F485779

General Info

Members Datasets Scaffolds Average Seq Length
922 362 1844 259

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1003065|JGI24736J21556_10030652
Length 306
Sequence MNVGDTSITRFRATQATASRFVPGMHQLTVYSGWAKLEAQVTTEPMSDPIQARGPRHRGIYLLPNLFTTGAMFAGFYAIVSAFHGDFRTAALAVFVAGILDGMDGRVARLTNTQSEFGVQFDSLSDLVSFGLAPALVMYTWSLSSLAEYGRTWGKIGWAAAFIYAVCAALRLARFNTQVGVADKRYFQGLASPAAAALCMSFVWTMTKFDITGAEVAFFTLPLAVIAGLLMVSNVRYYSFKAWPKGDRVPFIWLITAVLIVVLLFIDPARVLFAGTVIYTISGPVMTLWGRAAHRRRARRHARSVE

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
110 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
188 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
195 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
215 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
216 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
217 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
218 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
219 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
220 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
221 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
222 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
233 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
278 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
301 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
327 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
333 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
336 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
341 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
342 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
343 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
344 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
345 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
346 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
347 2734482264 Dyella sp. AD052 Isolate Unclassified
348 2738543009 Luteibacter sp. OK325 Isolate Unclassified
349 2739367700 Dyella sp. YR388 Isolate Unclassified
350 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
351 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
352 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
353 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
354 2884411467 Dyella sp. AD56 Isolate Rhizosphere
355 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
356 2919085039 Luteibacter sp. 1214 Isolate Unclassified
357 2919404418 Luteibacter sp. 3190 Isolate Unclassified
358 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
359 2928963466 Dyella japonica 1073 Isolate Unclassified
360 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
361 2941471342 Luteibacter sp. 621 Isolate Unclassified
362 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 0.65
Isolates 2.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.8
Nodule 0
Rhizoplane 1.74
Rhizosphere 74.95
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003065 3300001904 Bacteria 2919
2 JGI24740J21852_10002516 3300001979 Bacteria 8274
3 JGI24740J21852_10004620 3300001979 Bacteria 5910
4 JGI24739J22299_10002555 3300001989 Bacteria 7020
5 JGI24737J22298_10003819 3300001990 Bacteria 5301
6 JGI24735J21928_10017069 3300002067 Bacteria 2246
7 JGI24738J21930_10016184 3300002075 Bacteria 1578
8 JGI25156J39149_1002499 3300002705 Bacteria 6551
9 JGI25162J39368_1000997 3300002737 Bacteria 17858
10 JGI25162J39368_1001016 3300002737 Bacteria 17505
11 JGI25162J39368_1001293 3300002737 Bacteria 14142
12 JGI25162J39368_1003388 3300002737 Bacteria 4677
13 JGI25162J39368_1010519 3300002737 Bacteria 1164
14 JGI25157J39369_1001296 3300002741 Bacteria 10019
15 JGI25157J39369_1003130 3300002741 Bacteria 3548
16 JGI25157J39369_1003163 3300002741 Bacteria 3511
17 JGI25163J39215_1000604 3300002771 Bacteria 9991
18 JGI25163J39215_1000836 3300002771 Bacteria 7374
19 JGI25164J39214_1000169 3300002772 Bacteria 61173
20 JGI25164J39214_1000510 3300002772 Bacteria 18642
21 JGI25164J39214_1000517 3300002772 Bacteria 18479
22 JGI25164J39214_1000877 3300002772 Bacteria 10211
23 JGI25165J46597_1000360 3300003214 Bacteria 51032
24 JGI25165J46597_1000562 3300003214 Bacteria 33635
25 JGI25165J46597_1001043 3300003214 Bacteria 18071
26 JGI25165J46597_1004619 3300003214 Bacteria 2890
27 JGI25153J46596_10009316 3300003215 Bacteria 4586
28 rootH1_10051601 3300003316 Bacteria 2448
29 rootH1_10145377 3300003316 Bacteria 3106
30 rootH2_10021538 3300003320 Bacteria 3925
31 Ga0006562J51391_1028147 3300003578 Bacteria 4987
32 Ga0006562J51391_1057626 3300003578 Bacteria 2490
33 Ga0055539_1001724 3300003752 Bacteria 3827
34 Ga0055525_1000464 3300003759 Bacteria 22607
35 Ga0055527_1000053 3300003760 Bacteria 100725
36 Ga0055527_1000116 3300003760 Bacteria 57355
37 Ga0055535_1000296 3300003761 Bacteria 51261
38 Ga0055535_1000298 3300003761 Bacteria 50927
39 Ga0055535_1000667 3300003761 Bacteria 27105
40 Ga0055535_1001282 3300003761 Bacteria 13649
41 Ga0055535_1001752 3300003761 Bacteria 9684
42 Ga0055542_1000056 3300003762 Bacteria 167483
43 Ga0055542_1000187 3300003762 Bacteria 76099
44 Ga0055542_1000277 3300003762 Bacteria 57355
45 Ga0055542_1000323 3300003762 Bacteria 50926
46 Ga0055542_1000387 3300003762 Bacteria 44412
47 Ga0055542_1001002 3300003762 Bacteria 18071
48 Ga0055529_1000264 3300003763 Bacteria 62197
49 Ga0055529_1000298 3300003763 Bacteria 57355
50 Ga0055529_1000415 3300003763 Bacteria 44412
51 Ga0055529_1001224 3300003763 Bacteria 9842
52 Ga0055526_1028093 3300003771 Bacteria 1712
53 Ga0055536_1019305 3300003781 Bacteria 2149
54 Ga0055530_10010387 3300003791 Bacteria 3444
55 Ga0055531_10010638 3300003794 Bacteria 4547
56 Ga0055531_10023299 3300003794 Bacteria 2327
57 Ga0065165_1000700 3300005262 Bacteria 47662
58 Ga0065165_1019690 3300005262 Bacteria 2399
59 Ga0065714_10089290 3300005288 Bacteria 1959
60 Ga0070658_10001497 3300005327 Bacteria 19822
61 Ga0070676_10159477 3300005328 Bacteria 1450
62 Ga0070670_100014157 3300005331 Bacteria 6842
63 Ga0068869_100235721 3300005334 Bacteria 1456
64 Ga0070666_10000013 3300005335 Bacteria 230442
65 Ga0070666_10002022 3300005335 Bacteria 12330
66 Ga0070666_10036820 3300005335 Bacteria 3250
67 Ga0070680_100000291 3300005336 Bacteria 33556
68 Ga0070680_100034991 3300005336 Bacteria 4053
69 Ga0070680_100065827 3300005336 Bacteria 2970
70 Ga0070680_100187766 3300005336 Bacteria 1741
71 Ga0070680_100705842 3300005336 Bacteria 868
72 Ga0070682_100001023 3300005337 Bacteria 16152
73 Ga0070682_100003056 3300005337 Bacteria 9265
74 Ga0070682_100047125 3300005337 Bacteria 2678
75 Ga0068868_100060167 3300005338 Bacteria 3006
76 Ga0070660_100046238 3300005339 Bacteria 3336
77 Ga0070660_100225080 3300005339 Bacteria 1525
78 Ga0070689_100002032 3300005340 Bacteria 13125
79 Ga0070691_10077010 3300005341 Bacteria 1627
80 Ga0070661_100014293 3300005344 Bacteria 5592
81 Ga0070661_100018614 3300005344 Bacteria 4940
82 Ga0070661_100027727 3300005344 Bacteria 4081
83 Ga0070661_100054393 3300005344 Bacteria 2931
84 Ga0070661_100085715 3300005344 Bacteria 2328
85 Ga0070661_100217364 3300005344 Bacteria 1465
86 Ga0070661_100374397 3300005344 Bacteria 1121
87 Ga0070692_10033272 3300005345 Bacteria 2597
88 Ga0070668_100123170 3300005347 Bacteria 2075
89 Ga0070674_100431921 3300005356 Bacteria 1083
90 Ga0070673_100129337 3300005364 Bacteria 2116
91 Ga0070659_100002227 3300005366 Bacteria 13777
92 Ga0070659_100063344 3300005366 Bacteria 2925
93 Ga0070659_100116351 3300005366 Bacteria 2161
94 Ga0070659_100184188 3300005366 Bacteria 1714
95 Ga0070667_100049159 3300005367 Bacteria 3551
96 Ga0070667_100347652 3300005367 Bacteria 1342
97 Ga0070667_100674886 3300005367 Bacteria 955
98 Ga0070714_100000020 3300005435 Bacteria 169262
99 Ga0070714_100015093 3300005435 Bacteria 6211
100 Ga0070714_100019341 3300005435 Bacteria 5545
101 Ga0070714_100050368 3300005435 Bacteria 3547
102 Ga0070713_100001409 3300005436 Bacteria 15418
103 Ga0070713_100161252 3300005436 Bacteria 2002
104 Ga0070711_100203830 3300005439 Bacteria 1528
105 Ga0070711_100453511 3300005439 Bacteria 1050
106 Ga0070700_100247848 3300005441 Bacteria 1276
107 Ga0070694_100027486 3300005444 Bacteria 3695
108 Ga0070663_100022581 3300005455 Bacteria 4208
109 Ga0070663_100073934 3300005455 Bacteria 2487
110 Ga0070663_100180617 3300005455 Bacteria 1636
111 Ga0070678_100060529 3300005456 Bacteria 2788
112 Ga0070678_100154504 3300005456 Bacteria 1852
113 Ga0070662_100083262 3300005457 Bacteria 2387
114 Ga0070662_100314460 3300005457 Bacteria 1276
115 Ga0070681_10000006 3300005458 Bacteria 169066
116 Ga0070681_10007337 3300005458 Bacteria 10770
117 Ga0070681_10011412 3300005458 Bacteria 8794
118 Ga0070681_10019530 3300005458 Bacteria 6785
119 Ga0070681_10051145 3300005458 Bacteria 4122
120 Ga0070681_10066806 3300005458 Bacteria 3565
121 Ga0070681_10145470 3300005458 Bacteria 2299
122 Ga0068867_100195727 3300005459 Bacteria 1616
123 Ga0070685_10010301 3300005466 Bacteria 4854
124 Ga0070679_100000207 3300005530 Bacteria 47969
125 Ga0070684_100186482 3300005535 Bacteria 1887
126 Ga0068853_100002190 3300005539 Bacteria 14571
127 Ga0068853_100104364 3300005539 Bacteria 2509
128 Ga0068853_100111514 3300005539 Bacteria 2430
129 Ga0068853_100140414 3300005539 Bacteria 2168
130 Ga0068853_100167334 3300005539 Bacteria 1987
131 Ga0070672_100073410 3300005543 Bacteria 2726
132 Ga0070686_100060673 3300005544 Bacteria 2441
133 Ga0070696_100007413 3300005546 Bacteria 7334
134 Ga0070696_100022947 3300005546 Bacteria 4243
135 Ga0070696_100269827 3300005546 Bacteria 1293
136 Ga0070696_100498915 3300005546 Bacteria 968
137 Ga0070693_100013764 3300005547 Bacteria 4128
138 Ga0070693_100015213 3300005547 Bacteria 3958
139 Ga0070693_100054239 3300005547 Bacteria 2304
140 Ga0070665_100000100 3300005548 Bacteria 160186
141 Ga0070665_100001350 3300005548 Bacteria 29089
142 Ga0070665_100071557 3300005548 Bacteria 3474
143 Ga0070665_100073872 3300005548 Bacteria 3415
144 Ga0068855_100014910 3300005563 Bacteria 9363
145 Ga0068855_100108448 3300005563 Bacteria 3189
146 Ga0068855_100141865 3300005563 Bacteria 2737
147 Ga0068855_100312103 3300005563 Bacteria 1739
148 Ga0068857_100034725 3300005577 Bacteria 4460
149 Ga0068857_100046125 3300005577 Bacteria 3867
150 Ga0068857_100058255 3300005577 Bacteria 3430
151 Ga0068857_100122926 3300005577 Bacteria 2338
152 Ga0068857_100279371 3300005577 Bacteria 1536
153 Ga0068854_100003203 3300005578 Bacteria 10214
154 Ga0068854_100003650 3300005578 Bacteria 9629
155 Ga0068854_100026043 3300005578 Bacteria 4016
156 Ga0068854_100034159 3300005578 Bacteria 3550
157 Ga0068854_100057110 3300005578 Bacteria 2815
158 Ga0068854_100413361 3300005578 Bacteria 1119
159 Ga0068856_100000882 3300005614 Bacteria 32118
160 Ga0068856_100003051 3300005614 Bacteria 17138
161 Ga0068856_100025778 3300005614 Bacteria 5733
162 Ga0068856_100144933 3300005614 Bacteria 2382
163 Ga0068852_100031237 3300005616 Bacteria 4392
164 Ga0068852_100249539 3300005616 Bacteria 1700
165 Ga0068859_100000712 3300005617 Bacteria 33511
166 Ga0068859_100781613 3300005617 Bacteria 1043
167 Ga0068864_100044068 3300005618 Bacteria 3822
168 Ga0068864_100168454 3300005618 Bacteria 1996
169 Ga0068851_10008194 3300005834 Bacteria 4823
170 Ga0068851_10016801 3300005834 Bacteria 3506
171 Ga0068851_10048722 3300005834 Bacteria 2147
172 Ga0068851_10260097 3300005834 Bacteria 987
173 Ga0068863_100027559 3300005841 Bacteria 5419
174 Ga0068863_100042126 3300005841 Bacteria 4339
175 Ga0068863_100100704 3300005841 Bacteria 2746
176 Ga0068863_100245002 3300005841 Bacteria 1731
177 Ga0068863_100246604 3300005841 Bacteria 1724
178 Ga0068863_100358085 3300005841 Bacteria 1422
179 Ga0068858_100001088 3300005842 Bacteria 28107
180 Ga0068858_100010755 3300005842 Bacteria 8652
181 Ga0068858_100176842 3300005842 Bacteria 2014
182 Ga0068860_100066163 3300005843 Bacteria 3433
183 Ga0068860_100291893 3300005843 Bacteria 1596
184 Ga0068862_100001541 3300005844 Bacteria 21086
185 Ga0068862_100065416 3300005844 Bacteria 3131
186 Ga0081540_1001452 3300005983 Bacteria 20481
187 Ga0097621_100058639 3300006237 Bacteria 3150
188 Ga0068871_100007828 3300006358 Bacteria 7656
189 Ga0068871_100031831 3300006358 Bacteria 4161
190 Ga0068871_100292652 3300006358 Bacteria 1427
191 Ga0068871_100384656 3300006358 Bacteria 1247
192 Ga0068865_100023502 3300006881 Bacteria 4037
193 Ga0097620_100000712 3300006931 Bacteria 33511
194 Ga0097620_100781610 3300006931 Bacteria 1043
195 Ga0105240_10002526 3300009093 Bacteria 29370
196 Ga0105240_10008269 3300009093 Bacteria 14895
197 Ga0105240_10077292 3300009093 Bacteria 4101
198 Ga0105240_10314102 3300009093 Bacteria 1788
199 Ga0105240_10715685 3300009093 Bacteria 1091
200 Ga0105247_10000994 3300009101 Bacteria 21412
201 Ga0105247_10046858 3300009101 Bacteria 2654
202 Ga0105241_10320818 3300009174 Bacteria 1336
203 Ga0105248_10055311 3300009177 Bacteria 4451
204 Ga0105248_10083302 3300009177 Bacteria 3598
205 Ga0105248_10179838 3300009177 Bacteria 2383
206 Ga0105248_10193928 3300009177 Bacteria 2289
207 Ga0105237_10000292 3300009545 Bacteria 69307
208 Ga0105237_10001255 3300009545 Bacteria 33878
209 Ga0105237_10069164 3300009545 Bacteria 3526
210 Ga0105237_10127922 3300009545 Bacteria 2534
211 Ga0105237_10130108 3300009545 Bacteria 2512
212 Ga0105237_10257373 3300009545 Bacteria 1748
213 Ga0105238_10000131 3300009551 Bacteria 82050
214 Ga0105238_10002315 3300009551 Bacteria 19146
215 Ga0105238_10008019 3300009551 Bacteria 10564
216 Ga0105238_10053714 3300009551 Bacteria 4048
217 Ga0105238_10059444 3300009551 Bacteria 3829
218 Ga0105238_10110292 3300009551 Bacteria 2732
219 Ga0105238_10148432 3300009551 Bacteria 2321
220 Ga0105238_10228643 3300009551 Bacteria 1837
221 Ga0105249_10003406 3300009553 Bacteria 13771
222 Ga0105239_10001711 3300010375 Bacteria 28894
223 Ga0105239_10017137 3300010375 Bacteria 8008
224 Ga0105239_10080197 3300010375 Bacteria 3591
225 Ga0105239_10105998 3300010375 Bacteria 3113
226 Ga0105239_10147002 3300010375 Bacteria 2629
227 Ga0105246_10024032 3300011119 Bacteria 3952
228 Ga0157314_1000159 3300012500 Bacteria 7374
229 Ga0157373_10002912 3300013100 Bacteria 12959
230 Ga0157373_10077647 3300013100 Bacteria 2343
231 Ga0157373_10111594 3300013100 Bacteria 1922
232 Ga0157373_10378432 3300013100 Bacteria 1012
233 Ga0157371_10004953 3300013102 Bacteria 11440
234 Ga0157371_10236209 3300013102 Bacteria 1314
235 Ga0157370_10003809 3300013104 Bacteria 17595
236 Ga0157370_10004261 3300013104 Bacteria 16506
237 Ga0157370_10012899 3300013104 Bacteria 8639
238 Ga0157370_10018653 3300013104 Bacteria 6975
239 Ga0157370_10069448 3300013104 Bacteria 3327
240 Ga0157370_10117478 3300013104 Bacteria 2484
241 Ga0157369_10000529 3300013105 Bacteria 50408
242 Ga0157369_10041539 3300013105 Bacteria 5019
243 Ga0157369_10221111 3300013105 Bacteria 1983
244 Ga0157369_10399687 3300013105 Bacteria 1425
245 Ga0157369_10432558 3300013105 Bacteria 1364
246 Ga0157369_10455937 3300013105 Bacteria 1324
247 Ga0157374_10200077 3300013296 Bacteria 1956
248 Ga0157374_10366630 3300013296 Bacteria 1433
249 Ga0157374_10476995 3300013296 Bacteria 1250
250 Ga0157378_10000597 3300013297 Bacteria 33850
251 Ga0157378_10080956 3300013297 Bacteria 2935
252 Ga0163162_10000221 3300013306 Bacteria 52249
253 Ga0163162_10040418 3300013306 Bacteria 4663
254 Ga0163162_10053140 3300013306 Bacteria 4071
255 Ga0157372_10004293 3300013307 Bacteria 15236
256 Ga0157372_10006042 3300013307 Bacteria 12866
257 Ga0157372_10019593 3300013307 Bacteria 7291
258 Ga0157372_10021196 3300013307 Bacteria 7021
259 Ga0157372_10038983 3300013307 Bacteria 5244
260 Ga0157372_10068313 3300013307 Bacteria 3995
261 Ga0157372_10079085 3300013307 Bacteria 3718
262 Ga0157372_10097690 3300013307 Bacteria 3350
263 Ga0157372_10117989 3300013307 Bacteria 3044
264 Ga0157372_10126400 3300013307 Bacteria 2940
265 Ga0157372_10337848 3300013307 Bacteria 1754
266 Ga0157375_10012477 3300013308 Bacteria 7543
267 Ga0157375_10393455 3300013308 Bacteria 1553
268 Ga0157380_10410091 3300014326 Bacteria 1288
269 Ga0182008_10008499 3300014497 Bacteria 5606
270 Ga0157379_10006942 3300014968 Bacteria 9794
271 Ga0157379_10144554 3300014968 Bacteria 2145
272 Ga0157379_10320195 3300014968 Bacteria 1416
273 Ga0157379_10459009 3300014968 Bacteria 1177
274 Ga0157376_10016625 3300014969 Bacteria 5592
275 Ga0157376_10020307 3300014969 Bacteria 5137
276 Ga0157376_10319423 3300014969 Bacteria 1476
277 Ga0157376_10614567 3300014969 Bacteria 1083
278 Ga0182006_1000093 3300015261 Bacteria 106185
279 Ga0182006_1000416 3300015261 Bacteria 34218
280 Ga0182007_10002081 3300015262 Bacteria 10274
281 Ga0182007_10004848 3300015262 Bacteria 6018
282 Ga0182005_1000536 3300015265 Bacteria 19181
283 Ga0182005_1008634 3300015265 Bacteria 2994
284 Ga0182005_1010115 3300015265 Bacteria 2719
285 Ga0183369_1003 3300015685 Bacteria 726443
286 Ga0183368_1003 3300015687 Bacteria 1276390
287 Ga0163161_10000685 3300017792 Bacteria 27037
288 Ga0163161_10040488 3300017792 Bacteria 3347
289 Ga0163161_10086853 3300017792 Bacteria 2309
290 Ga0206356_10643678 3300020070 Bacteria 2531
291 Ga0206353_11323503 3300020082 Bacteria 3163
292 Ga0206353_11660574 3300020082 Bacteria 970
293 Ga0209760_100616 3300025207 Bacteria 6064
294 Ga0209784_100422 3300025224 Bacteria 18592
295 Ga0209566_101298 3300025225 Bacteria 8198
296 Ga0209674_100012 3300025226 Bacteria 950162
297 Ga0209674_100077 3300025226 Bacteria 206312
298 Ga0209674_100642 3300025226 Bacteria 12654
299 Ga0209674_100983 3300025226 Bacteria 8798
300 Ga0209674_102647 3300025226 Bacteria 3714
301 Ga0209672_100004 3300025228 Bacteria 1467504
302 Ga0209672_100022 3300025228 Bacteria 374313
303 Ga0209672_100476 3300025228 Bacteria 22515
304 Ga0209672_101466 3300025228 Bacteria 8364
305 Ga0209563_100103 3300025230 Bacteria 151835
306 Ga0207427_100111 3300025231 Bacteria 112775
307 Ga0207427_100175 3300025231 Bacteria 69585
308 Ga0207427_100179 3300025231 Bacteria 67665
309 Ga0207427_100304 3300025231 Bacteria 34224
310 Ga0207427_102993 3300025231 Bacteria 3926
311 Ga0207427_110925 3300025231 Bacteria 934
312 Ga0209437_100099 3300025233 Bacteria 229500
313 Ga0209437_100269 3300025233 Bacteria 78465
314 Ga0209437_100270 3300025233 Bacteria 78319
315 Ga0209437_100368 3300025233 Bacteria 48548
316 Ga0209437_100384 3300025233 Bacteria 43568
317 Ga0209437_102555 3300025233 Bacteria 3504
318 Ga0209437_106531 3300025233 Bacteria 1938
319 Ga0209258_100003 3300025242 Bacteria 1467504
320 Ga0209258_100004 3300025242 Bacteria 1376422
321 Ga0209258_100119 3300025242 Bacteria 183554
322 Ga0209258_100137 3300025242 Bacteria 167913
323 Ga0209258_100182 3300025242 Bacteria 136629
324 Ga0209258_100849 3300025242 Bacteria 16503
325 Ga0209646_1000986 3300025246 Bacteria 8802
326 Ga0209646_1001576 3300025246 Bacteria 5967
327 Ga0209646_1005596 3300025246 Bacteria 2174
328 Ga0209026_1000175 3300025250 Bacteria 98059
329 Ga0209026_1000242 3300025250 Bacteria 70111
330 Ga0209026_1000276 3300025250 Bacteria 60964
331 Ga0209026_1000504 3300025250 Bacteria 27840
332 Ga0209026_1001966 3300025250 Bacteria 8245
333 Ga0209026_1006043 3300025250 Bacteria 3077
334 Ga0209677_110280 3300025253 Bacteria 1574
335 Ga0209148_1000005 3300025254 Bacteria 1806504
336 Ga0209148_1000025 3300025254 Bacteria 663262
337 Ga0209148_1000036 3300025254 Bacteria 530505
338 Ga0209148_1000062 3300025254 Bacteria 347704
339 Ga0209148_1000083 3300025254 Bacteria 270142
340 Ga0209148_1000137 3300025254 Bacteria 168097
341 Ga0209148_1001922 3300025254 Bacteria 8486
342 Ga0209759_1000136 3300025256 Bacteria 125393
343 Ga0209759_1003929 3300025256 Bacteria 5726
344 Ga0209759_1008606 3300025256 Bacteria 3164
345 Ga0209759_1009273 3300025256 Bacteria 2986
346 Ga0209759_1014828 3300025256 Bacteria 2039
347 Ga0209129_1001516 3300025258 Bacteria 12864
348 Ga0209233_1000040 3300025261 Bacteria 530395
349 Ga0209233_1000075 3300025261 Bacteria 356837
350 Ga0209233_1000077 3300025261 Bacteria 349570
351 Ga0209233_1000128 3300025261 Bacteria 209927
352 Ga0209233_1006779 3300025261 Bacteria 3665
353 Ga0209455_1000004 3300025272 Bacteria 1467504
354 Ga0209455_1000040 3300025272 Bacteria 430197
355 Ga0209455_1000084 3300025272 Bacteria 253164
356 Ga0209455_1000095 3300025272 Bacteria 217487
357 Ga0209455_1000164 3300025272 Bacteria 114011
358 Ga0209675_1010375 3300025291 Bacteria 3186
359 Ga0209676_1003628 3300025292 Bacteria 9282
360 Ga0209676_1004464 3300025292 Bacteria 7783
361 Ga0209025_1001565 3300025294 Bacteria 29000
362 Ga0209025_1040053 3300025294 Bacteria 2033
363 Ga0209564_1038640 3300025295 Bacteria 1324
364 Ga0209758_1002651 3300025297 Bacteria 17708
365 Ga0209758_1003842 3300025297 Bacteria 13182
366 Ga0209758_1030526 3300025297 Bacteria 2230
367 Ga0209050_1000712 3300025298 Bacteria 48980
368 Ga0209256_1002872 3300025299 Bacteria 13090
369 Ga0209256_1011746 3300025299 Bacteria 3455
370 Ga0209256_1019927 3300025299 Bacteria 2114
371 Ga0209051_1012143 3300025303 Bacteria 4184
372 Ga0209051_1051734 3300025303 Bacteria 1363
373 Ga0209257_1000210 3300025304 Bacteria 140822
374 Ga0209257_1000792 3300025304 Bacteria 46155
375 Ga0209257_1000856 3300025304 Bacteria 43386
376 Ga0209257_1009432 3300025304 Bacteria 5227
377 Ga0207656_10006257 3300025321 Bacteria 4264
378 Ga0207710_10015097 3300025900 Bacteria 3262
379 Ga0207680_10000001 3300025903 Bacteria 1091453
380 Ga0207680_10131591 3300025903 Bacteria 1649
381 Ga0207647_10000505 3300025904 Bacteria 31222
382 Ga0207647_10001812 3300025904 Bacteria 16389
383 Ga0207647_10004982 3300025904 Bacteria 9791
384 Ga0207647_10012646 3300025904 Bacteria 5866
385 Ga0207647_10034080 3300025904 Bacteria 3254
386 Ga0207647_10082383 3300025904 Bacteria 1927
387 Ga0207647_10095622 3300025904 Bacteria 1769
388 Ga0207699_10198393 3300025906 Bacteria 1358
389 Ga0207645_10080512 3300025907 Bacteria 2088
390 Ga0207705_10001749 3300025909 Bacteria 17172
391 Ga0207705_10006682 3300025909 Bacteria 8532
392 Ga0207705_10009407 3300025909 Bacteria 7105
393 Ga0207705_10042602 3300025909 Bacteria 3259
394 Ga0207705_10120522 3300025909 Bacteria 1946
395 Ga0207654_10010017 3300025911 Bacteria 4819
396 Ga0207707_10015416 3300025912 Bacteria 6657
397 Ga0207707_10017428 3300025912 Bacteria 6262
398 Ga0207707_10074164 3300025912 Bacteria 2968
399 Ga0207695_10000588 3300025913 Bacteria 73260
400 Ga0207695_10001221 3300025913 Bacteria 44045
401 Ga0207695_10004028 3300025913 Bacteria 20230
402 Ga0207695_10005207 3300025913 Bacteria 17395
403 Ga0207695_10021315 3300025913 Bacteria 7398
404 Ga0207695_10036666 3300025913 Bacteria 5298
405 Ga0207695_10103332 3300025913 Bacteria 2841
406 Ga0207695_10320295 3300025913 Bacteria 1440
407 Ga0207671_10000011 3300025914 Bacteria 530349
408 Ga0207671_10001034 3300025914 Bacteria 33866
409 Ga0207671_10022794 3300025914 Bacteria 4730
410 Ga0207671_10181031 3300025914 Bacteria 1640
411 Ga0207693_10405722 3300025915 Bacteria 1065
412 Ga0207663_10225792 3300025916 Bacteria 1365
413 Ga0207663_10243526 3300025916 Bacteria 1320
414 Ga0207663_10297875 3300025916 Bacteria 1204
415 Ga0207660_10018727 3300025917 Bacteria 4620
416 Ga0207660_10190204 3300025917 Bacteria 1598
417 Ga0207657_10042581 3300025919 Bacteria 4005
418 Ga0207657_10099172 3300025919 Bacteria 2420
419 Ga0207657_10112915 3300025919 Bacteria 2242
420 Ga0207657_10294805 3300025919 Bacteria 1286
421 Ga0207657_10406232 3300025919 Bacteria 1071
422 Ga0207649_10036870 3300025920 Bacteria 2949
423 Ga0207649_10045564 3300025920 Bacteria 2689
424 Ga0207649_10068356 3300025920 Bacteria 2258
425 Ga0207649_10170829 3300025920 Bacteria 1514
426 Ga0207652_10003552 3300025921 Bacteria 12873
427 Ga0207652_10141772 3300025921 Bacteria 2149
428 Ga0207694_10000168 3300025924 Bacteria 67647
429 Ga0207694_10000569 3300025924 Bacteria 33457
430 Ga0207694_10010204 3300025924 Bacteria 7081
431 Ga0207694_10035516 3300025924 Bacteria 3825
432 Ga0207694_10039308 3300025924 Bacteria 3641
433 Ga0207694_10176486 3300025924 Bacteria 1731
434 Ga0207694_10373064 3300025924 Bacteria 1183
435 Ga0207650_10006083 3300025925 Bacteria 8227
436 Ga0207650_10031247 3300025925 Bacteria 3844
437 Ga0207700_10000786 3300025928 Bacteria 18351
438 Ga0207664_10000023 3300025929 Bacteria 204730
439 Ga0207664_10014270 3300025929 Bacteria 5730
440 Ga0207664_10019584 3300025929 Bacteria 5004
441 Ga0207664_10230146 3300025929 Bacteria 1611
442 Ga0207644_10239554 3300025931 Bacteria 1444
443 Ga0207690_10000138 3300025932 Bacteria 59404
444 Ga0207690_10002810 3300025932 Bacteria 10508
445 Ga0207690_10002895 3300025932 Bacteria 10343
446 Ga0207690_10003142 3300025932 Bacteria 9917
447 Ga0207690_10051003 3300025932 Bacteria 2765
448 Ga0207690_10074563 3300025932 Bacteria 2350
449 Ga0207690_10077466 3300025932 Bacteria 2311
450 Ga0207706_10009106 3300025933 Bacteria 9129
451 Ga0207706_10152053 3300025933 Bacteria 2035
452 Ga0207670_10005511 3300025936 Bacteria 6957
453 Ga0207691_10022061 3300025940 Bacteria 6007
454 Ga0207691_10092693 3300025940 Bacteria 2705
455 Ga0207689_10137571 3300025942 Bacteria 2011
456 Ga0207689_10162490 3300025942 Bacteria 1840
457 Ga0207667_10000219 3300025949 Bacteria 80218
458 Ga0207667_10002626 3300025949 Bacteria 22232
459 Ga0207667_10003053 3300025949 Bacteria 20770
460 Ga0207667_10007466 3300025949 Bacteria 13136
461 Ga0207667_10015699 3300025949 Bacteria 8589
462 Ga0207667_10021746 3300025949 Bacteria 7106
463 Ga0207667_10031108 3300025949 Bacteria 5764
464 Ga0207667_10380849 3300025949 Bacteria 1437
465 Ga0207651_10036454 3300025960 Bacteria 3211
466 Ga0207712_10000910 3300025961 Bacteria 21443
467 Ga0207668_10013757 3300025972 Bacteria 4992
468 Ga0207668_10222940 3300025972 Bacteria 1515
469 Ga0207640_10001957 3300025981 Bacteria 11091
470 Ga0207640_10002433 3300025981 Bacteria 9958
471 Ga0207640_10010933 3300025981 Bacteria 5121
472 Ga0207640_10039046 3300025981 Bacteria 3001
473 Ga0207640_10044999 3300025981 Bacteria 2832
474 Ga0207640_10203347 3300025981 Bacteria 1503
475 Ga0207658_10020832 3300025986 Bacteria 4542
476 Ga0207658_10304492 3300025986 Bacteria 1374
477 Ga0207677_10110499 3300026023 Bacteria 2046
478 Ga0207703_10002638 3300026035 Bacteria 15454
479 Ga0207703_10014170 3300026035 Bacteria 6217
480 Ga0207639_10001276 3300026041 Bacteria 17007
481 Ga0207639_10001781 3300026041 Bacteria 14501
482 Ga0207639_10011087 3300026041 Bacteria 6253
483 Ga0207639_10025673 3300026041 Bacteria 4274
484 Ga0207639_10050968 3300026041 Bacteria 3146
485 Ga0207639_10414708 3300026041 Bacteria 1216
486 Ga0207639_10657079 3300026041 Bacteria 970
487 Ga0207678_10005893 3300026067 Bacteria 10927
488 Ga0207678_10025277 3300026067 Bacteria 5185
489 Ga0207678_10135531 3300026067 Bacteria 2101
490 Ga0207678_10593785 3300026067 Bacteria 970
491 Ga0207702_10000132 3300026078 Bacteria 88794
492 Ga0207702_10000338 3300026078 Bacteria 53744
493 Ga0207702_10160243 3300026078 Bacteria 2054
494 Ga0207702_10247053 3300026078 Bacteria 1674
495 Ga0207702_10504919 3300026078 Bacteria 1179
496 Ga0207641_10039591 3300026088 Bacteria 3943
497 Ga0207641_10089040 3300026088 Bacteria 2697
498 Ga0207641_10098154 3300026088 Bacteria 2575
499 Ga0207641_10193128 3300026088 Bacteria 1872
500 Ga0207641_10255860 3300026088 Bacteria 1637
501 Ga0207648_10049917 3300026089 Bacteria 3659
502 Ga0207648_10167078 3300026089 Bacteria 1944
503 Ga0207676_10009124 3300026095 Bacteria 7064
504 Ga0207674_10000445 3300026116 Bacteria 53735
505 Ga0207674_10007822 3300026116 Bacteria 12427
506 Ga0207674_10012043 3300026116 Bacteria 9687
507 Ga0207674_10051627 3300026116 Bacteria 4196
508 Ga0207674_10067443 3300026116 Bacteria 3602
509 Ga0207674_10105359 3300026116 Bacteria 2798
510 Ga0207674_10218425 3300026116 Bacteria 1854
511 Ga0207683_10049228 3300026121 Bacteria 3689
512 Ga0207683_10145598 3300026121 Bacteria 2136
513 Ga0207698_10162288 3300026142 Bacteria 1956
514 Ga0207698_10203692 3300026142 Bacteria 1774
515 Ga0207698_10240639 3300026142 Bacteria 1649
516 Ga0207698_10241769 3300026142 Bacteria 1646
517 Ga0207698_10344539 3300026142 Bacteria 1405
518 Ga0207698_10521664 3300026142 Bacteria 1159
519 Ga0268266_10000008 3300028379 Bacteria 1161875
520 Ga0268266_10000017 3300028379 Bacteria 607272
521 Ga0268266_10000075 3300028379 Bacteria 218045
522 Ga0268266_10255490 3300028379 Bacteria 1622
523 Ga0268265_10001331 3300028380 Bacteria 21127
524 Ga0268265_10032360 3300028380 Bacteria 3789
525 Ga0268265_10542882 3300028380 Bacteria 1102
526 Ga0268264_10071857 3300028381 Bacteria 2933
527 Ga0268264_10143110 3300028381 Bacteria 2135
528 Ga0265326_10022819 3300028558 Bacteria 1790
529 Ga0265334_10000010 3300028573 Bacteria 188179
530 Ga0265334_10009716 3300028573 Bacteria 4066
531 Ga0265338_10025223 3300028800 Bacteria 6044
532 Ga0265331_10044359 3300031250 Bacteria 2151
533 Ga0265327_10048817 3300031251 Bacteria 2223
534 Ga0307408_100042774 3300031548 Bacteria 3220
535 Ga0265313_10000125 3300031595 Bacteria 77022
536 Ga0265313_10033433 3300031595 Bacteria 2613
537 Ga0316575_10005736 3300031665 Bacteria 4433
538 Ga0316575_10045999 3300031665 Bacteria 1733
539 Ga0316579_10001636 3300031691 Bacteria 8218
540 Ga0316576_10331485 3300031727 Unclassified 1134
541 Ga0307516_10016384 3300031730 Bacteria 7753
542 Ga0316577_10034295 3300031733 Bacteria 2836
543 Ga0307416_100220704 3300032002 Bacteria 1818
544 Ga0307411_10154500 3300032005 Bacteria 1710
545 Ga0307415_100290842 3300032126 Bacteria 1349
546 Ga0316593_10063885 3300032168 Bacteria 1263
547 Ga0307510_10002207 3300033180 Bacteria 21991
548 Ga0373926_0020069 3300035083 Bacteria 2307
549 Ga0373954_0177001 3300035118 Bacteria 1046
550 Ga0316574_0087922 3300035398 Bacteria 1979
551 Ga0316574_0123308 3300035398 Bacteria 1665
552 Ga0373927_0000002 3300035695 Bacteria 966219
553 Ga0316582_0002724 3300036647 Bacteria 8392
554 Ga0316582_0030543 3300036647 Bacteria 3283
555 Ga0316582_0086870 3300036647 Bacteria 2052
556 Ga0316584_0055286 3300036712 Bacteria 2972
557 Ga0316584_0098219 3300036712 Bacteria 2192
558 Ga0395899_0000110 3300037312 Bacteria 140811
559 Ga0395899_0012571 3300037312 Bacteria 6488
560 Ga0395899_0044042 3300037312 Bacteria 3326
561 Ga0395899_0061640 3300037312 Bacteria 2762
562 Ga0395899_0159318 3300037312 Bacteria 1595
563 Ga0395900_0000049 3300037418 Bacteria 226847
564 Ga0395900_0001309 3300037418 Bacteria 30258
565 Ga0395900_0005124 3300037418 Bacteria 13762
566 Ga0395900_0036270 3300037418 Bacteria 5082
567 Ga0395898_0000023 3300037466 Bacteria 379477
568 Ga0395898_0000237 3300037466 Bacteria 139991
569 Ga0395898_0004579 3300037466 Bacteria 15091
570 Ga0395898_0048634 3300037466 Bacteria 4157
571 Ga0395898_0223178 3300037466 Bacteria 1797
572 Ga0395898_0514194 3300037466 Bacteria 1138
573 Ga0395901_0000873 3300038443 Bacteria 33251
574 Ga0395901_0053236 3300038443 Bacteria 4206
575 Ga0395901_0061952 3300038443 Bacteria 3892
576 Ga0395901_0067604 3300038443 Bacteria 3722
577 Ga0395901_0106254 3300038443 Bacteria 2946
578 Ga0395901_0160744 3300038443 Bacteria 2359
579 Ga0395901_0167601 3300038443 Bacteria 2305
580 Ga0400484_11747 3300038725 Bacteria 10365
581 Ga0400490_02358 3300038726 Bacteria 3708
582 Ga0400490_18961 3300038726 Bacteria 1300
583 Ga0400490_30277 3300038726 Bacteria 1982
584 Ga0400490_43842 3300038726 Bacteria 5670
585 Ga0400485_07224 3300038735 Bacteria 1976
586 Ga0400488_53730 3300038741 Bacteria 1576
587 Ga0400488_60826 3300038741 Bacteria 1673
588 Ga0400486_04121 3300038742 Bacteria 1871
589 Ga0400486_26793 3300038742 Bacteria 2756
590 Ga0400483_103881 3300039062 Bacteria 3863
591 Ga0400483_148714 3300039062 Bacteria 1963
592 Ga0400483_290206 3300039062 Bacteria 8610
593 Ga0400489_54126 3300039093 Bacteria 1100
594 Ga0400487_07673 3300039110 Bacteria 1549
595 Ga0400487_16810 3300039110 Bacteria 2209
596 Ga0439436_0000016 3300041404 Bacteria 80941
597 Ga0439465_0000015 3300041413 Bacteria 34100
598 Ga0451807_0248796 3300041486 Bacteria 1613
599 Ga0451853_0579969 3300041512 Bacteria 4136
600 Ga0439452_020180 3300042010 Bacteria 1751
601 Ga0439462_0043340 3300042015 Bacteria 1203
602 Ga0450908_000014 3300042184 Bacteria 41620
603 Ga0451577_0002835 3300042876 Bacteria 19940
604 Ga0466969_0008578 3300044656 Bacteria 5422
605 Ga0466969_0055518 3300044656 Bacteria 1937
606 Ga0466972_0106509 3300044658 Bacteria 1325
607 Ga0466975_0071941 3300044661 Bacteria 2469
608 Ga0466982_0000018 3300044672 Bacteria 113912
609 Ga0466982_0000063 3300044672 Bacteria 29669
610 Ga0466965_0048618 3300044683 Bacteria 2101
611 Ga0466966_0002133 3300044684 Bacteria 12818
612 Ga0466966_0027281 3300044684 Bacteria 3724
613 Ga0466966_0044340 3300044684 Bacteria 2847
614 Ga0466966_0125883 3300044684 Bacteria 1571
615 Ga0466961_0002932 3300044693 Bacteria 10591
616 Ga0466961_0006126 3300044693 Bacteria 7631
617 Ga0466961_0009482 3300044693 Bacteria 6200
618 Ga0466963_0096881 3300044694 Bacteria 2015
619 Ga0466964_0009495 3300044706 Bacteria 3665
620 Ga0466964_0014585 3300044706 Bacteria 2989
621 Ga0453684_0001318 3300044712 Bacteria 73362
622 Ga0466971_0004604 3300044719 Bacteria 5958
623 Ga0466971_0005321 3300044719 Bacteria 5582
624 Ga0466971_0105084 3300044719 Bacteria 1300
625 Ga0466968_0000215 3300044735 Bacteria 17905
626 Ga0466968_0004358 3300044735 Bacteria 5283
627 Ga0466968_0116575 3300044735 Bacteria 1205
628 Ga0466970_0028072 3300044765 Bacteria 2955
629 Ga0466970_0036680 3300044765 Bacteria 2597
630 Ga0466970_0041328 3300044765 Bacteria 2449
631 Ga0466970_0213805 3300044765 Bacteria 1075
632 Ga0466957_0016106 3300044842 Bacteria 4369
633 Ga0466957_0089139 3300044842 Bacteria 1931
634 Ga0466960_0031795 3300044901 Bacteria 2437
635 Ga0466959_0000265 3300045049 Bacteria 32152
636 Ga0466959_0080423 3300045049 Bacteria 2349
637 Ga0466959_0150125 3300045049 Bacteria 1643
638 Ga0451576_0000628 3300045051 Bacteria 73375
639 Ga0466958_0029415 3300045836 Bacteria 3260
640 Ga0466958_0049622 3300045836 Bacteria 2539
641 Ga0466967_0305623 3300045976 Bacteria 1531
642 Ga0495617_000110 3300046452 Bacteria 59952
643 Ga0495617_000750 3300046452 Bacteria 15942
644 Ga0495590_0066941 3300046457 Bacteria 1258
645 Ga0495638_0000019 3300046460 Bacteria 384671
646 Ga0495638_0000078 3300046460 Bacteria 157545
647 Ga0495638_0000406 3300046460 Bacteria 52627
648 Ga0495650_0000286 3300046471 Bacteria 94680
649 Ga0495650_0000350 3300046471 Bacteria 81541
650 Ga0495650_0000466 3300046471 Bacteria 62626
651 Ga0495584_0007684 3300046491 Bacteria 5613
652 Ga0495585_0000366 3300046492 Bacteria 43799
653 Ga0495585_0005846 3300046492 Bacteria 7714
654 Ga0495607_0000040 3300046501 Bacteria 133419
655 Ga0495607_0000140 3300046501 Bacteria 76410
656 Ga0495606_0000479 3300046507 Bacteria 65601
657 Ga0495606_0001310 3300046507 Bacteria 34251
658 Ga0495606_0002054 3300046507 Bacteria 24650
659 Ga0495610_0003265 3300046512 Bacteria 12790
660 Ga0495610_0049341 3300046512 Bacteria 2061
661 Ga0495616_0000045 3300046513 Bacteria 113226
662 Ga0495616_0002958 3300046513 Bacteria 11034
663 Ga0495620_0000141 3300046515 Bacteria 58744
664 Ga0495620_0017422 3300046515 Bacteria 3581
665 Ga0495630_0120297 3300046517 Bacteria 1992
666 Ga0495631_0000025 3300046518 Bacteria 89262
667 Ga0495631_0000610 3300046518 Bacteria 23558
668 Ga0495632_0000016 3300046519 Bacteria 232022
669 Ga0495632_0015335 3300046519 Bacteria 4303
670 Ga0495632_0018780 3300046519 Bacteria 3785
671 Ga0495632_0122862 3300046519 Bacteria 1212
672 Ga0495643_0040192 3300046522 Bacteria 2555
673 Ga0495648_0000508 3300046524 Bacteria 41940
674 Ga0495648_0054997 3300046524 Bacteria 2401
675 Ga0495609_0000369 3300046538 Bacteria 38747
676 Ga0495668_0001459 3300046616 Bacteria 22747
677 Ga0495668_0013566 3300046616 Bacteria 4801
678 Ga0495611_0000001 3300046648 Bacteria 2628469
679 Ga0495611_0000073 3300046648 Bacteria 70704
680 Ga0495625_0000041 3300046660 Bacteria 206598
681 Ga0495625_0011746 3300046660 Bacteria 7117
682 Ga0495625_0122101 3300046660 Bacteria 1771
683 Ga0495661_0003999 3300046665 Bacteria 10750
684 Ga0495670_0007981 3300046691 Bacteria 5206
685 Ga0495670_0024078 3300046691 Bacteria 3007
686 Ga0495671_0000182 3300046692 Bacteria 55867
687 Ga0495649_0008764 3300046694 Bacteria 6065
688 Ga0495649_0286209 3300046694 Bacteria 841
689 Ga0495589_0000008 3300046794 Bacteria 266071
690 Ga0495600_0167133 3300046809 Bacteria 1421
691 Ga0495660_0000149 3300046810 Bacteria 76124
692 Ga0495660_0000169 3300046810 Bacteria 70663
693 Ga0495683_0004682 3300047323 Bacteria 7707
694 Ga0495679_000004 3300047446 Bacteria 748056
695 Ga0495673_0000004 3300047469 Bacteria 1354526
696 Ga0495673_0000278 3300047469 Bacteria 69367
697 Ga0495673_0001102 3300047469 Bacteria 23237
698 Ga0495686_0000017 3300047472 Bacteria 435554
699 Ga0495686_0001145 3300047472 Bacteria 31190
700 Ga0495686_0006922 3300047472 Bacteria 8576
701 Ga0496100_0000429 3300048903 Bacteria 20428
702 Ga0496101_0002069 3300048904 Bacteria 12212
703 Ga0496101_0003821 3300048904 Bacteria 9408
704 Ga0496102_0147830 3300048905 Bacteria 2206
705 Ga0496104_0007726 3300048907 Bacteria 9523
706 Ga0496105_0061042 3300048908 Bacteria 3110
707 Ga0496106_0012978 3300048909 Bacteria 6147
708 Ga0496106_0359119 3300048909 Bacteria 1170
709 Ga0496112_0449258 3300048915 Bacteria 1227
710 Ga0496113_0046234 3300048916 Bacteria 3231
711 Ga0496113_0121091 3300048916 Bacteria 2046
712 Ga0496114_0281161 3300048917 Bacteria 1467
713 Ga0496114_0466432 3300048917 Bacteria 1118
714 Ga0496115_0000014 3300048918 Bacteria 204935
715 Ga0496115_0000114 3300048918 Bacteria 73307
716 Ga0496117_0047074 3300048920 Bacteria 3096
717 Ga0496117_0167951 3300048920 Bacteria 1277
718 Ga0496118_0000968 3300048921 Bacteria 44862
719 Ga0496118_0001481 3300048921 Bacteria 35145
720 Ga0496118_0002007 3300048921 Bacteria 28814
721 Ga0496118_0013096 3300048921 Bacteria 7880
722 Ga0496118_0074424 3300048921 Bacteria 2428
723 Ga0496119_0000182 3300048922 Bacteria 87907
724 Ga0496119_0014215 3300048922 Bacteria 6253
725 Ga0496119_0040442 3300048922 Bacteria 2982
726 Ga0496120_0000661 3300048923 Bacteria 50628
727 Ga0496121_0000399 3300048924 Bacteria 86768
728 Ga0496121_0000419 3300048924 Bacteria 84137
729 Ga0496121_0001549 3300048924 Bacteria 38481
730 Ga0496121_0003203 3300048924 Bacteria 23561
731 Ga0496121_0049903 3300048924 Bacteria 3542
732 Ga0496121_0077231 3300048924 Bacteria 2652
733 Ga0496121_0099162 3300048924 Bacteria 2252
734 Ga0496122_0016943 3300048925 Bacteria 6847
735 Ga0496122_0048689 3300048925 Bacteria 3255
736 Ga0496123_0026838 3300048926 Bacteria 4305
737 Ga0496124_0000333 3300048927 Bacteria 87394
738 Ga0496124_0000364 3300048927 Bacteria 82831
739 Ga0496125_0025513 3300048928 Bacteria 5410
740 Ga0496125_0038509 3300048928 Bacteria 4136
741 Ga0496125_0057144 3300048928 Bacteria 3163
742 Ga0496125_0074718 3300048928 Bacteria 2627
743 Ga0496125_0248222 3300048928 Bacteria 1125
744 Ga0496126_0000047 3300048929 Bacteria 322212
745 Ga0496126_0002016 3300048929 Bacteria 28707
746 Ga0496126_0004710 3300048929 Bacteria 16111
747 Ga0496126_0133690 3300048929 Bacteria 2141
748 Ga0496126_0147072 3300048929 Bacteria 2022
749 Ga0495678_000612 3300049459 Bacteria 33460
750 Ga0495682_0002092 3300049460 Bacteria 9734
751 Ga0495682_0007777 3300049460 Bacteria 4245
752 Ga0501031_0036953 3300049568 Bacteria 3187
753 Ga0501031_0038968 3300049568 Bacteria 3100
754 Ga0501031_0209706 3300049568 Bacteria 1269
755 Ga0501032_0005403 3300049569 Bacteria 9503
756 Ga0501032_0012679 3300049569 Bacteria 6011
757 Ga0501032_0020087 3300049569 Bacteria 4657
758 Ga0501032_0035966 3300049569 Bacteria 3382
759 Ga0501033_0000348 3300049570 Bacteria 43990
760 Ga0501033_0001926 3300049570 Bacteria 18077
761 Ga0501033_0038366 3300049570 Bacteria 3582
762 Ga0501033_0087062 3300049570 Bacteria 2286
763 Ga0501033_0336776 3300049570 Bacteria 1058
764 Ga0501034_0005114 3300049571 Bacteria 14395
765 Ga0501034_0009682 3300049571 Bacteria 10079
766 Ga0501034_0056279 3300049571 Bacteria 3957
767 Ga0501034_0146756 3300049571 Bacteria 2336
768 Ga0501034_0314849 3300049571 Bacteria 1499
769 Ga0501036_0009155 3300049572 Bacteria 8141
770 Ga0501036_0036709 3300049572 Bacteria 4148
771 Ga0501036_0053181 3300049572 Bacteria 3430
772 Ga0501036_0086069 3300049572 Bacteria 2657
773 Ga0501036_0244309 3300049572 Bacteria 1505
774 Ga0501037_0014817 3300049573 Bacteria 5735
775 Ga0501037_0015803 3300049573 Bacteria 5555
776 Ga0501037_0016568 3300049573 Bacteria 5424
777 Ga0501037_0053811 3300049573 Bacteria 2944
778 Ga0501037_0062955 3300049573 Bacteria 2704
779 Ga0501037_0128610 3300049573 Bacteria 1817
780 Ga0501038_0002090 3300049574 Bacteria 18511
781 Ga0501038_0004400 3300049574 Bacteria 13113
782 Ga0501038_0125044 3300049574 Bacteria 2117
783 Ga0501038_0220005 3300049574 Bacteria 1515
784 Ga0501039_0112018 3300049575 Bacteria 2133
785 Ga0501039_0351342 3300049575 Bacteria 1158
786 Ga0501040_0213105 3300049576 Bacteria 1373
787 Ga0501043_0014793 3300049579 Bacteria 6109
788 Ga0501043_0018774 3300049579 Bacteria 5426
789 Ga0501043_0027599 3300049579 Bacteria 4456
790 Ga0501043_0041442 3300049579 Bacteria 3617
791 Ga0501043_0048624 3300049579 Bacteria 3334
792 Ga0501043_0049784 3300049579 Bacteria 3294
793 Ga0501043_0174840 3300049579 Bacteria 1674
794 Ga0501043_0285417 3300049579 Bacteria 1264
795 Ga0501043_0349076 3300049579 Bacteria 1124
796 Ga0501046_0007181 3300049580 Bacteria 9801
797 Ga0501046_0017017 3300049580 Bacteria 6079
798 Ga0501046_0020695 3300049580 Bacteria 5439
799 Ga0501046_0045408 3300049580 Bacteria 3491
800 Ga0501046_0062053 3300049580 Bacteria 2921
801 Ga0501047_0002283 3300049581 Bacteria 18340
802 Ga0501047_0002357 3300049581 Bacteria 18067
803 Ga0501047_0009404 3300049581 Bacteria 9234
804 Ga0501047_0022487 3300049581 Bacteria 6055
805 Ga0501047_0037056 3300049581 Bacteria 4714
806 Ga0501047_0048735 3300049581 Bacteria 4091
807 Ga0501047_0088296 3300049581 Bacteria 2977
808 Ga0501047_0173781 3300049581 Bacteria 2023
809 Ga0501047_0203539 3300049581 Bacteria 1840
810 Ga0501047_0578370 3300049581 Bacteria 946
811 Ga0501048_0016969 3300049582 Bacteria 5366
812 Ga0501048_0037248 3300049582 Bacteria 3492
813 Ga0501048_0183181 3300049582 Bacteria 1485
814 Ga0501067_0107094 3300049583 Bacteria 1553
815 Ga0501067_0122715 3300049583 Bacteria 1446
816 Ga0501068_0018324 3300049584 Bacteria 4055
817 Ga0501068_0038322 3300049584 Bacteria 2871
818 Ga0501068_0219789 3300049584 Bacteria 1207
819 Ga0501069_0003346 3300049585 Bacteria 8230
820 Ga0501069_0066495 3300049585 Bacteria 2016
821 Ga0501069_0092224 3300049585 Bacteria 1713
822 Ga0501070_0000326 3300049586 Bacteria 43230
823 Ga0501070_0004534 3300049586 Bacteria 11920
824 Ga0501070_0010746 3300049586 Bacteria 7735
825 Ga0501070_0012984 3300049586 Bacteria 7021
826 Ga0501070_0022914 3300049586 Bacteria 5227
827 Ga0501070_0023118 3300049586 Bacteria 5206
828 Ga0501070_0029077 3300049586 Bacteria 4634
829 Ga0501070_0144692 3300049586 Bacteria 1962
830 Ga0501070_0260550 3300049586 Bacteria 1417
831 Ga0501070_0330234 3300049586 Bacteria 1239
832 Ga0501071_0009415 3300049587 Bacteria 6503
833 Ga0501071_0027058 3300049587 Bacteria 4032
834 Ga0501072_0004448 3300049588 Bacteria 10646
835 Ga0501073_0005962 3300049589 Bacteria 9091
836 Ga0501073_0006378 3300049589 Bacteria 8778
837 Ga0501073_0013747 3300049589 Bacteria 5888
838 Ga0501073_0096556 3300049589 Bacteria 2052
839 Ga0501073_0147484 3300049589 Bacteria 1630
840 Ga0501073_0153741 3300049589 Bacteria 1594
841 Ga0501073_0197764 3300049589 Bacteria 1390
842 Ga0501073_0222727 3300049589 Bacteria 1303
843 Ga0501074_0003509 3300049590 Bacteria 11133
844 Ga0501074_0009116 3300049590 Bacteria 7206
845 Ga0501074_0023223 3300049590 Bacteria 4510
846 Ga0501074_0079919 3300049590 Bacteria 2346
847 Ga0501074_0174608 3300049590 Bacteria 1533
848 Ga0501074_0177145 3300049590 Bacteria 1521
849 Ga0501076_0181898 3300049592 Bacteria 1714
850 Ga0501079_0010160 3300049741 Bacteria 7146
851 Ga0501079_0078559 3300049741 Bacteria 2552
852 Ga0501079_0204370 3300049741 Bacteria 1543
853 Ga0501079_0240688 3300049741 Bacteria 1414
854 Ga0501080_0001852 3300049742 Bacteria 18163
855 Ga0501080_0012301 3300049742 Bacteria 7840
856 Ga0501080_0014254 3300049742 Bacteria 7319
857 Ga0501080_0020322 3300049742 Bacteria 6145
858 Ga0501080_0038414 3300049742 Bacteria 4469
859 Ga0501080_0143426 3300049742 Bacteria 2208
860 Ga0501080_0193486 3300049742 Bacteria 1868
861 Ga0501081_0026930 3300049743 Bacteria 3879
862 Ga0501083_0001507 3300049744 Bacteria 15917
863 Ga0501083_0170180 3300049744 Bacteria 1424
864 Ga0501035_0009202 3300049822 Bacteria 9185
865 Ga0501035_0059449 3300049822 Bacteria 3403
866 Ga0501035_0079624 3300049822 Bacteria 2894
867 Ga0501035_0093689 3300049822 Bacteria 2642
868 Ga0501035_0219622 3300049822 Bacteria 1623
869 Ga0501035_0658303 3300049822 Bacteria 848
870 Ga0501044_0002749 3300049823 Bacteria 20015
871 Ga0501044_0013604 3300049823 Bacteria 8795
872 Ga0501044_0019990 3300049823 Bacteria 7151
873 Ga0501044_0022516 3300049823 Bacteria 6713
874 Ga0501044_0024652 3300049823 Bacteria 6383
875 Ga0501044_0036023 3300049823 Bacteria 5178
876 Ga0501044_0045100 3300049823 Bacteria 4571
877 Ga0501044_0046685 3300049823 Bacteria 4483
878 Ga0501044_0046821 3300049823 Bacteria 4476
879 Ga0501044_0071982 3300049823 Bacteria 3515
880 Ga0501044_0100319 3300049823 Bacteria 2913
881 Ga0501044_0121713 3300049823 Bacteria 2609
882 Ga0501044_0309081 3300049823 Bacteria 1508
883 Ga0501044_0650305 3300049823 Bacteria 943
884 nmdc:mga00v17_26824_c1 3300050491 Bacteria 3360
885 nmdc:mga0n895_162959_c1 3300050512 Bacteria 2261
886 Ga0500643_000020 3300053087 Bacteria 290328
887 Ga0500651_0000415 3300053093 Bacteria 22937
888 Ga0500568_0000367 3300053139 Bacteria 34838
889 Ga0500633_0037073 3300053160 Bacteria 1616
890 Ga0500645_000617 3300053730 Bacteria 22792
891 Ga0501084_0023603 3300054114 Bacteria 5130
892 Ga0501084_0124925 3300054114 Bacteria 2165
893 Ga0501082_0000141 3300060353 Bacteria 59767
894 Ga0501082_0026881 3300060353 Bacteria 4958
895 Ga0501082_0027942 3300060353 Bacteria 4859
896 Ga0501082_0127048 3300060353 Bacteria 2211
897 Ga0466962_0003234 3300061719 Bacteria 7743
898 Ga0466962_0029291 3300061719 Bacteria 2635
899 Ga0466962_0231345 3300061719 Bacteria 906
900 2538835124 2537561836 Bacteria 3910579
901 2595446984 2593339238 Bacteria 4182970
902 2595449742 2593339239 Bacteria 4124669
903 2643829388 2643221562 Bacteria 4048635
904 2644475982 2643221685 Bacteria 3673288
905 2687582028 2687453130 Bacteria 4227172
906 2721026348 2718218334 Bacteria 4765486
907 2735833674 2734482264 Unclassified 5014763
908 2739229324 2738543009 Bacteria 4944499
909 2739729961 2739367700 Bacteria 4747630
910 2819564123 2818991440 Bacteria 4774720
911 2842917676 2842914999 Bacteria 4419378
912 2842920050 2842918807 Bacteria 4289178
913 2884341662 2884338543 Bacteria 4610696
914 2884412997 2884411467 Bacteria 5246714
915 2904464759 2904463128 Bacteria 4775606
916 2919088153 2919085039 Bacteria 4532964
917 2919406273 2919404418 Bacteria 4232372
918 2919499223 2919497567 Bacteria 4408621
919 2928965853 2928963466 Bacteria 5165703
920 2939612893 2939611941 Bacteria 3892017
921 2941473064 2941471342 Bacteria 5018624
922 2953995339 2953994433 Bacteria 4303959
923 JGI24736J21556_1003065
924 JGI24740J21852_10002516
925 JGI24740J21852_10004620
926 JGI24739J22299_10002555
927 JGI24737J22298_10003819
928 JGI24735J21928_10017069
929 JGI24738J21930_10016184
930 JGI25156J39149_1002499
931 JGI25162J39368_1000997
932 JGI25162J39368_1001016
933 JGI25162J39368_1001293
934 JGI25162J39368_1003388
935 JGI25162J39368_1010519
936 JGI25157J39369_1001296
937 JGI25157J39369_1003130
938 JGI25157J39369_1003163
939 JGI25163J39215_1000604
940 JGI25163J39215_1000836
941 JGI25164J39214_1000169
942 JGI25164J39214_1000510
943 JGI25164J39214_1000517
944 JGI25164J39214_1000877
945 JGI25165J46597_1000360
946 JGI25165J46597_1000562
947 JGI25165J46597_1001043
948 JGI25165J46597_1004619
949 JGI25153J46596_10009316
950 rootH1_10051601
951 rootH1_10145377
952 rootH2_10021538
953 Ga0006562J51391_1028147
954 Ga0006562J51391_1057626
955 Ga0055539_1001724
956 Ga0055525_1000464
957 Ga0055527_1000053
958 Ga0055527_1000116
959 Ga0055535_1000296
960 Ga0055535_1000298
961 Ga0055535_1000667
962 Ga0055535_1001282
963 Ga0055535_1001752
964 Ga0055542_1000056
965 Ga0055542_1000187
966 Ga0055542_1000277
967 Ga0055542_1000323
968 Ga0055542_1000387
969 Ga0055542_1001002
970 Ga0055529_1000264
971 Ga0055529_1000298
972 Ga0055529_1000415
973 Ga0055529_1001224
974 Ga0055526_1028093
975 Ga0055536_1019305
976 Ga0055530_10010387
977 Ga0055531_10010638
978 Ga0055531_10023299
979 Ga0065165_1000700
980 Ga0065165_1019690
981 Ga0065714_10089290
982 Ga0070658_10001497
983 Ga0070676_10159477
984 Ga0070670_100014157
985 Ga0068869_100235721
986 Ga0070666_10000013
987 Ga0070666_10002022
988 Ga0070666_10036820
989 Ga0070680_100000291
990 Ga0070680_100034991
991 Ga0070680_100065827
992 Ga0070680_100187766
993 Ga0070680_100705842
994 Ga0070682_100001023
995 Ga0070682_100003056
996 Ga0070682_100047125
997 Ga0068868_100060167
998 Ga0070660_100046238
999 Ga0070660_100225080
1000 Ga0070689_100002032
1001 Ga0070691_10077010
1002 Ga0070661_100014293
1003 Ga0070661_100018614
1004 Ga0070661_100027727
1005 Ga0070661_100054393
1006 Ga0070661_100085715
1007 Ga0070661_100217364
1008 Ga0070661_100374397
1009 Ga0070692_10033272
1010 Ga0070668_100123170
1011 Ga0070674_100431921
1012 Ga0070673_100129337
1013 Ga0070659_100002227
1014 Ga0070659_100063344
1015 Ga0070659_100116351
1016 Ga0070659_100184188
1017 Ga0070667_100049159
1018 Ga0070667_100347652
1019 Ga0070667_100674886
1020 Ga0070714_100000020
1021 Ga0070714_100015093
1022 Ga0070714_100019341
1023 Ga0070714_100050368
1024 Ga0070713_100001409
1025 Ga0070713_100161252
1026 Ga0070711_100203830
1027 Ga0070711_100453511
1028 Ga0070700_100247848
1029 Ga0070694_100027486
1030 Ga0070663_100022581
1031 Ga0070663_100073934
1032 Ga0070663_100180617
1033 Ga0070678_100060529
1034 Ga0070678_100154504
1035 Ga0070662_100083262
1036 Ga0070662_100314460
1037 Ga0070681_10000006
1038 Ga0070681_10007337
1039 Ga0070681_10011412
1040 Ga0070681_10019530
1041 Ga0070681_10051145
1042 Ga0070681_10066806
1043 Ga0070681_10145470
1044 Ga0068867_100195727
1045 Ga0070685_10010301
1046 Ga0070679_100000207
1047 Ga0070684_100186482
1048 Ga0068853_100002190
1049 Ga0068853_100104364
1050 Ga0068853_100111514
1051 Ga0068853_100140414
1052 Ga0068853_100167334
1053 Ga0070672_100073410
1054 Ga0070686_100060673
1055 Ga0070696_100007413
1056 Ga0070696_100022947
1057 Ga0070696_100269827
1058 Ga0070696_100498915
1059 Ga0070693_100013764
1060 Ga0070693_100015213
1061 Ga0070693_100054239
1062 Ga0070665_100000100
1063 Ga0070665_100001350
1064 Ga0070665_100071557
1065 Ga0070665_100073872
1066 Ga0068855_100014910
1067 Ga0068855_100108448
1068 Ga0068855_100141865
1069 Ga0068855_100312103
1070 Ga0068857_100034725
1071 Ga0068857_100046125
1072 Ga0068857_100058255
1073 Ga0068857_100122926
1074 Ga0068857_100279371
1075 Ga0068854_100003203
1076 Ga0068854_100003650
1077 Ga0068854_100026043
1078 Ga0068854_100034159
1079 Ga0068854_100057110
1080 Ga0068854_100413361
1081 Ga0068856_100000882
1082 Ga0068856_100003051
1083 Ga0068856_100025778
1084 Ga0068856_100144933
1085 Ga0068852_100031237
1086 Ga0068852_100249539
1087 Ga0068859_100000712
1088 Ga0068859_100781613
1089 Ga0068864_100044068
1090 Ga0068864_100168454
1091 Ga0068851_10008194
1092 Ga0068851_10016801
1093 Ga0068851_10048722
1094 Ga0068851_10260097
1095 Ga0068863_100027559
1096 Ga0068863_100042126
1097 Ga0068863_100100704
1098 Ga0068863_100245002
1099 Ga0068863_100246604
1100 Ga0068863_100358085
1101 Ga0068858_100001088
1102 Ga0068858_100010755
1103 Ga0068858_100176842
1104 Ga0068860_100066163
1105 Ga0068860_100291893
1106 Ga0068862_100001541
1107 Ga0068862_100065416
1108 Ga0081540_1001452
1109 Ga0097621_100058639
1110 Ga0068871_100007828
1111 Ga0068871_100031831
1112 Ga0068871_100292652
1113 Ga0068871_100384656
1114 Ga0068865_100023502
1115 Ga0097620_100000712
1116 Ga0097620_100781610
1117 Ga0105240_10002526
1118 Ga0105240_10008269
1119 Ga0105240_10077292
1120 Ga0105240_10314102
1121 Ga0105240_10715685
1122 Ga0105247_10000994
1123 Ga0105247_10046858
1124 Ga0105241_10320818
1125 Ga0105248_10055311
1126 Ga0105248_10083302
1127 Ga0105248_10179838
1128 Ga0105248_10193928
1129 Ga0105237_10000292
1130 Ga0105237_10001255
1131 Ga0105237_10069164
1132 Ga0105237_10127922
1133 Ga0105237_10130108
1134 Ga0105237_10257373
1135 Ga0105238_10000131
1136 Ga0105238_10002315
1137 Ga0105238_10008019
1138 Ga0105238_10053714
1139 Ga0105238_10059444
1140 Ga0105238_10110292
1141 Ga0105238_10148432
1142 Ga0105238_10228643
1143 Ga0105249_10003406
1144 Ga0105239_10001711
1145 Ga0105239_10017137
1146 Ga0105239_10080197
1147 Ga0105239_10105998
1148 Ga0105239_10147002
1149 Ga0105246_10024032
1150 Ga0157314_1000159
1151 Ga0157373_10002912
1152 Ga0157373_10077647
1153 Ga0157373_10111594
1154 Ga0157373_10378432
1155 Ga0157371_10004953
1156 Ga0157371_10236209
1157 Ga0157370_10003809
1158 Ga0157370_10004261
1159 Ga0157370_10012899
1160 Ga0157370_10018653
1161 Ga0157370_10069448
1162 Ga0157370_10117478
1163 Ga0157369_10000529
1164 Ga0157369_10041539
1165 Ga0157369_10221111
1166 Ga0157369_10399687
1167 Ga0157369_10432558
1168 Ga0157369_10455937
1169 Ga0157374_10200077
1170 Ga0157374_10366630
1171 Ga0157374_10476995
1172 Ga0157378_10000597
1173 Ga0157378_10080956
1174 Ga0163162_10000221
1175 Ga0163162_10040418
1176 Ga0163162_10053140
1177 Ga0157372_10004293
1178 Ga0157372_10006042
1179 Ga0157372_10019593
1180 Ga0157372_10021196
1181 Ga0157372_10038983
1182 Ga0157372_10068313
1183 Ga0157372_10079085
1184 Ga0157372_10097690
1185 Ga0157372_10117989
1186 Ga0157372_10126400
1187 Ga0157372_10337848
1188 Ga0157375_10012477
1189 Ga0157375_10393455
1190 Ga0157380_10410091
1191 Ga0182008_10008499
1192 Ga0157379_10006942
1193 Ga0157379_10144554
1194 Ga0157379_10320195
1195 Ga0157379_10459009
1196 Ga0157376_10016625
1197 Ga0157376_10020307
1198 Ga0157376_10319423
1199 Ga0157376_10614567
1200 Ga0182006_1000093
1201 Ga0182006_1000416
1202 Ga0182007_10002081
1203 Ga0182007_10004848
1204 Ga0182005_1000536
1205 Ga0182005_1008634
1206 Ga0182005_1010115
1207 Ga0183369_1003
1208 Ga0183368_1003
1209 Ga0163161_10000685
1210 Ga0163161_10040488
1211 Ga0163161_10086853
1212 Ga0206356_10643678
1213 Ga0206353_11323503
1214 Ga0206353_11660574
1215 Ga0209760_100616
1216 Ga0209784_100422
1217 Ga0209566_101298
1218 Ga0209674_100012
1219 Ga0209674_100077
1220 Ga0209674_100642
1221 Ga0209674_100983
1222 Ga0209674_102647
1223 Ga0209672_100004
1224 Ga0209672_100022
1225 Ga0209672_100476
1226 Ga0209672_101466
1227 Ga0209563_100103
1228 Ga0207427_100111
1229 Ga0207427_100175
1230 Ga0207427_100179
1231 Ga0207427_100304
1232 Ga0207427_102993
1233 Ga0207427_110925
1234 Ga0209437_100099
1235 Ga0209437_100269
1236 Ga0209437_100270
1237 Ga0209437_100368
1238 Ga0209437_100384
1239 Ga0209437_102555
1240 Ga0209437_106531
1241 Ga0209258_100003
1242 Ga0209258_100004
1243 Ga0209258_100119
1244 Ga0209258_100137
1245 Ga0209258_100182
1246 Ga0209258_100849
1247 Ga0209646_1000986
1248 Ga0209646_1001576
1249 Ga0209646_1005596
1250 Ga0209026_1000175
1251 Ga0209026_1000242
1252 Ga0209026_1000276
1253 Ga0209026_1000504
1254 Ga0209026_1001966
1255 Ga0209026_1006043
1256 Ga0209677_110280
1257 Ga0209148_1000005
1258 Ga0209148_1000025
1259 Ga0209148_1000036
1260 Ga0209148_1000062
1261 Ga0209148_1000083
1262 Ga0209148_1000137
1263 Ga0209148_1001922
1264 Ga0209759_1000136
1265 Ga0209759_1003929
1266 Ga0209759_1008606
1267 Ga0209759_1009273
1268 Ga0209759_1014828
1269 Ga0209129_1001516
1270 Ga0209233_1000040
1271 Ga0209233_1000075
1272 Ga0209233_1000077
1273 Ga0209233_1000128
1274 Ga0209233_1006779
1275 Ga0209455_1000004
1276 Ga0209455_1000040
1277 Ga0209455_1000084
1278 Ga0209455_1000095
1279 Ga0209455_1000164
1280 Ga0209675_1010375
1281 Ga0209676_1003628
1282 Ga0209676_1004464
1283 Ga0209025_1001565
1284 Ga0209025_1040053
1285 Ga0209564_1038640
1286 Ga0209758_1002651
1287 Ga0209758_1003842
1288 Ga0209758_1030526
1289 Ga0209050_1000712
1290 Ga0209256_1002872
1291 Ga0209256_1011746
1292 Ga0209256_1019927
1293 Ga0209051_1012143
1294 Ga0209051_1051734
1295 Ga0209257_1000210
1296 Ga0209257_1000792
1297 Ga0209257_1000856
1298 Ga0209257_1009432
1299 Ga0207656_10006257
1300 Ga0207710_10015097
1301 Ga0207680_10000001
1302 Ga0207680_10131591
1303 Ga0207647_10000505
1304 Ga0207647_10001812
1305 Ga0207647_10004982
1306 Ga0207647_10012646
1307 Ga0207647_10034080
1308 Ga0207647_10082383
1309 Ga0207647_10095622
1310 Ga0207699_10198393
1311 Ga0207645_10080512
1312 Ga0207705_10001749
1313 Ga0207705_10006682
1314 Ga0207705_10009407
1315 Ga0207705_10042602
1316 Ga0207705_10120522
1317 Ga0207654_10010017
1318 Ga0207707_10015416
1319 Ga0207707_10017428
1320 Ga0207707_10074164
1321 Ga0207695_10000588
1322 Ga0207695_10001221
1323 Ga0207695_10004028
1324 Ga0207695_10005207
1325 Ga0207695_10021315
1326 Ga0207695_10036666
1327 Ga0207695_10103332
1328 Ga0207695_10320295
1329 Ga0207671_10000011
1330 Ga0207671_10001034
1331 Ga0207671_10022794
1332 Ga0207671_10181031
1333 Ga0207693_10405722
1334 Ga0207663_10225792
1335 Ga0207663_10243526
1336 Ga0207663_10297875
1337 Ga0207660_10018727
1338 Ga0207660_10190204
1339 Ga0207657_10042581
1340 Ga0207657_10099172
1341 Ga0207657_10112915
1342 Ga0207657_10294805
1343 Ga0207657_10406232
1344 Ga0207649_10036870
1345 Ga0207649_10045564
1346 Ga0207649_10068356
1347 Ga0207649_10170829
1348 Ga0207652_10003552
1349 Ga0207652_10141772
1350 Ga0207694_10000168
1351 Ga0207694_10000569
1352 Ga0207694_10010204
1353 Ga0207694_10035516
1354 Ga0207694_10039308
1355 Ga0207694_10176486
1356 Ga0207694_10373064
1357 Ga0207650_10006083
1358 Ga0207650_10031247
1359 Ga0207700_10000786
1360 Ga0207664_10000023
1361 Ga0207664_10014270
1362 Ga0207664_10019584
1363 Ga0207664_10230146
1364 Ga0207644_10239554
1365 Ga0207690_10000138
1366 Ga0207690_10002810
1367 Ga0207690_10002895
1368 Ga0207690_10003142
1369 Ga0207690_10051003
1370 Ga0207690_10074563
1371 Ga0207690_10077466
1372 Ga0207706_10009106
1373 Ga0207706_10152053
1374 Ga0207670_10005511
1375 Ga0207691_10022061
1376 Ga0207691_10092693
1377 Ga0207689_10137571
1378 Ga0207689_10162490
1379 Ga0207667_10000219
1380 Ga0207667_10002626
1381 Ga0207667_10003053
1382 Ga0207667_10007466
1383 Ga0207667_10015699
1384 Ga0207667_10021746
1385 Ga0207667_10031108
1386 Ga0207667_10380849
1387 Ga0207651_10036454
1388 Ga0207712_10000910
1389 Ga0207668_10013757
1390 Ga0207668_10222940
1391 Ga0207640_10001957
1392 Ga0207640_10002433
1393 Ga0207640_10010933
1394 Ga0207640_10039046
1395 Ga0207640_10044999
1396 Ga0207640_10203347
1397 Ga0207658_10020832
1398 Ga0207658_10304492
1399 Ga0207677_10110499
1400 Ga0207703_10002638
1401 Ga0207703_10014170
1402 Ga0207639_10001276
1403 Ga0207639_10001781
1404 Ga0207639_10011087
1405 Ga0207639_10025673
1406 Ga0207639_10050968
1407 Ga0207639_10414708
1408 Ga0207639_10657079
1409 Ga0207678_10005893
1410 Ga0207678_10025277
1411 Ga0207678_10135531
1412 Ga0207678_10593785
1413 Ga0207702_10000132
1414 Ga0207702_10000338
1415 Ga0207702_10160243
1416 Ga0207702_10247053
1417 Ga0207702_10504919
1418 Ga0207641_10039591
1419 Ga0207641_10089040
1420 Ga0207641_10098154
1421 Ga0207641_10193128
1422 Ga0207641_10255860
1423 Ga0207648_10049917
1424 Ga0207648_10167078
1425 Ga0207676_10009124
1426 Ga0207674_10000445
1427 Ga0207674_10007822
1428 Ga0207674_10012043
1429 Ga0207674_10051627
1430 Ga0207674_10067443
1431 Ga0207674_10105359
1432 Ga0207674_10218425
1433 Ga0207683_10049228
1434 Ga0207683_10145598
1435 Ga0207698_10162288
1436 Ga0207698_10203692
1437 Ga0207698_10240639
1438 Ga0207698_10241769
1439 Ga0207698_10344539
1440 Ga0207698_10521664
1441 Ga0268266_10000008
1442 Ga0268266_10000017
1443 Ga0268266_10000075
1444 Ga0268266_10255490
1445 Ga0268265_10001331
1446 Ga0268265_10032360
1447 Ga0268265_10542882
1448 Ga0268264_10071857
1449 Ga0268264_10143110
1450 Ga0265326_10022819
1451 Ga0265334_10000010
1452 Ga0265334_10009716
1453 Ga0265338_10025223
1454 Ga0265331_10044359
1455 Ga0265327_10048817
1456 Ga0307408_100042774
1457 Ga0265313_10000125
1458 Ga0265313_10033433
1459 Ga0316575_10005736
1460 Ga0316575_10045999
1461 Ga0316579_10001636
1462 Ga0316576_10331485
1463 Ga0307516_10016384
1464 Ga0316577_10034295
1465 Ga0307416_100220704
1466 Ga0307411_10154500
1467 Ga0307415_100290842
1468 Ga0316593_10063885
1469 Ga0307510_10002207
1470 Ga0373926_0020069
1471 Ga0373954_0177001
1472 Ga0316574_0087922
1473 Ga0316574_0123308
1474 Ga0373927_0000002
1475 Ga0316582_0002724
1476 Ga0316582_0030543
1477 Ga0316582_0086870
1478 Ga0316584_0055286
1479 Ga0316584_0098219
1480 Ga0395899_0000110
1481 Ga0395899_0012571
1482 Ga0395899_0044042
1483 Ga0395899_0061640
1484 Ga0395899_0159318
1485 Ga0395900_0000049
1486 Ga0395900_0001309
1487 Ga0395900_0005124
1488 Ga0395900_0036270
1489 Ga0395898_0000023
1490 Ga0395898_0000237
1491 Ga0395898_0004579
1492 Ga0395898_0048634
1493 Ga0395898_0223178
1494 Ga0395898_0514194
1495 Ga0395901_0000873
1496 Ga0395901_0053236
1497 Ga0395901_0061952
1498 Ga0395901_0067604
1499 Ga0395901_0106254
1500 Ga0395901_0160744
1501 Ga0395901_0167601
1502 Ga0400484_11747
1503 Ga0400490_02358
1504 Ga0400490_18961
1505 Ga0400490_30277
1506 Ga0400490_43842
1507 Ga0400485_07224
1508 Ga0400488_53730
1509 Ga0400488_60826
1510 Ga0400486_04121
1511 Ga0400486_26793
1512 Ga0400483_103881
1513 Ga0400483_148714
1514 Ga0400483_290206
1515 Ga0400489_54126
1516 Ga0400487_07673
1517 Ga0400487_16810
1518 Ga0439436_0000016
1519 Ga0439465_0000015
1520 Ga0451807_0248796
1521 Ga0451853_0579969
1522 Ga0439452_020180
1523 Ga0439462_0043340
1524 Ga0450908_000014
1525 Ga0451577_0002835
1526 Ga0466969_0008578
1527 Ga0466969_0055518
1528 Ga0466972_0106509
1529 Ga0466975_0071941
1530 Ga0466982_0000018
1531 Ga0466982_0000063
1532 Ga0466965_0048618
1533 Ga0466966_0002133
1534 Ga0466966_0027281
1535 Ga0466966_0044340
1536 Ga0466966_0125883
1537 Ga0466961_0002932
1538 Ga0466961_0006126
1539 Ga0466961_0009482
1540 Ga0466963_0096881
1541 Ga0466964_0009495
1542 Ga0466964_0014585
1543 Ga0453684_0001318
1544 Ga0466971_0004604
1545 Ga0466971_0005321
1546 Ga0466971_0105084
1547 Ga0466968_0000215
1548 Ga0466968_0004358
1549 Ga0466968_0116575
1550 Ga0466970_0028072
1551 Ga0466970_0036680
1552 Ga0466970_0041328
1553 Ga0466970_0213805
1554 Ga0466957_0016106
1555 Ga0466957_0089139
1556 Ga0466960_0031795
1557 Ga0466959_0000265
1558 Ga0466959_0080423
1559 Ga0466959_0150125
1560 Ga0451576_0000628
1561 Ga0466958_0029415
1562 Ga0466958_0049622
1563 Ga0466967_0305623
1564 Ga0495617_000110
1565 Ga0495617_000750
1566 Ga0495590_0066941
1567 Ga0495638_0000019
1568 Ga0495638_0000078
1569 Ga0495638_0000406
1570 Ga0495650_0000286
1571 Ga0495650_0000350
1572 Ga0495650_0000466
1573 Ga0495584_0007684
1574 Ga0495585_0000366
1575 Ga0495585_0005846
1576 Ga0495607_0000040
1577 Ga0495607_0000140
1578 Ga0495606_0000479
1579 Ga0495606_0001310
1580 Ga0495606_0002054
1581 Ga0495610_0003265
1582 Ga0495610_0049341
1583 Ga0495616_0000045
1584 Ga0495616_0002958
1585 Ga0495620_0000141
1586 Ga0495620_0017422
1587 Ga0495630_0120297
1588 Ga0495631_0000025
1589 Ga0495631_0000610
1590 Ga0495632_0000016
1591 Ga0495632_0015335
1592 Ga0495632_0018780
1593 Ga0495632_0122862
1594 Ga0495643_0040192
1595 Ga0495648_0000508
1596 Ga0495648_0054997
1597 Ga0495609_0000369
1598 Ga0495668_0001459
1599 Ga0495668_0013566
1600 Ga0495611_0000001
1601 Ga0495611_0000073
1602 Ga0495625_0000041
1603 Ga0495625_0011746
1604 Ga0495625_0122101
1605 Ga0495661_0003999
1606 Ga0495670_0007981
1607 Ga0495670_0024078
1608 Ga0495671_0000182
1609 Ga0495649_0008764
1610 Ga0495649_0286209
1611 Ga0495589_0000008
1612 Ga0495600_0167133
1613 Ga0495660_0000149
1614 Ga0495660_0000169
1615 Ga0495683_0004682
1616 Ga0495679_000004
1617 Ga0495673_0000004
1618 Ga0495673_0000278
1619 Ga0495673_0001102
1620 Ga0495686_0000017
1621 Ga0495686_0001145
1622 Ga0495686_0006922
1623 Ga0496100_0000429
1624 Ga0496101_0002069
1625 Ga0496101_0003821
1626 Ga0496102_0147830
1627 Ga0496104_0007726
1628 Ga0496105_0061042
1629 Ga0496106_0012978
1630 Ga0496106_0359119
1631 Ga0496112_0449258
1632 Ga0496113_0046234
1633 Ga0496113_0121091
1634 Ga0496114_0281161
1635 Ga0496114_0466432
1636 Ga0496115_0000014
1637 Ga0496115_0000114
1638 Ga0496117_0047074
1639 Ga0496117_0167951
1640 Ga0496118_0000968
1641 Ga0496118_0001481
1642 Ga0496118_0002007
1643 Ga0496118_0013096
1644 Ga0496118_0074424
1645 Ga0496119_0000182
1646 Ga0496119_0014215
1647 Ga0496119_0040442
1648 Ga0496120_0000661
1649 Ga0496121_0000399
1650 Ga0496121_0000419
1651 Ga0496121_0001549
1652 Ga0496121_0003203
1653 Ga0496121_0049903
1654 Ga0496121_0077231
1655 Ga0496121_0099162
1656 Ga0496122_0016943
1657 Ga0496122_0048689
1658 Ga0496123_0026838
1659 Ga0496124_0000333
1660 Ga0496124_0000364
1661 Ga0496125_0025513
1662 Ga0496125_0038509
1663 Ga0496125_0057144
1664 Ga0496125_0074718
1665 Ga0496125_0248222
1666 Ga0496126_0000047
1667 Ga0496126_0002016
1668 Ga0496126_0004710
1669 Ga0496126_0133690
1670 Ga0496126_0147072
1671 Ga0495678_000612
1672 Ga0495682_0002092
1673 Ga0495682_0007777
1674 Ga0501031_0036953
1675 Ga0501031_0038968
1676 Ga0501031_0209706
1677 Ga0501032_0005403
1678 Ga0501032_0012679
1679 Ga0501032_0020087
1680 Ga0501032_0035966
1681 Ga0501033_0000348
1682 Ga0501033_0001926
1683 Ga0501033_0038366
1684 Ga0501033_0087062
1685 Ga0501033_0336776
1686 Ga0501034_0005114
1687 Ga0501034_0009682
1688 Ga0501034_0056279
1689 Ga0501034_0146756
1690 Ga0501034_0314849
1691 Ga0501036_0009155
1692 Ga0501036_0036709
1693 Ga0501036_0053181
1694 Ga0501036_0086069
1695 Ga0501036_0244309
1696 Ga0501037_0014817
1697 Ga0501037_0015803
1698 Ga0501037_0016568
1699 Ga0501037_0053811
1700 Ga0501037_0062955
1701 Ga0501037_0128610
1702 Ga0501038_0002090
1703 Ga0501038_0004400
1704 Ga0501038_0125044
1705 Ga0501038_0220005
1706 Ga0501039_0112018
1707 Ga0501039_0351342
1708 Ga0501040_0213105
1709 Ga0501043_0014793
1710 Ga0501043_0018774
1711 Ga0501043_0027599
1712 Ga0501043_0041442
1713 Ga0501043_0048624
1714 Ga0501043_0049784
1715 Ga0501043_0174840
1716 Ga0501043_0285417
1717 Ga0501043_0349076
1718 Ga0501046_0007181
1719 Ga0501046_0017017
1720 Ga0501046_0020695
1721 Ga0501046_0045408
1722 Ga0501046_0062053
1723 Ga0501047_0002283
1724 Ga0501047_0002357
1725 Ga0501047_0009404
1726 Ga0501047_0022487
1727 Ga0501047_0037056
1728 Ga0501047_0048735
1729 Ga0501047_0088296
1730 Ga0501047_0173781
1731 Ga0501047_0203539
1732 Ga0501047_0578370
1733 Ga0501048_0016969
1734 Ga0501048_0037248
1735 Ga0501048_0183181
1736 Ga0501067_0107094
1737 Ga0501067_0122715
1738 Ga0501068_0018324
1739 Ga0501068_0038322
1740 Ga0501068_0219789
1741 Ga0501069_0003346
1742 Ga0501069_0066495
1743 Ga0501069_0092224
1744 Ga0501070_0000326
1745 Ga0501070_0004534
1746 Ga0501070_0010746
1747 Ga0501070_0012984
1748 Ga0501070_0022914
1749 Ga0501070_0023118
1750 Ga0501070_0029077
1751 Ga0501070_0144692
1752 Ga0501070_0260550
1753 Ga0501070_0330234
1754 Ga0501071_0009415
1755 Ga0501071_0027058
1756 Ga0501072_0004448
1757 Ga0501073_0005962
1758 Ga0501073_0006378
1759 Ga0501073_0013747
1760 Ga0501073_0096556
1761 Ga0501073_0147484
1762 Ga0501073_0153741
1763 Ga0501073_0197764
1764 Ga0501073_0222727
1765 Ga0501074_0003509
1766 Ga0501074_0009116
1767 Ga0501074_0023223
1768 Ga0501074_0079919
1769 Ga0501074_0174608
1770 Ga0501074_0177145
1771 Ga0501076_0181898
1772 Ga0501079_0010160
1773 Ga0501079_0078559
1774 Ga0501079_0204370
1775 Ga0501079_0240688
1776 Ga0501080_0001852
1777 Ga0501080_0012301
1778 Ga0501080_0014254
1779 Ga0501080_0020322
1780 Ga0501080_0038414
1781 Ga0501080_0143426
1782 Ga0501080_0193486
1783 Ga0501081_0026930
1784 Ga0501083_0001507
1785 Ga0501083_0170180
1786 Ga0501035_0009202
1787 Ga0501035_0059449
1788 Ga0501035_0079624
1789 Ga0501035_0093689
1790 Ga0501035_0219622
1791 Ga0501035_0658303
1792 Ga0501044_0002749
1793 Ga0501044_0013604
1794 Ga0501044_0019990
1795 Ga0501044_0022516
1796 Ga0501044_0024652
1797 Ga0501044_0036023
1798 Ga0501044_0045100
1799 Ga0501044_0046685
1800 Ga0501044_0046821
1801 Ga0501044_0071982
1802 Ga0501044_0100319
1803 Ga0501044_0121713
1804 Ga0501044_0309081
1805 Ga0501044_0650305
1806 nmdc:mga00v17_26824_c1
1807 nmdc:mga0n895_162959_c1
1808 Ga0500643_000020
1809 Ga0500651_0000415
1810 Ga0500568_0000367
1811 Ga0500633_0037073
1812 Ga0500645_000617
1813 Ga0501084_0023603
1814 Ga0501084_0124925
1815 Ga0501082_0000141
1816 Ga0501082_0026881
1817 Ga0501082_0027942
1818 Ga0501082_0127048
1819 Ga0466962_0003234
1820 Ga0466962_0029291
1821 Ga0466962_0231345
1822 2538835124
1823 2595446984
1824 2595449742
1825 2643829388
1826 2644475982
1827 2687582028
1828 2721026348
1829 2735833674
1830 2739229324
1831 2739729961
1832 2819564123
1833 2842917676
1834 2842920050
1835 2884341662
1836 2884412997
1837 2904464759
1838 2919088153
1839 2919406273
1840 2919499223
1841 2928965853
1842 2939612893
1843 2941473064
1844 2953995339

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

61

235

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uxt-assembly1.cif.gz_A crystal structure of unknown function protein yfdx from shigella flexneri 0.9688 67 101
2wy2-assembly1.cif.gz_C nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. coli phosphotransferase system. 0.8326 58 140
2lrl-assembly1.cif.gz_A solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose branch of the escherichia coli phosphotransferase system 0.829 54 140
2lrk-assembly1.cif.gz_A solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose 0.8132 54 140
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.8012 58 288
ID Description Score Start End Superfamily
2wwvA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8351 58 140 1.20.58.80
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.833 33 238 1.20.120.1760
2wy2C00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8326 58 140 1.20.58.80
1wcrC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8309 58 140 1.20.58.80
af_P9WPG1_2_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8297 52 242 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A7C5GR08-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9779 73 294 GO:0008654
GO:0016020
GO:0016780
AF-A0A2K9L9G9-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9609 53 304 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A4Q6C633-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9607 52 293 GO:0003882
GO:0008444
GO:0008654
GO:0012505
GO:0016020
AF-A0A7Y3E6K0-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9594 73 304 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A5EVH7-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9592 54 296 GO:0003882
GO:0008444
GO:0008654
GO:0012505
GO:0016020

Map