F485801

General Info

Members Datasets Scaffolds Average Seq Length
922 299 920 140

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10088360|Ga0265328_100883602
Length 157
Sequence MIYLTRRATFSASHYYWNDAWTAEKNEQVFGRCSRRAGHGHNYTLEVTVAGEPDPVTGFVVDLKWLKDAIEREVLDAWDHRHLNLEAPEFTEGKLIPTTENLAIAAWKRLEPAVTAAGGARLSRVRIYETPEIFAEYRGPHVRRGGFVSGVDDEGGL

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
223 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.74
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 2.17
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10160945 3300003316 Bacteria 2393
2 rootH2_10026678 3300003320 Unclassified 2694
3 rootH2_10165665 3300003320 Unclassified 2365
4 rootH2_10260805 3300003320 Unclassified 1380
5 rootL2_10200354 3300003322 Bacteria 4503
6 Ga0058862_12011688 3300004803 Bacteria 656
7 Ga0065714_10006998 3300005288 Bacteria 3043
8 Ga0065704_10036673 3300005289 Unclassified 843
9 Ga0065712_10217890 3300005290 Unclassified 1051
10 Ga0065707_10937773 3300005295 Bacteria 556
11 Ga0070658_10023555 3300005327 Bacteria 4940
12 Ga0070658_10032764 3300005327 Bacteria 4178
13 Ga0070658_10080374 3300005327 Bacteria 2678
14 Ga0070658_10084667 3300005327 Bacteria 2607
15 Ga0070658_10203144 3300005327 Bacteria 1672
16 Ga0070683_100001556 3300005329 Bacteria 17746
17 Ga0070683_100023527 3300005329 Bacteria 5510
18 Ga0070683_100081436 3300005329 Bacteria 3031
19 Ga0070683_100119774 3300005329 Unclassified 2486
20 Ga0070683_100132018 3300005329 Bacteria 2364
21 Ga0070683_100185303 3300005329 Bacteria 1976
22 Ga0070683_100211522 3300005329 Bacteria 1842
23 Ga0070683_100322832 3300005329 Bacteria 1469
24 Ga0070690_100529017 3300005330 Bacteria 886
25 Ga0068869_100017699 3300005334 Bacteria 4838
26 Ga0068869_100213801 3300005334 Bacteria 1526
27 Ga0068869_101467597 3300005334 Bacteria 605
28 Ga0070666_10028737 3300005335 Bacteria 3651
29 Ga0070666_10359297 3300005335 Bacteria 1043
30 Ga0070680_100042940 3300005336 Bacteria 3670
31 Ga0070680_100197399 3300005336 Bacteria 1696
32 Ga0070680_100287859 3300005336 Bacteria 1392
33 Ga0070680_100329878 3300005336 Unclassified 1296
34 Ga0070680_100350120 3300005336 Bacteria 1256
35 Ga0070680_100945723 3300005336 Bacteria 744
36 Ga0068868_100004476 3300005338 Bacteria 9800
37 Ga0068868_100015337 3300005338 Bacteria 5665
38 Ga0068868_100022297 3300005338 Bacteria 4776
39 Ga0068868_100346578 3300005338 Bacteria 1271
40 Ga0068868_100476518 3300005338 Bacteria 1089
41 Ga0068868_100740633 3300005338 Unclassified 882
42 Ga0070660_100006768 3300005339 Bacteria 7956
43 Ga0070660_100054107 3300005339 Bacteria 3098
44 Ga0070660_100101301 3300005339 Unclassified 2282
45 Ga0070689_100490055 3300005340 Unclassified 1051
46 Ga0070691_10039203 3300005341 Unclassified 2238
47 Ga0070691_10368595 3300005341 Bacteria 802
48 Ga0070691_10860431 3300005341 Bacteria 556
49 Ga0070661_100003065 3300005344 Bacteria 11492
50 Ga0070661_100004616 3300005344 Bacteria 9480
51 Ga0070661_100107987 3300005344 Bacteria 2076
52 Ga0070661_100194418 3300005344 Bacteria 1548
53 Ga0070661_100951947 3300005344 Bacteria 711
54 Ga0070668_100061780 3300005347 Bacteria 2903
55 Ga0070669_100469884 3300005353 Bacteria 1039
56 Ga0070669_100787855 3300005353 Unclassified 807
57 Ga0070675_100186492 3300005354 Bacteria 1795
58 Ga0070675_100188659 3300005354 Bacteria 1785
59 Ga0070671_100025737 3300005355 Bacteria 4831
60 Ga0070671_100027068 3300005355 Bacteria 4717
61 Ga0070671_100131020 3300005355 Bacteria 2112
62 Ga0070671_100775859 3300005355 Bacteria 834
63 Ga0070673_100023375 3300005364 Bacteria 4516
64 Ga0070673_100362368 3300005364 Bacteria 1289
65 Ga0070659_100200491 3300005366 Bacteria 1642
66 Ga0070659_101006636 3300005366 Bacteria 732
67 Ga0070667_100006815 3300005367 Bacteria 9489
68 Ga0070667_100049090 3300005367 Bacteria 3554
69 Ga0070667_102316328 3300005367 Bacteria 506
70 Ga0070709_10069913 3300005434 Bacteria 2262
71 Ga0070709_10385238 3300005434 Unclassified 1043
72 Ga0070709_11178743 3300005434 Bacteria 615
73 Ga0070714_100014205 3300005435 Bacteria 6394
74 Ga0070714_100690404 3300005435 Bacteria 984
75 Ga0070713_100010367 3300005436 Bacteria 6733
76 Ga0070713_100315805 3300005436 Unclassified 1442
77 Ga0070713_100740150 3300005436 Unclassified 940
78 Ga0070710_10172280 3300005437 Unclassified 1349
79 Ga0070710_10845429 3300005437 Unclassified 657
80 Ga0070711_100102773 3300005439 Unclassified 2082
81 Ga0070711_100285151 3300005439 Bacteria 1308
82 Ga0070711_101050785 3300005439 Unclassified 700
83 Ga0070705_100458253 3300005440 Bacteria 958
84 Ga0070663_100031150 3300005455 Bacteria 3663
85 Ga0070663_100290365 3300005455 Bacteria 1306
86 Ga0070663_100627248 3300005455 Bacteria 907
87 Ga0070663_100745487 3300005455 Bacteria 836
88 Ga0070663_100820753 3300005455 Bacteria 798
89 Ga0070678_100003237 3300005456 Bacteria 9044
90 Ga0070662_100082083 3300005457 Bacteria 2403
91 Ga0070681_10003755 3300005458 Bacteria 14254
92 Ga0070681_10004476 3300005458 Bacteria 13323
93 Ga0070681_10470233 3300005458 Bacteria 1170
94 Ga0070681_10755568 3300005458 Bacteria 889
95 Ga0070698_100000535 3300005471 Bacteria 40564
96 Ga0070699_100080454 3300005518 Bacteria 2840
97 Ga0070699_100853161 3300005518 Unclassified 834
98 Ga0070679_100020623 3300005530 Bacteria 6427
99 Ga0070679_100112249 3300005530 Bacteria 2712
100 Ga0070679_100341361 3300005530 Bacteria 1446
101 Ga0070679_100357345 3300005530 Bacteria 1408
102 Ga0070679_100385382 3300005530 Bacteria 1348
103 Ga0070679_100394852 3300005530 Unclassified 1329
104 Ga0070684_100002861 3300005535 Bacteria 12829
105 Ga0070684_100005055 3300005535 Bacteria 10070
106 Ga0070684_100021807 3300005535 Bacteria 5335
107 Ga0070684_100050758 3300005535 Bacteria 3604
108 Ga0070684_100630286 3300005535 Bacteria 997
109 Ga0070684_100745168 3300005535 Unclassified 914
110 Ga0070684_101176267 3300005535 Unclassified 721
111 Ga0070684_101289172 3300005535 Bacteria 687
112 Ga0068853_100004104 3300005539 Bacteria 11220
113 Ga0068853_100043023 3300005539 Bacteria 3864
114 Ga0068853_100044174 3300005539 Bacteria 3814
115 Ga0068853_100047503 3300005539 Bacteria 3683
116 Ga0068853_100084324 3300005539 Bacteria 2784
117 Ga0068853_100186843 3300005539 Bacteria 1881
118 Ga0070672_100119666 3300005543 Unclassified 2154
119 Ga0070665_100024742 3300005548 Bacteria 6049
120 Ga0070665_100049315 3300005548 Bacteria 4225
121 Ga0070665_100082946 3300005548 Bacteria 3211
122 Ga0070665_100171818 3300005548 Bacteria 2168
123 Ga0070665_100195887 3300005548 Bacteria 2021
124 Ga0070665_100350010 3300005548 Bacteria 1483
125 Ga0070665_100869712 3300005548 Bacteria 914
126 Ga0070665_101608419 3300005548 Bacteria 658
127 Ga0070704_100020808 3300005549 Bacteria 4239
128 Ga0068855_100000819 3300005563 Bacteria 38473
129 Ga0068855_100004206 3300005563 Bacteria 17569
130 Ga0068855_100012254 3300005563 Bacteria 10363
131 Ga0068855_100014110 3300005563 Bacteria 9629
132 Ga0068855_100014511 3300005563 Bacteria 9488
133 Ga0068855_100026325 3300005563 Bacteria 6958
134 Ga0068855_100057916 3300005563 Bacteria 4541
135 Ga0068855_100072112 3300005563 Bacteria 4015
136 Ga0068855_100081457 3300005563 Bacteria 3751
137 Ga0068855_100152156 3300005563 Bacteria 2630
138 Ga0068855_100185794 3300005563 Unclassified 2347
139 Ga0068855_100501351 3300005563 Bacteria 1319
140 Ga0068855_100532933 3300005563 Bacteria 1273
141 Ga0068855_100543429 3300005563 Bacteria 1258
142 Ga0068855_100655331 3300005563 Bacteria 1127
143 Ga0068855_100859036 3300005563 Unclassified 961
144 Ga0068855_101147539 3300005563 Bacteria 810
145 Ga0068855_101413872 3300005563 Bacteria 717
146 Ga0068855_101814569 3300005563 Bacteria 619
147 Ga0068855_102067886 3300005563 Unclassified 574
148 Ga0068855_102144557 3300005563 Bacteria 562
149 Ga0070664_100136329 3300005564 Unclassified 2159
150 Ga0070664_100253364 3300005564 Bacteria 1583
151 Ga0070664_101063845 3300005564 Unclassified 761
152 Ga0068857_100001991 3300005577 Bacteria 16557
153 Ga0068857_100083477 3300005577 Bacteria 2854
154 Ga0068857_100235583 3300005577 Bacteria 1675
155 Ga0068857_100335207 3300005577 Bacteria 1399
156 Ga0068857_100564421 3300005577 Bacteria 1073
157 Ga0068854_100058150 3300005578 Unclassified 2790
158 Ga0068854_100368625 3300005578 Unclassified 1180
159 Ga0068854_101203020 3300005578 Bacteria 679
160 Ga0068856_100001782 3300005614 Bacteria 22500
161 Ga0068856_100008091 3300005614 Bacteria 10266
162 Ga0068856_100011451 3300005614 Bacteria 8606
163 Ga0068856_100015606 3300005614 Bacteria 7344
164 Ga0068856_100060352 3300005614 Bacteria 3746
165 Ga0068856_100091653 3300005614 Bacteria 3023
166 Ga0068856_100316967 3300005614 Bacteria 1577
167 Ga0068856_100382337 3300005614 Bacteria 1427
168 Ga0068856_100960335 3300005614 Bacteria 873
169 Ga0068856_101692099 3300005614 Unclassified 645
170 Ga0068852_100003017 3300005616 Bacteria 11711
171 Ga0068852_100003172 3300005616 Bacteria 11474
172 Ga0068852_100003318 3300005616 Bacteria 11236
173 Ga0068852_100008628 3300005616 Bacteria 7527
174 Ga0068852_100111185 3300005616 Bacteria 2491
175 Ga0068852_100243251 3300005616 Unclassified 1721
176 Ga0068852_100260003 3300005616 Bacteria 1666
177 Ga0068852_100387959 3300005616 Bacteria 1371
178 Ga0068852_100515525 3300005616 Bacteria 1192
179 Ga0068852_100558806 3300005616 Unclassified 1145
180 Ga0068852_100584811 3300005616 Bacteria 1120
181 Ga0068852_100899394 3300005616 Bacteria 902
182 Ga0068859_100083756 3300005617 Bacteria 3233
183 Ga0068859_100102578 3300005617 Bacteria 2918
184 Ga0068859_100860959 3300005617 Bacteria 992
185 Ga0068859_100866161 3300005617 Bacteria 989
186 Ga0068859_102353838 3300005617 Unclassified 587
187 Ga0068864_100001011 3300005618 Bacteria 23500
188 Ga0068851_10016720 3300005834 Bacteria 3515
189 Ga0068851_10070517 3300005834 Bacteria 1807
190 Ga0068851_10077545 3300005834 Bacteria 1730
191 Ga0068851_10092843 3300005834 Bacteria 1591
192 Ga0068851_10190298 3300005834 Unclassified 1140
193 Ga0068851_10314664 3300005834 Unclassified 903
194 Ga0068870_10567091 3300005840 Bacteria 767
195 Ga0068863_100001678 3300005841 Bacteria 21916
196 Ga0068863_100007398 3300005841 Bacteria 10747
197 Ga0068863_101106728 3300005841 Bacteria 797
198 Ga0068858_100003486 3300005842 Bacteria 15597
199 Ga0068858_100203322 3300005842 Bacteria 1873
200 Ga0068858_100284937 3300005842 Bacteria 1573
201 Ga0068858_100476504 3300005842 Bacteria 1204
202 Ga0068858_100682275 3300005842 Unclassified 999
203 Ga0068860_100007224 3300005843 Bacteria 11106
204 Ga0068860_100023371 3300005843 Bacteria 5974
205 Ga0068860_100854229 3300005843 Bacteria 925
206 Ga0068862_100244391 3300005844 Bacteria 1633
207 Ga0068862_100883479 3300005844 Unclassified 878
208 Ga0070717_10016965 3300006028 Bacteria 5656
209 Ga0070717_10216768 3300006028 Bacteria 1681
210 Ga0070717_11214219 3300006028 Unclassified 686
211 Ga0070717_11379792 3300006028 Bacteria 640
212 Ga0070712_100082293 3300006175 Unclassified 2335
213 Ga0097621_100003579 3300006237 Bacteria 10736
214 Ga0097621_100039628 3300006237 Bacteria 3785
215 Ga0097621_101410398 3300006237 Bacteria 660
216 Ga0068871_100003833 3300006358 Bacteria 10365
217 Ga0068871_100020118 3300006358 Bacteria 5107
218 Ga0068871_100028898 3300006358 Bacteria 4351
219 Ga0068871_101305172 3300006358 Bacteria 683
220 Ga0068871_101396223 3300006358 Unclassified 660
221 Ga0075428_100272270 3300006844 Unclassified 1822
222 Ga0075430_100032755 3300006846 Bacteria 4410
223 Ga0075429_100009842 3300006880 Bacteria 8288
224 Ga0075429_100488698 3300006880 Bacteria 1079
225 Ga0075429_101549622 3300006880 Unclassified 576
226 Ga0068865_100054112 3300006881 Bacteria 2787
227 Ga0068865_101181530 3300006881 Bacteria 677
228 Ga0075436_100032986 3300006914 Bacteria 3568
229 Ga0097620_100083764 3300006931 Bacteria 3233
230 Ga0097620_100102569 3300006931 Bacteria 2918
231 Ga0097620_100861045 3300006931 Bacteria 992
232 Ga0097620_100866296 3300006931 Bacteria 989
233 Ga0097620_102354255 3300006931 Unclassified 587
234 Ga0105240_10000531 3300009093 Bacteria 70393
235 Ga0105240_10003431 3300009093 Bacteria 24635
236 Ga0105240_10009850 3300009093 Bacteria 13489
237 Ga0105240_10015189 3300009093 Bacteria 10478
238 Ga0105240_10015938 3300009093 Bacteria 10194
239 Ga0105240_10034845 3300009093 Bacteria 6490
240 Ga0105240_10042759 3300009093 Bacteria 5771
241 Ga0105240_10054107 3300009093 Bacteria 5031
242 Ga0105240_10084928 3300009093 Bacteria 3880
243 Ga0105240_10092926 3300009093 Unclassified 3683
244 Ga0105240_10232022 3300009093 Bacteria 2144
245 Ga0105240_10311733 3300009093 Bacteria 1797
246 Ga0105240_10394695 3300009093 Unclassified 1560
247 Ga0105240_10394867 3300009093 Bacteria 1559
248 Ga0105240_10470736 3300009093 Unclassified 1402
249 Ga0105240_10802720 3300009093 Bacteria 1019
250 Ga0105240_10868925 3300009093 Bacteria 972
251 Ga0105240_11241263 3300009093 Bacteria 788
252 Ga0111539_10012544 3300009094 Bacteria 10619
253 Ga0111539_10039250 3300009094 Bacteria 5708
254 Ga0111539_11272971 3300009094 Unclassified 854
255 Ga0105245_10006340 3300009098 Bacteria 10409
256 Ga0105245_10032253 3300009098 Unclassified 4638
257 Ga0105245_10045717 3300009098 Bacteria 3910
258 Ga0105245_10073426 3300009098 Bacteria 3111
259 Ga0105245_10152482 3300009098 Bacteria 2186
260 Ga0105245_10480985 3300009098 Bacteria 1255
261 Ga0105247_10016685 3300009101 Bacteria 4404
262 Ga0105247_10094104 3300009101 Bacteria 1906
263 Ga0105247_10168380 3300009101 Unclassified 1455
264 Ga0114129_10168959 3300009147 Unclassified 2982
265 Ga0114129_10616725 3300009147 Bacteria 1404
266 Ga0105243_10009867 3300009148 Bacteria 7263
267 Ga0105243_10782929 3300009148 Bacteria 938
268 Ga0105241_10000199 3300009174 Bacteria 44908
269 Ga0105241_10001305 3300009174 Bacteria 18974
270 Ga0105241_10002734 3300009174 Bacteria 13219
271 Ga0105241_10013210 3300009174 Bacteria 6053
272 Ga0105241_10018485 3300009174 Bacteria 5127
273 Ga0105241_10093630 3300009174 Bacteria 2375
274 Ga0105241_10172273 3300009174 Bacteria 1789
275 Ga0105241_10402184 3300009174 Bacteria 1201
276 Ga0105241_10437407 3300009174 Bacteria 1154
277 Ga0105241_10542257 3300009174 Bacteria 1043
278 Ga0105241_10814294 3300009174 Unclassified 861
279 Ga0105242_11204845 3300009176 Unclassified 777
280 Ga0105248_10000004 3300009177 Bacteria 695244
281 Ga0105248_10000255 3300009177 Bacteria 62145
282 Ga0105248_10093925 3300009177 Bacteria 3378
283 Ga0105248_10205747 3300009177 Bacteria 2218
284 Ga0105248_10400748 3300009177 Bacteria 1545
285 Ga0105248_10616549 3300009177 Bacteria 1224
286 Ga0105248_11092470 3300009177 Bacteria 901
287 Ga0105237_10003805 3300009545 Bacteria 17734
288 Ga0105237_10019484 3300009545 Bacteria 7007
289 Ga0105237_10050367 3300009545 Bacteria 4184
290 Ga0105237_10230918 3300009545 Bacteria 1851
291 Ga0105237_10247869 3300009545 Bacteria 1783
292 Ga0105237_10265446 3300009545 Bacteria 1720
293 Ga0105237_10321428 3300009545 Unclassified 1551
294 Ga0105237_10345581 3300009545 Unclassified 1492
295 Ga0105237_11543340 3300009545 Bacteria 671
296 Ga0105238_10000262 3300009551 Bacteria 58846
297 Ga0105238_10000292 3300009551 Bacteria 55692
298 Ga0105238_10001340 3300009551 Bacteria 24728
299 Ga0105238_10007813 3300009551 Bacteria 10696
300 Ga0105238_10032054 3300009551 Bacteria 5348
301 Ga0105238_10052982 3300009551 Bacteria 4078
302 Ga0105238_10078667 3300009551 Bacteria 3288
303 Ga0105238_10081743 3300009551 Bacteria 3220
304 Ga0105238_10227607 3300009551 Unclassified 1841
305 Ga0105238_10232640 3300009551 Bacteria 1819
306 Ga0105238_10239389 3300009551 Bacteria 1792
307 Ga0105238_10413015 3300009551 Bacteria 1343
308 Ga0105238_10684020 3300009551 Bacteria 1037
309 Ga0105238_10743348 3300009551 Bacteria 994
310 Ga0105238_12184579 3300009551 Unclassified 588
311 Ga0105249_10035872 3300009553 Bacteria 4497
312 Ga0105249_10064494 3300009553 Bacteria 3368
313 Ga0105249_12137559 3300009553 Bacteria 633
314 Ga0105239_10001873 3300010375 Bacteria 27535
315 Ga0105239_10004032 3300010375 Bacteria 17766
316 Ga0105239_10007426 3300010375 Bacteria 12574
317 Ga0105239_10054842 3300010375 Bacteria 4373
318 Ga0105239_10096949 3300010375 Bacteria 3258
319 Ga0105239_10307055 3300010375 Bacteria 1787
320 Ga0105239_10316960 3300010375 Bacteria 1758
321 Ga0105239_10337112 3300010375 Bacteria 1701
322 Ga0105239_10770631 3300010375 Unclassified 1101
323 Ga0105239_13561122 3300010375 Unclassified 506
324 Ga0105246_10006772 3300011119 Bacteria 7006
325 Ga0105246_10467531 3300011119 Bacteria 1064
326 Ga0105246_10884187 3300011119 Unclassified 800
327 Ga0157373_10000734 3300013100 Bacteria 25474
328 Ga0157373_10053519 3300013100 Bacteria 2870
329 Ga0157373_10459506 3300013100 Bacteria 917
330 Ga0157373_10577668 3300013100 Bacteria 817
331 Ga0157373_11562317 3300013100 Unclassified 505
332 Ga0157371_10029907 3300013102 Bacteria 3933
333 Ga0157371_10279736 3300013102 Unclassified 1205
334 Ga0157370_10000107 3300013104 Bacteria 95413
335 Ga0157370_10010187 3300013104 Bacteria 9927
336 Ga0157370_10011099 3300013104 Bacteria 9444
337 Ga0157370_10021637 3300013104 Bacteria 6407
338 Ga0157370_10028338 3300013104 Bacteria 5511
339 Ga0157370_10052263 3300013104 Bacteria 3901
340 Ga0157370_10061945 3300013104 Bacteria 3550
341 Ga0157370_10101058 3300013104 Bacteria 2701
342 Ga0157370_10192159 3300013104 Unclassified 1895
343 Ga0157370_10192399 3300013104 Unclassified 1894
344 Ga0157370_10361919 3300013104 Bacteria 1337
345 Ga0157370_10498118 3300013104 Unclassified 1119
346 Ga0157370_10549010 3300013104 Bacteria 1059
347 Ga0157370_10838706 3300013104 Bacteria 836
348 Ga0157370_11795871 3300013104 Bacteria 550
349 Ga0157369_10000275 3300013105 Bacteria 69270
350 Ga0157369_10002075 3300013105 Bacteria 24207
351 Ga0157369_10003741 3300013105 Bacteria 18074
352 Ga0157369_10014204 3300013105 Bacteria 8996
353 Ga0157369_10017062 3300013105 Bacteria 8157
354 Ga0157369_10017846 3300013105 Bacteria 7966
355 Ga0157369_10021414 3300013105 Bacteria 7232
356 Ga0157369_10042732 3300013105 Bacteria 4944
357 Ga0157369_10079311 3300013105 Bacteria 3517
358 Ga0157369_10089774 3300013105 Bacteria 3281
359 Ga0157369_10092522 3300013105 Bacteria 3227
360 Ga0157369_10097179 3300013105 Bacteria 3142
361 Ga0157369_10099468 3300013105 Bacteria 3101
362 Ga0157369_10112954 3300013105 Bacteria 2886
363 Ga0157369_10138740 3300013105 Bacteria 2573
364 Ga0157369_10274304 3300013105 Bacteria 1757
365 Ga0157369_10339131 3300013105 Bacteria 1561
366 Ga0157369_10519471 3300013105 Bacteria 1232
367 Ga0157369_11827151 3300013105 Unclassified 617
368 Ga0157374_10009059 3300013296 Bacteria 8529
369 Ga0157374_10009888 3300013296 Bacteria 8185
370 Ga0157374_10025221 3300013296 Bacteria 5334
371 Ga0157374_10043879 3300013296 Bacteria 4131
372 Ga0157374_10076869 3300013296 Bacteria 3157
373 Ga0157374_10216396 3300013296 Unclassified 1879
374 Ga0157374_10220706 3300013296 Bacteria 1860
375 Ga0157374_10828369 3300013296 Bacteria 942
376 Ga0157374_10847509 3300013296 Unclassified 931
377 Ga0157374_10884859 3300013296 Bacteria 910
378 Ga0157374_10958257 3300013296 Bacteria 874
379 Ga0157374_11251476 3300013296 Unclassified 764
380 Ga0157374_11725672 3300013296 Bacteria 651
381 Ga0157378_10017511 3300013297 Bacteria 6289
382 Ga0157378_10029194 3300013297 Bacteria 4868
383 Ga0157378_10037831 3300013297 Bacteria 4276
384 Ga0157378_10078165 3300013297 Bacteria 2984
385 Ga0157378_10090679 3300013297 Bacteria 2778
386 Ga0157378_10110831 3300013297 Unclassified 2516
387 Ga0163162_10050845 3300013306 Unclassified 4157
388 Ga0163162_10442181 3300013306 Bacteria 1432
389 Ga0163162_10474961 3300013306 Bacteria 1382
390 Ga0163162_10974753 3300013306 Bacteria 958
391 Ga0157372_10000127 3300013307 Bacteria 82699
392 Ga0157372_10001526 3300013307 Bacteria 25177
393 Ga0157372_10004316 3300013307 Bacteria 15198
394 Ga0157372_10011047 3300013307 Bacteria 9608
395 Ga0157372_10016987 3300013307 Bacteria 7812
396 Ga0157372_10020604 3300013307 Bacteria 7116
397 Ga0157372_10023808 3300013307 Bacteria 6643
398 Ga0157372_10024442 3300013307 Bacteria 6562
399 Ga0157372_10030644 3300013307 Bacteria 5885
400 Ga0157372_10044759 3300013307 Bacteria 4905
401 Ga0157372_10047346 3300013307 Bacteria 4778
402 Ga0157372_10056981 3300013307 Bacteria 4367
403 Ga0157372_10076793 3300013307 Unclassified 3772
404 Ga0157372_10096852 3300013307 Unclassified 3363
405 Ga0157372_10099093 3300013307 Bacteria 3324
406 Ga0157372_10112432 3300013307 Bacteria 3120
407 Ga0157372_10179432 3300013307 Bacteria 2451
408 Ga0157372_10191598 3300013307 Bacteria 2368
409 Ga0157372_10212721 3300013307 Bacteria 2241
410 Ga0157372_10252014 3300013307 Unclassified 2049
411 Ga0157372_10307228 3300013307 Unclassified 1845
412 Ga0157372_10459844 3300013307 Bacteria 1483
413 Ga0157372_10566334 3300013307 Bacteria 1324
414 Ga0157375_10011935 3300013308 Bacteria 7687
415 Ga0157375_10015926 3300013308 Bacteria 6742
416 Ga0157375_10032288 3300013308 Bacteria 4964
417 Ga0157375_10257217 3300013308 Unclassified 1907
418 Ga0157375_11208298 3300013308 Bacteria 887
419 Ga0163163_10016141 3300014325 Bacteria 6929
420 Ga0163163_10065040 3300014325 Bacteria 3619
421 Ga0163163_10122743 3300014325 Bacteria 2632
422 Ga0157380_10173810 3300014326 Unclassified 1885
423 Ga0182008_10229877 3300014497 Bacteria 951
424 Ga0157377_10089227 3300014745 Bacteria 1817
425 Ga0157379_10005183 3300014968 Bacteria 11193
426 Ga0157379_10018173 3300014968 Bacteria 6195
427 Ga0157379_10074904 3300014968 Bacteria 3030
428 Ga0157379_10140759 3300014968 Bacteria 2175
429 Ga0157379_11310565 3300014968 Bacteria 699
430 Ga0157376_10001195 3300014969 Bacteria 17141
431 Ga0157376_10021210 3300014969 Bacteria 5044
432 Ga0157376_10104173 3300014969 Bacteria 2486
433 Ga0157376_10159694 3300014969 Unclassified 2042
434 Ga0157376_10192979 3300014969 Bacteria 1869
435 Ga0157376_10265556 3300014969 Bacteria 1610
436 Ga0157376_11914256 3300014969 Unclassified 630
437 Ga0163161_10035791 3300017792 Bacteria 3555
438 Ga0197907_11423606 3300020069 Bacteria 1838
439 Ga0206356_11265128 3300020070 Bacteria 1042
440 Ga0206351_10892278 3300020077 Bacteria 748
441 Ga0206352_10576970 3300020078 Unclassified 1036
442 Ga0206352_11317142 3300020078 Bacteria 672
443 Ga0206354_10491568 3300020081 Unclassified 633
444 Ga0206354_10556744 3300020081 Bacteria 1509
445 Ga0206353_11896668 3300020082 Bacteria 808
446 Ga0154015_1346029 3300020610 Bacteria 1302
447 Ga0154015_1571093 3300020610 Bacteria 740
448 Ga0213872_10025707 3300021361 Bacteria 2706
449 Ga0213872_10048157 3300021361 Bacteria 1937
450 Ga0213872_10106642 3300021361 Bacteria 1246
451 Ga0213872_10115337 3300021361 Bacteria 1190
452 Ga0213874_10349338 3300021377 Bacteria 566
453 Ga0213871_10021294 3300021441 Bacteria 1614
454 Ga0213871_10039638 3300021441 Unclassified 1261
455 Ga0207697_10026675 3300025315 Bacteria 2362
456 Ga0207656_10029705 3300025321 Bacteria 2253
457 Ga0207656_10039750 3300025321 Bacteria 1991
458 Ga0207656_10057652 3300025321 Bacteria 1695
459 Ga0207656_10091433 3300025321 Bacteria 1382
460 Ga0207656_10159065 3300025321 Bacteria 1074
461 Ga0207656_10334267 3300025321 Bacteria 754
462 Ga0207692_10663357 3300025898 Unclassified 675
463 Ga0207710_10008632 3300025900 Bacteria 4296
464 Ga0207710_10165353 3300025900 Unclassified 1079
465 Ga0207710_10406345 3300025900 Unclassified 699
466 Ga0207688_10034034 3300025901 Bacteria 2820
467 Ga0207688_10318402 3300025901 Unclassified 954
468 Ga0207647_10007335 3300025904 Bacteria 7974
469 Ga0207647_10046122 3300025904 Bacteria 2716
470 Ga0207647_10096372 3300025904 Bacteria 1761
471 Ga0207685_10077323 3300025905 Unclassified 1367
472 Ga0207699_11006898 3300025906 Unclassified 616
473 Ga0207645_10005882 3300025907 Bacteria 8836
474 Ga0207705_10035919 3300025909 Bacteria 3547
475 Ga0207705_10051275 3300025909 Bacteria 2970
476 Ga0207705_10052224 3300025909 Bacteria 2942
477 Ga0207705_10077691 3300025909 Bacteria 2415
478 Ga0207705_10593242 3300025909 Bacteria 861
479 Ga0207705_11227478 3300025909 Bacteria 574
480 Ga0207705_11333878 3300025909 Bacteria 547
481 Ga0207654_10000013 3300025911 Bacteria 241873
482 Ga0207654_10000219 3300025911 Bacteria 35241
483 Ga0207654_10006439 3300025911 Bacteria 5911
484 Ga0207654_10027124 3300025911 Unclassified 3111
485 Ga0207654_10111395 3300025911 Bacteria 1704
486 Ga0207654_10123076 3300025911 Bacteria 1632
487 Ga0207654_10130565 3300025911 Unclassified 1590
488 Ga0207654_10496501 3300025911 Unclassified 861
489 Ga0207654_10534572 3300025911 Bacteria 831
490 Ga0207707_10007146 3300025912 Bacteria 9722
491 Ga0207707_10030886 3300025912 Bacteria 4686
492 Ga0207707_10070052 3300025912 Unclassified 3056
493 Ga0207707_10846436 3300025912 Bacteria 759
494 Ga0207707_11055558 3300025912 Bacteria 664
495 Ga0207695_10000233 3300025913 Bacteria 147498
496 Ga0207695_10000258 3300025913 Bacteria 134197
497 Ga0207695_10000398 3300025913 Bacteria 97114
498 Ga0207695_10000501 3300025913 Bacteria 83342
499 Ga0207695_10005107 3300025913 Bacteria 17581
500 Ga0207695_10009332 3300025913 Bacteria 12141
501 Ga0207695_10069784 3300025913 Bacteria 3595
502 Ga0207695_10089803 3300025913 Bacteria 3089
503 Ga0207695_10095375 3300025913 Bacteria 2979
504 Ga0207695_10125935 3300025913 Bacteria 2524
505 Ga0207695_10137036 3300025913 Bacteria 2400
506 Ga0207695_10260032 3300025913 Bacteria 1634
507 Ga0207695_10326451 3300025913 Bacteria 1424
508 Ga0207695_10518431 3300025913 Bacteria 1074
509 Ga0207695_10747188 3300025913 Unclassified 858
510 Ga0207671_10000022 3300025914 Bacteria 277803
511 Ga0207671_10001087 3300025914 Bacteria 32869
512 Ga0207671_10054501 3300025914 Bacteria 2963
513 Ga0207671_10123056 3300025914 Unclassified 1984
514 Ga0207671_10351187 3300025914 Bacteria 1169
515 Ga0207693_10496298 3300025915 Unclassified 953
516 Ga0207663_10064936 3300025916 Bacteria 2331
517 Ga0207663_10084866 3300025916 Unclassified 2084
518 Ga0207663_10644198 3300025916 Bacteria 836
519 Ga0207660_10049572 3300025917 Bacteria 2978
520 Ga0207660_10087558 3300025917 Bacteria 2301
521 Ga0207660_10107284 3300025917 Bacteria 2095
522 Ga0207660_10446806 3300025917 Unclassified 1045
523 Ga0207660_10462142 3300025917 Unclassified 1027
524 Ga0207660_10719764 3300025917 Bacteria 814
525 Ga0207660_10724152 3300025917 Bacteria 812
526 Ga0207660_11061230 3300025917 Unclassified 660
527 Ga0207657_10107475 3300025919 Bacteria 2308
528 Ga0207657_10108566 3300025919 Bacteria 2294
529 Ga0207657_10226742 3300025919 Bacteria 1495
530 Ga0207649_10014261 3300025920 Bacteria 4447
531 Ga0207649_10349614 3300025920 Bacteria 1094
532 Ga0207649_10357049 3300025920 Bacteria 1083
533 Ga0207652_10172244 3300025921 Bacteria 1943
534 Ga0207652_10434536 3300025921 Bacteria 1184
535 Ga0207652_10497440 3300025921 Bacteria 1098
536 Ga0207652_10811748 3300025921 Bacteria 830
537 Ga0207652_11033143 3300025921 Unclassified 721
538 Ga0207681_10505328 3300025923 Bacteria 990
539 Ga0207681_11139914 3300025923 Unclassified 655
540 Ga0207694_10000009 3300025924 Bacteria 460687
541 Ga0207694_10000682 3300025924 Bacteria 30458
542 Ga0207694_10001146 3300025924 Bacteria 23003
543 Ga0207694_10042704 3300025924 Bacteria 3498
544 Ga0207694_10078940 3300025924 Bacteria 2581
545 Ga0207694_10273007 3300025924 Bacteria 1387
546 Ga0207694_10378282 3300025924 Bacteria 1175
547 Ga0207694_10497979 3300025924 Unclassified 1020
548 Ga0207694_10572608 3300025924 Unclassified 949
549 Ga0207694_10723890 3300025924 Bacteria 839
550 Ga0207694_10831456 3300025924 Bacteria 780
551 Ga0207659_10110682 3300025926 Bacteria 2087
552 Ga0207659_10437636 3300025926 Bacteria 1099
553 Ga0207687_10063915 3300025927 Bacteria 2607
554 Ga0207687_10112375 3300025927 Bacteria 2024
555 Ga0207687_10171439 3300025927 Bacteria 1674
556 Ga0207687_10390703 3300025927 Bacteria 1142
557 Ga0207687_10521880 3300025927 Bacteria 994
558 Ga0207687_10856468 3300025927 Unclassified 777
559 Ga0207700_10002175 3300025928 Bacteria 11231
560 Ga0207700_10984627 3300025928 Unclassified 755
561 Ga0207664_10318671 3300025929 Unclassified 1371
562 Ga0207644_10069804 3300025931 Unclassified 2566
563 Ga0207644_10240824 3300025931 Bacteria 1440
564 Ga0207644_10303894 3300025931 Unclassified 1286
565 Ga0207690_10228223 3300025932 Bacteria 1428
566 Ga0207690_10536159 3300025932 Bacteria 950
567 Ga0207706_10013501 3300025933 Bacteria 7423
568 Ga0207686_10074609 3300025934 Unclassified 2192
569 Ga0207709_10021388 3300025935 Bacteria 3661
570 Ga0207670_10460519 3300025936 Unclassified 1027
571 Ga0207704_10278017 3300025938 Unclassified 1271
572 Ga0207704_10286135 3300025938 Bacteria 1255
573 Ga0207691_10010218 3300025940 Bacteria 9004
574 Ga0207711_10000008 3300025941 Bacteria 597686
575 Ga0207711_10000010 3300025941 Bacteria 557970
576 Ga0207711_10016171 3300025941 Bacteria 6194
577 Ga0207711_10053830 3300025941 Bacteria 3452
578 Ga0207711_10184420 3300025941 Bacteria 1899
579 Ga0207711_10445447 3300025941 Unclassified 1205
580 Ga0207689_10000543 3300025942 Bacteria 35857
581 Ga0207689_10028697 3300025942 Bacteria 4654
582 Ga0207661_10002791 3300025944 Bacteria 12045
583 Ga0207661_10017763 3300025944 Bacteria 5271
584 Ga0207661_10074641 3300025944 Bacteria 2780
585 Ga0207661_10111456 3300025944 Unclassified 2315
586 Ga0207661_10132114 3300025944 Bacteria 2140
587 Ga0207661_10149798 3300025944 Bacteria 2016
588 Ga0207661_10164465 3300025944 Bacteria 1927
589 Ga0207679_10050554 3300025945 Bacteria 3039
590 Ga0207667_10000930 3300025949 Bacteria 37351
591 Ga0207667_10001644 3300025949 Bacteria 28165
592 Ga0207667_10007052 3300025949 Bacteria 13580
593 Ga0207667_10007746 3300025949 Bacteria 12837
594 Ga0207667_10011149 3300025949 Bacteria 10463
595 Ga0207667_10034028 3300025949 Bacteria 5474
596 Ga0207667_10034303 3300025949 Bacteria 5450
597 Ga0207667_10062025 3300025949 Bacteria 3910
598 Ga0207667_10090955 3300025949 Bacteria 3153
599 Ga0207667_10299733 3300025949 Bacteria 1642
600 Ga0207667_10485896 3300025949 Bacteria 1253
601 Ga0207667_10677006 3300025949 Bacteria 1035
602 Ga0207667_11014428 3300025949 Bacteria 817
603 Ga0207667_11099345 3300025949 Bacteria 778
604 Ga0207651_10055776 3300025960 Bacteria 2716
605 Ga0207712_10018867 3300025961 Bacteria 4497
606 Ga0207712_10078847 3300025961 Bacteria 2391
607 Ga0207640_10042322 3300025981 Unclassified 2904
608 Ga0207640_11528230 3300025981 Bacteria 600
609 Ga0207640_12032103 3300025981 Unclassified 521
610 Ga0207658_10048455 3300025986 Unclassified 3115
611 Ga0207658_10328029 3300025986 Bacteria 1327
612 Ga0207677_10002256 3300026023 Bacteria 10115
613 Ga0207677_10026651 3300026023 Bacteria 3629
614 Ga0207677_10137836 3300026023 Bacteria 1863
615 Ga0207677_10694240 3300026023 Bacteria 902
616 Ga0207703_11794843 3300026035 Bacteria 589
617 Ga0207639_10002669 3300026041 Bacteria 11977
618 Ga0207639_10067330 3300026041 Bacteria 2786
619 Ga0207639_10068103 3300026041 Bacteria 2772
620 Ga0207639_10126360 3300026041 Bacteria 2110
621 Ga0207639_10175555 3300026041 Unclassified 1819
622 Ga0207639_10927215 3300026041 Bacteria 814
623 Ga0207678_10001021 3300026067 Bacteria 25521
624 Ga0207678_10029470 3300026067 Bacteria 4790
625 Ga0207678_10168013 3300026067 Bacteria 1873
626 Ga0207678_10198662 3300026067 Unclassified 1714
627 Ga0207678_10407698 3300026067 Bacteria 1177
628 Ga0207708_10142552 3300026075 Bacteria 1881
629 Ga0207708_10867766 3300026075 Bacteria 780
630 Ga0207702_10008532 3300026078 Bacteria 8638
631 Ga0207702_10026962 3300026078 Bacteria 4770
632 Ga0207702_10032700 3300026078 Bacteria 4340
633 Ga0207702_10137200 3300026078 Bacteria 2208
634 Ga0207702_10227246 3300026078 Unclassified 1742
635 Ga0207702_10509216 3300026078 Bacteria 1174
636 Ga0207641_10105295 3300026088 Unclassified 2491
637 Ga0207641_10537005 3300026088 Bacteria 1139
638 Ga0207648_11031637 3300026089 Bacteria 771
639 Ga0207676_10002800 3300026095 Bacteria 12398
640 Ga0207676_10087223 3300026095 Bacteria 2552
641 Ga0207674_10001254 3300026116 Bacteria 33164
642 Ga0207674_10001761 3300026116 Bacteria 27686
643 Ga0207674_10003906 3300026116 Bacteria 18131
644 Ga0207674_10232890 3300026116 Bacteria 1790
645 Ga0207674_10348926 3300026116 Bacteria 1431
646 Ga0207674_10725269 3300026116 Bacteria 959
647 Ga0207675_100410887 3300026118 Unclassified 1335
648 Ga0207683_10000329 3300026121 Bacteria 43154
649 Ga0207683_10251139 3300026121 Bacteria 1614
650 Ga0207698_10000109 3300026142 Bacteria 51574
651 Ga0207698_10002320 3300026142 Bacteria 11270
652 Ga0207698_10041267 3300026142 Bacteria 3437
653 Ga0207698_10099352 3300026142 Bacteria 2407
654 Ga0207698_10107593 3300026142 Bacteria 2328
655 Ga0207698_10287994 3300026142 Bacteria 1523
656 Ga0207698_10300006 3300026142 Unclassified 1495
657 Ga0207698_10687859 3300026142 Unclassified 1017
658 Ga0207698_10824643 3300026142 Bacteria 931
659 Ga0207698_11412049 3300026142 Bacteria 711
660 Ga0209967_1035577 3300027364 Bacteria 751
661 Ga0210000_1016879 3300027462 Bacteria 1104
662 Ga0209968_1030049 3300027526 Unclassified 906
663 Ga0209999_1003706 3300027543 Unclassified 2739
664 Ga0209966_1138527 3300027695 Unclassified 564
665 Ga0207428_10011495 3300027907 Bacteria 7825
666 Ga0268266_10014819 3300028379 Bacteria 6695
667 Ga0268266_10108658 3300028379 Bacteria 2455
668 Ga0268266_10159323 3300028379 Bacteria 2041
669 Ga0268266_10161622 3300028379 Bacteria 2027
670 Ga0268266_10634349 3300028379 Bacteria 1028
671 Ga0268266_10813973 3300028379 Unclassified 902
672 Ga0268266_10852963 3300028379 Bacteria 880
673 Ga0268265_10228555 3300028380 Bacteria 1633
674 Ga0268265_12594909 3300028380 Unclassified 512
675 Ga0268264_10025217 3300028381 Bacteria 4857
676 Ga0265319_1165439 3300028563 Bacteria 683
677 Ga0265318_10045097 3300028577 Bacteria 1667
678 Ga0265318_10075307 3300028577 Bacteria 1249
679 Ga0265318_10234322 3300028577 Bacteria 670
680 Ga0265318_10271068 3300028577 Unclassified 619
681 Ga0265323_10149059 3300028653 Unclassified 750
682 Ga0265323_10188211 3300028653 Bacteria 652
683 Ga0265336_10003228 3300028666 Bacteria 6468
684 Ga0265338_10004864 3300028800 Bacteria 17896
685 Ga0265338_10009983 3300028800 Bacteria 11226
686 Ga0265338_10027301 3300028800 Bacteria 5730
687 Ga0265338_10058037 3300028800 Bacteria 3420
688 Ga0265338_10271109 3300028800 Bacteria 1244
689 Ga0265338_10471957 3300028800 Bacteria 886
690 Ga0265338_10640100 3300028800 Bacteria 738
691 Ga0265338_10856134 3300028800 Bacteria 621
692 Ga0265338_11000875 3300028800 Bacteria 566
693 Ga0265770_1011796 3300030878 Bacteria 1287
694 Ga0265770_1021466 3300030878 Bacteria 1027
695 Ga0265765_1017833 3300030879 Unclassified 840
696 Ga0265760_10064375 3300031090 Unclassified 1118
697 Ga0265760_10330854 3300031090 Bacteria 543
698 Ga0265330_10002436 3300031235 Bacteria 10138
699 Ga0265330_10018567 3300031235 Bacteria 3194
700 Ga0265330_10023360 3300031235 Bacteria 2808
701 Ga0265330_10092375 3300031235 Unclassified 1299
702 Ga0265330_10099791 3300031235 Unclassified 1243
703 Ga0265330_10112096 3300031235 Bacteria 1165
704 Ga0265330_10204034 3300031235 Bacteria 836
705 Ga0265330_10215016 3300031235 Bacteria 812
706 Ga0265332_10081563 3300031238 Bacteria 1372
707 Ga0265328_10026137 3300031239 Bacteria 2196
708 Ga0265328_10048673 3300031239 Bacteria 1557
709 Ga0265328_10088360 3300031239 Unclassified 1144
710 Ga0265325_10000115 3300031241 Bacteria 54808
711 Ga0265325_10016335 3300031241 Bacteria 4151
712 Ga0265325_10038953 3300031241 Bacteria 2505
713 Ga0265325_10039205 3300031241 Bacteria 2496
714 Ga0265325_10069413 3300031241 Bacteria 1772
715 Ga0265325_10365419 3300031241 Bacteria 636
716 Ga0265325_10430213 3300031241 Unclassified 576
717 Ga0265329_10038904 3300031242 Bacteria 1530
718 Ga0265340_10011351 3300031247 Bacteria 4736
719 Ga0265340_10076277 3300031247 Bacteria 1583
720 Ga0265340_10094114 3300031247 Unclassified 1398
721 Ga0265340_10123160 3300031247 Bacteria 1192
722 Ga0265340_10125515 3300031247 Bacteria 1179
723 Ga0265340_10183842 3300031247 Bacteria 944
724 Ga0265339_10000557 3300031249 Bacteria 29155
725 Ga0265339_10000694 3300031249 Bacteria 26062
726 Ga0265339_10003616 3300031249 Bacteria 10790
727 Ga0265339_10073954 3300031249 Bacteria 1811
728 Ga0265339_10263109 3300031249 Bacteria 831
729 Ga0265316_10001818 3300031344 Bacteria 22421
730 Ga0265316_10016452 3300031344 Bacteria 6414
731 Ga0265316_10067550 3300031344 Bacteria 2764
732 Ga0265316_10122599 3300031344 Bacteria 1962
733 Ga0265316_10131782 3300031344 Bacteria 1882
734 Ga0265316_10151408 3300031344 Bacteria 1738
735 Ga0265316_10379797 3300031344 Bacteria 1019
736 Ga0265316_10400247 3300031344 Bacteria 989
737 Ga0265316_10979057 3300031344 Bacteria 589
738 Ga0265313_10003472 3300031595 Bacteria 12727
739 Ga0265313_10011695 3300031595 Bacteria 5435
740 Ga0265313_10045080 3300031595 Unclassified 2148
741 Ga0265313_10097836 3300031595 Bacteria 1307
742 Ga0265314_10000081 3300031711 Bacteria 143776
743 Ga0265314_10041564 3300031711 Bacteria 3288
744 Ga0265314_10106077 3300031711 Bacteria 1796
745 Ga0265314_10377088 3300031711 Unclassified 773
746 Ga0265342_10001506 3300031712 Bacteria 21599
747 Ga0265342_10004150 3300031712 Bacteria 11533
748 Ga0265342_10009471 3300031712 Bacteria 6858
749 Ga0265342_10018805 3300031712 Bacteria 4466
750 Ga0265342_10044547 3300031712 Bacteria 2674
751 Ga0265342_10087771 3300031712 Bacteria 1787
752 Ga0265342_10088974 3300031712 Unclassified 1772
753 Ga0265342_10098523 3300031712 Bacteria 1668
754 Ga0265342_10120751 3300031712 Bacteria 1476
755 Ga0265342_10288221 3300031712 Bacteria 868
756 Ga0307413_11770369 3300031824 Unclassified 552
757 Ga0307407_10575892 3300031903 Unclassified 835
758 Ga0307412_10000867 3300031911 Bacteria 17373
759 Ga0307416_100014064 3300032002 Bacteria 5465
760 Ga0307411_10791410 3300032005 Unclassified 834
761 Ga0316212_1055856 3300033547 Unclassified 565
762 Ga0373934_0041393 3300035086 Bacteria 1818
763 Ga0373923_0102840 3300035111 Unclassified 1262
764 Ga0373954_0076840 3300035118 Bacteria 1592
765 Ga0373956_0188645 3300035119 Unclassified 976
766 Ga0373956_0245959 3300035119 Bacteria 850
767 Ga0373943_0066714 3300035170 Unclassified 1813
768 Ga0373935_0020449 3300035692 Bacteria 4046
769 Ga0373935_0474696 3300035692 Bacteria 906
770 Ga0373927_0177651 3300035695 Unclassified 1396
771 Ga0373933_0016019 3300035724 Bacteria 4187
772 Ga0373933_0039060 3300035724 Unclassified 2791
773 Ga0373933_0450197 3300035724 Unclassified 842
774 Ga0373947_0280848 3300035725 Unclassified 1107
775 Ga0373937_0129068 3300036401 Unclassified 2360
776 Ga0373937_0219266 3300036401 Unclassified 1791
777 Ga0373937_1447729 3300036401 Unclassified 635
778 Ga0373925_0085805 3300037068 Bacteria 2400
779 Ga0395899_0000049 3300037312 Bacteria 225231
780 Ga0395900_0183023 3300037418 Unclassified 2128
781 Ga0395900_0237534 3300037418 Unclassified 1830
782 Ga0395900_0323935 3300037418 Bacteria 1521
783 Ga0395900_0492583 3300037418 Bacteria 1177
784 Ga0395898_0383162 3300037466 Unclassified 1341
785 Ga0395898_1623608 3300037466 Bacteria 570
786 Ga0395905_1368075 3300037471 Bacteria 612
787 Ga0395901_1077642 3300038443 Unclassified 775
788 Ga0436365_1104300 3300039437 Bacteria 1215
789 Ga0436360_0796911 3300039438 Bacteria 2617
790 Ga0436360_1350082 3300039438 Bacteria 5150
791 Ga0436361_0032893 3300039447 Bacteria 666
792 Ga0436361_0111045 3300039447 Bacteria 1608
793 Ga0436361_0212937 3300039447 Bacteria 30499
794 Ga0436361_0412341 3300039447 Bacteria 712
795 Ga0436361_0664017 3300039447 Bacteria 5339
796 Ga0436361_1088884 3300039447 Bacteria 8192
797 Ga0436361_1207243 3300039447 Bacteria 1505
798 Ga0436363_0818606 3300039450 Bacteria 1048
799 Ga0436362_0601495 3300039453 Bacteria 1618
800 Ga0439439_0001461 3300041406 Bacteria 4707
801 Ga0451802_0641939 3300041460 Bacteria 659
802 Ga0439448_0025639 3300042005 Bacteria 1850
803 Ga0439434_0011608 3300042435 Bacteria 2604
804 Ga0451577_0000156 3300042876 Bacteria 151954
805 Ga0451577_0001689 3300042876 Bacteria 28478
806 Ga0451577_0350863 3300042876 Bacteria 1338
807 Ga0451577_0547590 3300042876 Bacteria 1050
808 Ga0466969_0086927 3300044656 Bacteria 1485
809 Ga0466969_0480599 3300044656 Unclassified 566
810 Ga0466966_0427979 3300044684 Bacteria 795
811 Ga0466966_0704025 3300044684 Unclassified 609
812 Ga0466961_0488986 3300044693 Bacteria 744
813 Ga0466963_0000873 3300044694 Bacteria 15279
814 Ga0466963_0111430 3300044694 Bacteria 1879
815 Ga0466963_0317102 3300044694 Unclassified 1097
816 Ga0466963_1034897 3300044694 Bacteria 578
817 Ga0453684_0000330 3300044712 Bacteria 198124
818 Ga0466959_0461360 3300045049 Bacteria 861
819 Ga0466959_1043589 3300045049 Unclassified 544
820 Ga0466958_0346800 3300045836 Unclassified 956
821 Ga0466958_0386573 3300045836 Unclassified 903
822 Ga0466958_0510676 3300045836 Bacteria 780
823 Ga0466967_0003352 3300045976 Bacteria 10415
824 Ga0466967_0574163 3300045976 Bacteria 1111
825 Ga0466967_1253151 3300045976 Unclassified 739
826 Ga0495603_0750882 3300046455 Bacteria 557
827 Ga0495629_0030602 3300046459 Bacteria 3816
828 Ga0495629_0123323 3300046459 Unclassified 1805
829 Ga0495629_0229166 3300046459 Bacteria 1281
830 Ga0495638_0072399 3300046460 Bacteria 2106
831 Ga0495651_0056152 3300046462 Bacteria 3025
832 Ga0495653_0037610 3300046463 Bacteria 3801
833 Ga0495580_0004972 3300046472 Bacteria 11106
834 Ga0495580_0151490 3300046472 Bacteria 1607
835 Ga0495639_0274708 3300046475 Unclassified 836
836 Ga0495639_0630219 3300046475 Unclassified 552
837 Ga0495585_0388442 3300046492 Unclassified 673
838 Ga0495594_0028271 3300046499 Bacteria 3025
839 Ga0495583_0288032 3300046506 Bacteria 654
840 Ga0495606_0011416 3300046507 Bacteria 7244
841 Ga0495606_0252848 3300046507 Bacteria 977
842 Ga0495608_0037060 3300046511 Bacteria 3280
843 Ga0495608_0443132 3300046511 Unclassified 791
844 Ga0495618_0047791 3300046514 Bacteria 2701
845 Ga0495628_0274807 3300046516 Bacteria 1252
846 Ga0495630_0025413 3300046517 Bacteria 4380
847 Ga0495652_0006717 3300046529 Bacteria 10678
848 Ga0495652_0093962 3300046529 Bacteria 2447
849 Ga0495665_0007352 3300046531 Bacteria 5953
850 Ga0495640_0315436 3300046533 Unclassified 969
851 Ga0495587_0000661 3300046536 Bacteria 23100
852 Ga0495587_0241525 3300046536 Bacteria 1016
853 Ga0495645_0002092 3300046543 Bacteria 13562
854 Ga0495645_0051474 3300046543 Bacteria 2996
855 Ga0495645_0615865 3300046543 Unclassified 666
856 Ga0495667_0001594 3300046559 Bacteria 15037
857 Ga0495634_0332245 3300046642 Unclassified 913
858 Ga0495635_0942356 3300046663 Unclassified 551
859 Ga0495657_0209785 3300046675 Unclassified 1184
860 Ga0495599_0003492 3300046678 Bacteria 9201
861 Ga0495599_0352514 3300046678 Unclassified 882
862 Ga0495623_0101297 3300046679 Bacteria 1754
863 Ga0495623_0542885 3300046679 Unclassified 609
864 Ga0495646_0281853 3300046680 Bacteria 883
865 Ga0495669_0052475 3300046684 Bacteria 1832
866 Ga0495613_0076371 3300046689 Bacteria 2438
867 Ga0495613_0172457 3300046689 Unclassified 1535
868 Ga0495613_0814292 3300046689 Bacteria 609
869 Ga0495581_0562687 3300047315 Unclassified 661
870 Ga0495604_0452631 3300047317 Unclassified 838
871 Ga0495674_0771961 3300047319 Unclassified 749
872 Ga0495674_0931111 3300047319 Bacteria 669
873 Ga0495674_1454373 3300047319 Unclassified 509
874 Ga0495680_0300434 3300047322 Bacteria 1127
875 Ga0495675_0055752 3300047444 Bacteria 2506
876 Ga0495684_0037556 3300047471 Bacteria 3715
877 Ga0495684_0429877 3300047471 Bacteria 921
878 Ga0495686_0004892 3300047472 Bacteria 10801
879 Ga0495686_0015720 3300047472 Bacteria 5157
880 Ga0495602_0045410 3300048088 Bacteria 3975
881 Ga0495602_0501328 3300048088 Unclassified 849
882 Ga0496101_0297462 3300048904 Bacteria 1264
883 Ga0496102_0168814 3300048905 Bacteria 2060
884 Ga0496104_0287969 3300048907 Bacteria 1555
885 Ga0496104_0498310 3300048907 Bacteria 1129
886 Ga0496104_0743084 3300048907 Unclassified 888
887 Ga0496105_0076727 3300048908 Bacteria 2760
888 Ga0496105_0406818 3300048908 Bacteria 1079
889 Ga0496105_0566538 3300048908 Bacteria 885
890 Ga0496106_0045792 3300048909 Bacteria 3287
891 Ga0496106_0426562 3300048909 Bacteria 1066
892 Ga0496109_0139862 3300048912 Bacteria 2263
893 Ga0496109_0615121 3300048912 Unclassified 1023
894 Ga0496109_1015050 3300048912 Unclassified 767
895 Ga0496110_0062072 3300048913 Bacteria 3300
896 Ga0496112_0623082 3300048915 Unclassified 1010
897 Ga0496113_0959534 3300048916 Unclassified 675
898 Ga0496114_1026635 3300048917 Bacteria 708
899 Ga0496115_0124505 3300048918 Bacteria 2123
900 Ga0496115_0130462 3300048918 Bacteria 2071
901 Ga0496119_0250072 3300048922 Bacteria 894
902 Ga0496120_0279265 3300048923 Bacteria 773
903 Ga0496126_0009992 3300048929 Bacteria 10018
904 Ga0496126_0015586 3300048929 Bacteria 7638
905 Ga0501034_0228194 3300049571 Bacteria 1812
906 Ga0501038_0091426 3300049574 Bacteria 2550
907 Ga0501047_0084069 3300049581 Bacteria 3059
908 Ga0501070_1536464 3300049586 Bacteria 503
909 Ga0501073_0491743 3300049589 Bacteria 848
910 Ga0501044_0123737 3300049823 Bacteria 2585
911 nmdc:mga09592_497300_c1 3300050508 Bacteria 1050
912 nmdc:mga0qj67_38045_c1 3300050509 Bacteria 3773
913 nmdc:mga08y16_440548_c1 3300050511 Bacteria 1330
914 nmdc:mga08x19_26821_c1 3300050514 Bacteria 3598
915 Ga0495601_0105045 3300053077 Unclassified 1826
916 Ga0495601_0192541 3300053077 Bacteria 1332
917 Ga0495601_0496315 3300053077 Bacteria 788
918 Ga0495612_0178694 3300053078 Bacteria 931
919 Ga0495619_0057510 3300053085 Bacteria 2581
920 Ga0500572_236537 3300053111 Unclassified 596

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10725269 Ga0207674_107252692 108
2 3300025898 Ga0207692_10663357 Ga0207692_106633571 117
3 3300013306 Ga0163162_10974753 Ga0163162_109747532 119
4 3300046507 Ga0495606_0011416 Ga0495606_0011416_4564_4935 119
5 3300013100 Ga0157373_10000734 Ga0157373_100007349 124
6 3300009551 Ga0105238_10232640 Ga0105238_102326402 128
7 3300013104 Ga0157370_10101058 Ga0157370_101010583 128
8 3300013307 Ga0157372_10566334 Ga0157372_105663342 128
9 3300020081 Ga0206354_10556744 Ga0206354_105567441 128
10 3300005518 Ga0070699_100853161 Ga0070699_1008531612 130
11 3300006844 Ga0075428_100272270 Ga0075428_1002722703 130
12 3300006880 Ga0075429_100009842 Ga0075429_1000098426 130
13 3300009147 Ga0114129_10168959 Ga0114129_101689595 130
14 3300005289 Ga0065704_10036673 Ga0065704_100366732 131
15 3300005329 Ga0070683_100322832 Ga0070683_1003228323 131
16 3300005334 Ga0068869_101467597 Ga0068869_1014675971 131
17 3300005336 Ga0070680_100197399 Ga0070680_1001973993 131
18 3300005341 Ga0070691_10039203 Ga0070691_100392032 131
19 3300005341 Ga0070691_10368595 Ga0070691_103685952 131
20 3300005354 Ga0070675_100186492 Ga0070675_1001864923 131
21 3300005354 Ga0070675_100188659 Ga0070675_1001886593 131
22 3300005434 Ga0070709_10069913 Ga0070709_100699133 131
23 3300005440 Ga0070705_100458253 Ga0070705_1004582531 131
24 3300005455 Ga0070663_100820753 Ga0070663_1008207532 131
25 3300005518 Ga0070699_100080454 Ga0070699_1000804543 131
26 3300005535 Ga0070684_100630286 Ga0070684_1006302861 131
27 3300005549 Ga0070704_100020808 Ga0070704_1000208085 131
28 3300005616 Ga0068852_100584811 Ga0068852_1005848112 131
29 3300005617 Ga0068859_100102578 Ga0068859_1001025783 131
30 3300005840 Ga0068870_10567091 Ga0068870_105670912 131
31 3300005844 Ga0068862_100883479 Ga0068862_1008834792 131
32 3300006931 Ga0097620_100102569 Ga0097620_1001025693 131
33 3300009093 Ga0105240_10394695 Ga0105240_103946952 131
34 3300009094 Ga0111539_10012544 Ga0111539_100125442 131
35 3300009094 Ga0111539_11272971 Ga0111539_112729712 131
36 3300009174 Ga0105241_10172273 Ga0105241_101722732 131
37 3300009551 Ga0105238_10081743 Ga0105238_100817433 131
38 3300013105 Ga0157369_10042732 Ga0157369_100427324 131
39 3300013105 Ga0157369_10339131 Ga0157369_103391313 131
40 3300013307 Ga0157372_10004316 Ga0157372_1000431611 131
41 3300013307 Ga0157372_10030644 Ga0157372_100306441 131
42 3300014326 Ga0157380_10173810 Ga0157380_101738102 131
43 3300014745 Ga0157377_10089227 Ga0157377_100892273 131
44 3300014969 Ga0157376_10159694 Ga0157376_101596943 131
45 3300025905 Ga0207685_10077323 Ga0207685_100773232 131
46 3300025913 Ga0207695_10747188 Ga0207695_107471882 131
47 3300025916 Ga0207663_10064936 Ga0207663_100649362 131
48 3300025924 Ga0207694_10042704 Ga0207694_100427044 131
49 3300025926 Ga0207659_10437636 Ga0207659_104376362 131
50 3300026075 Ga0207708_10142552 Ga0207708_101425522 131
51 3300026089 Ga0207648_11031637 Ga0207648_110316372 131
52 3300027907 Ga0207428_10011495 Ga0207428_100114952 131
53 3300028380 Ga0268265_12594909 Ga0268265_125949091 131
54 3300035086 Ga0373934_0041393 Ga0373934_0041393_931_1347 131
55 3300035119 Ga0373956_0245959 Ga0373956_0245959_59_475 131
56 3300035170 Ga0373943_0066714 Ga0373943_0066714_651_1067 131
57 3300035692 Ga0373935_0020449 Ga0373935_0020449_2861_3277 131
58 3300035695 Ga0373927_0177651 Ga0373927_0177651_179_595 131
59 3300035724 Ga0373933_0016019 Ga0373933_0016019_1081_1497 131
60 3300035725 Ga0373947_0280848 Ga0373947_0280848_465_881 131
61 3300037068 Ga0373925_0085805 Ga0373925_0085805_321_737 131
62 3300042876 Ga0451577_0547590 Ga0451577_0547590_149_568 131
63 3300046455 Ga0495603_0750882 Ga0495603_0750882_119_535 131
64 3300046459 Ga0495629_0123323 Ga0495629_0123323_845_1261 131
65 3300046463 Ga0495653_0037610 Ga0495653_0037610_1104_1520 131
66 3300046472 Ga0495580_0004972 Ga0495580_0004972_9028_9444 131
67 3300046475 Ga0495639_0274708 Ga0495639_0274708_114_530 131
68 3300046499 Ga0495594_0028271 Ga0495594_0028271_2227_2643 131
69 3300046511 Ga0495608_0037060 Ga0495608_0037060_2172_2588 131
70 3300046514 Ga0495618_0047791 Ga0495618_0047791_173_589 131
71 3300046516 Ga0495628_0274807 Ga0495628_0274807_668_1084 131
72 3300046517 Ga0495630_0025413 Ga0495630_0025413_1387_1803 131
73 3300046529 Ga0495652_0006717 Ga0495652_0006717_8971_9387 131
74 3300046531 Ga0495665_0007352 Ga0495665_0007352_4964_5380 131
75 3300046533 Ga0495640_0315436 Ga0495640_0315436_466_882 131
76 3300046536 Ga0495587_0000661 Ga0495587_0000661_10493_10909 131
77 3300046543 Ga0495645_0002092 Ga0495645_0002092_3264_3680 131
78 3300046543 Ga0495645_0615865 Ga0495645_0615865_112_528 131
79 3300046559 Ga0495667_0001594 Ga0495667_0001594_809_1225 131
80 3300046642 Ga0495634_0332245 Ga0495634_0332245_232_648 131
81 3300046663 Ga0495635_0942356 Ga0495635_0942356_119_535 131
82 3300046675 Ga0495657_0209785 Ga0495657_0209785_559_975 131
83 3300046678 Ga0495599_0003492 Ga0495599_0003492_639_1055 131
84 3300046679 Ga0495623_0101297 Ga0495623_0101297_1229_1645 131
85 3300046689 Ga0495613_0076371 Ga0495613_0076371_152_568 131
86 3300047317 Ga0495604_0452631 Ga0495604_0452631_158_574 131
87 3300047319 Ga0495674_0931111 Ga0495674_0931111_197_613 131
88 3300047319 Ga0495674_1454373 Ga0495674_1454373_59_475 131
89 3300047322 Ga0495680_0300434 Ga0495680_0300434_402_818 131
90 3300047444 Ga0495675_0055752 Ga0495675_0055752_383_799 131
91 3300047471 Ga0495684_0037556 Ga0495684_0037556_2938_3354 131
92 3300047471 Ga0495684_0429877 Ga0495684_0429877_52_468 131
93 3300048088 Ga0495602_0045410 Ga0495602_0045410_2268_2684 131
94 3300048907 Ga0496104_0498310 Ga0496104_0498310_88_504 131
95 3300048908 Ga0496105_0566538 Ga0496105_0566538_302_718 131
96 3300048909 Ga0496106_0426562 Ga0496106_0426562_435_851 131
97 3300049571 Ga0501034_0228194 Ga0501034_0228194_794_1210 131
98 3300050511 nmdc:mga08y16_440548_c1 nmdc:mga08y16_440548_c1_416_835 131
99 3300053077 Ga0495601_0496315 Ga0495601_0496315_299_715 131
100 3300053078 Ga0495612_0178694 Ga0495612_0178694_171_587 131
101 iso_pu_bacteria 2852623160 2852627099 131
102 iso_pu_bacteria 2884933994 2884935167 131
103 3300005295 Ga0065707_10937773 Ga0065707_109377731 132
104 3300005327 Ga0070658_10080374 Ga0070658_100803744 132
105 3300005330 Ga0070690_100529017 Ga0070690_1005290171 132
106 3300005335 Ga0070666_10359297 Ga0070666_103592972 132
107 3300005338 Ga0068868_100476518 Ga0068868_1004765182 132
108 3300005353 Ga0070669_100469884 Ga0070669_1004698842 132
109 3300005364 Ga0070673_100362368 Ga0070673_1003623682 132
110 3300005471 Ga0070698_100000535 Ga0070698_1000005359 132
111 3300005548 Ga0070665_100082946 Ga0070665_1000829462 132
112 3300005617 Ga0068859_100866161 Ga0068859_1008661612 132
113 3300005842 Ga0068858_100284937 Ga0068858_1002849371 132
114 3300005843 Ga0068860_100854229 Ga0068860_1008542292 132
115 3300006237 Ga0097621_101410398 Ga0097621_1014103981 132
116 3300006358 Ga0068871_101305172 Ga0068871_1013051722 132
117 3300006846 Ga0075430_100032755 Ga0075430_1000327555 132
118 3300006880 Ga0075429_100488698 Ga0075429_1004886982 132
119 3300006880 Ga0075429_101549622 Ga0075429_1015496222 132
120 3300006881 Ga0068865_101181530 Ga0068865_1011815302 132
121 3300006931 Ga0097620_100866296 Ga0097620_1008662962 132
122 3300009094 Ga0111539_10039250 Ga0111539_100392505 132
123 3300009098 Ga0105245_10480985 Ga0105245_104809852 132
124 3300009147 Ga0114129_10616725 Ga0114129_106167252 132
125 3300009148 Ga0105243_10782929 Ga0105243_107829292 132
126 3300009553 Ga0105249_12137559 Ga0105249_121375592 132
127 3300013297 Ga0157378_10037831 Ga0157378_100378313 132
128 3300013306 Ga0163162_10442181 Ga0163162_104421811 132
129 3300013308 Ga0157375_10257217 Ga0157375_102572172 132
130 3300025909 Ga0207705_10035919 Ga0207705_100359194 132
131 3300025919 Ga0207657_10226742 Ga0207657_102267422 132
132 3300025923 Ga0207681_10505328 Ga0207681_105053282 132
133 3300025927 Ga0207687_10521880 Ga0207687_105218801 132
134 3300025934 Ga0207686_10074609 Ga0207686_100746093 132
135 3300025936 Ga0207670_10460519 Ga0207670_104605191 132
136 3300025938 Ga0207704_10286135 Ga0207704_102861352 132
137 3300026023 Ga0207677_10694240 Ga0207677_106942402 132
138 3300026035 Ga0207703_11794843 Ga0207703_117948432 132
139 3300026121 Ga0207683_10251139 Ga0207683_102511393 132
140 3300028379 Ga0268266_10161622 Ga0268266_101616222 132
141 3300031824 Ga0307413_11770369 Ga0307413_117703691 132
142 3300031903 Ga0307407_10575892 Ga0307407_105758922 132
143 3300031911 Ga0307412_10000867 Ga0307412_1000086712 132
144 3300032002 Ga0307416_100014064 Ga0307416_1000140645 132
145 3300032005 Ga0307411_10791410 Ga0307411_107914102 132
146 3300037312 Ga0395899_0000049 Ga0395899_0000049_84225_84635 132
147 3300037418 Ga0395900_0183023 Ga0395900_0183023_687_1097 132
148 3300037471 Ga0395905_1368075 Ga0395905_1368075_81_491 132
149 3300041406 Ga0439439_0001461 Ga0439439_0001461_1892_2314 132
150 3300042435 Ga0439434_0011608 Ga0439434_0011608_1998_2420 132
151 3300042876 Ga0451577_0000156 Ga0451577_0000156_37587_38006 132
152 3300042876 Ga0451577_0001689 Ga0451577_0001689_10890_11312 132
153 3300042876 Ga0451577_0350863 Ga0451577_0350863_286_708 132
154 3300044712 Ga0453684_0000330 Ga0453684_0000330_100249_100671 132
155 3300050508 nmdc:mga09592_497300_c1 nmdc:mga09592_497300_c1_403_834 132
156 3300050509 nmdc:mga0qj67_38045_c1 nmdc:mga0qj67_38045_c1_3243_3674 132
157 3300003320 rootH2_10165665 rootH2_101656653 133
158 3300005617 Ga0068859_100860959 Ga0068859_1008609592 133
159 3300006931 Ga0097620_100861045 Ga0097620_1008610452 133
160 3300026075 Ga0207708_10867766 Ga0207708_108677661 133
161 3300027364 Ga0209967_1035577 Ga0209967_10355771 133
162 3300027462 Ga0210000_1016879 Ga0210000_10168792 133
163 3300027526 Ga0209968_1030049 Ga0209968_10300492 133
164 3300027543 Ga0209999_1003706 Ga0209999_10037062 133
165 3300027695 Ga0209966_1138527 Ga0209966_11385271 133
166 3300046460 Ga0495638_0072399 Ga0495638_0072399_623_1054 133
167 3300005288 Ga0065714_10006998 Ga0065714_100069982 134
168 3300041460 Ga0451802_0641939 Ga0451802_0641939_67_483 134
169 3300005336 Ga0070680_100350120 Ga0070680_1003501202 135
170 3300005338 Ga0068868_100015337 Ga0068868_1000153375 135
171 3300005344 Ga0070661_100107987 Ga0070661_1001079872 135
172 3300005458 Ga0070681_10004476 Ga0070681_100044764 135
173 3300005530 Ga0070679_100020623 Ga0070679_1000206235 135
174 3300005539 Ga0068853_100186843 Ga0068853_1001868432 135
175 3300005563 Ga0068855_100543429 Ga0068855_1005434292 135
176 3300005563 Ga0068855_100655331 Ga0068855_1006553312 135
177 3300005563 Ga0068855_101413872 Ga0068855_1014138721 135
178 3300005563 Ga0068855_101814569 Ga0068855_1018145692 135
179 3300005616 Ga0068852_100260003 Ga0068852_1002600032 135
180 3300005616 Ga0068852_100387959 Ga0068852_1003879593 135
181 3300005842 Ga0068858_100682275 Ga0068858_1006822752 135
182 3300006914 Ga0075436_100032986 Ga0075436_1000329864 135
183 3300009093 Ga0105240_10092926 Ga0105240_100929264 135
184 3300009093 Ga0105240_10232022 Ga0105240_102320221 135
185 3300009093 Ga0105240_10802720 Ga0105240_108027202 135
186 3300009093 Ga0105240_11241263 Ga0105240_112412632 135
187 3300009098 Ga0105245_10032253 Ga0105245_100322535 135
188 3300009174 Ga0105241_10437407 Ga0105241_104374072 135
189 3300009177 Ga0105248_10000004 Ga0105248_10000004380 135
190 3300009177 Ga0105248_10093925 Ga0105248_100939253 135
191 3300009545 Ga0105237_10345581 Ga0105237_103455812 135
192 3300009551 Ga0105238_10239389 Ga0105238_102393892 135
193 3300010375 Ga0105239_10770631 Ga0105239_107706312 135
194 3300013104 Ga0157370_10010187 Ga0157370_1001018710 135
195 3300013104 Ga0157370_10052263 Ga0157370_100522634 135
196 3300013104 Ga0157370_10192159 Ga0157370_101921592 135
197 3300013105 Ga0157369_10017846 Ga0157369_100178467 135
198 3300013105 Ga0157369_10112954 Ga0157369_101129544 135
199 3300013297 Ga0157378_10110831 Ga0157378_101108313 135
200 3300013307 Ga0157372_10011047 Ga0157372_100110478 135
201 3300013307 Ga0157372_10252014 Ga0157372_102520142 135
202 3300013308 Ga0157375_10032288 Ga0157375_100322883 135
203 3300014497 Ga0182008_10229877 Ga0182008_102298772 135
204 3300014968 Ga0157379_10140759 Ga0157379_101407592 135
205 3300020082 Ga0206353_11896668 Ga0206353_118966682 135
206 3300025911 Ga0207654_10534572 Ga0207654_105345721 135
207 3300025912 Ga0207707_10007146 Ga0207707_100071464 135
208 3300025913 Ga0207695_10009332 Ga0207695_100093324 135
209 3300025913 Ga0207695_10069784 Ga0207695_100697843 135
210 3300025913 Ga0207695_10260032 Ga0207695_102600322 135
211 3300025913 Ga0207695_10326451 Ga0207695_103264513 135
212 3300025917 Ga0207660_10049572 Ga0207660_100495724 135
213 3300025921 Ga0207652_10172244 Ga0207652_101722442 135
214 3300025924 Ga0207694_10378282 Ga0207694_103782822 135
215 3300025924 Ga0207694_10497979 Ga0207694_104979792 135
216 3300025927 Ga0207687_10171439 Ga0207687_101714392 135
217 3300025941 Ga0207711_10000008 Ga0207711_10000008470 135
218 3300025941 Ga0207711_10000010 Ga0207711_100000108 135
219 3300025941 Ga0207711_10053830 Ga0207711_100538304 135
220 3300025949 Ga0207667_10299733 Ga0207667_102997332 135
221 3300025949 Ga0207667_11014428 Ga0207667_110144282 135
222 3300026023 Ga0207677_10137836 Ga0207677_101378361 135
223 3300026142 Ga0207698_10107593 Ga0207698_101075931 135
224 3300028577 Ga0265318_10234322 Ga0265318_102343222 135
225 3300028666 Ga0265336_10003228 Ga0265336_100032281 135
226 3300028800 Ga0265338_10471957 Ga0265338_104719571 135
227 3300030878 Ga0265770_1021466 Ga0265770_10214661 135
228 3300031241 Ga0265325_10016335 Ga0265325_100163351 135
229 3300031247 Ga0265340_10094114 Ga0265340_100941142 135
230 3300031595 Ga0265313_10045080 Ga0265313_100450803 135
231 3300031712 Ga0265342_10088974 Ga0265342_100889742 135
232 3300044656 Ga0466969_0480599 Ga0466969_0480599_96_503 135
233 3300045049 Ga0466959_0461360 Ga0466959_0461360_153_560 135
234 3300045836 Ga0466958_0510676 Ga0466958_0510676_141_548 135
235 3300050514 nmdc:mga08x19_26821_c1 nmdc:mga08x19_26821_c1_987_1415 135
236 3300053111 Ga0500572_236537 Ga0500572_236537_44_460 135
237 3300003316 rootH1_10160945 rootH1_101609452 136
238 3300003320 rootH2_10026678 rootH2_100266784 136
239 3300003320 rootH2_10260805 rootH2_102608051 136
240 3300003322 rootL2_10200354 rootL2_102003545 136
241 3300004803 Ga0058862_12011688 Ga0058862_120116882 136
242 3300005290 Ga0065712_10217890 Ga0065712_102178902 136
243 3300005327 Ga0070658_10023555 Ga0070658_100235556 136
244 3300005327 Ga0070658_10032764 Ga0070658_100327642 136
245 3300005327 Ga0070658_10084667 Ga0070658_100846672 136
246 3300005327 Ga0070658_10203144 Ga0070658_102031442 136
247 3300005329 Ga0070683_100001556 Ga0070683_10000155610 136
248 3300005329 Ga0070683_100023527 Ga0070683_1000235274 136
249 3300005329 Ga0070683_100081436 Ga0070683_1000814362 136
250 3300005329 Ga0070683_100119774 Ga0070683_1001197742 136
251 3300005329 Ga0070683_100132018 Ga0070683_1001320182 136
252 3300005329 Ga0070683_100185303 Ga0070683_1001853031 136
253 3300005329 Ga0070683_100211522 Ga0070683_1002115222 136
254 3300005334 Ga0068869_100017699 Ga0068869_1000176995 136
255 3300005334 Ga0068869_100213801 Ga0068869_1002138011 136
256 3300005335 Ga0070666_10028737 Ga0070666_100287375 136
257 3300005336 Ga0070680_100042940 Ga0070680_1000429405 136
258 3300005336 Ga0070680_100287859 Ga0070680_1002878592 136
259 3300005336 Ga0070680_100329878 Ga0070680_1003298781 136
260 3300005336 Ga0070680_100945723 Ga0070680_1009457232 136
261 3300005338 Ga0068868_100004476 Ga0068868_1000044761 136
262 3300005338 Ga0068868_100022297 Ga0068868_1000222974 136
263 3300005338 Ga0068868_100346578 Ga0068868_1003465781 136
264 3300005338 Ga0068868_100740633 Ga0068868_1007406332 136
265 3300005339 Ga0070660_100006768 Ga0070660_1000067682 136
266 3300005339 Ga0070660_100054107 Ga0070660_1000541072 136
267 3300005339 Ga0070660_100101301 Ga0070660_1001013012 136
268 3300005340 Ga0070689_100490055 Ga0070689_1004900552 136
269 3300005341 Ga0070691_10860431 Ga0070691_108604311 136
270 3300005344 Ga0070661_100003065 Ga0070661_10000306511 136
271 3300005344 Ga0070661_100004616 Ga0070661_1000046168 136
272 3300005344 Ga0070661_100194418 Ga0070661_1001944182 136
273 3300005344 Ga0070661_100951947 Ga0070661_1009519471 136
274 3300005347 Ga0070668_100061780 Ga0070668_1000617805 136
275 3300005353 Ga0070669_100787855 Ga0070669_1007878551 136
276 3300005355 Ga0070671_100025737 Ga0070671_1000257374 136
277 3300005355 Ga0070671_100027068 Ga0070671_1000270683 136
278 3300005355 Ga0070671_100131020 Ga0070671_1001310202 136
279 3300005355 Ga0070671_100775859 Ga0070671_1007758592 136
280 3300005364 Ga0070673_100023375 Ga0070673_1000233754 136
281 3300005366 Ga0070659_100200491 Ga0070659_1002004912 136
282 3300005366 Ga0070659_101006636 Ga0070659_1010066362 136
283 3300005367 Ga0070667_100006815 Ga0070667_10000681510 136
284 3300005367 Ga0070667_100049090 Ga0070667_1000490902 136
285 3300005367 Ga0070667_102316328 Ga0070667_1023163281 136
286 3300005434 Ga0070709_10385238 Ga0070709_103852382 136
287 3300005434 Ga0070709_11178743 Ga0070709_111787432 136
288 3300005435 Ga0070714_100014205 Ga0070714_10001420510 136
289 3300005435 Ga0070714_100690404 Ga0070714_1006904041 136
290 3300005436 Ga0070713_100010367 Ga0070713_1000103677 136
291 3300005436 Ga0070713_100315805 Ga0070713_1003158052 136
292 3300005436 Ga0070713_100740150 Ga0070713_1007401502 136
293 3300005437 Ga0070710_10172280 Ga0070710_101722802 136
294 3300005437 Ga0070710_10845429 Ga0070710_108454291 136
295 3300005439 Ga0070711_100102773 Ga0070711_1001027733 136
296 3300005439 Ga0070711_100285151 Ga0070711_1002851512 136
297 3300005439 Ga0070711_101050785 Ga0070711_1010507852 136
298 3300005455 Ga0070663_100031150 Ga0070663_1000311503 136
299 3300005455 Ga0070663_100290365 Ga0070663_1002903652 136
300 3300005455 Ga0070663_100627248 Ga0070663_1006272481 136
301 3300005455 Ga0070663_100745487 Ga0070663_1007454872 136
302 3300005456 Ga0070678_100003237 Ga0070678_1000032372 136
303 3300005457 Ga0070662_100082083 Ga0070662_1000820831 136
304 3300005458 Ga0070681_10003755 Ga0070681_1000375514 136
305 3300005458 Ga0070681_10470233 Ga0070681_104702332 136
306 3300005458 Ga0070681_10755568 Ga0070681_107555682 136
307 3300005530 Ga0070679_100112249 Ga0070679_1001122493 136
308 3300005530 Ga0070679_100341361 Ga0070679_1003413611 136
309 3300005530 Ga0070679_100357345 Ga0070679_1003573452 136
310 3300005530 Ga0070679_100385382 Ga0070679_1003853823 136
311 3300005530 Ga0070679_100394852 Ga0070679_1003948522 136
312 3300005535 Ga0070684_100002861 Ga0070684_10000286110 136
313 3300005535 Ga0070684_100005055 Ga0070684_1000050551 136
314 3300005535 Ga0070684_100021807 Ga0070684_1000218074 136
315 3300005535 Ga0070684_100050758 Ga0070684_1000507587 136
316 3300005535 Ga0070684_100745168 Ga0070684_1007451682 136
317 3300005535 Ga0070684_101176267 Ga0070684_1011762671 136
318 3300005535 Ga0070684_101289172 Ga0070684_1012891721 136
319 3300005539 Ga0068853_100004104 Ga0068853_1000041046 136
320 3300005539 Ga0068853_100043023 Ga0068853_1000430235 136
321 3300005539 Ga0068853_100044174 Ga0068853_1000441745 136
322 3300005539 Ga0068853_100047503 Ga0068853_1000475035 136
323 3300005539 Ga0068853_100084324 Ga0068853_1000843243 136
324 3300005543 Ga0070672_100119666 Ga0070672_1001196662 136
325 3300005548 Ga0070665_100024742 Ga0070665_1000247422 136
326 3300005548 Ga0070665_100049315 Ga0070665_1000493153 136
327 3300005548 Ga0070665_100171818 Ga0070665_1001718184 136
328 3300005548 Ga0070665_100195887 Ga0070665_1001958872 136
329 3300005548 Ga0070665_100350010 Ga0070665_1003500103 136
330 3300005548 Ga0070665_100869712 Ga0070665_1008697122 136
331 3300005548 Ga0070665_101608419 Ga0070665_1016084191 136
332 3300005563 Ga0068855_100000819 Ga0068855_10000081947 136
333 3300005563 Ga0068855_100004206 Ga0068855_10000420615 136
334 3300005563 Ga0068855_100012254 Ga0068855_1000122544 136
335 3300005563 Ga0068855_100014110 Ga0068855_1000141109 136
336 3300005563 Ga0068855_100014511 Ga0068855_1000145119 136
337 3300005563 Ga0068855_100026325 Ga0068855_1000263256 136
338 3300005563 Ga0068855_100057916 Ga0068855_1000579165 136
339 3300005563 Ga0068855_100072112 Ga0068855_1000721123 136
340 3300005563 Ga0068855_100081457 Ga0068855_1000814573 136
341 3300005563 Ga0068855_100152156 Ga0068855_1001521561 136
342 3300005563 Ga0068855_100185794 Ga0068855_1001857944 136
343 3300005563 Ga0068855_100501351 Ga0068855_1005013511 136
344 3300005563 Ga0068855_100532933 Ga0068855_1005329333 136
345 3300005563 Ga0068855_100859036 Ga0068855_1008590362 136
346 3300005563 Ga0068855_101147539 Ga0068855_1011475391 136
347 3300005563 Ga0068855_102067886 Ga0068855_1020678861 136
348 3300005563 Ga0068855_102144557 Ga0068855_1021445571 136
349 3300005564 Ga0070664_100136329 Ga0070664_1001363293 136
350 3300005564 Ga0070664_100253364 Ga0070664_1002533643 136
351 3300005564 Ga0070664_101063845 Ga0070664_1010638452 136
352 3300005577 Ga0068857_100001991 Ga0068857_1000019912 136
353 3300005577 Ga0068857_100083477 Ga0068857_1000834774 136
354 3300005577 Ga0068857_100235583 Ga0068857_1002355832 136
355 3300005577 Ga0068857_100335207 Ga0068857_1003352072 136
356 3300005577 Ga0068857_100564421 Ga0068857_1005644212 136
357 3300005578 Ga0068854_100058150 Ga0068854_1000581503 136
358 3300005578 Ga0068854_100368625 Ga0068854_1003686253 136
359 3300005578 Ga0068854_101203020 Ga0068854_1012030201 136
360 3300005614 Ga0068856_100001782 Ga0068856_1000017825 136
361 3300005614 Ga0068856_100008091 Ga0068856_1000080912 136
362 3300005614 Ga0068856_100011451 Ga0068856_1000114515 136
363 3300005614 Ga0068856_100015606 Ga0068856_1000156069 136
364 3300005614 Ga0068856_100060352 Ga0068856_1000603521 136
365 3300005614 Ga0068856_100091653 Ga0068856_1000916532 136
366 3300005614 Ga0068856_100316967 Ga0068856_1003169672 136
367 3300005614 Ga0068856_100382337 Ga0068856_1003823371 136
368 3300005614 Ga0068856_100960335 Ga0068856_1009603351 136
369 3300005614 Ga0068856_101692099 Ga0068856_1016920991 136
370 3300005616 Ga0068852_100003017 Ga0068852_1000030172 136
371 3300005616 Ga0068852_100003172 Ga0068852_10000317210 136
372 3300005616 Ga0068852_100003318 Ga0068852_10000331814 136
373 3300005616 Ga0068852_100008628 Ga0068852_1000086283 136
374 3300005616 Ga0068852_100111185 Ga0068852_1001111852 136
375 3300005616 Ga0068852_100243251 Ga0068852_1002432512 136
376 3300005616 Ga0068852_100515525 Ga0068852_1005155252 136
377 3300005616 Ga0068852_100558806 Ga0068852_1005588062 136
378 3300005616 Ga0068852_100899394 Ga0068852_1008993942 136
379 3300005617 Ga0068859_100083756 Ga0068859_1000837562 136
380 3300005617 Ga0068859_102353838 Ga0068859_1023538381 136
381 3300005618 Ga0068864_100001011 Ga0068864_10000101124 136
382 3300005834 Ga0068851_10016720 Ga0068851_100167202 136
383 3300005834 Ga0068851_10070517 Ga0068851_100705172 136
384 3300005834 Ga0068851_10077545 Ga0068851_100775452 136
385 3300005834 Ga0068851_10092843 Ga0068851_100928432 136
386 3300005834 Ga0068851_10190298 Ga0068851_101902982 136
387 3300005834 Ga0068851_10314664 Ga0068851_103146641 136
388 3300005841 Ga0068863_100001678 Ga0068863_10000167810 136
389 3300005841 Ga0068863_100007398 Ga0068863_1000073985 136
390 3300005841 Ga0068863_101106728 Ga0068863_1011067282 136
391 3300005842 Ga0068858_100003486 Ga0068858_1000034862 136
392 3300005842 Ga0068858_100203322 Ga0068858_1002033224 136
393 3300005842 Ga0068858_100476504 Ga0068858_1004765041 136
394 3300005843 Ga0068860_100007224 Ga0068860_10000722410 136
395 3300005843 Ga0068860_100023371 Ga0068860_1000233717 136
396 3300005844 Ga0068862_100244391 Ga0068862_1002443913 136
397 3300006028 Ga0070717_10016965 Ga0070717_100169658 136
398 3300006028 Ga0070717_10216768 Ga0070717_102167682 136
399 3300006028 Ga0070717_11214219 Ga0070717_112142192 136
400 3300006028 Ga0070717_11379792 Ga0070717_113797922 136
401 3300006175 Ga0070712_100082293 Ga0070712_1000822933 136
402 3300006237 Ga0097621_100003579 Ga0097621_1000035792 136
403 3300006237 Ga0097621_100039628 Ga0097621_1000396282 136
404 3300006358 Ga0068871_100003833 Ga0068871_1000038332 136
405 3300006358 Ga0068871_100020118 Ga0068871_1000201184 136
406 3300006358 Ga0068871_100028898 Ga0068871_1000288986 136
407 3300006358 Ga0068871_101396223 Ga0068871_1013962231 136
408 3300006881 Ga0068865_100054112 Ga0068865_1000541124 136
409 3300006931 Ga0097620_100083764 Ga0097620_1000837644 136
410 3300006931 Ga0097620_102354255 Ga0097620_1023542551 136
411 3300009093 Ga0105240_10000531 Ga0105240_1000053148 136
412 3300009093 Ga0105240_10003431 Ga0105240_1000343120 136
413 3300009093 Ga0105240_10009850 Ga0105240_1000985010 136
414 3300009093 Ga0105240_10015189 Ga0105240_1001518910 136
415 3300009093 Ga0105240_10015938 Ga0105240_1001593812 136
416 3300009093 Ga0105240_10034845 Ga0105240_100348457 136
417 3300009093 Ga0105240_10042759 Ga0105240_100427598 136
418 3300009093 Ga0105240_10054107 Ga0105240_100541076 136
419 3300009093 Ga0105240_10084928 Ga0105240_100849282 136
420 3300009093 Ga0105240_10311733 Ga0105240_103117333 136
421 3300009093 Ga0105240_10394867 Ga0105240_103948672 136
422 3300009093 Ga0105240_10470736 Ga0105240_104707363 136
423 3300009093 Ga0105240_10868925 Ga0105240_108689251 136
424 3300009098 Ga0105245_10006340 Ga0105245_1000634011 136
425 3300009098 Ga0105245_10045717 Ga0105245_100457171 136
426 3300009098 Ga0105245_10073426 Ga0105245_100734262 136
427 3300009098 Ga0105245_10152482 Ga0105245_101524823 136
428 3300009101 Ga0105247_10016685 Ga0105247_100166853 136
429 3300009101 Ga0105247_10094104 Ga0105247_100941041 136
430 3300009101 Ga0105247_10168380 Ga0105247_101683802 136
431 3300009148 Ga0105243_10009867 Ga0105243_100098675 136
432 3300009174 Ga0105241_10000199 Ga0105241_1000019927 136
433 3300009174 Ga0105241_10001305 Ga0105241_1000130514 136
434 3300009174 Ga0105241_10002734 Ga0105241_100027345 136
435 3300009174 Ga0105241_10013210 Ga0105241_100132107 136
436 3300009174 Ga0105241_10018485 Ga0105241_100184855 136
437 3300009174 Ga0105241_10093630 Ga0105241_100936303 136
438 3300009174 Ga0105241_10402184 Ga0105241_104021842 136
439 3300009174 Ga0105241_10542257 Ga0105241_105422571 136
440 3300009174 Ga0105241_10814294 Ga0105241_108142942 136
441 3300009176 Ga0105242_11204845 Ga0105242_112048452 136
442 3300009177 Ga0105248_10000255 Ga0105248_1000025542 136
443 3300009177 Ga0105248_10205747 Ga0105248_102057472 136
444 3300009177 Ga0105248_10400748 Ga0105248_104007483 136
445 3300009177 Ga0105248_10616549 Ga0105248_106165493 136
446 3300009177 Ga0105248_11092470 Ga0105248_110924702 136
447 3300009545 Ga0105237_10003805 Ga0105237_1000380513 136
448 3300009545 Ga0105237_10019484 Ga0105237_100194849 136
449 3300009545 Ga0105237_10050367 Ga0105237_100503675 136
450 3300009545 Ga0105237_10230918 Ga0105237_102309183 136
451 3300009545 Ga0105237_10247869 Ga0105237_102478691 136
452 3300009545 Ga0105237_10265446 Ga0105237_102654464 136
453 3300009545 Ga0105237_10321428 Ga0105237_103214282 136
454 3300009545 Ga0105237_11543340 Ga0105237_115433402 136
455 3300009551 Ga0105238_10000262 Ga0105238_1000026212 136
456 3300009551 Ga0105238_10000292 Ga0105238_1000029212 136
457 3300009551 Ga0105238_10001340 Ga0105238_100013402 136
458 3300009551 Ga0105238_10007813 Ga0105238_100078133 136
459 3300009551 Ga0105238_10032054 Ga0105238_100320547 136
460 3300009551 Ga0105238_10052982 Ga0105238_100529824 136
461 3300009551 Ga0105238_10078667 Ga0105238_100786675 136
462 3300009551 Ga0105238_10227607 Ga0105238_102276072 136
463 3300009551 Ga0105238_10413015 Ga0105238_104130152 136
464 3300009551 Ga0105238_10684020 Ga0105238_106840202 136
465 3300009551 Ga0105238_10743348 Ga0105238_107433481 136
466 3300009551 Ga0105238_12184579 Ga0105238_121845791 136
467 3300009553 Ga0105249_10035872 Ga0105249_100358727 136
468 3300009553 Ga0105249_10064494 Ga0105249_100644944 136
469 3300010375 Ga0105239_10001873 Ga0105239_1000187326 136
470 3300010375 Ga0105239_10004032 Ga0105239_1000403213 136
471 3300010375 Ga0105239_10007426 Ga0105239_1000742611 136
472 3300010375 Ga0105239_10054842 Ga0105239_100548422 136
473 3300010375 Ga0105239_10096949 Ga0105239_100969494 136
474 3300010375 Ga0105239_10307055 Ga0105239_103070552 136
475 3300010375 Ga0105239_10316960 Ga0105239_103169604 136
476 3300010375 Ga0105239_10337112 Ga0105239_103371123 136
477 3300010375 Ga0105239_13561122 Ga0105239_135611221 136
478 3300011119 Ga0105246_10006772 Ga0105246_100067729 136
479 3300011119 Ga0105246_10467531 Ga0105246_104675312 136
480 3300011119 Ga0105246_10884187 Ga0105246_108841871 136
481 3300013100 Ga0157373_10053519 Ga0157373_100535194 136
482 3300013100 Ga0157373_10459506 Ga0157373_104595062 136
483 3300013100 Ga0157373_10577668 Ga0157373_105776682 136
484 3300013100 Ga0157373_11562317 Ga0157373_115623171 136
485 3300013102 Ga0157371_10029907 Ga0157371_100299072 136
486 3300013102 Ga0157371_10279736 Ga0157371_102797363 136
487 3300013104 Ga0157370_10000107 Ga0157370_1000010711 136
488 3300013104 Ga0157370_10011099 Ga0157370_100110996 136
489 3300013104 Ga0157370_10021637 Ga0157370_1002163710 136
490 3300013104 Ga0157370_10028338 Ga0157370_100283386 136
491 3300013104 Ga0157370_10061945 Ga0157370_100619455 136
492 3300013104 Ga0157370_10192399 Ga0157370_101923993 136
493 3300013104 Ga0157370_10361919 Ga0157370_103619193 136
494 3300013104 Ga0157370_10498118 Ga0157370_104981182 136
495 3300013104 Ga0157370_10549010 Ga0157370_105490102 136
496 3300013104 Ga0157370_10838706 Ga0157370_108387061 136
497 3300013104 Ga0157370_11795871 Ga0157370_117958712 136
498 3300013105 Ga0157369_10000275 Ga0157369_1000027529 136
499 3300013105 Ga0157369_10002075 Ga0157369_1000207511 136
500 3300013105 Ga0157369_10003741 Ga0157369_1000374111 136
501 3300013105 Ga0157369_10014204 Ga0157369_100142046 136
502 3300013105 Ga0157369_10017062 Ga0157369_100170628 136
503 3300013105 Ga0157369_10021414 Ga0157369_100214144 136
504 3300013105 Ga0157369_10079311 Ga0157369_100793113 136
505 3300013105 Ga0157369_10089774 Ga0157369_100897743 136
506 3300013105 Ga0157369_10092522 Ga0157369_100925222 136
507 3300013105 Ga0157369_10097179 Ga0157369_100971793 136
508 3300013105 Ga0157369_10099468 Ga0157369_100994684 136
509 3300013105 Ga0157369_10138740 Ga0157369_101387402 136
510 3300013105 Ga0157369_10274304 Ga0157369_102743042 136
511 3300013105 Ga0157369_10519471 Ga0157369_105194712 136
512 3300013105 Ga0157369_11827151 Ga0157369_118271511 136
513 3300013296 Ga0157374_10009059 Ga0157374_100090597 136
514 3300013296 Ga0157374_10009888 Ga0157374_100098886 136
515 3300013296 Ga0157374_10025221 Ga0157374_100252214 136
516 3300013296 Ga0157374_10043879 Ga0157374_100438794 136
517 3300013296 Ga0157374_10076869 Ga0157374_100768692 136
518 3300013296 Ga0157374_10216396 Ga0157374_102163963 136
519 3300013296 Ga0157374_10220706 Ga0157374_102207064 136
520 3300013296 Ga0157374_10828369 Ga0157374_108283691 136
521 3300013296 Ga0157374_10847509 Ga0157374_108475092 136
522 3300013296 Ga0157374_10884859 Ga0157374_108848591 136
523 3300013296 Ga0157374_10958257 Ga0157374_109582572 136
524 3300013296 Ga0157374_11251476 Ga0157374_112514761 136
525 3300013296 Ga0157374_11725672 Ga0157374_117256721 136
526 3300013297 Ga0157378_10017511 Ga0157378_100175117 136
527 3300013297 Ga0157378_10029194 Ga0157378_100291944 136
528 3300013297 Ga0157378_10078165 Ga0157378_100781656 136
529 3300013297 Ga0157378_10090679 Ga0157378_100906792 136
530 3300013306 Ga0163162_10050845 Ga0163162_100508454 136
531 3300013306 Ga0163162_10474961 Ga0163162_104749612 136
532 3300013307 Ga0157372_10000127 Ga0157372_1000012712 136
533 3300013307 Ga0157372_10001526 Ga0157372_1000152618 136
534 3300013307 Ga0157372_10016987 Ga0157372_100169876 136
535 3300013307 Ga0157372_10020604 Ga0157372_100206049 136
536 3300013307 Ga0157372_10023808 Ga0157372_100238085 136
537 3300013307 Ga0157372_10024442 Ga0157372_100244426 136
538 3300013307 Ga0157372_10044759 Ga0157372_100447592 136
539 3300013307 Ga0157372_10047346 Ga0157372_100473465 136
540 3300013307 Ga0157372_10056981 Ga0157372_100569812 136
541 3300013307 Ga0157372_10076793 Ga0157372_100767934 136
542 3300013307 Ga0157372_10096852 Ga0157372_100968525 136
543 3300013307 Ga0157372_10099093 Ga0157372_100990935 136
544 3300013307 Ga0157372_10112432 Ga0157372_101124322 136
545 3300013307 Ga0157372_10179432 Ga0157372_101794324 136
546 3300013307 Ga0157372_10191598 Ga0157372_101915984 136
547 3300013307 Ga0157372_10212721 Ga0157372_102127214 136
548 3300013307 Ga0157372_10307228 Ga0157372_103072283 136
549 3300013307 Ga0157372_10459844 Ga0157372_104598442 136
550 3300013308 Ga0157375_10011935 Ga0157375_100119356 136
551 3300013308 Ga0157375_10015926 Ga0157375_100159267 136
552 3300013308 Ga0157375_11208298 Ga0157375_112082982 136
553 3300014325 Ga0163163_10016141 Ga0163163_100161414 136
554 3300014325 Ga0163163_10065040 Ga0163163_100650404 136
555 3300014325 Ga0163163_10122743 Ga0163163_101227434 136
556 3300014968 Ga0157379_10005183 Ga0157379_1000518311 136
557 3300014968 Ga0157379_10018173 Ga0157379_100181736 136
558 3300014968 Ga0157379_10074904 Ga0157379_100749044 136
559 3300014968 Ga0157379_11310565 Ga0157379_113105652 136
560 3300014969 Ga0157376_10001195 Ga0157376_1000119510 136
561 3300014969 Ga0157376_10021210 Ga0157376_100212103 136
562 3300014969 Ga0157376_10104173 Ga0157376_101041732 136
563 3300014969 Ga0157376_10192979 Ga0157376_101929792 136
564 3300014969 Ga0157376_10265556 Ga0157376_102655562 136
565 3300014969 Ga0157376_11914256 Ga0157376_119142562 136
566 3300017792 Ga0163161_10035791 Ga0163161_100357912 136
567 3300020069 Ga0197907_11423606 Ga0197907_114236061 136
568 3300020070 Ga0206356_11265128 Ga0206356_112651281 136
569 3300020077 Ga0206351_10892278 Ga0206351_108922781 136
570 3300020078 Ga0206352_10576970 Ga0206352_105769702 136
571 3300020078 Ga0206352_11317142 Ga0206352_113171421 136
572 3300020081 Ga0206354_10491568 Ga0206354_104915681 136
573 3300020610 Ga0154015_1346029 Ga0154015_13460292 136
574 3300020610 Ga0154015_1571093 Ga0154015_15710932 136
575 3300021361 Ga0213872_10025707 Ga0213872_100257073 136
576 3300021361 Ga0213872_10048157 Ga0213872_100481572 136
577 3300021361 Ga0213872_10106642 Ga0213872_101066422 136
578 3300021361 Ga0213872_10115337 Ga0213872_101153373 136
579 3300021377 Ga0213874_10349338 Ga0213874_103493381 136
580 3300021441 Ga0213871_10021294 Ga0213871_100212942 136
581 3300021441 Ga0213871_10039638 Ga0213871_100396383 136
582 3300025315 Ga0207697_10026675 Ga0207697_100266751 136
583 3300025321 Ga0207656_10029705 Ga0207656_100297052 136
584 3300025321 Ga0207656_10039750 Ga0207656_100397501 136
585 3300025321 Ga0207656_10057652 Ga0207656_100576522 136
586 3300025321 Ga0207656_10091433 Ga0207656_100914332 136
587 3300025321 Ga0207656_10159065 Ga0207656_101590652 136
588 3300025321 Ga0207656_10334267 Ga0207656_103342672 136
589 3300025900 Ga0207710_10008632 Ga0207710_100086325 136
590 3300025900 Ga0207710_10165353 Ga0207710_101653532 136
591 3300025900 Ga0207710_10406345 Ga0207710_104063452 136
592 3300025901 Ga0207688_10034034 Ga0207688_100340344 136
593 3300025901 Ga0207688_10318402 Ga0207688_103184022 136
594 3300025904 Ga0207647_10007335 Ga0207647_100073357 136
595 3300025904 Ga0207647_10046122 Ga0207647_100461221 136
596 3300025904 Ga0207647_10096372 Ga0207647_100963722 136
597 3300025906 Ga0207699_11006898 Ga0207699_110068981 136
598 3300025907 Ga0207645_10005882 Ga0207645_100058827 136
599 3300025909 Ga0207705_10051275 Ga0207705_100512753 136
600 3300025909 Ga0207705_10052224 Ga0207705_100522243 136
601 3300025909 Ga0207705_10077691 Ga0207705_100776912 136
602 3300025909 Ga0207705_10593242 Ga0207705_105932421 136
603 3300025909 Ga0207705_11227478 Ga0207705_112274781 136
604 3300025909 Ga0207705_11333878 Ga0207705_113338782 136
605 3300025911 Ga0207654_10000013 Ga0207654_10000013182 136
606 3300025911 Ga0207654_10000219 Ga0207654_100002195 136
607 3300025911 Ga0207654_10006439 Ga0207654_100064392 136
608 3300025911 Ga0207654_10027124 Ga0207654_100271242 136
609 3300025911 Ga0207654_10111395 Ga0207654_101113953 136
610 3300025911 Ga0207654_10123076 Ga0207654_101230762 136
611 3300025911 Ga0207654_10130565 Ga0207654_101305652 136
612 3300025911 Ga0207654_10496501 Ga0207654_104965012 136
613 3300025912 Ga0207707_10030886 Ga0207707_100308864 136
614 3300025912 Ga0207707_10070052 Ga0207707_100700522 136
615 3300025912 Ga0207707_10846436 Ga0207707_108464362 136
616 3300025912 Ga0207707_11055558 Ga0207707_110555582 136
617 3300025913 Ga0207695_10000233 Ga0207695_1000023351 136
618 3300025913 Ga0207695_10000258 Ga0207695_10000258105 136
619 3300025913 Ga0207695_10000398 Ga0207695_1000039816 136
620 3300025913 Ga0207695_10000501 Ga0207695_1000050187 136
621 3300025913 Ga0207695_10005107 Ga0207695_100051072 136
622 3300025913 Ga0207695_10089803 Ga0207695_100898032 136
623 3300025913 Ga0207695_10095375 Ga0207695_100953754 136
624 3300025913 Ga0207695_10125935 Ga0207695_101259353 136
625 3300025913 Ga0207695_10137036 Ga0207695_101370362 136
626 3300025913 Ga0207695_10518431 Ga0207695_105184312 136
627 3300025914 Ga0207671_10000022 Ga0207671_1000002218 136
628 3300025914 Ga0207671_10001087 Ga0207671_1000108726 136
629 3300025914 Ga0207671_10054501 Ga0207671_100545014 136
630 3300025914 Ga0207671_10123056 Ga0207671_101230562 136
631 3300025914 Ga0207671_10351187 Ga0207671_103511872 136
632 3300025915 Ga0207693_10496298 Ga0207693_104962982 136
633 3300025916 Ga0207663_10084866 Ga0207663_100848663 136
634 3300025916 Ga0207663_10644198 Ga0207663_106441982 136
635 3300025917 Ga0207660_10087558 Ga0207660_100875583 136
636 3300025917 Ga0207660_10107284 Ga0207660_101072843 136
637 3300025917 Ga0207660_10446806 Ga0207660_104468062 136
638 3300025917 Ga0207660_10462142 Ga0207660_104621422 136
639 3300025917 Ga0207660_10719764 Ga0207660_107197642 136
640 3300025917 Ga0207660_10724152 Ga0207660_107241522 136
641 3300025917 Ga0207660_11061230 Ga0207660_110612301 136
642 3300025919 Ga0207657_10107475 Ga0207657_101074754 136
643 3300025919 Ga0207657_10108566 Ga0207657_101085662 136
644 3300025920 Ga0207649_10014261 Ga0207649_100142615 136
645 3300025920 Ga0207649_10349614 Ga0207649_103496142 136
646 3300025920 Ga0207649_10357049 Ga0207649_103570492 136
647 3300025921 Ga0207652_10434536 Ga0207652_104345362 136
648 3300025921 Ga0207652_10497440 Ga0207652_104974401 136
649 3300025921 Ga0207652_10811748 Ga0207652_108117482 136
650 3300025921 Ga0207652_11033143 Ga0207652_110331431 136
651 3300025923 Ga0207681_11139914 Ga0207681_111399141 136
652 3300025924 Ga0207694_10000009 Ga0207694_10000009264 136
653 3300025924 Ga0207694_10000682 Ga0207694_100006822 136
654 3300025924 Ga0207694_10001146 Ga0207694_1000114624 136
655 3300025924 Ga0207694_10078940 Ga0207694_100789403 136
656 3300025924 Ga0207694_10273007 Ga0207694_102730072 136
657 3300025924 Ga0207694_10572608 Ga0207694_105726082 136
658 3300025924 Ga0207694_10723890 Ga0207694_107238901 136
659 3300025924 Ga0207694_10831456 Ga0207694_108314562 136
660 3300025926 Ga0207659_10110682 Ga0207659_101106821 136
661 3300025927 Ga0207687_10063915 Ga0207687_100639151 136
662 3300025927 Ga0207687_10112375 Ga0207687_101123752 136
663 3300025927 Ga0207687_10390703 Ga0207687_103907032 136
664 3300025927 Ga0207687_10856468 Ga0207687_108564682 136
665 3300025928 Ga0207700_10002175 Ga0207700_100021756 136
666 3300025928 Ga0207700_10984627 Ga0207700_109846271 136
667 3300025929 Ga0207664_10318671 Ga0207664_103186712 136
668 3300025931 Ga0207644_10069804 Ga0207644_100698043 136
669 3300025931 Ga0207644_10240824 Ga0207644_102408241 136
670 3300025931 Ga0207644_10303894 Ga0207644_103038942 136
671 3300025932 Ga0207690_10228223 Ga0207690_102282231 136
672 3300025932 Ga0207690_10536159 Ga0207690_105361591 136
673 3300025933 Ga0207706_10013501 Ga0207706_100135013 136
674 3300025935 Ga0207709_10021388 Ga0207709_100213885 136
675 3300025938 Ga0207704_10278017 Ga0207704_102780171 136
676 3300025940 Ga0207691_10010218 Ga0207691_100102186 136
677 3300025941 Ga0207711_10016171 Ga0207711_100161714 136
678 3300025941 Ga0207711_10184420 Ga0207711_101844201 136
679 3300025941 Ga0207711_10445447 Ga0207711_104454472 136
680 3300025942 Ga0207689_10000543 Ga0207689_1000054331 136
681 3300025942 Ga0207689_10028697 Ga0207689_100286972 136
682 3300025944 Ga0207661_10002791 Ga0207661_1000279113 136
683 3300025944 Ga0207661_10017763 Ga0207661_100177633 136
684 3300025944 Ga0207661_10074641 Ga0207661_100746414 136
685 3300025944 Ga0207661_10111456 Ga0207661_101114562 136
686 3300025944 Ga0207661_10132114 Ga0207661_101321143 136
687 3300025944 Ga0207661_10149798 Ga0207661_101497984 136
688 3300025944 Ga0207661_10164465 Ga0207661_101644653 136
689 3300025945 Ga0207679_10050554 Ga0207679_100505544 136
690 3300025949 Ga0207667_10000930 Ga0207667_1000093020 136
691 3300025949 Ga0207667_10001644 Ga0207667_1000164418 136
692 3300025949 Ga0207667_10007052 Ga0207667_100070526 136
693 3300025949 Ga0207667_10007746 Ga0207667_1000774615 136
694 3300025949 Ga0207667_10011149 Ga0207667_100111494 136
695 3300025949 Ga0207667_10034028 Ga0207667_100340284 136
696 3300025949 Ga0207667_10034303 Ga0207667_100343032 136
697 3300025949 Ga0207667_10062025 Ga0207667_100620252 136
698 3300025949 Ga0207667_10090955 Ga0207667_100909552 136
699 3300025949 Ga0207667_10485896 Ga0207667_104858961 136
700 3300025949 Ga0207667_10677006 Ga0207667_106770062 136
701 3300025949 Ga0207667_11099345 Ga0207667_110993452 136
702 3300025960 Ga0207651_10055776 Ga0207651_100557762 136
703 3300025961 Ga0207712_10018867 Ga0207712_100188677 136
704 3300025961 Ga0207712_10078847 Ga0207712_100788473 136
705 3300025981 Ga0207640_10042322 Ga0207640_100423223 136
706 3300025981 Ga0207640_11528230 Ga0207640_115282302 136
707 3300025981 Ga0207640_12032103 Ga0207640_120321031 136
708 3300025986 Ga0207658_10048455 Ga0207658_100484552 136
709 3300025986 Ga0207658_10328029 Ga0207658_103280291 136
710 3300026023 Ga0207677_10002256 Ga0207677_100022562 136
711 3300026023 Ga0207677_10026651 Ga0207677_100266514 136
712 3300026041 Ga0207639_10002669 Ga0207639_100026693 136
713 3300026041 Ga0207639_10067330 Ga0207639_100673302 136
714 3300026041 Ga0207639_10068103 Ga0207639_100681034 136
715 3300026041 Ga0207639_10126360 Ga0207639_101263602 136
716 3300026041 Ga0207639_10175555 Ga0207639_101755552 136
717 3300026041 Ga0207639_10927215 Ga0207639_109272152 136
718 3300026067 Ga0207678_10001021 Ga0207678_1000102120 136
719 3300026067 Ga0207678_10029470 Ga0207678_100294704 136
720 3300026067 Ga0207678_10168013 Ga0207678_101680133 136
721 3300026067 Ga0207678_10198662 Ga0207678_101986623 136
722 3300026067 Ga0207678_10407698 Ga0207678_104076983 136
723 3300026078 Ga0207702_10008532 Ga0207702_100085323 136
724 3300026078 Ga0207702_10026962 Ga0207702_100269622 136
725 3300026078 Ga0207702_10032700 Ga0207702_100327004 136
726 3300026078 Ga0207702_10137200 Ga0207702_101372003 136
727 3300026078 Ga0207702_10227246 Ga0207702_102272462 136
728 3300026078 Ga0207702_10509216 Ga0207702_105092161 136
729 3300026088 Ga0207641_10105295 Ga0207641_101052953 136
730 3300026088 Ga0207641_10537005 Ga0207641_105370052 136
731 3300026095 Ga0207676_10002800 Ga0207676_1000280014 136
732 3300026095 Ga0207676_10087223 Ga0207676_100872231 136
733 3300026116 Ga0207674_10001254 Ga0207674_1000125429 136
734 3300026116 Ga0207674_10001761 Ga0207674_1000176123 136
735 3300026116 Ga0207674_10003906 Ga0207674_100039065 136
736 3300026116 Ga0207674_10232890 Ga0207674_102328902 136
737 3300026116 Ga0207674_10348926 Ga0207674_103489262 136
738 3300026118 Ga0207675_100410887 Ga0207675_1004108873 136
739 3300026121 Ga0207683_10000329 Ga0207683_100003296 136
740 3300026142 Ga0207698_10000109 Ga0207698_1000010914 136
741 3300026142 Ga0207698_10002320 Ga0207698_1000232013 136
742 3300026142 Ga0207698_10041267 Ga0207698_100412673 136
743 3300026142 Ga0207698_10099352 Ga0207698_100993522 136
744 3300026142 Ga0207698_10287994 Ga0207698_102879943 136
745 3300026142 Ga0207698_10300006 Ga0207698_103000062 136
746 3300026142 Ga0207698_10687859 Ga0207698_106878591 136
747 3300026142 Ga0207698_10824643 Ga0207698_108246432 136
748 3300026142 Ga0207698_11412049 Ga0207698_114120491 136
749 3300028379 Ga0268266_10014819 Ga0268266_100148193 136
750 3300028379 Ga0268266_10108658 Ga0268266_101086584 136
751 3300028379 Ga0268266_10159323 Ga0268266_101593232 136
752 3300028379 Ga0268266_10634349 Ga0268266_106343492 136
753 3300028379 Ga0268266_10813973 Ga0268266_108139732 136
754 3300028379 Ga0268266_10852963 Ga0268266_108529632 136
755 3300028380 Ga0268265_10228555 Ga0268265_102285553 136
756 3300028381 Ga0268264_10025217 Ga0268264_100252174 136
757 3300028563 Ga0265319_1165439 Ga0265319_11654392 136
758 3300028577 Ga0265318_10045097 Ga0265318_100450972 136
759 3300028577 Ga0265318_10075307 Ga0265318_100753072 136
760 3300028577 Ga0265318_10271068 Ga0265318_102710681 136
761 3300028653 Ga0265323_10149059 Ga0265323_101490591 136
762 3300028653 Ga0265323_10188211 Ga0265323_101882112 136
763 3300028800 Ga0265338_10004864 Ga0265338_1000486411 136
764 3300028800 Ga0265338_10009983 Ga0265338_1000998317 136
765 3300028800 Ga0265338_10027301 Ga0265338_100273012 136
766 3300028800 Ga0265338_10058037 Ga0265338_100580376 136
767 3300028800 Ga0265338_10271109 Ga0265338_102711091 136
768 3300028800 Ga0265338_10640100 Ga0265338_106401002 136
769 3300028800 Ga0265338_10856134 Ga0265338_108561341 136
770 3300028800 Ga0265338_11000875 Ga0265338_110008751 136
771 3300030878 Ga0265770_1011796 Ga0265770_10117962 136
772 3300030879 Ga0265765_1017833 Ga0265765_10178332 136
773 3300031090 Ga0265760_10064375 Ga0265760_100643752 136
774 3300031090 Ga0265760_10330854 Ga0265760_103308541 136
775 3300031235 Ga0265330_10002436 Ga0265330_100024367 136
776 3300031235 Ga0265330_10018567 Ga0265330_100185672 136
777 3300031235 Ga0265330_10023360 Ga0265330_100233602 136
778 3300031235 Ga0265330_10092375 Ga0265330_100923752 136
779 3300031235 Ga0265330_10099791 Ga0265330_100997913 136
780 3300031235 Ga0265330_10112096 Ga0265330_101120962 136
781 3300031235 Ga0265330_10204034 Ga0265330_102040342 136
782 3300031235 Ga0265330_10215016 Ga0265330_102150161 136
783 3300031238 Ga0265332_10081563 Ga0265332_100815632 136
784 3300031239 Ga0265328_10026137 Ga0265328_100261372 136
785 3300031239 Ga0265328_10048673 Ga0265328_100486732 136
786 3300031239 Ga0265328_10088360 Ga0265328_100883602 136
787 3300031241 Ga0265325_10000115 Ga0265325_1000011551 136
788 3300031241 Ga0265325_10038953 Ga0265325_100389534 136
789 3300031241 Ga0265325_10039205 Ga0265325_100392054 136
790 3300031241 Ga0265325_10069413 Ga0265325_100694132 136
791 3300031241 Ga0265325_10365419 Ga0265325_103654191 136
792 3300031241 Ga0265325_10430213 Ga0265325_104302132 136
793 3300031242 Ga0265329_10038904 Ga0265329_100389042 136
794 3300031247 Ga0265340_10011351 Ga0265340_100113515 136
795 3300031247 Ga0265340_10076277 Ga0265340_100762771 136
796 3300031247 Ga0265340_10123160 Ga0265340_101231602 136
797 3300031247 Ga0265340_10125515 Ga0265340_101255152 136
798 3300031247 Ga0265340_10183842 Ga0265340_101838422 136
799 3300031249 Ga0265339_10000557 Ga0265339_100005575 136
800 3300031249 Ga0265339_10000694 Ga0265339_100006948 136
801 3300031249 Ga0265339_10003616 Ga0265339_1000361616 136
802 3300031249 Ga0265339_10073954 Ga0265339_100739543 136
803 3300031249 Ga0265339_10263109 Ga0265339_102631091 136
804 3300031344 Ga0265316_10001818 Ga0265316_100018188 136
805 3300031344 Ga0265316_10016452 Ga0265316_100164526 136
806 3300031344 Ga0265316_10067550 Ga0265316_100675504 136
807 3300031344 Ga0265316_10122599 Ga0265316_101225993 136
808 3300031344 Ga0265316_10131782 Ga0265316_101317821 136
809 3300031344 Ga0265316_10151408 Ga0265316_101514083 136
810 3300031344 Ga0265316_10379797 Ga0265316_103797972 136
811 3300031344 Ga0265316_10400247 Ga0265316_104002472 136
812 3300031344 Ga0265316_10979057 Ga0265316_109790571 136
813 3300031595 Ga0265313_10003472 Ga0265313_100034722 136
814 3300031595 Ga0265313_10011695 Ga0265313_100116952 136
815 3300031595 Ga0265313_10097836 Ga0265313_100978363 136
816 3300031711 Ga0265314_10000081 Ga0265314_1000008156 136
817 3300031711 Ga0265314_10041564 Ga0265314_100415644 136
818 3300031711 Ga0265314_10106077 Ga0265314_101060773 136
819 3300031711 Ga0265314_10377088 Ga0265314_103770882 136
820 3300031712 Ga0265342_10001506 Ga0265342_100015068 136
821 3300031712 Ga0265342_10004150 Ga0265342_1000415012 136
822 3300031712 Ga0265342_10009471 Ga0265342_100094715 136
823 3300031712 Ga0265342_10018805 Ga0265342_100188055 136
824 3300031712 Ga0265342_10044547 Ga0265342_100445474 136
825 3300031712 Ga0265342_10087771 Ga0265342_100877713 136
826 3300031712 Ga0265342_10098523 Ga0265342_100985232 136
827 3300031712 Ga0265342_10120751 Ga0265342_101207512 136
828 3300031712 Ga0265342_10288221 Ga0265342_102882212 136
829 3300033547 Ga0316212_1055856 Ga0316212_10558561 136
830 3300035111 Ga0373923_0102840 Ga0373923_0102840_823_1242 136
831 3300035118 Ga0373954_0076840 Ga0373954_0076840_547_966 136
832 3300035119 Ga0373956_0188645 Ga0373956_0188645_367_786 136
833 3300035692 Ga0373935_0474696 Ga0373935_0474696_208_627 136
834 3300035724 Ga0373933_0039060 Ga0373933_0039060_669_1088 136
835 3300035724 Ga0373933_0450197 Ga0373933_0450197_199_618 136
836 3300036401 Ga0373937_0129068 Ga0373937_0129068_401_820 136
837 3300036401 Ga0373937_0219266 Ga0373937_0219266_1106_1525 136
838 3300036401 Ga0373937_1447729 Ga0373937_1447729_59_478 136
839 3300037418 Ga0395900_0237534 Ga0395900_0237534_576_986 136
840 3300037418 Ga0395900_0323935 Ga0395900_0323935_75_485 136
841 3300037418 Ga0395900_0492583 Ga0395900_0492583_592_1002 136
842 3300037466 Ga0395898_0383162 Ga0395898_0383162_136_546 136
843 3300037466 Ga0395898_1623608 Ga0395898_1623608_90_500 136
844 3300038443 Ga0395901_1077642 Ga0395901_1077642_225_650 136
845 3300039437 Ga0436365_1104300 Ga0436365_1104300_420_830 136
846 3300039438 Ga0436360_0796911 Ga0436360_0796911_1997_2407 136
847 3300039438 Ga0436360_1350082 Ga0436360_1350082_1429_1839 136
848 3300039447 Ga0436361_0032893 Ga0436361_0032893_244_654 136
849 3300039447 Ga0436361_0111045 Ga0436361_0111045_885_1295 136
850 3300039447 Ga0436361_0212937 Ga0436361_0212937_27246_27656 136
851 3300039447 Ga0436361_0412341 Ga0436361_0412341_155_565 136
852 3300039447 Ga0436361_0664017 Ga0436361_0664017_1955_2365 136
853 3300039447 Ga0436361_1088884 Ga0436361_1088884_728_1138 136
854 3300039447 Ga0436361_1207243 Ga0436361_1207243_1085_1495 136
855 3300039450 Ga0436363_0818606 Ga0436363_0818606_556_975 136
856 3300039453 Ga0436362_0601495 Ga0436362_0601495_1194_1604 136
857 3300042005 Ga0439448_0025639 Ga0439448_0025639_168_578 136
858 3300044656 Ga0466969_0086927 Ga0466969_0086927_50_469 136
859 3300044684 Ga0466966_0427979 Ga0466966_0427979_269_679 136
860 3300044684 Ga0466966_0704025 Ga0466966_0704025_99_518 136
861 3300044693 Ga0466961_0488986 Ga0466961_0488986_177_587 136
862 3300044694 Ga0466963_0000873 Ga0466963_0000873_5380_5805 136
863 3300044694 Ga0466963_0111430 Ga0466963_0111430_678_1091 136
864 3300044694 Ga0466963_0317102 Ga0466963_0317102_233_667 136
865 3300044694 Ga0466963_1034897 Ga0466963_1034897_41_460 136
866 3300045049 Ga0466959_1043589 Ga0466959_1043589_32_451 136
867 3300045836 Ga0466958_0346800 Ga0466958_0346800_52_477 136
868 3300045836 Ga0466958_0386573 Ga0466958_0386573_126_545 136
869 3300045976 Ga0466967_0003352 Ga0466967_0003352_8202_8627 136
870 3300045976 Ga0466967_0574163 Ga0466967_0574163_262_675 136
871 3300045976 Ga0466967_1253151 Ga0466967_1253151_45_470 136
872 3300046459 Ga0495629_0030602 Ga0495629_0030602_1791_2216 136
873 3300046459 Ga0495629_0229166 Ga0495629_0229166_442_867 136
874 3300046462 Ga0495651_0056152 Ga0495651_0056152_44_469 136
875 3300046472 Ga0495580_0151490 Ga0495580_0151490_190_615 136
876 3300046475 Ga0495639_0630219 Ga0495639_0630219_123_533 136
877 3300046492 Ga0495585_0388442 Ga0495585_0388442_206_616 136
878 3300046506 Ga0495583_0288032 Ga0495583_0288032_161_571 136
879 3300046507 Ga0495606_0252848 Ga0495606_0252848_323_733 136
880 3300046511 Ga0495608_0443132 Ga0495608_0443132_46_465 136
881 3300046529 Ga0495652_0093962 Ga0495652_0093962_393_818 136
882 3300046536 Ga0495587_0241525 Ga0495587_0241525_163_588 136
883 3300046543 Ga0495645_0051474 Ga0495645_0051474_689_1114 136
884 3300046678 Ga0495599_0352514 Ga0495599_0352514_97_522 136
885 3300046679 Ga0495623_0542885 Ga0495623_0542885_20_445 136
886 3300046680 Ga0495646_0281853 Ga0495646_0281853_243_662 136
887 3300046684 Ga0495669_0052475 Ga0495669_0052475_528_947 136
888 3300046689 Ga0495613_0172457 Ga0495613_0172457_344_769 136
889 3300046689 Ga0495613_0814292 Ga0495613_0814292_96_521 136
890 3300047315 Ga0495581_0562687 Ga0495581_0562687_107_532 136
891 3300047319 Ga0495674_0771961 Ga0495674_0771961_111_536 136
892 3300047472 Ga0495686_0004892 Ga0495686_0004892_6032_6463 136
893 3300047472 Ga0495686_0015720 Ga0495686_0015720_530_943 136
894 3300048088 Ga0495602_0501328 Ga0495602_0501328_86_505 136
895 3300048904 Ga0496101_0297462 Ga0496101_0297462_806_1231 136
896 3300048905 Ga0496102_0168814 Ga0496102_0168814_628_1047 136
897 3300048907 Ga0496104_0287969 Ga0496104_0287969_168_587 136
898 3300048907 Ga0496104_0743084 Ga0496104_0743084_216_641 136
899 3300048908 Ga0496105_0076727 Ga0496105_0076727_1083_1502 136
900 3300048908 Ga0496105_0406818 Ga0496105_0406818_628_1047 136
901 3300048909 Ga0496106_0045792 Ga0496106_0045792_1761_2186 136
902 3300048912 Ga0496109_0139862 Ga0496109_0139862_366_785 136
903 3300048912 Ga0496109_0615121 Ga0496109_0615121_200_670 136
904 3300048912 Ga0496109_1015050 Ga0496109_1015050_17_427 136
905 3300048913 Ga0496110_0062072 Ga0496110_0062072_2277_2696 136
906 3300048915 Ga0496112_0623082 Ga0496112_0623082_486_956 136
907 3300048916 Ga0496113_0959534 Ga0496113_0959534_85_510 136
908 3300048917 Ga0496114_1026635 Ga0496114_1026635_72_491 136
909 3300048918 Ga0496115_0124505 Ga0496115_0124505_1135_1560 136
910 3300048918 Ga0496115_0130462 Ga0496115_0130462_902_1327 136
911 3300048922 Ga0496119_0250072 Ga0496119_0250072_190_609 136
912 3300048923 Ga0496120_0279265 Ga0496120_0279265_22_432 136
913 3300048929 Ga0496126_0009992 Ga0496126_0009992_8276_8686 136
914 3300048929 Ga0496126_0015586 Ga0496126_0015586_3196_3615 136
915 3300049574 Ga0501038_0091426 Ga0501038_0091426_773_1183 136
916 3300049581 Ga0501047_0084069 Ga0501047_0084069_2392_2802 136
917 3300049586 Ga0501070_1536464 Ga0501070_1536464_61_471 136
918 3300049589 Ga0501073_0491743 Ga0501073_0491743_61_471 136
919 3300049823 Ga0501044_0123737 Ga0501044_0123737_284_694 136
920 3300053077 Ga0495601_0105045 Ga0495601_0105045_893_1318 136
921 3300053077 Ga0495601_0192541 Ga0495601_0192541_543_962 136
922 3300053085 Ga0495619_0057510 Ga0495619_0057510_1725_2150 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

140

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9638 2 135
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.963 2 135
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9432 2 135
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9424 2 135
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.9361 2 135
ID Description Score Start End Superfamily
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9535 2 135 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9361 2 135 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9267 1 134 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9195 2 135 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9186 1 134 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A372ISJ7-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 1.002 1 135 GO:0046872
GO:0070497
AF-A0A1H4JCJ5-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 1.001 1 135 GO:0046872
GO:0070497
AF-A0A372ISJ7-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9943 1 135 GO:0046872
GO:0070497
AF-A0A383CQG5-F1-model_v4 6-pyruvoyltetrahydropterin synthase 0.9901 1 87 GO:0016829
GO:0046872
AF-A0A846PD74-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.99 1 136 GO:0016829
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.97 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map