022947 | 3300005546 | Bacteria | 4243 |
| 135 | Ga0070696_100269827 | 3300005546 | Bacteria | 1293 |
| 136 | Ga0070696_100498915 | 3300005546 | Bacteria | 968 |
| 137 | Ga0070693_100013764 | 3300005547 | Bacteria | 4128 |
| 138 | Ga0070693_100015213 | 3300005547 | Bacteria | 3958 |
| 139 | Ga0070693_100054239 | 3300005547 | Bacteria | 2304 |
| 140 | Ga0070665_100000100 | 3300005548 | Bacteria | 160186 |
| 141 | Ga0070665_100001350 | 3300005548 | Bacteria | 29089 |
| 142 | Ga0070665_100071557 | 3300005548 | Bacteria | 3474 |
| 143 | Ga0070665_100073872 | 3300005548 | Bacteria | 3415 |
| 144 | Ga0068855_100014910 | 3300005563 | Bacteria | 9363 |
| 145 | Ga0068855_100108448 | 3300005563 | Bacteria | 3189 |
| 146 | Ga0068855_100141865 | 3300005563 | Bacteria | 2737 |
| 147 | Ga0068855_100312103 | 3300005563 | Bacteria | 1739 |
| 148 | Ga0068857_100034725 | 3300005577 | Bacteria | 4460 |
| 149 | Ga0068857_100046125 | 3300005577 | Bacteria | 3867 |
| 150 | Ga0068857_100058255 | 3300005577 | Bacteria | 3430 |
| 151 | Ga0068857_100122926 | 3300005577 | Bacteria | 2338 |
| 152 | Ga0068857_100279371 | 3300005577 | Bacteria | 1536 |
| 153 | Ga0068854_100003203 | 3300005578 | Bacteria | 10214 |
| 154 | Ga0068854_100003650 | 3300005578 | Bacteria | 9629 |
| 155 | Ga0068854_100026043 | 3300005578 | Bacteria | 4016 |
| 156 | Ga0068854_100034159 | 3300005578 | Bacteria | 3550 |
| 157 | Ga0068854_100057110 | 3300005578 | Bacteria | 2815 |
| 158 | Ga0068854_100413361 | 3300005578 | Bacteria | 1119 |
| 159 | Ga0068856_100000882 | 3300005614 | Bacteria | 32118 |
| 160 | Ga0068856_100003051 | 3300005614 | Bacteria | 17138 |
| 161 | Ga0068856_100025778 | 3300005614 | Bacteria | 5733 |
| 162 | Ga0068856_100144933 | 3300005614 | Bacteria | 2382 |
| 163 | Ga0068852_100031237 | 3300005616 | Bacteria | 4392 |
| 164 | Ga0068852_100249539 | 3300005616 | Bacteria | 1700 |
| 165 | Ga0068859_100000712 | 3300005617 | Bacteria | 33511 |
| 166 | Ga0068859_100781613 | 3300005617 | Bacteria | 1043 |
| 167 | Ga0068864_100044068 | 3300005618 | Bacteria | 3822 |
| 168 | Ga0068864_100168454 | 3300005618 | Bacteria | 1996 |
| 169 | Ga0068851_10008194 | 3300005834 | Bacteria | 4823 |
| 170 | Ga0068851_10016801 | 3300005834 | Bacteria | 3506 |
| 171 | Ga0068851_10048722 | 3300005834 | Bacteria | 2147 |
| 172 | Ga0068851_10260097 | 3300005834 | Bacteria | 987 |
| 173 | Ga0068863_100027559 | 3300005841 | Bacteria | 5419 |
| 174 | Ga0068863_100042126 | 3300005841 | Bacteria | 4339 |
| 175 | Ga0068863_100100704 | 3300005841 | Bacteria | 2746 |
| 176 | Ga0068863_100245002 | 3300005841 | Bacteria | 1731 |
| 177 | Ga0068863_100246604 | 3300005841 | Bacteria | 1724 |
| 178 | Ga0068863_100358085 | 3300005841 | Bacteria | 1422 |
| 179 | Ga0068858_100001088 | 3300005842 | Bacteria | 28107 |
| 180 | Ga0068858_100010755 | 3300005842 | Bacteria | 8652 |
| 181 | Ga0068858_100176842 | 3300005842 | Bacteria | 2014 |
| 182 | Ga0068860_100066163 | 3300005843 | Bacteria | 3433 |
| 183 | Ga0068860_100291893 | 3300005843 | Bacteria | 1596 |
| 184 | Ga0068862_100001541 | 3300005844 | Bacteria | 21086 |
| 185 | Ga0068862_100065416 | 3300005844 | Bacteria | 3131 |
| 186 | Ga0081540_1001452 | 3300005983 | Bacteria | 20481 |
| 187 | Ga0097621_100058639 | 3300006237 | Bacteria | 3150 |
| 188 | Ga0068871_100007828 | 3300006358 | Bacteria | 7656 |
| 189 | Ga0068871_100031831 | 3300006358 | Bacteria | 4161 |
| 190 | Ga0068871_100292652 | 3300006358 | Bacteria | 1427 |
| 191 | Ga0068871_100384656 | 3300006358 | Bacteria | 1247 |
| 192 | Ga0068865_100023502 | 3300006881 | Bacteria | 4037 |
| 193 | Ga0097620_100000712 | 3300006931 | Bacteria | 33511 |
| 194 | Ga0097620_100781610 | 3300006931 | Bacteria | 1043 |
| 195 | Ga0105240_10002526 | 3300009093 | Bacteria | 29370 |
| 196 | Ga0105240_10008269 | 3300009093 | Bacteria | 14895 |
| 197 | Ga0105240_10077292 | 3300009093 | Bacteria | 4101 |
| 198 | Ga0105240_10314102 | 3300009093 | Bacteria | 1788 |
| 199 | Ga0105240_10715685 | 3300009093 | Bacteria | 1091 |
| 200 | Ga0105247_10000994 | 3300009101 | Bacteria | 21412 |
| 201 | Ga0105247_10046858 | 3300009101 | Bacteria | 2654 |
| 202 | Ga0105241_10320818 | 3300009174 | Bacteria | 1336 |
| 203 | Ga0105248_10055311 | 3300009177 | Bacteria | 4451 |
| 204 | Ga0105248_10083302 | 3300009177 | Bacteria | 3598 |
| 205 | Ga0105248_10179838 | 3300009177 | Bacteria | 2383 |
| 206 | Ga0105248_10193928 | 3300009177 | Bacteria | 2289 |
| 207 | Ga0105237_10000292 | 3300009545 | Bacteria | 69307 |
| 208 | Ga0105237_10001255 | 3300009545 | Bacteria | 33878 |
| 209 | Ga0105237_10069164 | 3300009545 | Bacteria | 3526 |
| 210 | Ga0105237_10127922 | 3300009545 | Bacteria | 2534 |
| 211 | Ga0105237_10130108 | 3300009545 | Bacteria | 2512 |
| 212 | Ga0105237_10257373 | 3300009545 | Bacteria | 1748 |
| 213 | Ga0105238_10000131 | 3300009551 | Bacteria | 82050 |
| 214 | Ga0105238_10002315 | 3300009551 | Bacteria | 19146 |
| 215 | Ga0105238_10008019 | 3300009551 | Bacteria | 10564 |
| 216 | Ga0105238_10053714 | 3300009551 | Bacteria | 4048 |
| 217 | Ga0105238_10059444 | 3300009551 | Bacteria | 3829 |
| 218 | Ga0105238_10110292 | 3300009551 | Bacteria | 2732 |
| 219 | Ga0105238_10148432 | 3300009551 | Bacteria | 2321 |
| 220 | Ga0105238_10228643 | 3300009551 | Bacteria | 1837 |
| 221 | Ga0105249_10003406 | 3300009553 | Bacteria | 13771 |
| 222 | Ga0105239_10001711 | 3300010375 | Bacteria | 28894 |
| 223 | Ga0105239_10017137 | 3300010375 | Bacteria | 8008 |
| 224 | Ga0105239_10080197 | 3300010375 | Bacteria | 3591 |
| 225 | Ga0105239_10105998 | 3300010375 | Bacteria | 3113 |
| 226 | Ga0105239_10147002 | 3300010375 | Bacteria | 2629 |
| 227 | Ga0105246_10024032 | 3300011119 | Bacteria | 3952 |
| 228 | Ga0157314_1000159 | 3300012500 | Bacteria | 7374 |
| 229 | Ga0157373_10002912 | 3300013100 | Bacteria | 12959 |
| 230 | Ga0157373_10077647 | 3300013100 | Bacteria | 2343 |
| 231 | Ga0157373_10111594 | 3300013100 | Bacteria | 1922 |
| 232 | Ga0157373_10378432 | 3300013100 | Bacteria | 1012 |
| 233 | Ga0157371_10004953 | 3300013102 | Bacteria | 11440 |
| 234 | Ga0157371_10236209 | 3300013102 | Bacteria | 1314 |
| 235 | Ga0157370_10003809 | 3300013104 | Bacteria | 17595 |
| 236 | Ga0157370_10004261 | 3300013104 | Bacteria | 16506 |
| 237 | Ga0157370_10012899 | 3300013104 | Bacteria | 8639 |
| 238 | Ga0157370_10018653 | 3300013104 | Bacteria | 6975 |
| 239 | Ga0157370_10069448 | 3300013104 | Bacteria | 3327 |
| 240 | Ga0157370_10117478 | 3300013104 | Bacteria | 2484 |
| 241 | Ga0157369_10000529 | 3300013105 | Bacteria | 50408 |
| 242 | Ga0157369_10041539 | 3300013105 | Bacteria | 5019 |
| 243 | Ga0157369_10221111 | 3300013105 | Bacteria | 1983 |
| 244 | Ga0157369_10399687 | 3300013105 | Bacteria | 1425 |
| 245 | Ga0157369_10432558 | 3300013105 | Bacteria | 1364 |
| 246 | Ga0157369_10455937 | 3300013105 | Bacteria | 1324 |
| 247 | Ga0157374_10200077 | 3300013296 | Bacteria | 1956 |
| 248 | Ga0157374_10366630 | 3300013296 | Bacteria | 1433 |
| 249 | Ga0157374_10476995 | 3300013296 | Bacteria | 1250 |
| 250 | Ga0157378_10000597 | 3300013297 | Bacteria | 33850 |
| 251 | Ga0157378_10080956 | 3300013297 | Bacteria | 2935 |
| 252 | Ga0163162_10000221 | 3300013306 | Bacteria | 52249 |
| 253 | Ga0163162_10040418 | 3300013306 | Bacteria | 4663 |
| 254 | Ga0163162_10053140 | 3300013306 | Bacteria | 4071 |
| 255 | Ga0157372_10004293 | 3300013307 | Bacteria | 15236 |
| 256 | Ga0157372_10006042 | 3300013307 | Bacteria | 12866 |
| 257 | Ga0157372_10019593 | 3300013307 | Bacteria | 7291 |
| 258 | Ga0157372_10021196 | 3300013307 | Bacteria | 7021 |
| 259 | Ga0157372_10038983 | 3300013307 | Bacteria | 5244 |
| 260 | Ga0157372_10068313 | 3300013307 | Bacteria | 3995 |
| 261 | Ga0157372_10079085 | 3300013307 | Bacteria | 3718 |
| 262 | Ga0157372_10097690 | 3300013307 | Bacteria | 3350 |
| 263 | Ga0157372_10117989 | 3300013307 | Bacteria | 3044 |
| 264 | Ga0157372_10126400 | 3300013307 | Bacteria | 2940 |
| 265 | Ga0157372_10337848 | 3300013307 | Bacteria | 1754 |
| 266 | Ga0157375_10012477 | 3300013308 | Bacteria | 7543 |
| 267 | Ga0157375_10393455 | 3300013308 | Bacteria | 1553 |
| 268 | Ga0157380_10410091 | 3300014326 | Bacteria | 1288 |
| 269 | Ga0182008_10008499 | 3300014497 | Bacteria | 5606 |
| 270 | Ga0157379_10006942 | 3300014968 | Bacteria | 9794 |
| 271 | Ga0157379_10144554 | 3300014968 | Bacteria | 2145 |
| 272 | Ga0157379_10320195 | 3300014968 | Bacteria | 1416 |
| 273 | Ga0157379_10459009 | 3300014968 | Bacteria | 1177 |
| 274 | Ga0157376_10016625 | 3300014969 | Bacteria | 5592 |
| 275 | Ga0157376_10020307 | 3300014969 | Bacteria | 5137 |
| 276 | Ga0157376_10319423 | 3300014969 | Bacteria | 1476 |
| 277 | Ga0157376_10614567 | 3300014969 | Bacteria | 1083 |
| 278 | Ga0182006_1000093 | 3300015261 | Bacteria | 106185 |
| 279 | Ga0182006_1000416 | 3300015261 | Bacteria | 34218 |
| 280 | Ga0182007_10002081 | 3300015262 | Bacteria | 10274 |
| 281 | Ga0182007_10004848 | 3300015262 | Bacteria | 6018 |
| 282 | Ga0182005_1000536 | 3300015265 | Bacteria | 19181 |
| 283 | Ga0182005_1008634 | 3300015265 | Bacteria | 2994 |
| 284 | Ga0182005_1010115 | 3300015265 | Bacteria | 2719 |
| 285 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 286 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 287 | Ga0163161_10000685 | 3300017792 | Bacteria | 27037 |
| 288 | Ga0163161_10040488 | 3300017792 | Bacteria | 3347 |
| 289 | Ga0163161_10086853 | 3300017792 | Bacteria | 2309 |
| 290 | Ga0206356_10643678 | 3300020070 | Bacteria | 2531 |
| 291 | Ga0206353_11323503 | 3300020082 | Bacteria | 3163 |
| 292 | Ga0206353_11660574 | 3300020082 | Bacteria | 970 |
| 293 | Ga0209760_100616 | 3300025207 | Bacteria | 6064 |
| 294 | Ga0209784_100422 | 3300025224 | Bacteria | 18592 |
| 295 | Ga0209566_101298 | 3300025225 | Bacteria | 8198 |
| 296 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 297 | Ga0209674_100077 | 3300025226 | Bacteria | 206312 |
| 298 | Ga0209674_100642 | 3300025226 | Bacteria | 12654 |
| 299 | Ga0209674_100983 | 3300025226 | Bacteria | 8798 |
| 300 | Ga0209674_102647 | 3300025226 | Bacteria | 3714 |
| 301 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 302 | Ga0209672_100022 | 3300025228 | Bacteria | 374313 |
| 303 | Ga0209672_100476 | 3300025228 | Bacteria | 22515 |
| 304 | Ga0209672_101466 | 3300025228 | Bacteria | 8364 |
| 305 | Ga0209563_100103 | 3300025230 | Bacteria | 151835 |
| 306 | Ga0207427_100111 | 3300025231 | Bacteria | 112775 |
| 307 | Ga0207427_100175 | 3300025231 | Bacteria | 69585 |
| 308 | Ga0207427_100179 | 3300025231 | Bacteria | 67665 |
| 309 | Ga0207427_100304 | 3300025231 | Bacteria | 34224 |
| 310 | Ga0207427_102993 | 3300025231 | Bacteria | 3926 |
| 311 | Ga0207427_110925 | 3300025231 | Bacteria | 934 |
| 312 | Ga0209437_100099 | 3300025233 | Bacteria | 229500 |
| 313 | Ga0209437_100269 | 3300025233 | Bacteria | 78465 |
| 314 | Ga0209437_100270 | 3300025233 | Bacteria | 78319 |
| 315 | Ga0209437_100368 | 3300025233 | Bacteria | 48548 |
| 316 | Ga0209437_100384 | 3300025233 | Bacteria | 43568 |
| 317 | Ga0209437_102555 | 3300025233 | Bacteria | 3504 |
| 318 | Ga0209437_106531 | 3300025233 | Bacteria | 1938 |
| 319 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 320 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 321 | Ga0209258_100119 | 3300025242 | Bacteria | 183554 |
| 322 | Ga0209258_100137 | 3300025242 | Bacteria | 167913 |
| 323 | Ga0209258_100182 | 3300025242 | Bacteria | 136629 |
| 324 | Ga0209258_100849 | 3300025242 | Bacteria | 16503 |
| 325 | Ga0209646_1000986 | 3300025246 | Bacteria | 8802 |
| 326 | Ga0209646_1001576 | 3300025246 | Bacteria | 5967 |
| 327 | Ga0209646_1005596 | 3300025246 | Bacteria | 2174 |
| 328 | Ga0209026_1000175 | 3300025250 | Bacteria | 98059 |
| 329 | Ga0209026_1000242 | 3300025250 | Bacteria | 70111 |
| 330 | Ga0209026_1000276 | 3300025250 | Bacteria | 60964 |
| 331 | Ga0209026_1000504 | 3300025250 | Bacteria | 27840 |
| 332 | Ga0209026_1001966 | 3300025250 | Bacteria | 8245 |
| 333 | Ga0209026_1006043 | 3300025250 | Bacteria | 3077 |
| 334 | Ga0209677_110280 | 3300025253 | Bacteria | 1574 |
| 335 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 336 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 337 | Ga0209148_1000036 | 3300025254 | Bacteria | 530505 |
| 338 | Ga0209148_1000062 | 3300025254 | Bacteria | 347704 |
| 339 | Ga0209148_1000083 | 3300025254 | Bacteria | 270142 |
| 340 | Ga0209148_1000137 | 3300025254 | Bacteria | 168097 |
| 341 | Ga0209148_1001922 | 3300025254 | Bacteria | 8486 |
| 342 | Ga0209759_1000136 | 3300025256 | Bacteria | 125393 |
| 343 | Ga0209759_1003929 | 3300025256 | Bacteria | 5726 |
| 344 | Ga0209759_1008606 | 3300025256 | Bacteria | 3164 |
| 345 | Ga0209759_1009273 | 3300025256 | Bacteria | 2986 |
| 346 | Ga0209759_1014828 | 3300025256 | Bacteria | 2039 |
| 347 | Ga0209129_1001516 | 3300025258 | Bacteria | 12864 |
| 348 | Ga0209233_1000040 | 3300025261 | Bacteria | 530395 |
| 349 | Ga0209233_1000075 | 3300025261 | Bacteria | 356837 |
| 350 | Ga0209233_1000077 | 3300025261 | Bacteria | 349570 |
| 351 | Ga0209233_1000128 | 3300025261 | Bacteria | 209927 |
| 352 | Ga0209233_1006779 | 3300025261 | Bacteria | 3665 |
| 353 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 354 | Ga0209455_1000040 | 3300025272 | Bacteria | 430197 |
| 355 | Ga0209455_1000084 | 3300025272 | Bacteria | 253164 |
| 356 | Ga0209455_1000095 | 3300025272 | Bacteria | 217487 |
| 357 | Ga0209455_1000164 | 3300025272 | Bacteria | 114011 |
| 358 | Ga0209675_1010375 | 3300025291 | Bacteria | 3186 |
| 359 | Ga0209676_1003628 | 3300025292 | Bacteria | 9282 |
| 360 | Ga0209676_1004464 | 3300025292 | Bacteria | 7783 |
| 361 | Ga0209025_1001565 | 3300025294 | Bacteria | 29000 |
| 362 | Ga0209025_1040053 | 3300025294 | Bacteria | 2033 |
| 363 | Ga0209564_1038640 | 3300025295 | Bacteria | 1324 |
| 364 | Ga0209758_1002651 | 3300025297 | Bacteria | 17708 |
| 365 | Ga0209758_1003842 | 3300025297 | Bacteria | 13182 |
| 366 | Ga0209758_1030526 | 3300025297 | Bacteria | 2230 |
| 367 | Ga0209050_1000712 | 3300025298 | Bacteria | 48980 |
| 368 | Ga0209256_1002872 | 3300025299 | Bacteria | 13090 |
| 369 | Ga0209256_1011746 | 3300025299 | Bacteria | 3455 |
| 370 | Ga0209256_1019927 | 3300025299 | Bacteria | 2114 |
| 371 | Ga0209051_1012143 | 3300025303 | Bacteria | 4184 |
| 372 | Ga0209051_1051734 | 3300025303 | Bacteria | 1363 |
| 373 | Ga0209257_1000210 | 3300025304 | Bacteria | 140822 |
| 374 | Ga0209257_1000792 | 3300025304 | Bacteria | 46155 |
| 375 | Ga0209257_1000856 | 3300025304 | Bacteria | 43386 |
| 376 | Ga0209257_1009432 | 3300025304 | Bacteria | 5227 |
| 377 | Ga0207656_10006257 | 3300025321 | Bacteria | 4264 |
| 378 | Ga0207710_10015097 | 3300025900 | Bacteria | 3262 |
| 379 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 380 | Ga0207680_10131591 | 3300025903 | Bacteria | 1649 |
| 381 | Ga0207647_10000505 | 3300025904 | Bacteria | 31222 |
| 382 | Ga0207647_10001812 | 3300025904 | Bacteria | 16389 |
| 383 | Ga0207647_10004982 | 3300025904 | Bacteria | 9791 |
| 384 | Ga0207647_10012646 | 3300025904 | Bacteria | 5866 |
| 385 | Ga0207647_10034080 | 3300025904 | Bacteria | 3254 |
| 386 | Ga0207647_10082383 | 3300025904 | Bacteria | 1927 |
| 387 | Ga0207647_10095622 | 3300025904 | Bacteria | 1769 |
| 388 | Ga0207699_10198393 | 3300025906 | Bacteria | 1358 |
| 389 | Ga0207645_10080512 | 3300025907 | Bacteria | 2088 |
| 390 | Ga0207705_10001749 | 3300025909 | Bacteria | 17172 |
| 391 | Ga0207705_10006682 | 3300025909 | Bacteria | 8532 |
| 392 | Ga0207705_10009407 | 3300025909 | Bacteria | 7105 |
| 393 | Ga0207705_10042602 | 3300025909 | Bacteria | 3259 |
| 394 | Ga0207705_10120522 | 3300025909 | Bacteria | 1946 |
| 395 | Ga0207654_10010017 | 3300025911 | Bacteria | 4819 |
| 396 | Ga0207707_10015416 | 3300025912 | Bacteria | 6657 |
| 397 | Ga0207707_10017428 | 3300025912 | Bacteria | 6262 |
| 398 | Ga0207707_10074164 | 3300025912 | Bacteria | 2968 |
| 399 | Ga0207695_10000588 | 3300025913 | Bacteria | 73260 |
| 400 | Ga0207695_10001221 | 3300025913 | Bacteria | 44045 |
| 401 | Ga0207695_10004028 | 3300025913 | Bacteria | 20230 |
| 402 | Ga0207695_10005207 | 3300025913 | Bacteria | 17395 |
| 403 | Ga0207695_10021315 | 3300025913 | Bacteria | 7398 |
| 404 | Ga0207695_10036666 | 3300025913 | Bacteria | 5298 |
| 405 | Ga0207695_10103332 | 3300025913 | Bacteria | 2841 |
| 406 | Ga0207695_10320295 | 3300025913 | Bacteria | 1440 |
| 407 | Ga0207671_10000011 | 3300025914 | Bacteria | 530349 |
| 408 | Ga0207671_10001034 | 3300025914 | Bacteria | 33866 |
| 409 | Ga0207671_10022794 | 3300025914 | Bacteria | 4730 |
| 410 | Ga0207671_10181031 | 3300025914 | Bacteria | 1640 |
| 411 | Ga0207693_10405722 | 3300025915 | Bacteria | 1065 |
| 412 | Ga0207663_10225792 | 3300025916 | Bacteria | 1365 |
| 413 | Ga0207663_10243526 | 3300025916 | Bacteria | 1320 |
| 414 | Ga0207663_10297875 | 3300025916 | Bacteria | 1204 |
| 415 | Ga0207660_10018727 | 3300025917 | Bacteria | 4620 |
| 416 | Ga0207660_10190204 | 3300025917 | Bacteria | 1598 |
| 417 | Ga0207657_10042581 | 3300025919 | Bacteria | 4005 |
| 418 | Ga0207657_10099172 | 3300025919 | Bacteria | 2420 |
| 419 | Ga0207657_10112915 | 3300025919 | Bacteria | 2242 |
| 420 | Ga0207657_10294805 | 3300025919 | Bacteria | 1286 |
| 421 | Ga0207657_10406232 | 3300025919 | Bacteria | 1071 |
| 422 | Ga0207649_10036870 | 3300025920 | Bacteria | 2949 |
| 423 | Ga0207649_10045564 | 3300025920 | Bacteria | 2689 |
| 424 | Ga0207649_10068356 | 3300025920 | Bacteria | 2258 |
| 425 | Ga0207649_10170829 | 3300025920 | Bacteria | 1514 |
| 426 | Ga0207652_10003552 | 3300025921 | Bacteria | 12873 |
| 427 | Ga0207652_10141772 | 3300025921 | Bacteria | 2149 |
| 428 | Ga0207694_10000168 | 3300025924 | Bacteria | 67647 |
| 429 | Ga0207694_10000569 | 3300025924 | Bacteria | 33457 |
| 430 | Ga0207694_10010204 | 3300025924 | Bacteria | 7081 |
| 431 | Ga0207694_10035516 | 3300025924 | Bacteria | 3825 |
| 432 | Ga0207694_10039308 | 3300025924 | Bacteria | 3641 |
| 433 | Ga0207694_10176486 | 3300025924 | Bacteria | 1731 |
| 434 | Ga0207694_10373064 | 3300025924 | Bacteria | 1183 |
| 435 | Ga0207650_10006083 | 3300025925 | Bacteria | 8227 |
| 436 | Ga0207650_10031247 | 3300025925 | Bacteria | 3844 |
| 437 | Ga0207700_10000786 | 3300025928 | Bacteria | 18351 |
| 438 | Ga0207664_10000023 | 3300025929 | Bacteria | 204730 |
| 439 | Ga0207664_10014270 | 3300025929 | Bacteria | 5730 |
| 440 | Ga0207664_10019584 | 3300025929 | Bacteria | 5004 |
| 441 | Ga0207664_10230146 | 3300025929 | Bacteria | 1611 |
| 442 | Ga0207644_10239554 | 3300025931 | Bacteria | 1444 |
| 443 | Ga0207690_10000138 | 3300025932 | Bacteria | 59404 |
| 444 | Ga0207690_10002810 | 3300025932 | Bacteria | 10508 |
| 445 | Ga0207690_10002895 | 3300025932 | Bacteria | 10343 |
| 446 | Ga0207690_10003142 | 3300025932 | Bacteria | 9917 |
| 447 | Ga0207690_10051003 | 3300025932 | Bacteria | 2765 |
| 448 | Ga0207690_10074563 | 3300025932 | Bacteria | 2350 |
| 449 | Ga0207690_10077466 | 3300025932 | Bacteria | 2311 |
| 450 | Ga0207706_10009106 | 3300025933 | Bacteria | 9129 |
| 451 | Ga0207706_10152053 | 3300025933 | Bacteria | 2035 |
| 452 | Ga0207670_10005511 | 3300025936 | Bacteria | 6957 |
| 453 | Ga0207691_10022061 | 3300025940 | Bacteria | 6007 |
| 454 | Ga0207691_10092693 | 3300025940 | Bacteria | 2705 |
| 455 | Ga0207689_10137571 | 3300025942 | Bacteria | 2011 |
| 456 | Ga0207689_10162490 | 3300025942 | Bacteria | 1840 |
| 457 | Ga0207667_10000219 | 3300025949 | Bacteria | 80218 |
| 458 | Ga0207667_10002626 | 3300025949 | Bacteria | 22232 |
| 459 | Ga0207667_10003053 | 3300025949 | Bacteria | 20770 |
| 460 | Ga0207667_10007466 | 3300025949 | Bacteria | 13136 |
| 461 | Ga0207667_10015699 | 3300025949 | Bacteria | 8589 |
| 462 | Ga0207667_10021746 | 3300025949 | Bacteria | 7106 |
| 463 | Ga0207667_10031108 | 3300025949 | Bacteria | 5764 |
| 464 | Ga0207667_10380849 | 3300025949 | Bacteria | 1437 |
| 465 | Ga0207651_10036454 | 3300025960 | Bacteria | 3211 |
| 466 | Ga0207712_10000910 | 3300025961 | Bacteria | 21443 |
| 467 | Ga0207668_10013757 | 3300025972 | Bacteria | 4992 |
| 468 | Ga0207668_10222940 | 3300025972 | Bacteria | 1515 |
| 469 | Ga0207640_10001957 | 3300025981 | Bacteria | 11091 |
| 470 | Ga0207640_10002433 | 3300025981 | Bacteria | 9958 |
| 471 | Ga0207640_10010933 | 3300025981 | Bacteria | 5121 |
| 472 | Ga0207640_10039046 | 3300025981 | Bacteria | 3001 |
| 473 | Ga0207640_10044999 | 3300025981 | Bacteria | 2832 |
| 474 | Ga0207640_10203347 | 3300025981 | Bacteria | 1503 |
| 475 | Ga0207658_10020832 | 3300025986 | Bacteria | 4542 |
| 476 | Ga0207658_10304492 | 3300025986 | Bacteria | 1374 |
| 477 | Ga0207677_10110499 | 3300026023 | Bacteria | 2046 |
| 478 | Ga0207703_10002638 | 3300026035 | Bacteria | 15454 |
| 479 | Ga0207703_10014170 | 3300026035 | Bacteria | 6217 |
| 480 | Ga0207639_10001276 | 3300026041 | Bacteria | 17007 |
| 481 | Ga0207639_10001781 | 3300026041 | Bacteria | 14501 |
| 482 | Ga0207639_10011087 | 3300026041 | Bacteria | 6253 |
| 483 | Ga0207639_10025673 | 3300026041 | Bacteria | 4274 |
| 484 | Ga0207639_10050968 | 3300026041 | Bacteria | 3146 |
| 485 | Ga0207639_10414708 | 3300026041 | Bacteria | 1216 |
| 486 | Ga0207639_10657079 | 3300026041 | Bacteria | 970 |
| 487 | Ga0207678_10005893 | 3300026067 | Bacteria | 10927 |
| 488 | Ga0207678_10025277 | 3300026067 | Bacteria | 5185 |
| 489 | Ga0207678_10135531 | 3300026067 | Bacteria | 2101 |
| 490 | Ga0207678_10593785 | 3300026067 | Bacteria | 970 |
| 491 | Ga0207702_10000132 | 3300026078 | Bacteria | 88794 |
| 492 | Ga0207702_10000338 | 3300026078 | Bacteria | 53744 |
| 493 | Ga0207702_10160243 | 3300026078 | Bacteria | 2054 |
| 494 | Ga0207702_10247053 | 3300026078 | Bacteria | 1674 |
| 495 | Ga0207702_10504919 | 3300026078 | Bacteria | 1179 |
| 496 | Ga0207641_10039591 | 3300026088 | Bacteria | 3943 |
| 497 | Ga0207641_10089040 | 3300026088 | Bacteria | 2697 |
| 498 | Ga0207641_10098154 | 3300026088 | Bacteria | 2575 |
| 499 | Ga0207641_10193128 | 3300026088 | Bacteria | 1872 |
| 500 | Ga0207641_10255860 | 3300026088 | Bacteria | 1637 |
| 501 | Ga0207648_10049917 | 3300026089 | Bacteria | 3659 |
| 502 | Ga0207648_10167078 | 3300026089 | Bacteria | 1944 |
| 503 | Ga0207676_10009124 | 3300026095 | Bacteria | 7064 |
| 504 | Ga0207674_10000445 | 3300026116 | Bacteria | 53735 |
| 505 | Ga0207674_10007822 | 3300026116 | Bacteria | 12427 |
| 506 | Ga0207674_10012043 | 3300026116 | Bacteria | 9687 |
| 507 | Ga0207674_10051627 | 3300026116 | Bacteria | 4196 |
| 508 | Ga0207674_10067443 | 3300026116 | Bacteria | 3602 |
| 509 | Ga0207674_10105359 | 3300026116 | Bacteria | 2798 |
| 510 | Ga0207674_10218425 | 3300026116 | Bacteria | 1854 |
| 511 | Ga0207683_10049228 | 3300026121 | Bacteria | 3689 |
| 512 | Ga0207683_10145598 | 3300026121 | Bacteria | 2136 |
| 513 | Ga0207698_10162288 | 3300026142 | Bacteria | 1956 |
| 514 | Ga0207698_10203692 | 3300026142 | Bacteria | 1774 |
| 515 | Ga0207698_10240639 | 3300026142 | Bacteria | 1649 |
| 516 | Ga0207698_10241769 | 3300026142 | Bacteria | 1646 |
| 517 | Ga0207698_10344539 | 3300026142 | Bacteria | 1405 |
| 518 | Ga0207698_10521664 | 3300026142 | Bacteria | 1159 |
| 519 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 520 | Ga0268266_10000017 | 3300028379 | Bacteria | 607272 |
| 521 | Ga0268266_10000075 | 3300028379 | Bacteria | 218045 |
| 522 | Ga0268266_10255490 | 3300028379 | Bacteria | 1622 |
| 523 | Ga0268265_10001331 | 3300028380 | Bacteria | 21127 |
| 524 | Ga0268265_10032360 | 3300028380 | Bacteria | 3789 |
| 525 | Ga0268265_10542882 | 3300028380 | Bacteria | 1102 |
| 526 | Ga0268264_10071857 | 3300028381 | Bacteria | 2933 |
| 527 | Ga0268264_10143110 | 3300028381 | Bacteria | 2135 |
| 528 | Ga0265326_10022819 | 3300028558 | Bacteria | 1790 |
| 529 | Ga0265334_10000010 | 3300028573 | Bacteria | 188179 |
| 530 | Ga0265334_10009716 | 3300028573 | Bacteria | 4066 |
| 531 | Ga0265338_10025223 | 3300028800 | Bacteria | 6044 |
| 532 | Ga0265331_10044359 | 3300031250 | Bacteria | 2151 |
| 533 | Ga0265327_10048817 | 3300031251 | Bacteria | 2223 |
| 534 | Ga0307408_100042774 | 3300031548 | Bacteria | 3220 |
| 535 | Ga0265313_10000125 | 3300031595 | Bacteria | 77022 |
| 536 | Ga0265313_10033433 | 3300031595 | Bacteria | 2613 |
| 537 | Ga0316575_10005736 | 3300031665 | Bacteria | 4433 |
| 538 | Ga0316575_10045999 | 3300031665 | Bacteria | 1733 |
| 539 | Ga0316579_10001636 | 3300031691 | Bacteria | 8218 |
| 540 | Ga0316576_10331485 | 3300031727 | Unclassified | 1134 |
| 541 | Ga0307516_10016384 | 3300031730 | Bacteria | 7753 |
| 542 | Ga0316577_10034295 | 3300031733 | Bacteria | 2836 |
| 543 | Ga0307416_100220704 | 3300032002 | Bacteria | 1818 |
| 544 | Ga0307411_10154500 | 3300032005 | Bacteria | 1710 |
| 545 | Ga0307415_100290842 | 3300032126 | Bacteria | 1349 |
| 546 | Ga0316593_10063885 | 3300032168 | Bacteria | 1263 |
| 547 | Ga0307510_10002207 | 3300033180 | Bacteria | 21991 |
| 548 | Ga0373926_0020069 | 3300035083 | Bacteria | 2307 |
| 549 | Ga0373954_0177001 | 3300035118 | Bacteria | 1046 |
| 550 | Ga0316574_0087922 | 3300035398 | Bacteria | 1979 |
| 551 | Ga0316574_0123308 | 3300035398 | Bacteria | 1665 |
| 552 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 553 | Ga0316582_0002724 | 3300036647 | Bacteria | 8392 |
| 554 | Ga0316582_0030543 | 3300036647 | Bacteria | 3283 |
| 555 | Ga0316582_0086870 | 3300036647 | Bacteria | 2052 |
| 556 | Ga0316584_0055286 | 3300036712 | Bacteria | 2972 |
| 557 | Ga0316584_0098219 | 3300036712 | Bacteria | 2192 |
| 558 | Ga0395899_0000110 | 3300037312 | Bacteria | 140811 |
| 559 | Ga0395899_0012571 | 3300037312 | Bacteria | 6488 |
| 560 | Ga0395899_0044042 | 3300037312 | Bacteria | 3326 |
| 561 | Ga0395899_0061640 | 3300037312 | Bacteria | 2762 |
| 562 | Ga0395899_0159318 | 3300037312 | Bacteria | 1595 |
| 563 | Ga0395900_0000049 | 3300037418 | Bacteria | 226847 |
| 564 | Ga0395900_0001309 | 3300037418 | Bacteria | 30258 |
| 565 | Ga0395900_0005124 | 3300037418 | Bacteria | 13762 |
| 566 | Ga0395900_0036270 | 3300037418 | Bacteria | 5082 |
| 567 | Ga0395898_0000023 | 3300037466 | Bacteria | 379477 |
| 568 | Ga0395898_0000237 | 3300037466 | Bacteria | 139991 |
| 569 | Ga0395898_0004579 | 3300037466 | Bacteria | 15091 |
| 570 | Ga0395898_0048634 | 3300037466 | Bacteria | 4157 |
| 571 | Ga0395898_0223178 | 3300037466 | Bacteria | 1797 |
| 572 | Ga0395898_0514194 | 3300037466 | Bacteria | 1138 |
| 573 | Ga0395901_0000873 | 3300038443 | Bacteria | 33251 |
| 574 | Ga0395901_0053236 | 3300038443 | Bacteria | 4206 |
| 575 | Ga0395901_0061952 | 3300038443 | Bacteria | 3892 |
| 576 | Ga0395901_0067604 | 3300038443 | Bacteria | 3722 |
| 577 | Ga0395901_0106254 | 3300038443 | Bacteria | 2946 |
| 578 | Ga0395901_0160744 | 3300038443 | Bacteria | 2359 |
| 579 | Ga0395901_0167601 | 3300038443 | Bacteria | 2305 |
| 580 | Ga0400484_11747 | 3300038725 | Bacteria | 10365 |
| 581 | Ga0400490_02358 | 3300038726 | Bacteria | 3708 |
| 582 | Ga0400490_18961 | 3300038726 | Bacteria | 1300 |
| 583 | Ga0400490_30277 | 3300038726 | Bacteria | 1982 |
| 584 | Ga0400490_43842 | 3300038726 | Bacteria | 5670 |
| 585 | Ga0400485_07224 | 3300038735 | Bacteria | 1976 |
| 586 | Ga0400488_53730 | 3300038741 | Bacteria | 1576 |
| 587 | Ga0400488_60826 | 3300038741 | Bacteria | 1673 |
| 588 | Ga0400486_04121 | 3300038742 | Bacteria | 1871 |
| 589 | Ga0400486_26793 | 3300038742 | Bacteria | 2756 |
| 590 | Ga0400483_103881 | 3300039062 | Bacteria | 3863 |
| 591 | Ga0400483_148714 | 3300039062 | Bacteria | 1963 |
| 592 | Ga0400483_290206 | 3300039062 | Bacteria | 8610 |
| 593 | Ga0400489_54126 | 3300039093 | Bacteria | 1100 |
| 594 | Ga0400487_07673 | 3300039110 | Bacteria | 1549 |
| 595 | Ga0400487_16810 | 3300039110 | Bacteria | 2209 |
| 596 | Ga0439436_0000016 | 3300041404 | Bacteria | 80941 |
| 597 | Ga0439465_0000015 | 3300041413 | Bacteria | 34100 |
| 598 | Ga0451807_0248796 | 3300041486 | Bacteria | 1613 |
| 599 | Ga0451853_0579969 | 3300041512 | Bacteria | 4136 |
| 600 | Ga0439452_020180 | 3300042010 | Bacteria | 1751 |
| 601 | Ga0439462_0043340 | 3300042015 | Bacteria | 1203 |
| 602 | Ga0450908_000014 | 3300042184 | Bacteria | 41620 |
| 603 | Ga0451577_0002835 | 3300042876 | Bacteria | 19940 |
| 604 | Ga0466969_0008578 | 3300044656 | Bacteria | 5422 |
| 605 | Ga0466969_0055518 | 3300044656 | Bacteria | 1937 |
| 606 | Ga0466972_0106509 | 3300044658 | Bacteria | 1325 |
| 607 | Ga0466975_0071941 | 3300044661 | Bacteria | 2469 |
| 608 | Ga0466982_0000018 | 3300044672 | Bacteria | 113912 |
| 609 | Ga0466982_0000063 | 3300044672 | Bacteria | 29669 |
| 610 | Ga0466965_0048618 | 3300044683 | Bacteria | 2101 |
| 611 | Ga0466966_0002133 | 3300044684 | Bacteria | 12818 |
| 612 | Ga0466966_0027281 | 3300044684 | Bacteria | 3724 |
| 613 | Ga0466966_0044340 | 3300044684 | Bacteria | 2847 |
| 614 | Ga0466966_0125883 | 3300044684 | Bacteria | 1571 |
| 615 | Ga0466961_0002932 | 3300044693 | Bacteria | 10591 |
| 616 | Ga0466961_0006126 | 3300044693 | Bacteria | 7631 |
| 617 | Ga0466961_0009482 | 3300044693 | Bacteria | 6200 |
| 618 | Ga0466963_0096881 | 3300044694 | Bacteria | 2015 |
| 619 | Ga0466964_0009495 | 3300044706 | Bacteria | 3665 |
| 620 | Ga0466964_0014585 | 3300044706 | Bacteria | 2989 |
| 621 | Ga0453684_0001318 | 3300044712 | Bacteria | 73362 |
| 622 | Ga0466971_0004604 | 3300044719 | Bacteria | 5958 |
| 623 | Ga0466971_0005321 | 3300044719 | Bacteria | 5582 |
| 624 | Ga0466971_0105084 | 3300044719 | Bacteria | 1300 |
| 625 | Ga0466968_0000215 | 3300044735 | Bacteria | 17905 |
| 626 | Ga0466968_0004358 | 3300044735 | Bacteria | 5283 |
| 627 | Ga0466968_0116575 | 3300044735 | Bacteria | 1205 |
| 628 | Ga0466970_0028072 | 3300044765 | Bacteria | 2955 |
| 629 | Ga0466970_0036680 | 3300044765 | Bacteria | 2597 |
| 630 | Ga0466970_0041328 | 3300044765 | Bacteria | 2449 |
| 631 | Ga0466970_0213805 | 3300044765 | Bacteria | 1075 |
| 632 | Ga0466957_0016106 | 3300044842 | Bacteria | 4369 |
| 633 | Ga0466957_0089139 | 3300044842 | Bacteria | 1931 |
| 634 | Ga0466960_0031795 | 3300044901 | Bacteria | 2437 |
| 635 | Ga0466959_0000265 | 3300045049 | Bacteria | 32152 |
| 636 | Ga0466959_0080423 | 3300045049 | Bacteria | 2349 |
| 637 | Ga0466959_0150125 | 3300045049 | Bacteria | 1643 |
| 638 | Ga0451576_0000628 | 3300045051 | Bacteria | 73375 |
| 639 | Ga0466958_0029415 | 3300045836 | Bacteria | 3260 |
| 640 | Ga0466958_0049622 | 3300045836 | Bacteria | 2539 |
| 641 | Ga0466967_0305623 | 3300045976 | Bacteria | 1531 |
| 642 | Ga0495617_000110 | 3300046452 | Bacteria | 59952 |
| 643 | Ga0495617_000750 | 3300046452 | Bacteria | 15942 |
| 644 | Ga0495590_0066941 | 3300046457 | Bacteria | 1258 |
| 645 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 646 | Ga0495638_0000078 | 3300046460 | Bacteria | 157545 |
| 647 | Ga0495638_0000406 | 3300046460 | Bacteria | 52627 |
| 648 | Ga0495650_0000286 | 3300046471 | Bacteria | 94680 |
| 649 | Ga0495650_0000350 | 3300046471 | Bacteria | 81541 |
| 650 | Ga0495650_0000466 | 3300046471 | Bacteria | 62626 |
| 651 | Ga0495584_0007684 | 3300046491 | Bacteria | 5613 |
| 652 | Ga0495585_0000366 | 3300046492 | Bacteria | 43799 |
| 653 | Ga0495585_0005846 | 3300046492 | Bacteria | 7714 |
| 654 | Ga0495607_0000040 | 3300046501 | Bacteria | 133419 |
| 655 | Ga0495607_0000140 | 3300046501 | Bacteria | 76410 |
| 656 | Ga0495606_0000479 | 3300046507 | Bacteria | 65601 |
| 657 | Ga0495606_0001310 | 3300046507 | Bacteria | 34251 |
| 658 | Ga0495606_0002054 | 3300046507 | Bacteria | 24650 |
| 659 | Ga0495610_0003265 | 3300046512 | Bacteria | 12790 |
| 660 | Ga0495610_0049341 | 3300046512 | Bacteria | 2061 |
| 661 | Ga0495616_0000045 | 3300046513 | Bacteria | 113226 |
| 662 | Ga0495616_0002958 | 3300046513 | Bacteria | 11034 |
| 663 | Ga0495620_0000141 | 3300046515 | Bacteria | 58744 |
| 664 | Ga0495620_0017422 | 3300046515 | Bacteria | 3581 |
| 665 | Ga0495630_0120297 | 3300046517 | Bacteria | 1992 |
| 666 | Ga0495631_0000025 | 3300046518 | Bacteria | 89262 |
| 667 | Ga0495631_0000610 | 3300046518 | Bacteria | 23558 |
| 668 | Ga0495632_0000016 | 3300046519 | Bacteria | 232022 |
| 669 | Ga0495632_0015335 | 3300046519 | Bacteria | 4303 |
| 670 | Ga0495632_0018780 | 3300046519 | Bacteria | 3785 |
| 671 | Ga0495632_0122862 | 3300046519 | Bacteria | 1212 |
| 672 | Ga0495643_0040192 | 3300046522 | Bacteria | 2555 |
| 673 | Ga0495648_0000508 | 3300046524 | Bacteria | 41940 |
| 674 | Ga0495648_0054997 | 3300046524 | Bacteria | 2401 |
| 675 | Ga0495609_0000369 | 3300046538 | Bacteria | 38747 |
| 676 | Ga0495668_0001459 | 3300046616 | Bacteria | 22747 |
| 677 | Ga0495668_0013566 | 3300046616 | Bacteria | 4801 |
| 678 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 679 | Ga0495611_0000073 | 3300046648 | Bacteria | 70704 |
| 680 | Ga0495625_0000041 | 3300046660 | Bacteria | 206598 |
| 681 | Ga0495625_0011746 | 3300046660 | Bacteria | 7117 |
| 682 | Ga0495625_0122101 | 3300046660 | Bacteria | 1771 |
| 683 | Ga0495661_0003999 | 3300046665 | Bacteria | 10750 |
| 684 | Ga0495670_0007981 | 3300046691 | Bacteria | 5206 |
| 685 | Ga0495670_0024078 | 3300046691 | Bacteria | 3007 |
| 686 | Ga0495671_0000182 | 3300046692 | Bacteria | 55867 |
| 687 | Ga0495649_0008764 | 3300046694 | Bacteria | 6065 |
| 688 | Ga0495649_0286209 | 3300046694 | Bacteria | 841 |
| 689 | Ga0495589_0000008 | 3300046794 | Bacteria | 266071 |
| 690 | Ga0495600_0167133 | 3300046809 | Bacteria | 1421 |
| 691 | Ga0495660_0000149 | 3300046810 | Bacteria | 76124 |
| 692 | Ga0495660_0000169 | 3300046810 | Bacteria | 70663 |
| 693 | Ga0495683_0004682 | 3300047323 | Bacteria | 7707 |
| 694 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 695 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 696 | Ga0495673_0000278 | 3300047469 | Bacteria | 69367 |
| 697 | Ga0495673_0001102 | 3300047469 | Bacteria | 23237 |
| 698 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 699 | Ga0495686_0001145 | 3300047472 | Bacteria | 31190 |
| 700 | Ga0495686_0006922 | 3300047472 | Bacteria | 8576 |
| 701 | Ga0496100_0000429 | 3300048903 | Bacteria | 20428 |
| 702 | Ga0496101_0002069 | 3300048904 | Bacteria | 12212 |
| 703 | Ga0496101_0003821 | 3300048904 | Bacteria | 9408 |
| 704 | Ga0496102_0147830 | 3300048905 | Bacteria | 2206 |
| 705 | Ga0496104_0007726 | 3300048907 | Bacteria | 9523 |
| 706 | Ga0496105_0061042 | 3300048908 | Bacteria | 3110 |
| 707 | Ga0496106_0012978 | 3300048909 | Bacteria | 6147 |
| 708 | Ga0496106_0359119 | 3300048909 | Bacteria | 1170 |
| 709 | Ga0496112_0449258 | 3300048915 | Bacteria | 1227 |
| 710 | Ga0496113_0046234 | 3300048916 | Bacteria | 3231 |
| 711 | Ga0496113_0121091 | 3300048916 | Bacteria | 2046 |
| 712 | Ga0496114_0281161 | 3300048917 | Bacteria | 1467 |
| 713 | Ga0496114_0466432 | 3300048917 | Bacteria | 1118 |
| 714 | Ga0496115_0000014 | 3300048918 | Bacteria | 204935 |
| 715 | Ga0496115_0000114 | 3300048918 | Bacteria | 73307 |
| 716 | Ga0496117_0047074 | 3300048920 | Bacteria | 3096 |
| 717 | Ga0496117_0167951 | 3300048920 | Bacteria | 1277 |
| 718 | Ga0496118_0000968 | 3300048921 | Bacteria | 44862 |
| 719 | Ga0496118_0001481 | 3300048921 | Bacteria | 35145 |
| 720 | Ga0496118_0002007 | 3300048921 | Bacteria | 28814 |
| 721 | Ga0496118_0013096 | 3300048921 | Bacteria | 7880 |
| 722 | Ga0496118_0074424 | 3300048921 | Bacteria | 2428 |
| 723 | Ga0496119_0000182 | 3300048922 | Bacteria | 87907 |
| 724 | Ga0496119_0014215 | 3300048922 | Bacteria | 6253 |
| 725 | Ga0496119_0040442 | 3300048922 | Bacteria | 2982 |
| 726 | Ga0496120_0000661 | 3300048923 | Bacteria | 50628 |
| 727 | Ga0496121_0000399 | 3300048924 | Bacteria | 86768 |
| 728 | Ga0496121_0000419 | 3300048924 | Bacteria | 84137 |
| 729 | Ga0496121_0001549 | 3300048924 | Bacteria | 38481 |
| 730 | Ga0496121_0003203 | 3300048924 | Bacteria | 23561 |
| 731 | Ga0496121_0049903 | 3300048924 | Bacteria | 3542 |
| 732 | Ga0496121_0077231 | 3300048924 | Bacteria | 2652 |
| 733 | Ga0496121_0099162 | 3300048924 | Bacteria | 2252 |
| 734 | Ga0496122_0016943 | 3300048925 | Bacteria | 6847 |
| 735 | Ga0496122_0048689 | 3300048925 | Bacteria | 3255 |
| 736 | Ga0496123_0026838 | 3300048926 | Bacteria | 4305 |
| 737 | Ga0496124_0000333 | 3300048927 | Bacteria | 87394 |
| 738 | Ga0496124_0000364 | 3300048927 | Bacteria | 82831 |
| 739 | Ga0496125_0025513 | 3300048928 | Bacteria | 5410 |
| 740 | Ga0496125_0038509 | 3300048928 | Bacteria | 4136 |
| 741 | Ga0496125_0057144 | 3300048928 | Bacteria | 3163 |
| 742 | Ga0496125_0074718 | 3300048928 | Bacteria | 2627 |
| 743 | Ga0496125_0248222 | 3300048928 | Bacteria | 1125 |
| 744 | Ga0496126_0000047 | 3300048929 | Bacteria | 322212 |
| 745 | Ga0496126_0002016 | 3300048929 | Bacteria | 28707 |
| 746 | Ga0496126_0004710 | 3300048929 | Bacteria | 16111 |
| 747 | Ga0496126_0133690 | 3300048929 | Bacteria | 2141 |
| 748 | Ga0496126_0147072 | 3300048929 | Bacteria | 2022 |
| 749 | Ga0495678_000612 | 3300049459 | Bacteria | 33460 |
| 750 | Ga0495682_0002092 | 3300049460 | Bacteria | 9734 |
| 751 | Ga0495682_0007777 | 3300049460 | Bacteria | 4245 |
| 752 | Ga0501031_0036953 | 3300049568 | Bacteria | 3187 |
| 753 | Ga0501031_0038968 | 3300049568 | Bacteria | 3100 |
| 754 | Ga0501031_0209706 | 3300049568 | Bacteria | 1269 |
| 755 | Ga0501032_0005403 | 3300049569 | Bacteria | 9503 |
| 756 | Ga0501032_0012679 | 3300049569 | Bacteria | 6011 |
| 757 | Ga0501032_0020087 | 3300049569 | Bacteria | 4657 |
| 758 | Ga0501032_0035966 | 3300049569 | Bacteria | 3382 |
| 759 | Ga0501033_0000348 | 3300049570 | Bacteria | 43990 |
| 760 | Ga0501033_0001926 | 3300049570 | Bacteria | 18077 |
| 761 | Ga0501033_0038366 | 3300049570 | Bacteria | 3582 |
| 762 | Ga0501033_0087062 | 3300049570 | Bacteria | 2286 |
| 763 | Ga0501033_0336776 | 3300049570 | Bacteria | 1058 |
| 764 | Ga0501034_0005114 | 3300049571 | Bacteria | 14395 |
| 765 | Ga0501034_0009682 | 3300049571 | Bacteria | 10079 |
| 766 | Ga0501034_0056279 | 3300049571 | Bacteria | 3957 |
| 767 | Ga0501034_0146756 | 3300049571 | Bacteria | 2336 |
| 768 | Ga0501034_0314849 | 3300049571 | Bacteria | 1499 |
| 769 | Ga0501036_0009155 | 3300049572 | Bacteria | 8141 |
| 770 | Ga0501036_0036709 | 3300049572 | Bacteria | 4148 |
| 771 | Ga0501036_0053181 | 3300049572 | Bacteria | 3430 |
| 772 | Ga0501036_0086069 | 3300049572 | Bacteria | 2657 |
| 773 | Ga0501036_0244309 | 3300049572 | Bacteria | 1505 |
| 774 | Ga0501037_0014817 | 3300049573 | Bacteria | 5735 |
| 775 | Ga0501037_0015803 | 3300049573 | Bacteria | 5555 |
| 776 | Ga0501037_0016568 | 3300049573 | Bacteria | 5424 |
| 777 | Ga0501037_0053811 | 3300049573 | Bacteria | 2944 |
| 778 | Ga0501037_0062955 | 3300049573 | Bacteria | 2704 |
| 779 | Ga0501037_0128610 | 3300049573 | Bacteria | 1817 |
| 780 | Ga0501038_0002090 | 3300049574 | Bacteria | 18511 |
| 781 | Ga0501038_0004400 | 3300049574 | Bacteria | 13113 |
| 782 | Ga0501038_0125044 | 3300049574 | Bacteria | 2117 |
| 783 | Ga0501038_0220005 | 3300049574 | Bacteria | 1515 |
| 784 | Ga0501039_0112018 | 3300049575 | Bacteria | 2133 |
| 785 | Ga0501039_0351342 | 3300049575 | Bacteria | 1158 |
| 786 | Ga0501040_0213105 | 3300049576 | Bacteria | 1373 |
| 787 | Ga0501043_0014793 | 3300049579 | Bacteria | 6109 |
| 788 | Ga0501043_0018774 | 3300049579 | Bacteria | 5426 |
| 789 | Ga0501043_0027599 | 3300049579 | Bacteria | 4456 |
| 790 | Ga0501043_0041442 | 3300049579 | Bacteria | 3617 |
| 791 | Ga0501043_0048624 | 3300049579 | Bacteria | 3334 |
| 792 | Ga0501043_0049784 | 3300049579 | Bacteria | 3294 |
| 793 | Ga0501043_0174840 | 3300049579 | Bacteria | 1674 |
| 794 | Ga0501043_0285417 | 3300049579 | Bacteria | 1264 |
| 795 | Ga0501043_0349076 | 3300049579 | Bacteria | 1124 |
| 796 | Ga0501046_0007181 | 3300049580 | Bacteria | 9801 |
| 797 | Ga0501046_0017017 | 3300049580 | Bacteria | 6079 |
| 798 | Ga0501046_0020695 | 3300049580 | Bacteria | 5439 |
| 799 | Ga0501046_0045408 | 3300049580 | Bacteria | 3491 |
| 800 | Ga0501046_0062053 | 3300049580 | Bacteria | 2921 |
| 801 | Ga0501047_0002283 | 3300049581 | Bacteria | 18340 |
| 802 | Ga0501047_0002357 | 3300049581 | Bacteria | 18067 |
| 803 | Ga0501047_0009404 | 3300049581 | Bacteria | 9234 |
| 804 | Ga0501047_0022487 | 3300049581 | Bacteria | 6055 |
| 805 | Ga0501047_0037056 | 3300049581 | Bacteria | 4714 |
| 806 | Ga0501047_0048735 | 3300049581 | Bacteria | 4091 |
| 807 | Ga0501047_0088296 | 3300049581 | Bacteria | 2977 |
| 808 | Ga0501047_0173781 | 3300049581 | Bacteria | 2023 |
| 809 | Ga0501047_0203539 | 3300049581 | Bacteria | 1840 |
| 810 | Ga0501047_0578370 | 3300049581 | Bacteria | 946 |
| 811 | Ga0501048_0016969 | 3300049582 | Bacteria | 5366 |
| 812 | Ga0501048_0037248 | 3300049582 | Bacteria | 3492 |
| 813 | Ga0501048_0183181 | 3300049582 | Bacteria | 1485 |
| 814 | Ga0501067_0107094 | 3300049583 | Bacteria | 1553 |
| 815 | Ga0501067_0122715 | 3300049583 | Bacteria | 1446 |
| 816 | Ga0501068_0018324 | 3300049584 | Bacteria | 4055 |
| 817 | Ga0501068_0038322 | 3300049584 | Bacteria | 2871 |
| 818 | Ga0501068_0219789 | 3300049584 | Bacteria | 1207 |
| 819 | Ga0501069_0003346 | 3300049585 | Bacteria | 8230 |
| 820 | Ga0501069_0066495 | 3300049585 | Bacteria | 2016 |
| 821 | Ga0501069_0092224 | 3300049585 | Bacteria | 1713 |
| 822 | Ga0501070_0000326 | 3300049586 | Bacteria | 43230 |
| 823 | Ga0501070_0004534 | 3300049586 | Bacteria | 11920 |
| 824 | Ga0501070_0010746 | 3300049586 | Bacteria | 7735 |
| 825 | Ga0501070_0012984 | 3300049586 | Bacteria | 7021 |
| 826 | Ga0501070_0022914 | 3300049586 | Bacteria | 5227 |
| 827 | Ga0501070_0023118 | 3300049586 | Bacteria | 5206 |
| 828 | Ga0501070_0029077 | 3300049586 | Bacteria | 4634 |
| 829 | Ga0501070_0144692 | 3300049586 | Bacteria | 1962 |
| 830 | Ga0501070_0260550 | 3300049586 | Bacteria | 1417 |
| 831 | Ga0501070_0330234 | 3300049586 | Bacteria | 1239 |
| 832 | Ga0501071_0009415 | 3300049587 | Bacteria | 6503 |
| 833 | Ga0501071_0027058 | 3300049587 | Bacteria | 4032 |
| 834 | Ga0501072_0004448 | 3300049588 | Bacteria | 10646 |
| 835 | Ga0501073_0005962 | 3300049589 | Bacteria | 9091 |
| 836 | Ga0501073_0006378 | 3300049589 | Bacteria | 8778 |
| 837 | Ga0501073_0013747 | 3300049589 | Bacteria | 5888 |
| 838 | Ga0501073_0096556 | 3300049589 | Bacteria | 2052 |
| 839 | Ga0501073_0147484 | 3300049589 | Bacteria | 1630 |
| 840 | Ga0501073_0153741 | 3300049589 | Bacteria | 1594 |
| 841 | Ga0501073_0197764 | 3300049589 | Bacteria | 1390 |
| 842 | Ga0501073_0222727 | 3300049589 | Bacteria | 1303 |
| 843 | Ga0501074_0003509 | 3300049590 | Bacteria | 11133 |
| 844 | Ga0501074_0009116 | 3300049590 | Bacteria | 7206 |
| 845 | Ga0501074_0023223 | 3300049590 | Bacteria | 4510 |
| 846 | Ga0501074_0079919 | 3300049590 | Bacteria | 2346 |
| 847 | Ga0501074_0174608 | 3300049590 | Bacteria | 1533 |
| 848 | Ga0501074_0177145 | 3300049590 | Bacteria | 1521 |
| 849 | Ga0501076_0181898 | 3300049592 | Bacteria | 1714 |
| 850 | Ga0501079_0010160 | 3300049741 | Bacteria | 7146 |
| 851 | Ga0501079_0078559 | 3300049741 | Bacteria | 2552 |
| 852 | Ga0501079_0204370 | 3300049741 | Bacteria | 1543 |
| 853 | Ga0501079_0240688 | 3300049741 | Bacteria | 1414 |
| 854 | Ga0501080_0001852 | 3300049742 | Bacteria | 18163 |
| 855 | Ga0501080_0012301 | 3300049742 | Bacteria | 7840 |
| 856 | Ga0501080_0014254 | 3300049742 | Bacteria | 7319 |
| 857 | Ga0501080_0020322 | 3300049742 | Bacteria | 6145 |
| 858 | Ga0501080_0038414 | 3300049742 | Bacteria | 4469 |
| 859 | Ga0501080_0143426 | 3300049742 | Bacteria | 2208 |
| 860 | Ga0501080_0193486 | 3300049742 | Bacteria | 1868 |
| 861 | Ga0501081_0026930 | 3300049743 | Bacteria | 3879 |
| 862 | Ga0501083_0001507 | 3300049744 | Bacteria | 15917 |
| 863 | Ga0501083_0170180 | 3300049744 | Bacteria | 1424 |
| 864 | Ga0501035_0009202 | 3300049822 | Bacteria | 9185 |
| 865 | Ga0501035_0059449 | 3300049822 | Bacteria | 3403 |
| 866 | Ga0501035_0079624 | 3300049822 | Bacteria | 2894 |
| 867 | Ga0501035_0093689 | 3300049822 | Bacteria | 2642 |
| 868 | Ga0501035_0219622 | 3300049822 | Bacteria | 1623 |
| 869 | Ga0501035_0658303 | 3300049822 | Bacteria | 848 |
| 870 | Ga0501044_0002749 | 3300049823 | Bacteria | 20015 |
| 871 | Ga0501044_0013604 | 3300049823 | Bacteria | 8795 |
| 872 | Ga0501044_0019990 | 3300049823 | Bacteria | 7151 |
| 873 | Ga0501044_0022516 | 3300049823 | Bacteria | 6713 |
| 874 | Ga0501044_0024652 | 3300049823 | Bacteria | 6383 |
| 875 | Ga0501044_0036023 | 3300049823 | Bacteria | 5178 |
| 876 | Ga0501044_0045100 | 3300049823 | Bacteria | 4571 |
| 877 | Ga0501044_0046685 | 3300049823 | Bacteria | 4483 |
| 878 | Ga0501044_0046821 | 3300049823 | Bacteria | 4476 |
| 879 | Ga0501044_0071982 | 3300049823 | Bacteria | 3515 |
| 880 | Ga0501044_0100319 | 3300049823 | Bacteria | 2913 |
| 881 | Ga0501044_0121713 | 3300049823 | Bacteria | 2609 |
| 882 | Ga0501044_0309081 | 3300049823 | Bacteria | 1508 |
| 883 | Ga0501044_0650305 | 3300049823 | Bacteria | 943 |
| 884 | nmdc:mga00v17_26824_c1 | 3300050491 | Bacteria | 3360 |
| 885 | nmdc:mga0n895_162959_c1 | 3300050512 | Bacteria | 2261 |
| 886 | Ga0500643_000020 | 3300053087 | Bacteria | 290328 |
| 887 | Ga0500651_0000415 | 3300053093 | Bacteria | 22937 |
| 888 | Ga0500568_0000367 | 3300053139 | Bacteria | 34838 |
| 889 | Ga0500633_0037073 | 3300053160 | Bacteria | 1616 |
| 890 | Ga0500645_000617 | 3300053730 | Bacteria | 22792 |
| 891 | Ga0501084_0023603 | 3300054114 | Bacteria | 5130 |
| 892 | Ga0501084_0124925 | 3300054114 | Bacteria | 2165 |
| 893 | Ga0501082_0000141 | 3300060353 | Bacteria | 59767 |
| 894 | Ga0501082_0026881 | 3300060353 | Bacteria | 4958 |
| 895 | Ga0501082_0027942 | 3300060353 | Bacteria | 4859 |
| 896 | Ga0501082_0127048 | 3300060353 | Bacteria | 2211 |
| 897 | Ga0466962_0003234 | 3300061719 | Bacteria | 7743 |
| 898 | Ga0466962_0029291 | 3300061719 | Bacteria | 2635 |
| 899 | Ga0466962_0231345 | 3300061719 | Bacteria | 906 |
| 900 | 2538835124 | 2537561836 | Bacteria | 3910579 |
| 901 | 2595446984 | 2593339238 | Bacteria | 4182970 |
| 902 | 2595449742 | 2593339239 | Bacteria | 4124669 |
| 903 | 2643829388 | 2643221562 | Bacteria | 4048635 |
| 904 | 2644475982 | 2643221685 | Bacteria | 3673288 |
| 905 | 2687582028 | 2687453130 | Bacteria | 4227172 |
| 906 | 2721026348 | 2718218334 | Bacteria | 4765486 |
| 907 | 2735833674 | 2734482264 | Unclassified | 5014763 |
| 908 | 2739229324 | 2738543009 | Bacteria | 4944499 |
| 909 | 2739729961 | 2739367700 | Bacteria | 4747630 |
| 910 | 2819564123 | 2818991440 | Bacteria | 4774720 |
| 911 | 2842917676 | 2842914999 | Bacteria | 4419378 |
| 912 | 2842920050 | 2842918807 | Bacteria | 4289178 |
| 913 | 2884341662 | 2884338543 | Bacteria | 4610696 |
| 914 | 2884412997 | 2884411467 | Bacteria | 5246714 |
| 915 | 2904464759 | 2904463128 | Bacteria | 4775606 |
| 916 | 2919088153 | 2919085039 | Bacteria | 4532964 |
| 917 | 2919406273 | 2919404418 | Bacteria | 4232372 |
| 918 | 2919499223 | 2919497567 | Bacteria | 4408621 |
| 919 | 2928965853 | 2928963466 | Bacteria | 5165703 |
| 920 | 2939612893 | 2939611941 | Bacteria | 3892017 |
| 921 | 2941473064 | 2941471342 | Bacteria | 5018624 |
| 922 | 2953995339 | 2953994433 | Bacteria | 4303959 |
| 923 | JGI24736J21556_1003065 | |||
| 924 | JGI24740J21852_10002516 | |||
| 925 | JGI24740J21852_10004620 | |||
| 926 | JGI24739J22299_10002555 | |||
| 927 | JGI24737J22298_10003819 | |||
| 928 | JGI24735J21928_10017069 | |||
| 929 | JGI24738J21930_10016184 | |||
| 930 | JGI25156J39149_1002499 | |||
| 931 | JGI25162J39368_1000997 | |||
| 932 | JGI25162J39368_1001016 | |||
| 933 | JGI25162J39368_1001293 | |||
| 934 | JGI25162J39368_1003388 | |||
| 935 | JGI25162J39368_1010519 | |||
| 936 | JGI25157J39369_1001296 | |||
| 937 | JGI25157J39369_1003130 | |||
| 938 | JGI25157J39369_1003163 | |||
| 939 | JGI25163J39215_1000604 | |||
| 940 | JGI25163J39215_1000836 | |||
| 941 | JGI25164J39214_1000169 | |||
| 942 | JGI25164J39214_1000510 | |||
| 943 | JGI25164J39214_1000517 | |||
| 944 | JGI25164J39214_1000877 | |||
| 945 | JGI25165J46597_1000360 | |||
| 946 | JGI25165J46597_1000562 | |||
| 947 | JGI25165J46597_1001043 | |||
| 948 | JGI25165J46597_1004619 | |||
| 949 | JGI25153J46596_10009316 | |||
| 950 | rootH1_10051601 | |||
| 951 | rootH1_10145377 | |||
| 952 | rootH2_10021538 | |||
| 953 | Ga0006562J51391_1028147 | |||
| 954 | Ga0006562J51391_1057626 | |||
| 955 | Ga0055539_1001724 | |||
| 956 | Ga0055525_1000464 | |||
| 957 | Ga0055527_1000053 | |||
| 958 | Ga0055527_1000116 | |||
| 959 | Ga0055535_1000296 | |||
| 960 | Ga0055535_1000298 | |||
| 961 | Ga0055535_1000667 | |||
| 962 | Ga0055535_1001282 | |||
| 963 | Ga0055535_1001752 | |||
| 964 | Ga0055542_1000056 | |||
| 965 | Ga0055542_1000187 | |||
| 966 | Ga0055542_1000277 | |||
| 967 | Ga0055542_1000323 | |||
| 968 | Ga0055542_1000387 | |||
| 969 | Ga0055542_1001002 | |||
| 970 | Ga0055529_1000264 | |||
| 971 | Ga0055529_1000298 | |||
| 972 | Ga0055529_1000415 | |||
| 973 | Ga0055529_1001224 | |||
| 974 | Ga0055526_1028093 | |||
| 975 | Ga0055536_1019305 | |||
| 976 | Ga0055530_10010387 | |||
| 977 | Ga0055531_10010638 | |||
| 978 | Ga0055531_10023299 | |||
| 979 | Ga0065165_1000700 | |||
| 980 | Ga0065165_1019690 | |||
| 981 | Ga0065714_10089290 | |||
| 982 | Ga0070658_10001497 | |||
| 983 | Ga0070676_10159477 | |||
| 984 | Ga0070670_100014157 | |||
| 985 | Ga0068869_100235721 | |||
| 986 | Ga0070666_10000013 | |||
| 987 | Ga0070666_10002022 | |||
| 988 | Ga0070666_10036820 | |||
| 989 | Ga0070680_100000291 | |||
| 990 | Ga0070680_100034991 | |||
| 991 | Ga0070680_100065827 | |||
| 992 | Ga0070680_100187766 | |||
| 993 | Ga0070680_100705842 | |||
| 994 | Ga0070682_100001023 | |||
| 995 | Ga0070682_100003056 | |||
| 996 | Ga0070682_100047125 | |||
| 997 | Ga0068868_100060167 | |||
| 998 | Ga0070660_100046238 | |||
| 999 | Ga0070660_100225080 | |||
| 1000 | Ga0070689_100002032 | |||
| 1001 | Ga0070691_10077010 | |||
| 1002 | Ga0070661_100014293 | |||
| 1003 | Ga0070661_100018614 | |||
| 1004 | Ga0070661_100027727 | |||
| 1005 | Ga0070661_100054393 | |||
| 1006 | Ga0070661_100085715 | |||
| 1007 | Ga0070661_100217364 | |||
| 1008 | Ga0070661_100374397 | |||
| 1009 | Ga0070692_10033272 | |||
| 1010 | Ga0070668_100123170 | |||
| 1011 | Ga0070674_100431921 | |||
| 1012 | Ga0070673_100129337 | |||
| 1013 | Ga0070659_100002227 | |||
| 1014 | Ga0070659_100063344 | |||
| 1015 | Ga0070659_100116351 | |||
| 1016 | Ga0070659_100184188 | |||
| 1017 | Ga0070667_100049159 | |||
| 1018 | Ga0070667_100347652 | |||
| 1019 | Ga0070667_100674886 | |||
| 1020 | Ga0070714_100000020 | |||
| 1021 | Ga0070714_100015093 | |||
| 1022 | Ga0070714_100019341 | |||
| 1023 | Ga0070714_100050368 | |||
| 1024 | Ga0070713_100001409 | |||
| 1025 | Ga0070713_100161252 | |||
| 1026 | Ga0070711_100203830 | |||
| 1027 | Ga0070711_100453511 | |||
| 1028 | Ga0070700_100247848 | |||
| 1029 | Ga0070694_100027486 | |||
| 1030 | Ga0070663_100022581 | |||
| 1031 | Ga0070663_100073934 | |||
| 1032 | Ga0070663_100180617 | |||
| 1033 | Ga0070678_100060529 | |||
| 1034 | Ga0070678_100154504 | |||
| 1035 | Ga0070662_100083262 | |||
| 1036 | Ga0070662_100314460 | |||
| 1037 | Ga0070681_10000006 | |||
| 1038 | Ga0070681_10007337 | |||
| 1039 | Ga0070681_10011412 | |||
| 1040 | Ga0070681_10019530 | |||
| 1041 | Ga0070681_10051145 | |||
| 1042 | Ga0070681_10066806 | |||
| 1043 | Ga0070681_10145470 | |||
| 1044 | Ga0068867_100195727 | |||
| 1045 | Ga0070685_10010301 | |||
| 1046 | Ga0070679_100000207 | |||
| 1047 | Ga0070684_100186482 | |||
| 1048 | Ga0068853_100002190 | |||
| 1049 | Ga0068853_100104364 | |||
| 1050 | Ga0068853_100111514 | |||
| 1051 | Ga0068853_100140414 | |||
| 1052 | Ga0068853_100167334 | |||
| 1053 | Ga0070672_100073410 | |||
| 1054 | Ga0070686_100060673 | |||
| 1055 | Ga0070696_100007413 | |||
| 1056 | Ga0070696_100022947 | |||
| 1057 | Ga0070696_100269827 | |||
| 1058 | Ga0070696_100498915 | |||
| 1059 | Ga0070693_100013764 | |||
| 1060 | Ga0070693_100015213 | |||
| 1061 | Ga0070693_100054239 | |||
| 1062 | Ga0070665_100000100 | |||
| 1063 | Ga0070665_100001350 | |||
| 1064 | Ga0070665_100071557 | |||
| 1065 | Ga0070665_100073872 | |||
| 1066 | Ga0068855_100014910 | |||
| 1067 | Ga0068855_100108448 | |||
| 1068 | Ga0068855_100141865 | |||
| 1069 | Ga0068855_100312103 | |||
| 1070 | Ga0068857_100034725 | |||
| 1071 | Ga0068857_100046125 | |||
| 1072 | Ga0068857_100058255 | |||
| 1073 | Ga0068857_100122926 | |||
| 1074 | Ga0068857_100279371 | |||
| 1075 | Ga0068854_100003203 | |||
| 1076 | Ga0068854_100003650 | |||
| 1077 | Ga0068854_100026043 | |||
| 1078 | Ga0068854_100034159 | |||
| 1079 | Ga0068854_100057110 | |||
| 1080 | Ga0068854_100413361 | |||
| 1081 | Ga0068856_100000882 | |||
| 1082 | Ga0068856_100003051 | |||
| 1083 | Ga0068856_100025778 | |||
| 1084 | Ga0068856_100144933 | |||
| 1085 | Ga0068852_100031237 | |||
| 1086 | Ga0068852_100249539 | |||
| 1087 | Ga0068859_100000712 | |||
| 1088 | Ga0068859_100781613 | |||
| 1089 | Ga0068864_100044068 | |||
| 1090 | Ga0068864_100168454 | |||
| 1091 | Ga0068851_10008194 | |||
| 1092 | Ga0068851_10016801 | |||
| 1093 | Ga0068851_10048722 | |||
| 1094 | Ga0068851_10260097 | |||
| 1095 | Ga0068863_100027559 | |||
| 1096 | Ga0068863_100042126 | |||
| 1097 | Ga0068863_100100704 | |||
| 1098 | Ga0068863_100245002 | |||
| 1099 | Ga0068863_100246604 | |||
| 1100 | Ga0068863_100358085 | |||
| 1101 | Ga0068858_100001088 | |||
| 1102 | Ga0068858_100010755 | |||
| 1103 | Ga0068858_100176842 | |||
| 1104 | Ga0068860_100066163 | |||
| 1105 | Ga0068860_100291893 | |||
| 1106 | Ga0068862_100001541 | |||
| 1107 | Ga0068862_100065416 | |||
| 1108 | Ga0081540_1001452 | |||
| 1109 | Ga0097621_100058639 | |||
| 1110 | Ga0068871_100007828 | |||
| 1111 | Ga0068871_100031831 | |||
| 1112 | Ga0068871_100292652 | |||
| 1113 | Ga0068871_100384656 | |||
| 1114 | Ga0068865_100023502 | |||
| 1115 | Ga0097620_100000712 | |||
| 1116 | Ga0097620_100781610 | |||
| 1117 | Ga0105240_10002526 | |||
| 1118 | Ga0105240_10008269 | |||
| 1119 | Ga0105240_10077292 | |||
| 1120 | Ga0105240_10314102 | |||
| 1121 | Ga0105240_10715685 | |||
| 1122 | Ga0105247_10000994 | |||
| 1123 | Ga0105247_10046858 | |||
| 1124 | Ga0105241_10320818 | |||
| 1125 | Ga0105248_10055311 | |||
| 1126 | Ga0105248_10083302 | |||
| 1127 | Ga0105248_10179838 | |||
| 1128 | Ga0105248_10193928 | |||
| 1129 | Ga0105237_10000292 | |||
| 1130 | Ga0105237_10001255 | |||
| 1131 | Ga0105237_10069164 | |||
| 1132 | Ga0105237_10127922 | |||
| 1133 | Ga0105237_10130108 | |||
| 1134 | Ga0105237_10257373 | |||
| 1135 | Ga0105238_10000131 | |||
| 1136 | Ga0105238_10002315 | |||
| 1137 | Ga0105238_10008019 | |||
| 1138 | Ga0105238_10053714 | |||
| 1139 | Ga0105238_10059444 | |||
| 1140 | Ga0105238_10110292 | |||
| 1141 | Ga0105238_10148432 | |||
| 1142 | Ga0105238_10228643 | |||
| 1143 | Ga0105249_10003406 | |||
| 1144 | Ga0105239_10001711 | |||
| 1145 | Ga0105239_10017137 | |||
| 1146 | Ga0105239_10080197 | |||
| 1147 | Ga0105239_10105998 | |||
| 1148 | Ga0105239_10147002 | |||
| 1149 | Ga0105246_10024032 | |||
| 1150 | Ga0157314_1000159 | |||
| 1151 | Ga0157373_10002912 | |||
| 1152 | Ga0157373_10077647 | |||
| 1153 | Ga0157373_10111594 | |||
| 1154 | Ga0157373_10378432 | |||
| 1155 | Ga0157371_10004953 | |||
| 1156 | Ga0157371_10236209 | |||
| 1157 | Ga0157370_10003809 | |||
| 1158 | Ga0157370_10004261 | |||
| 1159 | Ga0157370_10012899 | |||
| 1160 | Ga0157370_10018653 | |||
| 1161 | Ga0157370_10069448 | |||
| 1162 | Ga0157370_10117478 | |||
| 1163 | Ga0157369_10000529 | |||
| 1164 | Ga0157369_10041539 | |||
| 1165 | Ga0157369_10221111 | |||
| 1166 | Ga0157369_10399687 | |||
| 1167 | Ga0157369_10432558 | |||
| 1168 | Ga0157369_10455937 | |||
| 1169 | Ga0157374_10200077 | |||
| 1170 | Ga0157374_10366630 | |||
| 1171 | Ga0157374_10476995 | |||
| 1172 | Ga0157378_10000597 | |||
| 1173 | Ga0157378_10080956 | |||
| 1174 | Ga0163162_10000221 | |||
| 1175 | Ga0163162_10040418 | |||
| 1176 | Ga0163162_10053140 | |||
| 1177 | Ga0157372_10004293 | |||
| 1178 | Ga0157372_10006042 | |||
| 1179 | Ga0157372_10019593 | |||
| 1180 | Ga0157372_10021196 | |||
| 1181 | Ga0157372_10038983 | |||
| 1182 | Ga0157372_10068313 | |||
| 1183 | Ga0157372_10079085 | |||
| 1184 | Ga0157372_10097690 | |||
| 1185 | Ga0157372_10117989 | |||
| 1186 | Ga0157372_10126400 | |||
| 1187 | Ga0157372_10337848 | |||
| 1188 | Ga0157375_10012477 | |||
| 1189 | Ga0157375_10393455 | |||
| 1190 | Ga0157380_10410091 | |||
| 1191 | Ga0182008_10008499 | |||
| 1192 | Ga0157379_10006942 | |||
| 1193 | Ga0157379_10144554 | |||
| 1194 | Ga0157379_10320195 | |||
| 1195 | Ga0157379_10459009 | |||
| 1196 | Ga0157376_10016625 | |||
| 1197 | Ga0157376_10020307 | |||
| 1198 | Ga0157376_10319423 | |||
| 1199 | Ga0157376_10614567 | |||
| 1200 | Ga0182006_1000093 | |||
| 1201 | Ga0182006_1000416 | |||
| 1202 | Ga0182007_10002081 | |||
| 1203 | Ga0182007_10004848 | |||
| 1204 | Ga0182005_1000536 | |||
| 1205 | Ga0182005_1008634 | |||
| 1206 | Ga0182005_1010115 | |||
| 1207 | Ga0183369_1003 | |||
| 1208 | Ga0183368_1003 | |||
| 1209 | Ga0163161_10000685 | |||
| 1210 | Ga0163161_10040488 | |||
| 1211 | Ga0163161_10086853 | |||
| 1212 | Ga0206356_10643678 | |||
| 1213 | Ga0206353_11323503 | |||
| 1214 | Ga0206353_11660574 | |||
| 1215 | Ga0209760_100616 | |||
| 1216 | Ga0209784_100422 | |||
| 1217 | Ga0209566_101298 | |||
| 1218 | Ga0209674_100012 | |||
| 1219 | Ga0209674_100077 | |||
| 1220 | Ga0209674_100642 | |||
| 1221 | Ga0209674_100983 | |||
| 1222 | Ga0209674_102647 | |||
| 1223 | Ga0209672_100004 | |||
| 1224 | Ga0209672_100022 | |||
| 1225 | Ga0209672_100476 | |||
| 1226 | Ga0209672_101466 | |||
| 1227 | Ga0209563_100103 | |||
| 1228 | Ga0207427_100111 | |||
| 1229 | Ga0207427_100175 | |||
| 1230 | Ga0207427_100179 | |||
| 1231 | Ga0207427_100304 | |||
| 1232 | Ga0207427_102993 | |||
| 1233 | Ga0207427_110925 | |||
| 1234 | Ga0209437_100099 | |||
| 1235 | Ga0209437_100269 | |||
| 1236 | Ga0209437_100270 | |||
| 1237 | Ga0209437_100368 | |||
| 1238 | Ga0209437_100384 | |||
| 1239 | Ga0209437_102555 | |||
| 1240 | Ga0209437_106531 | |||
| 1241 | Ga0209258_100003 | |||
| 1242 | Ga0209258_100004 | |||
| 1243 | Ga0209258_100119 | |||
| 1244 | Ga0209258_100137 | |||
| 1245 | Ga0209258_100182 | |||
| 1246 | Ga0209258_100849 | |||
| 1247 | Ga0209646_1000986 | |||
| 1248 | Ga0209646_1001576 | |||
| 1249 | Ga0209646_1005596 | |||
| 1250 | Ga0209026_1000175 | |||
| 1251 | Ga0209026_1000242 | |||
| 1252 | Ga0209026_1000276 | |||
| 1253 | Ga0209026_1000504 | |||
| 1254 | Ga0209026_1001966 | |||
| 1255 | Ga0209026_1006043 | |||
| 1256 | Ga0209677_110280 | |||
| 1257 | Ga0209148_1000005 | |||
| 1258 | Ga0209148_1000025 | |||
| 1259 | Ga0209148_1000036 | |||
| 1260 | Ga0209148_1000062 | |||
| 1261 | Ga0209148_1000083 | |||
| 1262 | Ga0209148_1000137 | |||
| 1263 | Ga0209148_1001922 | |||
| 1264 | Ga0209759_1000136 | |||
| 1265 | Ga0209759_1003929 | |||
| 1266 | Ga0209759_1008606 | |||
| 1267 | Ga0209759_1009273 | |||
| 1268 | Ga0209759_1014828 | |||
| 1269 | Ga0209129_1001516 | |||
| 1270 | Ga0209233_1000040 | |||
| 1271 | Ga0209233_1000075 | |||
| 1272 | Ga0209233_1000077 | |||
| 1273 | Ga0209233_1000128 | |||
| 1274 | Ga0209233_1006779 | |||
| 1275 | Ga0209455_1000004 | |||
| 1276 | Ga0209455_1000040 | |||
| 1277 | Ga0209455_1000084 | |||
| 1278 | Ga0209455_1000095 | |||
| 1279 | Ga0209455_1000164 | |||
| 1280 | Ga0209675_1010375 | |||
| 1281 | Ga0209676_1003628 | |||
| 1282 | Ga0209676_1004464 | |||
| 1283 | Ga0209025_1001565 | |||
| 1284 | Ga0209025_1040053 | |||
| 1285 | Ga0209564_1038640 | |||
| 1286 | Ga0209758_1002651 | |||
| 1287 | Ga0209758_1003842 | |||
| 1288 | Ga0209758_1030526 | |||
| 1289 | Ga0209050_1000712 | |||
| 1290 | Ga0209256_1002872 | |||
| 1291 | Ga0209256_1011746 | |||
| 1292 | Ga0209256_1019927 | |||
| 1293 | Ga0209051_1012143 | |||
| 1294 | Ga0209051_1051734 | |||
| 1295 | Ga0209257_1000210 | |||
| 1296 | Ga0209257_1000792 | |||
| 1297 | Ga0209257_1000856 | |||
| 1298 | Ga0209257_1009432 | |||
| 1299 | Ga0207656_10006257 | |||
| 1300 | Ga0207710_10015097 | |||
| 1301 | Ga0207680_10000001 | |||
| 1302 | Ga0207680_10131591 | |||
| 1303 | Ga0207647_10000505 | |||
| 1304 | Ga0207647_10001812 | |||
| 1305 | Ga0207647_10004982 | |||
| 1306 | Ga0207647_10012646 | |||
| 1307 | Ga0207647_10034080 | |||
| 1308 | Ga0207647_10082383 | |||
| 1309 | Ga0207647_10095622 | |||
| 1310 | Ga0207699_10198393 | |||
| 1311 | Ga0207645_10080512 | |||
| 1312 | Ga0207705_10001749 | |||
| 1313 | Ga0207705_10006682 | |||
| 1314 | Ga0207705_10009407 | |||
| 1315 | Ga0207705_10042602 | |||
| 1316 | Ga0207705_10120522 | |||
| 1317 | Ga0207654_10010017 | |||
| 1318 | Ga0207707_10015416 | |||
| 1319 | Ga0207707_10017428 | |||
| 1320 | Ga0207707_10074164 | |||
| 1321 | Ga0207695_10000588 | |||
| 1322 | Ga0207695_10001221 | |||
| 1323 | Ga0207695_10004028 | |||
| 1324 | Ga0207695_10005207 | |||
| 1325 | Ga0207695_10021315 | |||
| 1326 | Ga0207695_10036666 | |||
| 1327 | Ga0207695_10103332 | |||
| 1328 | Ga0207695_10320295 | |||
| 1329 | Ga0207671_10000011 | |||
| 1330 | Ga0207671_10001034 | |||
| 1331 | Ga0207671_10022794 | |||
| 1332 | Ga0207671_10181031 | |||
| 1333 | Ga0207693_10405722 | |||
| 1334 | Ga0207663_10225792 | |||
| 1335 | Ga0207663_10243526 | |||
| 1336 | Ga0207663_10297875 | |||
| 1337 | Ga0207660_10018727 | |||
| 1338 | Ga0207660_10190204 | |||
| 1339 | Ga0207657_10042581 | |||
| 1340 | Ga0207657_10099172 | |||
| 1341 | Ga0207657_10112915 | |||
| 1342 | Ga0207657_10294805 | |||
| 1343 | Ga0207657_10406232 | |||
| 1344 | Ga0207649_10036870 | |||
| 1345 | Ga0207649_10045564 | |||
| 1346 | Ga0207649_10068356 | |||
| 1347 | Ga0207649_10170829 | |||
| 1348 | Ga0207652_10003552 | |||
| 1349 | Ga0207652_10141772 | |||
| 1350 | Ga0207694_10000168 | |||
| 1351 | Ga0207694_10000569 | |||
| 1352 | Ga0207694_10010204 | |||
| 1353 | Ga0207694_10035516 | |||
| 1354 | Ga0207694_10039308 | |||
| 1355 | Ga0207694_10176486 | |||
| 1356 | Ga0207694_10373064 | |||
| 1357 | Ga0207650_10006083 | |||
| 1358 | Ga0207650_10031247 | |||
| 1359 | Ga0207700_10000786 | |||
| 1360 | Ga0207664_10000023 | |||
| 1361 | Ga0207664_10014270 | |||
| 1362 | Ga0207664_10019584 | |||
| 1363 | Ga0207664_10230146 | |||
| 1364 | Ga0207644_10239554 | |||
| 1365 | Ga0207690_10000138 | |||
| 1366 | Ga0207690_10002810 | |||
| 1367 | Ga0207690_10002895 | |||
| 1368 | Ga0207690_10003142 | |||
| 1369 | Ga0207690_10051003 | |||
| 1370 | Ga0207690_10074563 | |||
| 1371 | Ga0207690_10077466 | |||
| 1372 | Ga0207706_10009106 | |||
| 1373 | Ga0207706_10152053 | |||
| 1374 | Ga0207670_10005511 | |||
| 1375 | Ga0207691_10022061 | |||
| 1376 | Ga0207691_10092693 | |||
| 1377 | Ga0207689_10137571 | |||
| 1378 | Ga0207689_10162490 | |||
| 1379 | Ga0207667_10000219 | |||
| 1380 | Ga0207667_10002626 | |||
| 1381 | Ga0207667_10003053 | |||
| 1382 | Ga0207667_10007466 | |||
| 1383 | Ga0207667_10015699 | |||
| 1384 | Ga0207667_10021746 | |||
| 1385 | Ga0207667_10031108 | |||
| 1386 | Ga0207667_10380849 | |||
| 1387 | Ga0207651_10036454 | |||
| 1388 | Ga0207712_10000910 | |||
| 1389 | Ga0207668_10013757 | |||
| 1390 | Ga0207668_10222940 | |||
| 1391 | Ga0207640_10001957 | |||
| 1392 | Ga0207640_10002433 | |||
| 1393 | Ga0207640_10010933 | |||
| 1394 | Ga0207640_10039046 | |||
| 1395 | Ga0207640_10044999 | |||
| 1396 | Ga0207640_10203347 | |||
| 1397 | Ga0207658_10020832 | |||
| 1398 | Ga0207658_10304492 | |||
| 1399 | Ga0207677_10110499 | |||
| 1400 | Ga0207703_10002638 | |||
| 1401 | Ga0207703_10014170 | |||
| 1402 | Ga0207639_10001276 | |||
| 1403 | Ga0207639_10001781 | |||
| 1404 | Ga0207639_10011087 | |||
| 1405 | Ga0207639_10025673 | |||
| 1406 | Ga0207639_10050968 | |||
| 1407 | Ga0207639_10414708 | |||
| 1408 | Ga0207639_10657079 | |||
| 1409 | Ga0207678_10005893 | |||
| 1410 | Ga0207678_10025277 | |||
| 1411 | Ga0207678_10135531 | |||
| 1412 | Ga0207678_10593785 | |||
| 1413 | Ga0207702_10000132 | |||
| 1414 | Ga0207702_10000338 | |||
| 1415 | Ga0207702_10160243 | |||
| 1416 | Ga0207702_10247053 | |||
| 1417 | Ga0207702_10504919 | |||
| 1418 | Ga0207641_10039591 | |||
| 1419 | Ga0207641_10089040 | |||
| 1420 | Ga0207641_10098154 | |||
| 1421 | Ga0207641_10193128 | |||
| 1422 | Ga0207641_10255860 | |||
| 1423 | Ga0207648_10049917 | |||
| 1424 | Ga0207648_10167078 | |||
| 1425 | Ga0207676_10009124 | |||
| 1426 | Ga0207674_10000445 | |||
| 1427 | Ga0207674_10007822 | |||
| 1428 | Ga0207674_10012043 | |||
| 1429 | Ga0207674_10051627 | |||
| 1430 | Ga0207674_10067443 | |||
| 1431 | Ga0207674_10105359 | |||
| 1432 | Ga0207674_10218425 | |||
| 1433 | Ga0207683_10049228 | |||
| 1434 | Ga0207683_10145598 | |||
| 1435 | Ga0207698_10162288 | |||
| 1436 | Ga0207698_10203692 | |||
| 1437 | Ga0207698_10240639 | |||
| 1438 | Ga0207698_10241769 | |||
| 1439 | Ga0207698_10344539 | |||
| 1440 | Ga0207698_10521664 | |||
| 1441 | Ga0268266_10000008 | |||
| 1442 | Ga0268266_10000017 | |||
| 1443 | Ga0268266_10000075 | |||
| 1444 | Ga0268266_10255490 | |||
| 1445 | Ga0268265_10001331 | |||
| 1446 | Ga0268265_10032360 | |||
| 1447 | Ga0268265_10542882 | |||
| 1448 | Ga0268264_10071857 | |||
| 1449 | Ga0268264_10143110 | |||
| 1450 | Ga0265326_10022819 | |||
| 1451 | Ga0265334_10000010 | |||
| 1452 | Ga0265334_10009716 | |||
| 1453 | Ga0265338_10025223 | |||
| 1454 | Ga0265331_10044359 | |||
| 1455 | Ga0265327_10048817 | |||
| 1456 | Ga0307408_100042774 | |||
| 1457 | Ga0265313_10000125 | |||
| 1458 | Ga0265313_10033433 | |||
| 1459 | Ga0316575_10005736 | |||
| 1460 | Ga0316575_10045999 | |||
| 1461 | Ga0316579_10001636 | |||
| 1462 | Ga0316576_10331485 | |||
| 1463 | Ga0307516_10016384 | |||
| 1464 | Ga0316577_10034295 | |||
| 1465 | Ga0307416_100220704 | |||
| 1466 | Ga0307411_10154500 | |||
| 1467 | Ga0307415_100290842 | |||
| 1468 | Ga0316593_10063885 | |||
| 1469 | Ga0307510_10002207 | |||
| 1470 | Ga0373926_0020069 | |||
| 1471 | Ga0373954_0177001 | |||
| 1472 | Ga0316574_0087922 | |||
| 1473 | Ga0316574_0123308 | |||
| 1474 | Ga0373927_0000002 | |||
| 1475 | Ga0316582_0002724 | |||
| 1476 | Ga0316582_0030543 | |||
| 1477 | Ga0316582_0086870 | |||
| 1478 | Ga0316584_0055286 | |||
| 1479 | Ga0316584_0098219 | |||
| 1480 | Ga0395899_0000110 | |||
| 1481 | Ga0395899_0012571 | |||
| 1482 | Ga0395899_0044042 | |||
| 1483 | Ga0395899_0061640 | |||
| 1484 | Ga0395899_0159318 | |||
| 1485 | Ga0395900_0000049 | |||
| 1486 | Ga0395900_0001309 | |||
| 1487 | Ga0395900_0005124 | |||
| 1488 | Ga0395900_0036270 | |||
| 1489 | Ga0395898_0000023 | |||
| 1490 | Ga0395898_0000237 | |||
| 1491 | Ga0395898_0004579 | |||
| 1492 | Ga0395898_0048634 | |||
| 1493 | Ga0395898_0223178 | |||
| 1494 | Ga0395898_0514194 | |||
| 1495 | Ga0395901_0000873 | |||
| 1496 | Ga0395901_0053236 | |||
| 1497 | Ga0395901_0061952 | |||
| 1498 | Ga0395901_0067604 | |||
| 1499 | Ga0395901_0106254 | |||
| 1500 | Ga0395901_0160744 | |||
| 1501 | Ga0395901_0167601 | |||
| 1502 | Ga0400484_11747 | |||
| 1503 | Ga0400490_02358 | |||
| 1504 | Ga0400490_18961 | |||
| 1505 | Ga0400490_30277 | |||
| 1506 | Ga0400490_43842 | |||
| 1507 | Ga0400485_07224 | |||
| 1508 | Ga0400488_53730 | |||
| 1509 | Ga0400488_60826 | |||
| 1510 | Ga0400486_04121 | |||
| 1511 | Ga0400486_26793 | |||
| 1512 | Ga0400483_103881 | |||
| 1513 | Ga0400483_148714 | |||
| 1514 | Ga0400483_290206 | |||
| 1515 | Ga0400489_54126 | |||
| 1516 | Ga0400487_07673 | |||
| 1517 | Ga0400487_16810 | |||
| 1518 | Ga0439436_0000016 | |||
| 1519 | Ga0439465_0000015 | |||
| 1520 | Ga0451807_0248796 | |||
| 1521 | Ga0451853_0579969 | |||
| 1522 | Ga0439452_020180 | |||
| 1523 | Ga0439462_0043340 | |||
| 1524 | Ga0450908_000014 | |||
| 1525 | Ga0451577_0002835 | |||
| 1526 | Ga0466969_0008578 | |||
| 1527 | Ga0466969_0055518 | |||
| 1528 | Ga0466972_0106509 | |||
| 1529 | Ga0466975_0071941 | |||
| 1530 | Ga0466982_0000018 | |||
| 1531 | Ga0466982_0000063 | |||
| 1532 | Ga0466965_0048618 | |||
| 1533 | Ga0466966_0002133 | |||
| 1534 | Ga0466966_0027281 | |||
| 1535 | Ga0466966_0044340 | |||
| 1536 | Ga0466966_0125883 | |||
| 1537 | Ga0466961_0002932 | |||
| 1538 | Ga0466961_0006126 | |||
| 1539 | Ga0466961_0009482 | |||
| 1540 | Ga0466963_0096881 | |||
| 1541 | Ga0466964_0009495 | |||
| 1542 | Ga0466964_0014585 | |||
| 1543 | Ga0453684_0001318 | |||
| 1544 | Ga0466971_0004604 | |||
| 1545 | Ga0466971_0005321 | |||
| 1546 | Ga0466971_0105084 | |||
| 1547 | Ga0466968_0000215 | |||
| 1548 | Ga0466968_0004358 | |||
| 1549 | Ga0466968_0116575 | |||
| 1550 | Ga0466970_0028072 | |||
| 1551 | Ga0466970_0036680 | |||
| 1552 | Ga0466970_0041328 | |||
| 1553 | Ga0466970_0213805 | |||
| 1554 | Ga0466957_0016106 | |||
| 1555 | Ga0466957_0089139 | |||
| 1556 | Ga0466960_0031795 | |||
| 1557 | Ga0466959_0000265 | |||
| 1558 | Ga0466959_0080423 | |||
| 1559 | Ga0466959_0150125 | |||
| 1560 | Ga0451576_0000628 | |||
| 1561 | Ga0466958_0029415 | |||
| 1562 | Ga0466958_0049622 | |||
| 1563 | Ga0466967_0305623 | |||
| 1564 | Ga0495617_000110 | |||
| 1565 | Ga0495617_000750 | |||
| 1566 | Ga0495590_0066941 | |||
| 1567 | Ga0495638_0000019 | |||
| 1568 | Ga0495638_0000078 | |||
| 1569 | Ga0495638_0000406 | |||
| 1570 | Ga0495650_0000286 | |||
| 1571 | Ga0495650_0000350 | |||
| 1572 | Ga0495650_0000466 | |||
| 1573 | Ga0495584_0007684 | |||
| 1574 | Ga0495585_0000366 | |||
| 1575 | Ga0495585_0005846 | |||
| 1576 | Ga0495607_0000040 | |||
| 1577 | Ga0495607_0000140 | |||
| 1578 | Ga0495606_0000479 | |||
| 1579 | Ga0495606_0001310 | |||
| 1580 | Ga0495606_0002054 | |||
| 1581 | Ga0495610_0003265 | |||
| 1582 | Ga0495610_0049341 | |||
| 1583 | Ga0495616_0000045 | |||
| 1584 | Ga0495616_0002958 | |||
| 1585 | Ga0495620_0000141 | |||
| 1586 | Ga0495620_0017422 | |||
| 1587 | Ga0495630_0120297 | |||
| 1588 | Ga0495631_0000025 | |||
| 1589 | Ga0495631_0000610 | |||
| 1590 | Ga0495632_0000016 | |||
| 1591 | Ga0495632_0015335 | |||
| 1592 | Ga0495632_0018780 | |||
| 1593 | Ga0495632_0122862 | |||
| 1594 | Ga0495643_0040192 | |||
| 1595 | Ga0495648_0000508 | |||
| 1596 | Ga0495648_0054997 | |||
| 1597 | Ga0495609_0000369 | |||
| 1598 | Ga0495668_0001459 | |||
| 1599 | Ga0495668_0013566 | |||
| 1600 | Ga0495611_0000001 | |||
| 1601 | Ga0495611_0000073 | |||
| 1602 | Ga0495625_0000041 | |||
| 1603 | Ga0495625_0011746 | |||
| 1604 | Ga0495625_0122101 | |||
| 1605 | Ga0495661_0003999 | |||
| 1606 | Ga0495670_0007981 | |||
| 1607 | Ga0495670_0024078 | |||
| 1608 | Ga0495671_0000182 | |||
| 1609 | Ga0495649_0008764 | |||
| 1610 | Ga0495649_0286209 | |||
| 1611 | Ga0495589_0000008 | |||
| 1612 | Ga0495600_0167133 | |||
| 1613 | Ga0495660_0000149 | |||
| 1614 | Ga0495660_0000169 | |||
| 1615 | Ga0495683_0004682 | |||
| 1616 | Ga0495679_000004 | |||
| 1617 | Ga0495673_0000004 | |||
| 1618 | Ga0495673_0000278 | |||
| 1619 | Ga0495673_0001102 | |||
| 1620 | Ga0495686_0000017 | |||
| 1621 | Ga0495686_0001145 | |||
| 1622 | Ga0495686_0006922 | |||
| 1623 | Ga0496100_0000429 | |||
| 1624 | Ga0496101_0002069 | |||
| 1625 | Ga0496101_0003821 | |||
| 1626 | Ga0496102_0147830 | |||
| 1627 | Ga0496104_0007726 | |||
| 1628 | Ga0496105_0061042 | |||
| 1629 | Ga0496106_0012978 | |||
| 1630 | Ga0496106_0359119 | |||
| 1631 | Ga0496112_0449258 | |||
| 1632 | Ga0496113_0046234 | |||
| 1633 | Ga0496113_0121091 | |||
| 1634 | Ga0496114_0281161 | |||
| 1635 | Ga0496114_0466432 | |||
| 1636 | Ga0496115_0000014 | |||
| 1637 | Ga0496115_0000114 | |||
| 1638 | Ga0496117_0047074 | |||
| 1639 | Ga0496117_0167951 | |||
| 1640 | Ga0496118_0000968 | |||
| 1641 | Ga0496118_0001481 | |||
| 1642 | Ga0496118_0002007 | |||
| 1643 | Ga0496118_0013096 | |||
| 1644 | Ga0496118_0074424 | |||
| 1645 | Ga0496119_0000182 | |||
| 1646 | Ga0496119_0014215 | |||
| 1647 | Ga0496119_0040442 | |||
| 1648 | Ga0496120_0000661 | |||
| 1649 | Ga0496121_0000399 | |||
| 1650 | Ga0496121_0000419 | |||
| 1651 | Ga0496121_0001549 | |||
| 1652 | Ga0496121_0003203 | |||
| 1653 | Ga0496121_0049903 | |||
| 1654 | Ga0496121_0077231 | |||
| 1655 | Ga0496121_0099162 | |||
| 1656 | Ga0496122_0016943 | |||
| 1657 | Ga0496122_0048689 | |||
| 1658 | Ga0496123_0026838 | |||
| 1659 | Ga0496124_0000333 | |||
| 1660 | Ga0496124_0000364 | |||
| 1661 | Ga0496125_0025513 | |||
| 1662 | Ga0496125_0038509 | |||
| 1663 | Ga0496125_0057144 | |||
| 1664 | Ga0496125_0074718 | |||
| 1665 | Ga0496125_0248222 | |||
| 1666 | Ga0496126_0000047 | |||
| 1667 | Ga0496126_0002016 | |||
| 1668 | Ga0496126_0004710 | |||
| 1669 | Ga0496126_0133690 | |||
| 1670 | Ga0496126_0147072 | |||
| 1671 | Ga0495678_000612 | |||
| 1672 | Ga0495682_0002092 | |||
| 1673 | Ga0495682_0007777 | |||
| 1674 | Ga0501031_0036953 | |||
| 1675 | Ga0501031_0038968 | |||
| 1676 | Ga0501031_0209706 | |||
| 1677 | Ga0501032_0005403 | |||
| 1678 | Ga0501032_0012679 | |||
| 1679 | Ga0501032_0020087 | |||
| 1680 | Ga0501032_0035966 | |||
| 1681 | Ga0501033_0000348 | |||
| 1682 | Ga0501033_0001926 | |||
| 1683 | Ga0501033_0038366 | |||
| 1684 | Ga0501033_0087062 | |||
| 1685 | Ga0501033_0336776 | |||
| 1686 | Ga0501034_0005114 | |||
| 1687 | Ga0501034_0009682 | |||
| 1688 | Ga0501034_0056279 | |||
| 1689 | Ga0501034_0146756 | |||
| 1690 | Ga0501034_0314849 | |||
| 1691 | Ga0501036_0009155 | |||
| 1692 | Ga0501036_0036709 | |||
| 1693 | Ga0501036_0053181 | |||
| 1694 | Ga0501036_0086069 | |||
| 1695 | Ga0501036_0244309 | |||
| 1696 | Ga0501037_0014817 | |||
| 1697 | Ga0501037_0015803 | |||
| 1698 | Ga0501037_0016568 | |||
| 1699 | Ga0501037_0053811 | |||
| 1700 | Ga0501037_0062955 | |||
| 1701 | Ga0501037_0128610 | |||
| 1702 | Ga0501038_0002090 | |||
| 1703 | Ga0501038_0004400 | |||
| 1704 | Ga0501038_0125044 | |||
| 1705 | Ga0501038_0220005 | |||
| 1706 | Ga0501039_0112018 | |||
| 1707 | Ga0501039_0351342 | |||
| 1708 | Ga0501040_0213105 | |||
| 1709 | Ga0501043_0014793 | |||
| 1710 | Ga0501043_0018774 | |||
| 1711 | Ga0501043_0027599 | |||
| 1712 | Ga0501043_0041442 | |||
| 1713 | Ga0501043_0048624 | |||
| 1714 | Ga0501043_0049784 | |||
| 1715 | Ga0501043_0174840 | |||
| 1716 | Ga0501043_0285417 | |||
| 1717 | Ga0501043_0349076 | |||
| 1718 | Ga0501046_0007181 | |||
| 1719 | Ga0501046_0017017 | |||
| 1720 | Ga0501046_0020695 | |||
| 1721 | Ga0501046_0045408 | |||
| 1722 | Ga0501046_0062053 | |||
| 1723 | Ga0501047_0002283 | |||
| 1724 | Ga0501047_0002357 | |||
| 1725 | Ga0501047_0009404 | |||
| 1726 | Ga0501047_0022487 | |||
| 1727 | Ga0501047_0037056 | |||
| 1728 | Ga0501047_0048735 | |||
| 1729 | Ga0501047_0088296 | |||
| 1730 | Ga0501047_0173781 | |||
| 1731 | Ga0501047_0203539 | |||
| 1732 | Ga0501047_0578370 | |||
| 1733 | Ga0501048_0016969 | |||
| 1734 | Ga0501048_0037248 | |||
| 1735 | Ga0501048_0183181 | |||
| 1736 | Ga0501067_0107094 | |||
| 1737 | Ga0501067_0122715 | |||
| 1738 | Ga0501068_0018324 | |||
| 1739 | Ga0501068_0038322 | |||
| 1740 | Ga0501068_0219789 | |||
| 1741 | Ga0501069_0003346 | |||
| 1742 | Ga0501069_0066495 | |||
| 1743 | Ga0501069_0092224 | |||
| 1744 | Ga0501070_0000326 | |||
| 1745 | Ga0501070_0004534 | |||
| 1746 | Ga0501070_0010746 | |||
| 1747 | Ga0501070_0012984 | |||
| 1748 | Ga0501070_0022914 | |||
| 1749 | Ga0501070_0023118 | |||
| 1750 | Ga0501070_0029077 | |||
| 1751 | Ga0501070_0144692 | |||
| 1752 | Ga0501070_0260550 | |||
| 1753 | Ga0501070_0330234 | |||
| 1754 | Ga0501071_0009415 | |||
| 1755 | Ga0501071_0027058 | |||
| 1756 | Ga0501072_0004448 | |||
| 1757 | Ga0501073_0005962 | |||
| 1758 | Ga0501073_0006378 | |||
| 1759 | Ga0501073_0013747 | |||
| 1760 | Ga0501073_0096556 | |||
| 1761 | Ga0501073_0147484 | |||
| 1762 | Ga0501073_0153741 | |||
| 1763 | Ga0501073_0197764 | |||
| 1764 | Ga0501073_0222727 | |||
| 1765 | Ga0501074_0003509 | |||
| 1766 | Ga0501074_0009116 | |||
| 1767 | Ga0501074_0023223 | |||
| 1768 | Ga0501074_0079919 | |||
| 1769 | Ga0501074_0174608 | |||
| 1770 | Ga0501074_0177145 | |||
| 1771 | Ga0501076_0181898 | |||
| 1772 | Ga0501079_0010160 | |||
| 1773 | Ga0501079_0078559 | |||
| 1774 | Ga0501079_0204370 | |||
| 1775 | Ga0501079_0240688 | |||
| 1776 | Ga0501080_0001852 | |||
| 1777 | Ga0501080_0012301 | |||
| 1778 | Ga0501080_0014254 | |||
| 1779 | Ga0501080_0020322 | |||
| 1780 | Ga0501080_0038414 | |||
| 1781 | Ga0501080_0143426 | |||
| 1782 | Ga0501080_0193486 | |||
| 1783 | Ga0501081_0026930 | |||
| 1784 | Ga0501083_0001507 | |||
| 1785 | Ga0501083_0170180 | |||
| 1786 | Ga0501035_0009202 | |||
| 1787 | Ga0501035_0059449 | |||
| 1788 | Ga0501035_0079624 | |||
| 1789 | Ga0501035_0093689 | |||
| 1790 | Ga0501035_0219622 | |||
| 1791 | Ga0501035_0658303 | |||
| 1792 | Ga0501044_0002749 | |||
| 1793 | Ga0501044_0013604 | |||
| 1794 | Ga0501044_0019990 | |||
| 1795 | Ga0501044_0022516 | |||
| 1796 | Ga0501044_0024652 | |||
| 1797 | Ga0501044_0036023 | |||
| 1798 | Ga0501044_0045100 | |||
| 1799 | Ga0501044_0046685 | |||
| 1800 | Ga0501044_0046821 | |||
| 1801 | Ga0501044_0071982 | |||
| 1802 | Ga0501044_0100319 | |||
| 1803 | Ga0501044_0121713 | |||
| 1804 | Ga0501044_0309081 | |||
| 1805 | Ga0501044_0650305 | |||
| 1806 | nmdc:mga00v17_26824_c1 | |||
| 1807 | nmdc:mga0n895_162959_c1 | |||
| 1808 | Ga0500643_000020 | |||
| 1809 | Ga0500651_0000415 | |||
| 1810 | Ga0500568_0000367 | |||
| 1811 | Ga0500633_0037073 | |||
| 1812 | Ga0500645_000617 | |||
| 1813 | Ga0501084_0023603 | |||
| 1814 | Ga0501084_0124925 | |||
| 1815 | Ga0501082_0000141 | |||
| 1816 | Ga0501082_0026881 | |||
| 1817 | Ga0501082_0027942 | |||
| 1818 | Ga0501082_0127048 | |||
| 1819 | Ga0466962_0003234 | |||
| 1820 | Ga0466962_0029291 | |||
| 1821 | Ga0466962_0231345 | |||
| 1822 | 2538835124 | |||
| 1823 | 2595446984 | |||
| 1824 | 2595449742 | |||
| 1825 | 2643829388 | |||
| 1826 | 2644475982 | |||
| 1827 | 2687582028 | |||
| 1828 | 2721026348 | |||
| 1829 | 2735833674 | |||
| 1830 | 2739229324 | |||
| 1831 | 2739729961 | |||
| 1832 | 2819564123 | |||
| 1833 | 2842917676 | |||
| 1834 | 2842920050 | |||
| 1835 | 2884341662 | |||
| 1836 | 2884412997 | |||
| 1837 | 2904464759 | |||
| 1838 | 2919088153 | |||
| 1839 | 2919406273 | |||
| 1840 | 2919499223 | |||
| 1841 | 2928965853 | |||
| 1842 | 2939612893 | |||
| 1843 | 2941473064 | |||
| 1844 | 2953995339 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6uxt-assembly1.cif.gz_A | crystal structure of unknown function protein yfdx from shigella flexneri | 0.9688 | 67 | 101 |
| 2wy2-assembly1.cif.gz_C | nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. coli phosphotransferase system. | 0.8326 | 58 | 140 |
| 2lrl-assembly1.cif.gz_A | solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose branch of the escherichia coli phosphotransferase system | 0.829 | 54 | 140 |
| 2lrk-assembly1.cif.gz_A | solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose | 0.8132 | 54 | 140 |
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.8012 | 58 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wwvA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.8351 | 58 | 140 | 1.20.58.80 |
| af_E7F188_23_199_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.833 | 33 | 238 | 1.20.120.1760 |
| 2wy2C00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.8326 | 58 | 140 | 1.20.58.80 |
| 1wcrC00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.8309 | 58 | 140 | 1.20.58.80 |
| af_P9WPG1_2_192_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8297 | 52 | 242 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5GR08-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9779 | 73 | 294 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A2K9L9G9-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) | 0.9609 | 53 | 304 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
| AF-A0A4Q6C633-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) | 0.9607 | 52 | 293 |
GO:0003882
GO:0008444 GO:0008654 GO:0012505 GO:0016020 |
| AF-A0A7Y3E6K0-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) | 0.9594 | 73 | 304 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
| AF-A5EVH7-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) | 0.9592 | 54 | 296 |
GO:0003882
GO:0008444 GO:0008654 GO:0012505 GO:0016020 |