F485803

General Info

Members Datasets Scaffolds Average Seq Length
922 360 922 395

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1784820|Ga0436365_1784820_14_1279
Length 421
Sequence LLSPALFSGGVVPIYHTLGQVPRKRHTAMRKADGGVYAEQLMGHEGFTGTSSLLYHVHQPTTVQSVRRVRELVWEADDDATLKHRHFRTSQARAGGSPTLDRTPLLFNADIGMLYVEPDEQDAHFYRNAQADEVVYVAKGKGVLETQFGDLPYRDGDYVVIHRGIMHRWRLDKASPQKFVVFESRGHVRWPKRYRNEFGQLVEGAPYSERDIRRPMELKTHDEMGDFPILVKQYDGLNELVLDHHPFDVVGWDGYFYPWIFNIHDFEPIVGRVHQPPPVHQTFQGDGFVICSFCPRPYDFDPNAIPAPYNHSNVDSDEVLYYASEEFMSRKGIEFGSVTHHPDGIPHGPHPGRYEASIGQKFTNELAVMMDSFRPLKVAKAATTIEDPSYHRSWIEAQHERVSAQKSGAPNAGGPALPLTD

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
222 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
315 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
316 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
317 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
318 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
319 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
320 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
321 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
322 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
323 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
324 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
325 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
326 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
327 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
333 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
334 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
335 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
336 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
337 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
353 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
354 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 4.01
Rhizosphere 94.69
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10044833 3300004799 Bacteria 3477
2 Ga0058862_12681691 3300004803 Bacteria 2756
3 Ga0065704_10112978 3300005289 Bacteria 1922
4 Ga0065712_10068461 3300005290 Bacteria 10472
5 Ga0065712_10087269 3300005290 Bacteria 2588
6 Ga0065712_10155362 3300005290 Bacteria 1339
7 Ga0065715_10001248 3300005293 Bacteria 12812
8 Ga0065707_10007385 3300005295 Bacteria 2621
9 Ga0065707_10085732 3300005295 Bacteria 5923
10 Ga0065707_10147578 3300005295 Bacteria 1696
11 Ga0070658_10007500 3300005327 Bacteria 8802
12 Ga0070658_10013583 3300005327 Bacteria 6533
13 Ga0070658_10118707 3300005327 Bacteria 2196
14 Ga0070658_10210928 3300005327 Bacteria 1641
15 Ga0070676_10001729 3300005328 Bacteria 11110
16 Ga0070676_10025287 3300005328 Bacteria 3354
17 Ga0070683_100000506 3300005329 Bacteria 27303
18 Ga0070683_100004796 3300005329 Bacteria 11190
19 Ga0070683_100026723 3300005329 Bacteria 5201
20 Ga0070683_100090149 3300005329 Bacteria 2878
21 Ga0070683_100097740 3300005329 Bacteria 2762
22 Ga0070683_100364290 3300005329 Unclassified 1377
23 Ga0070690_100011022 3300005330 Bacteria 5279
24 Ga0070670_100014299 3300005331 Bacteria 6810
25 Ga0070670_100045579 3300005331 Bacteria 3770
26 Ga0070677_10016654 3300005333 Bacteria 2620
27 Ga0068869_100007356 3300005334 Bacteria 7028
28 Ga0068869_100027937 3300005334 Bacteria 3937
29 Ga0070680_100001150 3300005336 Bacteria 18989
30 Ga0070680_100002220 3300005336 Bacteria 14321
31 Ga0070680_100015762 3300005336 Bacteria 5934
32 Ga0070680_100109013 3300005336 Bacteria 2304
33 Ga0070680_100177268 3300005336 Bacteria 1794
34 Ga0070680_100187638 3300005336 Bacteria 1742
35 Ga0070680_100246993 3300005336 Bacteria 1509
36 Ga0070682_100001803 3300005337 Bacteria 11960
37 Ga0068868_100041382 3300005338 Bacteria 3590
38 Ga0070660_100006566 3300005339 Bacteria 8071
39 Ga0070660_100009811 3300005339 Bacteria 6749
40 Ga0070660_100052733 3300005339 Bacteria 3136
41 Ga0070660_100054075 3300005339 Bacteria 3098
42 Ga0070660_100071160 3300005339 Bacteria 2715
43 Ga0070660_100227058 3300005339 Bacteria 1519
44 Ga0070689_100023013 3300005340 Bacteria 4659
45 Ga0070689_100043232 3300005340 Bacteria 3462
46 Ga0070689_100091258 3300005340 Bacteria 2401
47 Ga0070691_10003961 3300005341 Bacteria 6701
48 Ga0070661_100013735 3300005344 Bacteria 5688
49 Ga0070692_10006257 3300005345 Bacteria 5157
50 Ga0070692_10025337 3300005345 Bacteria 2922
51 Ga0070668_100001256 3300005347 Bacteria 18100
52 Ga0070668_100059097 3300005347 Bacteria 2967
53 Ga0070669_100061421 3300005353 Bacteria 2761
54 Ga0070669_100107514 3300005353 Bacteria 2113
55 Ga0070675_100004386 3300005354 Bacteria 10764
56 Ga0070675_100060255 3300005354 Bacteria 3133
57 Ga0070675_100305732 3300005354 Unclassified 1402
58 Ga0070671_100014034 3300005355 Bacteria 6468
59 Ga0070671_100034859 3300005355 Bacteria 4167
60 Ga0070671_100042215 3300005355 Bacteria 3791
61 Ga0070674_100002002 3300005356 Bacteria 11153
62 Ga0070674_100031297 3300005356 Bacteria 3525
63 Ga0070673_100024811 3300005364 Bacteria 4402
64 Ga0070673_100032333 3300005364 Unclassified 3938
65 Ga0070688_100001194 3300005365 Bacteria 12918
66 Ga0070688_100033411 3300005365 Bacteria 3109
67 Ga0070659_100006082 3300005366 Bacteria 8705
68 Ga0070659_100055898 3300005366 Bacteria 3112
69 Ga0070659_100101459 3300005366 Bacteria 2316
70 Ga0070659_100131520 3300005366 Bacteria 2033
71 Ga0070659_100179222 3300005366 Bacteria 1738
72 Ga0070667_100005119 3300005367 Bacteria 10974
73 Ga0070667_100172753 3300005367 Bacteria 1909
74 Ga0070667_100231787 3300005367 Bacteria 1647
75 Ga0070709_10026893 3300005434 Bacteria 3415
76 Ga0070714_100001589 3300005435 Bacteria 16510
77 Ga0070714_100035823 3300005435 Bacteria 4160
78 Ga0070714_100043001 3300005435 Bacteria 3818
79 Ga0070713_100000223 3300005436 Bacteria 37729
80 Ga0070701_10027207 3300005438 Bacteria 2799
81 Ga0070701_10041833 3300005438 Bacteria 2336
82 Ga0070711_100077594 3300005439 Bacteria 2358
83 Ga0070711_100103447 3300005439 Bacteria 2075
84 Ga0070700_100024511 3300005441 Bacteria 3544
85 Ga0070694_100070776 3300005444 Bacteria 2403
86 Ga0070694_100127571 3300005444 Bacteria 1833
87 Ga0070694_100154517 3300005444 Bacteria 1679
88 Ga0070708_100000007 3300005445 Bacteria 146443
89 Ga0070708_100030039 3300005445 Bacteria 4693
90 Ga0070708_100030224 3300005445 Bacteria 4682
91 Ga0070708_100109496 3300005445 Bacteria 2538
92 Ga0070678_100054667 3300005456 Bacteria 2911
93 Ga0070662_100005443 3300005457 Bacteria 8132
94 Ga0070681_10000978 3300005458 Bacteria 24153
95 Ga0070681_10001876 3300005458 Bacteria 18970
96 Ga0070681_10016210 3300005458 Bacteria 7431
97 Ga0070681_10016523 3300005458 Bacteria 7370
98 Ga0070681_10027504 3300005458 Bacteria 5717
99 Ga0070681_10035919 3300005458 Bacteria 4978
100 Ga0070681_10038262 3300005458 Bacteria 4810
101 Ga0070681_10065418 3300005458 Bacteria 3604
102 Ga0070681_10093955 3300005458 Bacteria 2948
103 Ga0070681_10194808 3300005458 Bacteria 1946
104 Ga0070681_10264515 3300005458 Bacteria 1632
105 Ga0068867_100037723 3300005459 Bacteria 3514
106 Ga0068867_100053382 3300005459 Bacteria 2985
107 Ga0068867_100054180 3300005459 Bacteria 2963
108 Ga0070685_10007599 3300005466 Bacteria 5546
109 Ga0070706_100036892 3300005467 Bacteria 4515
110 Ga0070707_100001546 3300005468 Bacteria 22369
111 Ga0070707_100026308 3300005468 Bacteria 5524
112 Ga0070707_100029839 3300005468 Bacteria 5190
113 Ga0070707_100036399 3300005468 Bacteria 4696
114 Ga0070707_100151413 3300005468 Bacteria 2259
115 Ga0070698_100000304 3300005471 Bacteria 50155
116 Ga0070698_100016906 3300005471 Bacteria 7693
117 Ga0070698_100017768 3300005471 Bacteria 7491
118 Ga0070698_100091070 3300005471 Bacteria 3032
119 Ga0070699_100085936 3300005518 Bacteria 2745
120 Ga0070699_100087671 3300005518 Bacteria 2717
121 Ga0070699_100093379 3300005518 Bacteria 2633
122 Ga0070699_100134093 3300005518 Bacteria 2184
123 Ga0070679_100007387 3300005530 Bacteria 10270
124 Ga0070679_100011988 3300005530 Bacteria 8275
125 Ga0070679_100015830 3300005530 Bacteria 7256
126 Ga0070679_100020198 3300005530 Bacteria 6493
127 Ga0070679_100026564 3300005530 Bacteria 5691
128 Ga0070679_100054355 3300005530 Bacteria 3986
129 Ga0070679_100099059 3300005530 Bacteria 2902
130 Ga0070679_100104869 3300005530 Bacteria 2813
131 Ga0070679_100236446 3300005530 Bacteria 1786
132 Ga0070684_100000532 3300005535 Bacteria 26110
133 Ga0070684_100003959 3300005535 Bacteria 11219
134 Ga0070684_100006038 3300005535 Bacteria 9333
135 Ga0070684_100014509 3300005535 Bacteria 6386
136 Ga0070684_100015321 3300005535 Bacteria 6239
137 Ga0070684_100142317 3300005535 Bacteria 2169
138 Ga0070684_100158616 3300005535 Bacteria 2052
139 Ga0070684_100255519 3300005535 Bacteria 1602
140 Ga0070697_100028334 3300005536 Bacteria 4484
141 Ga0070697_100075136 3300005536 Bacteria 2777
142 Ga0068853_100014834 3300005539 Bacteria 6398
143 Ga0070672_100008586 3300005543 Bacteria 6997
144 Ga0070672_100010531 3300005543 Bacteria 6418
145 Ga0070672_100092229 3300005543 Bacteria 2445
146 Ga0070686_100016804 3300005544 Bacteria 4262
147 Ga0070696_100000366 3300005546 Bacteria 27619
148 Ga0070696_100000824 3300005546 Bacteria 19978
149 Ga0070696_100004572 3300005546 Bacteria 9237
150 Ga0070696_100022348 3300005546 Bacteria 4296
151 Ga0070696_100101642 3300005546 Bacteria 2061
152 Ga0070693_100002493 3300005547 Bacteria 8483
153 Ga0070693_100122508 3300005547 Bacteria 1614
154 Ga0070665_100030040 3300005548 Bacteria 5469
155 Ga0070665_100037055 3300005548 Bacteria 4904
156 Ga0070665_100211391 3300005548 Bacteria 1941
157 Ga0070704_100008321 3300005549 Bacteria 6214
158 Ga0068855_100061263 3300005563 Bacteria 4397
159 Ga0068855_100068640 3300005563 Bacteria 4126
160 Ga0068855_100209375 3300005563 Bacteria 2192
161 Ga0070664_100026278 3300005564 Bacteria 4828
162 Ga0070664_100097643 3300005564 Bacteria 2551
163 Ga0068857_100007819 3300005577 Bacteria 9218
164 Ga0068857_100019015 3300005577 Bacteria 6027
165 Ga0068857_100042460 3300005577 Bacteria 4035
166 Ga0068857_100050761 3300005577 Bacteria 3679
167 Ga0068854_100015847 3300005578 Bacteria 5008
168 Ga0068856_100237183 3300005614 Bacteria 1839
169 Ga0068856_100248510 3300005614 Bacteria 1794
170 Ga0068856_100279572 3300005614 Bacteria 1686
171 Ga0070702_100095839 3300005615 Bacteria 1809
172 Ga0068859_100007707 3300005617 Bacteria 10932
173 Ga0068859_100080324 3300005617 Bacteria 3302
174 Ga0068859_100162246 3300005617 Bacteria 2314
175 Ga0068859_100341696 3300005617 Bacteria 1591
176 Ga0068864_100032756 3300005618 Bacteria 4417
177 Ga0068864_100041997 3300005618 Bacteria 3912
178 Ga0068864_100200477 3300005618 Bacteria 1833
179 Ga0068866_10014044 3300005718 Bacteria 3526
180 Ga0068861_100001399 3300005719 Bacteria 15155
181 Ga0068851_10025230 3300005834 Bacteria 2915
182 Ga0068870_10005763 3300005840 Bacteria 5429
183 Ga0068863_100039343 3300005841 Bacteria 4500
184 Ga0068863_100130271 3300005841 Bacteria 2401
185 Ga0068858_100035928 3300005842 Bacteria 4595
186 Ga0068860_100010585 3300005843 Bacteria 9110
187 Ga0068862_100003461 3300005844 Bacteria 13576
188 Ga0068862_100071909 3300005844 Bacteria 2987
189 Ga0068862_100221115 3300005844 Bacteria 1714
190 Ga0081455_10027499 3300005937 Bacteria 5212
191 Ga0081455_10218649 3300005937 Bacteria 1414
192 Ga0081538_10088963 3300005981 Bacteria 1605
193 Ga0081539_10000290 3300005985 Bacteria 113852
194 Ga0081539_10026740 3300005985 Bacteria 3671
195 Ga0081539_10038333 3300005985 Unclassified 2841
196 Ga0070716_100011367 3300006173 Bacteria 4482
197 Ga0070712_100025778 3300006175 Bacteria 3911
198 Ga0070712_100095463 3300006175 Bacteria 2188
199 Ga0075367_10009362 3300006178 Bacteria 5116
200 Ga0075367_10025360 3300006178 Bacteria 3353
201 Ga0075367_10084254 3300006178 Bacteria 1927
202 Ga0097621_100012962 3300006237 Bacteria 6195
203 Ga0075370_10059486 3300006353 Unclassified 2175
204 Ga0068871_100082468 3300006358 Bacteria 2666
205 Ga0075428_100033303 3300006844 Bacteria 5690
206 Ga0075428_100037388 3300006844 Bacteria 5345
207 Ga0075428_100143933 3300006844 Bacteria 2591
208 Ga0075428_100173631 3300006844 Bacteria 2335
209 Ga0075430_100005544 3300006846 Bacteria 10658
210 Ga0075430_100018306 3300006846 Bacteria 5962
211 Ga0075430_100057193 3300006846 Bacteria 3281
212 Ga0075430_100072796 3300006846 Bacteria 2882
213 Ga0075431_100000825 3300006847 Bacteria 27053
214 Ga0075431_100130776 3300006847 Bacteria 2589
215 Ga0075431_100238536 3300006847 Bacteria 1850
216 Ga0075433_10069477 3300006852 Bacteria 3094
217 Ga0075433_10123858 3300006852 Bacteria 2296
218 Ga0075433_10176100 3300006852 Bacteria 1904
219 Ga0075434_100006320 3300006871 Bacteria 10860
220 Ga0075434_100026438 3300006871 Bacteria 5684
221 Ga0075434_100057505 3300006871 Bacteria 3865
222 Ga0075434_100071500 3300006871 Bacteria 3461
223 Ga0075434_100077810 3300006871 Bacteria 3312
224 Ga0075429_100002304 3300006880 Bacteria 16026
225 Ga0068865_100008155 3300006881 Bacteria 6465
226 Ga0068865_100017197 3300006881 Bacteria 4647
227 Ga0068865_100182146 3300006881 Bacteria 1618
228 Ga0075436_100035378 3300006914 Bacteria 3446
229 Ga0097620_100007707 3300006931 Bacteria 10932
230 Ga0097620_100080316 3300006931 Bacteria 3302
231 Ga0097620_100162221 3300006931 Bacteria 2314
232 Ga0097620_100341683 3300006931 Bacteria 1591
233 Ga0075435_100232064 3300007076 Bacteria 1568
234 Ga0075435_100241615 3300007076 Bacteria 1536
235 Ga0099795_10009855 3300007788 Bacteria 2788
236 Ga0105240_10229668 3300009093 Bacteria 2157
237 Ga0111539_10073804 3300009094 Bacteria 4021
238 Ga0111539_10155614 3300009094 Bacteria 2675
239 Ga0111539_10187877 3300009094 Bacteria 2412
240 Ga0111539_10248186 3300009094 Bacteria 2073
241 Ga0111539_10315906 3300009094 Bacteria 1818
242 Ga0111539_10500062 3300009094 Bacteria 1416
243 Ga0105245_10062376 3300009098 Bacteria 3363
244 Ga0105245_10114676 3300009098 Bacteria 2510
245 Ga0105245_10145948 3300009098 Bacteria 2232
246 Ga0105245_10298097 3300009098 Bacteria 1581
247 Ga0105245_10305719 3300009098 Bacteria 1562
248 Ga0114129_10001902 3300009147 Bacteria 28442
249 Ga0114129_10004330 3300009147 Bacteria 20068
250 Ga0114129_10006598 3300009147 Bacteria 16471
251 Ga0114129_10018551 3300009147 Bacteria 9906
252 Ga0114129_10036775 3300009147 Bacteria 6913
253 Ga0114129_10038801 3300009147 Bacteria 6714
254 Ga0114129_10178696 3300009147 Bacteria 2889
255 Ga0114129_10335293 3300009147 Bacteria 2007
256 Ga0114129_10385035 3300009147 Bacteria 1851
257 Ga0105243_10087572 3300009148 Bacteria 2557
258 Ga0105243_10351424 3300009148 Bacteria 1354
259 Ga0105241_10000050 3300009174 Bacteria 95122
260 Ga0105241_10150396 3300009174 Bacteria 1904
261 Ga0105241_10236463 3300009174 Bacteria 1542
262 Ga0105242_10004361 3300009176 Bacteria 11010
263 Ga0105242_10064719 3300009176 Bacteria 3015
264 Ga0105242_10145674 3300009176 Bacteria 2060
265 Ga0105242_10174504 3300009176 Bacteria 1891
266 Ga0105248_10013902 3300009177 Bacteria 8857
267 Ga0105248_10014499 3300009177 Bacteria 8676
268 Ga0105248_10036692 3300009177 Bacteria 5482
269 Ga0105248_10077842 3300009177 Bacteria 3728
270 Ga0105248_10107543 3300009177 Bacteria 3145
271 Ga0105248_10110041 3300009177 Bacteria 3106
272 Ga0105248_10294906 3300009177 Bacteria 1826
273 Ga0105248_10309276 3300009177 Bacteria 1780
274 Ga0105248_10320811 3300009177 Bacteria 1745
275 Ga0105237_10093750 3300009545 Bacteria 2991
276 Ga0105237_10138912 3300009545 Bacteria 2424
277 Ga0105238_10031538 3300009551 Bacteria 5396
278 Ga0105238_10225284 3300009551 Bacteria 1851
279 Ga0105249_10001395 3300009553 Bacteria 21132
280 Ga0105249_10002382 3300009553 Bacteria 16317
281 Ga0105249_10024865 3300009553 Bacteria 5387
282 Ga0105249_10170406 3300009553 Bacteria 2110
283 Ga0099796_10007713 3300010159 Bacteria 2827
284 Ga0105239_10017961 3300010375 Bacteria 7822
285 Ga0105239_10036411 3300010375 Bacteria 5402
286 Ga0105239_10038711 3300010375 Bacteria 5225
287 Ga0105239_10242297 3300010375 Bacteria 2024
288 Ga0105246_10004459 3300011119 Bacteria 8522
289 Ga0157373_10021800 3300013100 Bacteria 4648
290 Ga0157370_10002257 3300013104 Bacteria 23417
291 Ga0157370_10158501 3300013104 Bacteria 2106
292 Ga0157369_10000703 3300013105 Bacteria 43189
293 Ga0157369_10104405 3300013105 Bacteria 3017
294 Ga0157369_10153156 3300013105 Bacteria 2436
295 Ga0157378_10005920 3300013297 Bacteria 10713
296 Ga0163162_10004539 3300013306 Bacteria 13375
297 Ga0163162_10041311 3300013306 Bacteria 4614
298 Ga0163162_10081707 3300013306 Bacteria 3302
299 Ga0163162_10088110 3300013306 Bacteria 3183
300 Ga0163162_10110140 3300013306 Bacteria 2851
301 Ga0163162_10162081 3300013306 Bacteria 2358
302 Ga0163162_10416745 3300013306 Bacteria 1475
303 Ga0157372_10006571 3300013307 Bacteria 12373
304 Ga0157372_10012150 3300013307 Bacteria 9172
305 Ga0157372_10014410 3300013307 Bacteria 8456
306 Ga0157372_10026080 3300013307 Bacteria 6358
307 Ga0157372_10028311 3300013307 Bacteria 6115
308 Ga0157372_10059881 3300013307 Bacteria 4261
309 Ga0157372_10060145 3300013307 Bacteria 4251
310 Ga0157372_10100853 3300013307 Bacteria 3295
311 Ga0157372_10234355 3300013307 Bacteria 2129
312 Ga0157372_10481477 3300013307 Bacteria 1447
313 Ga0157375_10016669 3300013308 Bacteria 6608
314 Ga0157375_10063176 3300013308 Bacteria 3682
315 Ga0157375_10148606 3300013308 Bacteria 2476
316 Ga0157375_10151762 3300013308 Bacteria 2453
317 Ga0157375_10277758 3300013308 Bacteria 1838
318 Ga0157375_10508599 3300013308 Bacteria 1368
319 Ga0163163_10049135 3300014325 Bacteria 4150
320 Ga0163163_10248393 3300014325 Bacteria 1830
321 Ga0157380_10002276 3300014326 Bacteria 12905
322 Ga0157380_10011979 3300014326 Bacteria 6274
323 Ga0157377_10024661 3300014745 Bacteria 3199
324 Ga0157379_10061745 3300014968 Bacteria 3351
325 Ga0157379_10086168 3300014968 Bacteria 2816
326 Ga0157379_10233051 3300014968 Bacteria 1669
327 Ga0157376_10034816 3300014969 Bacteria 4069
328 Ga0157376_10215033 3300014969 Bacteria 1777
329 Ga0157376_10240300 3300014969 Bacteria 1687
330 Ga0163161_10090582 3300017792 Bacteria 2263
331 Ga0163161_10163396 3300017792 Bacteria 1699
332 Ga0206356_11274886 3300020070 Bacteria 3315
333 Ga0213876_10010769 3300021384 Bacteria 4901
334 Ga0207697_10003283 3300025315 Bacteria 8041
335 Ga0207656_10042204 3300025321 Bacteria 1940
336 Ga0207642_10010217 3300025899 Bacteria 3297
337 Ga0207688_10014055 3300025901 Bacteria 4353
338 Ga0207688_10090047 3300025901 Bacteria 1761
339 Ga0207680_10087969 3300025903 Bacteria 1968
340 Ga0207647_10033949 3300025904 Bacteria 3261
341 Ga0207699_10075953 3300025906 Bacteria 2068
342 Ga0207699_10094264 3300025906 Bacteria 1885
343 Ga0207645_10000203 3300025907 Bacteria 48457
344 Ga0207645_10041414 3300025907 Bacteria 2948
345 Ga0207645_10123777 3300025907 Bacteria 1680
346 Ga0207643_10007454 3300025908 Bacteria 5872
347 Ga0207643_10014845 3300025908 Bacteria 4235
348 Ga0207643_10075917 3300025908 Bacteria 1940
349 Ga0207705_10000772 3300025909 Bacteria 26312
350 Ga0207705_10029065 3300025909 Bacteria 3942
351 Ga0207684_10030486 3300025910 Bacteria 4590
352 Ga0207684_10136243 3300025910 Bacteria 2108
353 Ga0207654_10000482 3300025911 Bacteria 22772
354 Ga0207707_10003701 3300025912 Bacteria 13550
355 Ga0207707_10016312 3300025912 Bacteria 6479
356 Ga0207707_10020807 3300025912 Bacteria 5731
357 Ga0207707_10021064 3300025912 Bacteria 5696
358 Ga0207707_10025112 3300025912 Bacteria 5212
359 Ga0207707_10076140 3300025912 Bacteria 2928
360 Ga0207707_10148080 3300025912 Bacteria 2052
361 Ga0207695_10047168 3300025913 Bacteria 4562
362 Ga0207695_10150376 3300025913 Bacteria 2268
363 Ga0207693_10043614 3300025915 Bacteria 3528
364 Ga0207693_10150039 3300025915 Bacteria 1833
365 Ga0207663_10053600 3300025916 Bacteria 2521
366 Ga0207663_10058928 3300025916 Bacteria 2426
367 Ga0207663_10080454 3300025916 Bacteria 2130
368 Ga0207663_10192157 3300025916 Bacteria 1466
369 Ga0207660_10001029 3300025917 Bacteria 18463
370 Ga0207660_10012858 3300025917 Bacteria 5481
371 Ga0207660_10070167 3300025917 Bacteria 2546
372 Ga0207660_10086151 3300025917 Bacteria 2319
373 Ga0207660_10268349 3300025917 Bacteria 1351
374 Ga0207662_10003049 3300025918 Bacteria 8550
375 Ga0207662_10010835 3300025918 Bacteria 5039
376 Ga0207662_10013467 3300025918 Bacteria 4574
377 Ga0207662_10020139 3300025918 Bacteria 3805
378 Ga0207657_10005682 3300025919 Bacteria 13012
379 Ga0207657_10013961 3300025919 Bacteria 7858
380 Ga0207657_10039831 3300025919 Bacteria 4171
381 Ga0207657_10040913 3300025919 Bacteria 4103
382 Ga0207657_10081718 3300025919 Bacteria 2713
383 Ga0207657_10137201 3300025919 Bacteria 2001
384 Ga0207657_10200205 3300025919 Bacteria 1607
385 Ga0207652_10008351 3300025921 Bacteria 8328
386 Ga0207652_10015274 3300025921 Bacteria 6233
387 Ga0207652_10020240 3300025921 Bacteria 5477
388 Ga0207652_10061155 3300025921 Bacteria 3251
389 Ga0207652_10195138 3300025921 Bacteria 1821
390 Ga0207646_10003329 3300025922 Bacteria 18270
391 Ga0207681_10006835 3300025923 Bacteria 6998
392 Ga0207681_10011214 3300025923 Bacteria 5504
393 Ga0207681_10015976 3300025923 Bacteria 4689
394 Ga0207681_10036254 3300025923 Bacteria 3253
395 Ga0207681_10140363 3300025923 Bacteria 1799
396 Ga0207681_10190537 3300025923 Bacteria 1569
397 Ga0207694_10026287 3300025924 Bacteria 4427
398 Ga0207650_10015045 3300025925 Bacteria 5382
399 Ga0207650_10079944 3300025925 Bacteria 2477
400 Ga0207659_10002780 3300025926 Bacteria 10441
401 Ga0207659_10041529 3300025926 Bacteria 3221
402 Ga0207659_10118629 3300025926 Bacteria 2024
403 Ga0207700_10000633 3300025928 Bacteria 20583
404 Ga0207664_10009762 3300025929 Bacteria 6751
405 Ga0207664_10032021 3300025929 Bacteria 4028
406 Ga0207664_10052560 3300025929 Bacteria 3223
407 Ga0207664_10206374 3300025929 Bacteria 1698
408 Ga0207644_10029906 3300025931 Bacteria 3782
409 Ga0207690_10013782 3300025932 Bacteria 4867
410 Ga0207690_10023216 3300025932 Bacteria 3869
411 Ga0207690_10058650 3300025932 Bacteria 2604
412 Ga0207690_10078522 3300025932 Bacteria 2298
413 Ga0207690_10099354 3300025932 Bacteria 2075
414 Ga0207706_10001427 3300025933 Bacteria 23910
415 Ga0207706_10005277 3300025933 Bacteria 12051
416 Ga0207706_10017143 3300025933 Bacteria 6531
417 Ga0207706_10280857 3300025933 Bacteria 1452
418 Ga0207686_10024071 3300025934 Bacteria 3523
419 Ga0207709_10095522 3300025935 Bacteria 1953
420 Ga0207669_10023012 3300025937 Bacteria 3320
421 Ga0207704_10020086 3300025938 Bacteria 3525
422 Ga0207704_10039326 3300025938 Bacteria 2753
423 Ga0207665_10005720 3300025939 Bacteria 8279
424 Ga0207691_10003767 3300025940 Bacteria 14725
425 Ga0207691_10005100 3300025940 Bacteria 12672
426 Ga0207691_10034713 3300025940 Bacteria 4689
427 Ga0207691_10057744 3300025940 Bacteria 3531
428 Ga0207691_10108619 3300025940 Bacteria 2469
429 Ga0207691_10121497 3300025940 Bacteria 2314
430 Ga0207711_10035232 3300025941 Bacteria 4242
431 Ga0207711_10078595 3300025941 Bacteria 2878
432 Ga0207711_10154094 3300025941 Bacteria 2075
433 Ga0207711_10230850 3300025941 Bacteria 1695
434 Ga0207689_10002072 3300025942 Bacteria 18927
435 Ga0207689_10004964 3300025942 Bacteria 11983
436 Ga0207661_10001605 3300025944 Bacteria 15380
437 Ga0207661_10006778 3300025944 Bacteria 8110
438 Ga0207661_10016943 3300025944 Bacteria 5382
439 Ga0207661_10043299 3300025944 Bacteria 3553
440 Ga0207661_10142790 3300025944 Bacteria 2062
441 Ga0207661_10157345 3300025944 Bacteria 1969
442 Ga0207679_10017014 3300025945 Bacteria 4837
443 Ga0207679_10019179 3300025945 Bacteria 4592
444 Ga0207667_10036553 3300025949 Bacteria 5263
445 Ga0207667_10060764 3300025949 Bacteria 3955
446 Ga0207667_10079459 3300025949 Bacteria 3399
447 Ga0207667_10131050 3300025949 Bacteria 2582
448 Ga0207667_10186358 3300025949 Bacteria 2130
449 Ga0207651_10022450 3300025960 Unclassified 3859
450 Ga0207651_10045920 3300025960 Bacteria 2933
451 Ga0207651_10073134 3300025960 Bacteria 2436
452 Ga0207651_10079602 3300025960 Bacteria 2355
453 Ga0207651_10161934 3300025960 Bacteria 1755
454 Ga0207712_10019275 3300025961 Bacteria 4454
455 Ga0207712_10030495 3300025961 Bacteria 3626
456 Ga0207712_10267604 3300025961 Bacteria 1389
457 Ga0207668_10004208 3300025972 Bacteria 8435
458 Ga0207668_10075221 3300025972 Bacteria 2427
459 Ga0207668_10118421 3300025972 Bacteria 2001
460 Ga0207640_10090896 3300025981 Bacteria 2113
461 Ga0207658_10071854 3300025986 Bacteria 2622
462 Ga0207677_10170257 3300026023 Bacteria 1702
463 Ga0207703_10035822 3300026035 Bacteria 3946
464 Ga0207678_10009416 3300026067 Bacteria 8594
465 Ga0207678_10048061 3300026067 Bacteria 3689
466 Ga0207708_10068592 3300026075 Bacteria 2714
467 Ga0207708_10084624 3300026075 Bacteria 2439
468 Ga0207708_10110984 3300026075 Bacteria 2128
469 Ga0207702_10009373 3300026078 Bacteria 8220
470 Ga0207702_10125561 3300026078 Bacteria 2303
471 Ga0207702_10241636 3300026078 Bacteria 1692
472 Ga0207641_10036965 3300026088 Bacteria 4077
473 Ga0207648_10016956 3300026089 Bacteria 6637
474 Ga0207648_10047220 3300026089 Bacteria 3775
475 Ga0207648_10062016 3300026089 Bacteria 3260
476 Ga0207648_10082606 3300026089 Bacteria 2802
477 Ga0207648_10130704 3300026089 Bacteria 2210
478 Ga0207648_10172456 3300026089 Bacteria 1913
479 Ga0207648_10341575 3300026089 Bacteria 1348
480 Ga0207676_10021319 3300026095 Bacteria 4754
481 Ga0207676_10026664 3300026095 Bacteria 4297
482 Ga0207676_10060304 3300026095 Bacteria 3000
483 Ga0207674_10000548 3300026116 Bacteria 49225
484 Ga0207674_10006791 3300026116 Bacteria 13425
485 Ga0207674_10029472 3300026116 Bacteria 5778
486 Ga0207674_10030455 3300026116 Bacteria 5672
487 Ga0207674_10145927 3300026116 Bacteria 2325
488 Ga0207674_10175426 3300026116 Bacteria 2096
489 Ga0207675_100004371 3300026118 Bacteria 13659
490 Ga0207675_100012918 3300026118 Bacteria 7797
491 Ga0207675_100142424 3300026118 Bacteria 2278
492 Ga0207683_10010379 3300026121 Bacteria 7946
493 Ga0207683_10074787 3300026121 Bacteria 2998
494 Ga0207683_10185328 3300026121 Bacteria 1888
495 Ga0207698_10113617 3300026142 Bacteria 2276
496 Ga0207698_10128839 3300026142 Bacteria 2158
497 Ga0207698_10156592 3300026142 Bacteria 1986
498 Ga0209968_1003659 3300027526 Bacteria 2304
499 Ga0209999_1003194 3300027543 Bacteria 2924
500 Ga0209971_1003303 3300027682 Bacteria 3833
501 Ga0209971_1008991 3300027682 Bacteria 2370
502 Ga0209971_1015199 3300027682 Bacteria 1824
503 Ga0209998_10024192 3300027717 Bacteria 1316
504 Ga0209974_10019510 3300027876 Bacteria 2248
505 Ga0209974_10034082 3300027876 Bacteria 1690
506 Ga0207428_10170192 3300027907 Bacteria 1650
507 Ga0268266_10103390 3300028379 Bacteria 2514
508 Ga0268265_10002887 3300028380 Bacteria 12619
509 Ga0268265_10068941 3300028380 Bacteria 2745
510 Ga0268264_10001217 3300028381 Bacteria 24741
511 Ga0268264_10095681 3300028381 Bacteria 2570
512 Ga0265340_10030526 3300031247 Bacteria 2701
513 Ga0307408_100000777 3300031548 Bacteria 25671
514 Ga0307408_100030129 3300031548 Bacteria 3766
515 Ga0307408_100166013 3300031548 Bacteria 1758
516 Ga0307408_100227783 3300031548 Bacteria 1524
517 Ga0265314_10024708 3300031711 Bacteria 4549
518 Ga0316576_10004090 3300031727 Bacteria 8693
519 Ga0316576_10043850 3300031727 Bacteria 3229
520 Ga0316578_10022388 3300031728 Bacteria 3523
521 Ga0316578_10181871 3300031728 Bacteria 1267
522 Ga0307405_10001938 3300031731 Bacteria 8926
523 Ga0307405_10003504 3300031731 Bacteria 7223
524 Ga0307405_10021160 3300031731 Bacteria 3652
525 Ga0307405_10041855 3300031731 Bacteria 2785
526 Ga0307405_10063028 3300031731 Bacteria 2350
527 Ga0316577_10001955 3300031733 Bacteria 9997
528 Ga0307413_10003160 3300031824 Bacteria 6877
529 Ga0307413_10029335 3300031824 Bacteria 3076
530 Ga0307413_10046486 3300031824 Bacteria 2581
531 Ga0307413_10120817 3300031824 Bacteria 1774
532 Ga0307413_10189684 3300031824 Bacteria 1474
533 Ga0307410_10000624 3300031852 Bacteria 14594
534 Ga0307410_10015033 3300031852 Bacteria 4577
535 Ga0307410_10032618 3300031852 Bacteria 3354
536 Ga0307410_10035531 3300031852 Bacteria 3237
537 Ga0307410_10037181 3300031852 Bacteria 3177
538 Ga0307410_10047216 3300031852 Bacteria 2877
539 Ga0307410_10049335 3300031852 Bacteria 2825
540 Ga0307410_10073931 3300031852 Bacteria 2372
541 Ga0307410_10105352 3300031852 Bacteria 2030
542 Ga0307406_10003417 3300031901 Bacteria 8650
543 Ga0307406_10036579 3300031901 Bacteria 3026
544 Ga0307406_10042025 3300031901 Bacteria 2852
545 Ga0307406_10046624 3300031901 Bacteria 2728
546 Ga0307406_10066057 3300031901 Bacteria 2353
547 Ga0307406_10067054 3300031901 Bacteria 2338
548 Ga0307406_10267678 3300031901 Bacteria 1296
549 Ga0307407_10000215 3300031903 Bacteria 17494
550 Ga0307407_10006344 3300031903 Bacteria 5240
551 Ga0307407_10009125 3300031903 Bacteria 4602
552 Ga0307407_10011201 3300031903 Bacteria 4257
553 Ga0307407_10025119 3300031903 Bacteria 3136
554 Ga0307407_10029111 3300031903 Bacteria 2962
555 Ga0307407_10031145 3300031903 Bacteria 2886
556 Ga0307407_10148971 3300031903 Bacteria 1518
557 Ga0307412_10087544 3300031911 Bacteria 2170
558 Ga0307412_10161126 3300031911 Bacteria 1667
559 Ga0307409_100000657 3300031995 Bacteria 15306
560 Ga0307409_100005431 3300031995 Bacteria 7335
561 Ga0307409_100063198 3300031995 Bacteria 2902
562 Ga0307409_100068741 3300031995 Bacteria 2803
563 Ga0307409_100089862 3300031995 Bacteria 2512
564 Ga0307409_100106901 3300031995 Bacteria 2337
565 Ga0307409_100114409 3300031995 Bacteria 2270
566 Ga0307409_100123248 3300031995 Bacteria 2199
567 Ga0307409_100140614 3300031995 Bacteria 2079
568 Ga0307409_100197987 3300031995 Bacteria 1794
569 Ga0307409_100328508 3300031995 Bacteria 1434
570 Ga0307409_100332750 3300031995 Bacteria 1426
571 Ga0307416_100000226 3300032002 Bacteria 29922
572 Ga0307416_100012079 3300032002 Bacteria 5799
573 Ga0307416_100012828 3300032002 Bacteria 5668
574 Ga0307416_100072619 3300032002 Bacteria 2865
575 Ga0307416_100121873 3300032002 Bacteria 2326
576 Ga0307416_100123440 3300032002 Bacteria 2314
577 Ga0307416_100177210 3300032002 Bacteria 1993
578 Ga0307416_100218838 3300032002 Bacteria 1824
579 Ga0307414_10013736 3300032004 Bacteria 4830
580 Ga0307414_10039699 3300032004 Bacteria 3173
581 Ga0307414_10047904 3300032004 Bacteria 2945
582 Ga0307414_10150727 3300032004 Bacteria 1834
583 Ga0307411_10001007 3300032005 Bacteria 10869
584 Ga0307411_10026785 3300032005 Bacteria 3476
585 Ga0307411_10056730 3300032005 Bacteria 2583
586 Ga0307411_10064065 3300032005 Bacteria 2459
587 Ga0307411_10068954 3300032005 Bacteria 2386
588 Ga0307411_10082100 3300032005 Bacteria 2222
589 Ga0307411_10155778 3300032005 Bacteria 1704
590 Ga0307411_10207731 3300032005 Bacteria 1509
591 Ga0307411_10217962 3300032005 Bacteria 1478
592 Ga0307415_100000602 3300032126 Bacteria 15746
593 Ga0307415_100012639 3300032126 Bacteria 4889
594 Ga0307415_100034014 3300032126 Bacteria 3313
595 Ga0307415_100051322 3300032126 Bacteria 2798
596 Ga0307415_100143166 3300032126 Bacteria 1829
597 Ga0307415_100150170 3300032126 Bacteria 1792
598 Ga0307415_100164152 3300032126 Bacteria 1725
599 Ga0307415_100171236 3300032126 Bacteria 1693
600 Ga0307415_100258219 3300032126 Bacteria 1420
601 Ga0373944_0001350 3300035089 Bacteria 6173
602 Ga0373956_0017747 3300035119 Bacteria 3005
603 Ga0373957_0044243 3300035120 Bacteria 1684
604 Ga0373943_0004041 3300035170 Bacteria 6672
605 Ga0373943_0028374 3300035170 Bacteria 2637
606 Ga0373943_0064689 3300035170 Bacteria 1837
607 Ga0373946_0010509 3300035171 Bacteria 3427
608 Ga0373955_0064029 3300035172 Bacteria 2037
609 Ga0373961_0018201 3300035241 Bacteria 1832
610 Ga0373924_0012365 3300035410 Bacteria 3188
611 Ga0373931_0127269 3300035691 Bacteria 1462
612 Ga0373931_0129736 3300035691 Bacteria 1450
613 Ga0373935_0084549 3300035692 Bacteria 2067
614 Ga0373927_0003399 3300035695 Bacteria 11447
615 Ga0373927_0008881 3300035695 Bacteria 6749
616 Ga0373933_0002172 3300035724 Bacteria 11228
617 Ga0373947_0000123 3300035725 Bacteria 39071
618 Ga0373947_0056991 3300035725 Bacteria 2363
619 Ga0373937_0024715 3300036401 Bacteria 5421
620 Ga0373937_0025310 3300036401 Bacteria 5357
621 Ga0373937_0095959 3300036401 Bacteria 2749
622 Ga0373937_0193017 3300036401 Bacteria 1914
623 Ga0316582_0002786 3300036647 Bacteria 8332
624 Ga0316584_0001769 3300036712 Bacteria 13290
625 Ga0373925_0000419 3300037068 Bacteria 43184
626 Ga0373925_0001690 3300037068 Bacteria 18555
627 Ga0373925_0115497 3300037068 Bacteria 2078
628 Ga0395899_0074662 3300037312 Bacteria 2477
629 Ga0395900_0047025 3300037418 Bacteria 4443
630 Ga0395900_0306746 3300037418 Unclassified 1572
631 Ga0395905_0054851 3300037471 Bacteria 3730
632 Ga0395905_0084769 3300037471 Bacteria 2969
633 Ga0395905_0208209 3300037471 Bacteria 1833
634 Ga0395901_0036042 3300038443 Bacteria 5111
635 Ga0242420_008901 3300038996 Bacteria 1638
636 Ga0436365_1410016 3300039437 Bacteria 5149
637 Ga0436365_1784820 3300039437 Bacteria 1420
638 Ga0450896_000471 3300042133 Bacteria 4172
639 Ga0439464_0057400 3300042439 Bacteria 1135
640 Ga0451577_0000005 3300042876 Bacteria 712599
641 Ga0451577_0036570 3300042876 Bacteria 4419
642 Ga0451577_0066903 3300042876 Unclassified 3204
643 Ga0453683_0072907 3300044673 Bacteria 2149
644 Ga0453683_0112401 3300044673 Bacteria 1713
645 Ga0466966_0086770 3300044684 Bacteria 1945
646 Ga0466959_0100461 3300045049 Bacteria 2071
647 Ga0466959_0110690 3300045049 Bacteria 1960
648 Ga0451576_0024257 3300045051 Bacteria 6553
649 Ga0451576_0066367 3300045051 Bacteria 3757
650 Ga0451576_0399997 3300045051 Bacteria 1440
651 Ga0466967_0048290 3300045976 Bacteria 3716
652 Ga0466967_0065164 3300045976 Bacteria 3242
653 Ga0495592_0034643 3300046454 Bacteria 3805
654 Ga0495592_0217349 3300046454 Bacteria 1280
655 Ga0495603_0010885 3300046455 Bacteria 5519
656 Ga0495603_0024609 3300046455 Bacteria 3642
657 Ga0495629_0007989 3300046459 Bacteria 7784
658 Ga0495629_0076455 3300046459 Bacteria 2338
659 Ga0495629_0076931 3300046459 Bacteria 2329
660 Ga0495629_0097417 3300046459 Bacteria 2052
661 Ga0495638_0040481 3300046460 Bacteria 2953
662 Ga0495651_0006822 3300046462 Bacteria 8722
663 Ga0495651_0020785 3300046462 Bacteria 5095
664 Ga0495651_0028761 3300046462 Bacteria 4331
665 Ga0495653_0004013 3300046463 Bacteria 11888
666 Ga0495653_0102397 3300046463 Bacteria 2072
667 Ga0495580_0000872 3300046472 Bacteria 26075
668 Ga0495580_0037719 3300046472 Bacteria 3466
669 Ga0495580_0058023 3300046472 Bacteria 2724
670 Ga0495582_0000388 3300046473 Bacteria 23923
671 Ga0495582_0033461 3300046473 Bacteria 2826
672 Ga0495582_0070374 3300046473 Bacteria 1935
673 Ga0495639_0000117 3300046475 Bacteria 40157
674 Ga0495639_0015918 3300046475 Bacteria 3261
675 Ga0495664_0020063 3300046477 Bacteria 3851
676 Ga0495594_0007118 3300046499 Bacteria 5754
677 Ga0495594_0012963 3300046499 Bacteria 4347
678 Ga0495594_0014285 3300046499 Bacteria 4156
679 Ga0495596_0037909 3300046500 Bacteria 1906
680 Ga0495608_0036480 3300046511 Bacteria 3310
681 Ga0495618_0067214 3300046514 Bacteria 2279
682 Ga0495618_0083113 3300046514 Bacteria 2046
683 Ga0495628_0027091 3300046516 Bacteria 4666
684 Ga0495630_0007914 3300046517 Bacteria 7623
685 Ga0495630_0092394 3300046517 Bacteria 2287
686 Ga0495630_0097933 3300046517 Bacteria 2218
687 Ga0495666_0012929 3300046526 Bacteria 4160
688 Ga0495652_0011768 3300046529 Bacteria 7905
689 Ga0495652_0022862 3300046529 Bacteria 5547
690 Ga0495665_0000362 3300046531 Bacteria 22903
691 Ga0495586_0004632 3300046535 Bacteria 7352
692 Ga0495586_0017841 3300046535 Bacteria 3776
693 Ga0495587_0001834 3300046536 Bacteria 14174
694 Ga0495587_0003085 3300046536 Bacteria 11130
695 Ga0495587_0005095 3300046536 Bacteria 8587
696 Ga0495587_0131896 3300046536 Bacteria 1428
697 Ga0495645_0002661 3300046543 Bacteria 12139
698 Ga0495645_0018448 3300046543 Bacteria 5010
699 Ga0495667_0010411 3300046559 Bacteria 6293
700 Ga0495667_0011841 3300046559 Bacteria 5909
701 Ga0495667_0037956 3300046559 Bacteria 3209
702 Ga0495634_0105490 3300046642 Bacteria 1817
703 Ga0495635_0022487 3300046663 Bacteria 4391
704 Ga0495635_0036000 3300046663 Bacteria 3432
705 Ga0495588_0007207 3300046674 Bacteria 5049
706 Ga0495588_0008939 3300046674 Bacteria 4612
707 Ga0495657_0003641 3300046675 Bacteria 12510
708 Ga0495657_0056374 3300046675 Bacteria 2617
709 Ga0495599_0003334 3300046678 Bacteria 9379
710 Ga0495599_0050452 3300046678 Bacteria 2607
711 Ga0495623_0009653 3300046679 Bacteria 6266
712 Ga0495623_0033095 3300046679 Bacteria 3318
713 Ga0495623_0063108 3300046679 Bacteria 2320
714 Ga0495646_0008083 3300046680 Bacteria 6687
715 Ga0495647_0003235 3300046681 Bacteria 5212
716 Ga0495658_0000095 3300046683 Bacteria 46039
717 Ga0495658_0055479 3300046683 Bacteria 2257
718 Ga0495613_0040549 3300046689 Bacteria 3450
719 Ga0495613_0044415 3300046689 Bacteria 3288
720 Ga0495613_0068611 3300046689 Bacteria 2586
721 Ga0495613_0226536 3300046689 Bacteria 1311
722 Ga0495600_0001787 3300046809 Bacteria 12024
723 Ga0495581_0000662 3300047315 Bacteria 18083
724 Ga0495581_0084229 3300047315 Bacteria 1842
725 Ga0495604_0120774 3300047317 Bacteria 1897
726 Ga0495674_0081175 3300047319 Bacteria 2782
727 Ga0495674_0081416 3300047319 Bacteria 2777
728 Ga0495674_0089153 3300047319 Bacteria 2637
729 Ga0495672_0016122 3300047320 Bacteria 5048
730 Ga0495672_0029516 3300047320 Bacteria 3453
731 Ga0495680_0027537 3300047322 Bacteria 4668
732 Ga0495680_0037480 3300047322 Bacteria 3883
733 Ga0495680_0085821 3300047322 Bacteria 2370
734 Ga0495684_0007844 3300047471 Bacteria 8261
735 Ga0495684_0010866 3300047471 Bacteria 7040
736 Ga0495684_0065305 3300047471 Bacteria 2766
737 Ga0495593_0013460 3300047673 Bacteria 4665
738 Ga0495593_0032872 3300047673 Bacteria 2827
739 Ga0495602_0003256 3300048088 Bacteria 16762
740 Ga0495602_0019139 3300048088 Bacteria 6809
741 Ga0495614_0000104 3300048089 Bacteria 28897
742 Ga0496103_0122742 3300048906 Bacteria 1656
743 Ga0496104_0002179 3300048907 Bacteria 16999
744 Ga0496104_0023962 3300048907 Bacteria 5614
745 Ga0496104_0045729 3300048907 Bacteria 4119
746 Ga0496105_0023253 3300048908 Bacteria 5026
747 Ga0496105_0077666 3300048908 Bacteria 2742
748 Ga0496106_0069033 3300048909 Bacteria 2697
749 Ga0496106_0093356 3300048909 Bacteria 2325
750 Ga0496108_0000799 3300048911 Bacteria 24565
751 Ga0496108_0000912 3300048911 Bacteria 22995
752 Ga0496108_0001419 3300048911 Bacteria 18887
753 Ga0496108_0052844 3300048911 Bacteria 3406
754 Ga0496108_0073271 3300048911 Bacteria 2891
755 Ga0496109_0000316 3300048912 Bacteria 45455
756 Ga0496109_0002146 3300048912 Bacteria 16401
757 Ga0496109_0003320 3300048912 Bacteria 13450
758 Ga0496109_0003739 3300048912 Bacteria 12719
759 Ga0496109_0171286 3300048912 Bacteria 2037
760 Ga0496110_0282850 3300048913 Bacteria 1510
761 Ga0496112_0000406 3300048915 Bacteria 28243
762 Ga0496112_0005001 3300048915 Bacteria 11373
763 Ga0496112_0005923 3300048915 Bacteria 10661
764 Ga0496112_0010713 3300048915 Bacteria 8334
765 Ga0496112_0021742 3300048915 Bacteria 6103
766 Ga0496112_0045567 3300048915 Bacteria 4299
767 Ga0496112_0112644 3300048915 Bacteria 2691
768 Ga0496112_0123619 3300048915 Bacteria 2559
769 Ga0496112_0147083 3300048915 Bacteria 2324
770 Ga0496113_0000919 3300048916 Bacteria 15572
771 Ga0496113_0001446 3300048916 Bacteria 13200
772 Ga0496113_0002607 3300048916 Bacteria 10546
773 Ga0496113_0004653 3300048916 Bacteria 8460
774 Ga0496114_0001537 3300048917 Bacteria 17479
775 Ga0496114_0023676 3300048917 Bacteria 5011
776 Ga0496115_0024238 3300048918 Bacteria 4714
777 Ga0496115_0030353 3300048918 Bacteria 4252
778 Ga0496115_0132684 3300048918 Bacteria 2053
779 Ga0501032_0165469 3300049569 Bacteria 1451
780 Ga0501033_0128168 3300049570 Bacteria 1839
781 Ga0501033_0131997 3300049570 Bacteria 1809
782 Ga0501034_0055921 3300049571 Bacteria 3971
783 Ga0501034_0085676 3300049571 Bacteria 3152
784 Ga0501034_0218232 3300049571 Bacteria 1860
785 Ga0501036_0039617 3300049572 Bacteria 3987
786 Ga0501036_0161162 3300049572 Bacteria 1891
787 Ga0501037_0111814 3300049573 Bacteria 1967
788 Ga0501038_0026378 3300049574 Bacteria 5175
789 Ga0501038_0207569 3300049574 Bacteria 1569
790 Ga0501038_0241455 3300049574 Bacteria 1434
791 Ga0501039_0017723 3300049575 Bacteria 5463
792 Ga0501039_0211671 3300049575 Bacteria 1524
793 Ga0501040_0022105 3300049576 Bacteria 4255
794 Ga0501043_0045483 3300049579 Bacteria 3453
795 Ga0501043_0046584 3300049579 Bacteria 3410
796 Ga0501043_0079879 3300049579 Bacteria 2570
797 Ga0501047_0013952 3300049581 Bacteria 7635
798 Ga0501047_0059971 3300049581 Bacteria 3673
799 Ga0501047_0204205 3300049581 Bacteria 1836
800 Ga0501048_0024006 3300049582 Bacteria 4453
801 Ga0501048_0043790 3300049582 Bacteria 3203
802 Ga0501067_0006496 3300049583 Bacteria 6483
803 Ga0501067_0006937 3300049583 Bacteria 6285
804 Ga0501068_0013505 3300049584 Bacteria 4648
805 Ga0501068_0069777 3300049584 Bacteria 2143
806 Ga0501069_0009746 3300049585 Bacteria 5074
807 Ga0501069_0012716 3300049585 Bacteria 4480
808 Ga0501069_0017267 3300049585 Bacteria 3882
809 Ga0501070_0005114 3300049586 Bacteria 11181
810 Ga0501070_0042518 3300049586 Bacteria 3785
811 Ga0501070_0189980 3300049586 Bacteria 1688
812 Ga0501071_0074358 3300049587 Bacteria 2479
813 Ga0501071_0079192 3300049587 Bacteria 2402
814 Ga0501072_0002466 3300049588 Bacteria 13854
815 Ga0501073_0015156 3300049589 Bacteria 5591
816 Ga0501073_0020760 3300049589 Bacteria 4736
817 Ga0501074_0011079 3300049590 Bacteria 6546
818 Ga0501074_0012984 3300049590 Bacteria 6054
819 Ga0501074_0028718 3300049590 Bacteria 4031
820 Ga0501075_0008809 3300049591 Bacteria 7033
821 Ga0501075_0104160 3300049591 Bacteria 2156
822 Ga0501075_0232195 3300049591 Bacteria 1407
823 Ga0501076_0051980 3300049592 Bacteria 3245
824 Ga0501076_0103602 3300049592 Bacteria 2295
825 Ga0501077_0000220 3300049593 Bacteria 33560
826 Ga0501202_005496 3300049652 Bacteria 2246
827 Ga0501209_001097 3300049656 Bacteria 3653
828 Ga0501216_001896 3300049660 Bacteria 2898
829 Ga0501217_003558 3300049661 Bacteria 3153
830 Ga0501224_000370 3300049664 Bacteria 5288
831 Ga0501230_007275 3300049667 Bacteria 1637
832 Ga0501235_000080 3300049669 Bacteria 15218
833 Ga0501235_004051 3300049669 Bacteria 3171
834 Ga0501239_001225 3300049672 Bacteria 2168
835 Ga0501247_001369 3300049677 Bacteria 2327
836 Ga0501249_005008 3300049679 Bacteria 2705
837 Ga0501249_027364 3300049679 Bacteria 1261
838 Ga0501257_005583 3300049686 Bacteria 2776
839 Ga0501259_004005 3300049688 Bacteria 2341
840 Ga0501221_003394 3300049704 Bacteria 2618
841 Ga0501225_0001718 3300049705 Bacteria 6859
842 Ga0501225_0022550 3300049705 Bacteria 1738
843 Ga0501225_0037153 3300049705 Bacteria 1342
844 Ga0501079_0174662 3300049741 Bacteria 1675
845 Ga0501079_0255190 3300049741 Bacteria 1371
846 Ga0501080_0026027 3300049742 Bacteria 5435
847 Ga0501080_0031362 3300049742 Bacteria 4952
848 Ga0501080_0041539 3300049742 Bacteria 4284
849 Ga0501081_0039771 3300049743 Bacteria 3219
850 Ga0501081_0092066 3300049743 Bacteria 2133
851 Ga0501083_0017773 3300049744 Bacteria 4960
852 Ga0501083_0025367 3300049744 Bacteria 4104
853 Ga0501083_0044259 3300049744 Bacteria 3013
854 Ga0501263_000245 3300049760 Bacteria 3533
855 Ga0501266_001036 3300049763 Bacteria 3588
856 Ga0501268_000756 3300049765 Bacteria 3716
857 Ga0501268_000875 3300049765 Bacteria 3518
858 Ga0501268_012958 3300049765 Bacteria 1340
859 Ga0501272_003614 3300049769 Bacteria 1579
860 Ga0501273_001040 3300049770 Bacteria 2503
861 Ga0501283_012061 3300049779 Bacteria 1294
862 Ga0501035_0052506 3300049822 Bacteria 3647
863 Ga0501044_0008920 3300049823 Bacteria 10960
864 Ga0501045_0033116 3300049824 Bacteria 3747
865 Ga0501045_0111354 3300049824 Bacteria 2030
866 Ga0501045_0130833 3300049824 Bacteria 1865
867 Ga0501204_003158 3300049850 Bacteria 1716
868 nmdc:mga05p37_114403_c1 3300050507 Bacteria 3316
869 nmdc:mga05p37_142513_c1 3300050507 Bacteria 2935
870 nmdc:mga05p37_154357_c1 3300050507 Bacteria 2806
871 nmdc:mga05p37_16091_c1 3300050507 Bacteria 9005
872 nmdc:mga05p37_1766_c1 3300050507 Bacteria 25251
873 nmdc:mga05p37_654_c1 3300050507 Bacteria 38315
874 nmdc:mga05p37_97298_c1 3300050507 Bacteria 3625
875 nmdc:mga09592_12192_c1 3300050508 Bacteria 6996
876 nmdc:mga09592_1607_c1 3300050508 Bacteria 10119
877 nmdc:mga09592_24034_c1 3300050508 Bacteria 5037
878 nmdc:mga0qj67_100788_c1 3300050509 Bacteria 2328
879 nmdc:mga0qj67_17085_c1 3300050509 Bacteria 5513
880 nmdc:mga0qj67_262491_c1 3300050509 Bacteria 1401
881 nmdc:mga0qj67_28563_c1 3300050509 Bacteria 4330
882 nmdc:mga0qj67_83913_c1 3300050509 Bacteria 2554
883 nmdc:mga06r32_18090_c1 3300050510 Bacteria 6444
884 nmdc:mga06r32_23503_c1 3300050510 Bacteria 5704
885 nmdc:mga06r32_282034_c1 3300050510 Bacteria 1648
886 nmdc:mga06r32_29595_c1 3300050510 Bacteria 5134
887 nmdc:mga06r32_77742_c1 3300050510 Bacteria 3224
888 nmdc:mga08y16_120559_c1 3300050511 Bacteria 2729
889 nmdc:mga08y16_502246_c1 3300050511 Bacteria 1232
890 nmdc:mga08y16_84919_c1 3300050511 Bacteria 3299
891 nmdc:mga0n895_10584_c1 3300050512 Bacteria 8162
892 nmdc:mga0n895_11550_c1 3300050512 Bacteria 7887
893 nmdc:mga0n895_122780_c1 3300050512 Bacteria 2619
894 nmdc:mga0n895_185619_c1 3300050512 Bacteria 2110
895 nmdc:mga0n895_322158_c1 3300050512 Bacteria 1566
896 nmdc:mga0n895_40532_c1 3300050512 Bacteria 4523
897 nmdc:mga0n895_94203_c1 3300050512 Bacteria 2998
898 nmdc:mga08x19_201063_c1 3300050514 Bacteria 1366
899 nmdc:mga0a205_138780_c1 3300050515 Bacteria 2331
900 nmdc:mga0a205_209681_c1 3300050515 Bacteria 1837
901 nmdc:mga0a205_25678_c1 3300050515 Bacteria 5614
902 nmdc:mga0a205_89028_c1 3300050515 Bacteria 2984
903 Ga0495595_0011150 3300053084 Bacteria 3754
904 Ga0495595_0073157 3300053084 Bacteria 1623
905 Ga0495619_0006382 3300053085 Bacteria 7474
906 Ga0495619_0025490 3300053085 Bacteria 3798
907 Ga0500555_000103 3300053103 Bacteria 40277
908 Ga0500568_0001868 3300053139 Bacteria 12968
909 Ga0500616_0000178 3300053153 Bacteria 106208
910 Ga0500645_000157 3300053730 Bacteria 52818
911 Ga0500645_018454 3300053730 Bacteria 2179
912 Ga0501084_0007102 3300054114 Bacteria 9228
913 Ga0501084_0008692 3300054114 Bacteria 8398
914 Ga0501084_0018949 3300054114 Bacteria 5730
915 Ga0501084_0039422 3300054114 Bacteria 3951
916 Ga0590071_000231 3300059421 Bacteria 16375
917 Ga0590074_008417 3300059423 Bacteria 1718
918 Ga0501082_0008232 3300060353 Bacteria 8992
919 Ga0501082_0032750 3300060353 Bacteria 4484
920 Ga0501082_0091470 3300060353 Bacteria 2627
921 Ga0501082_0106768 3300060353 Bacteria 2422
922 Ga0530510_0007306 3300061734 Bacteria 7688

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_322158_c1 nmdc:mga0n895_322158_c1_356_1312 318
2 3300042439 Ga0439464_0057400 Ga0439464_0057400_24_1016 330
3 3300046517 Ga0495630_0092394 Ga0495630_0092394_1241_2254 337
4 3300049574 Ga0501038_0207569 Ga0501038_0207569_509_1546 345
5 3300050511 nmdc:mga08y16_502246_c1 nmdc:mga08y16_502246_c1_50_1090 346
6 3300025933 Ga0207706_10280857 Ga0207706_102808572 351
7 3300009148 Ga0105243_10351424 Ga0105243_103514241 352
8 3300049574 Ga0501038_0241455 Ga0501038_0241455_64_1131 355
9 3300037471 Ga0395905_0208209 Ga0395905_0208209_696_1805 364
10 3300050509 nmdc:mga0qj67_83913_c1 nmdc:mga0qj67_83913_c1_228_1331 366
11 3300005334 Ga0068869_100027937 Ga0068869_1000279372 367
12 3300005367 Ga0070667_100172753 Ga0070667_1001727532 367
13 3300045049 Ga0466959_0100461 Ga0466959_0100461_944_2047 367
14 3300046642 Ga0495634_0105490 Ga0495634_0105490_699_1802 367
15 3300049824 Ga0501045_0130833 Ga0501045_0130833_751_1854 367
16 3300048906 Ga0496103_0122742 Ga0496103_0122742_512_1618 368
17 3300005544 Ga0070686_100016804 Ga0070686_1000168044 369
18 3300025918 Ga0207662_10010835 Ga0207662_100108354 369
19 3300025923 Ga0207681_10140363 Ga0207681_101403632 369
20 3300037068 Ga0373925_0115497 Ga0373925_0115497_934_2046 370
21 3300047315 Ga0495581_0084229 Ga0495581_0084229_15_1127 370
22 3300042876 Ga0451577_0066903 Ga0451577_0066903_1988_3139 373
23 3300006847 Ga0075431_100000825 Ga0075431_1000008255 374
24 3300027682 Ga0209971_1015199 Ga0209971_10151992 374
25 3300053103 Ga0500555_000103 Ga0500555_000103_16399_17559 374
26 3300053730 Ga0500645_000157 Ga0500645_000157_15069_16229 374
27 3300048908 Ga0496105_0077666 Ga0496105_0077666_661_1788 375
28 3300027717 Ga0209998_10024192 Ga0209998_100241921 377
29 3300014969 Ga0157376_10034816 Ga0157376_100348161 378
30 3300037471 Ga0395905_0054851 Ga0395905_0054851_163_1320 378
31 3300048917 Ga0496114_0023676 Ga0496114_0023676_175_1311 378
32 3300044673 Ga0453683_0072907 Ga0453683_0072907_606_1751 380
33 3300031995 Ga0307409_100328508 Ga0307409_1003285082 381
34 3300005459 Ga0068867_100053382 Ga0068867_1000533822 382
35 3300005577 Ga0068857_100050761 Ga0068857_1000507614 382
36 3300005617 Ga0068859_100162246 Ga0068859_1001622461 382
37 3300006931 Ga0097620_100162221 Ga0097620_1001622211 382
38 3300009176 Ga0105242_10064719 Ga0105242_100647194 382
39 3300014326 Ga0157380_10002276 Ga0157380_100022768 382
40 3300014745 Ga0157377_10024661 Ga0157377_100246612 382
41 3300026089 Ga0207648_10047220 Ga0207648_100472203 382
42 3300026116 Ga0207674_10175426 Ga0207674_101754262 382
43 3300045051 Ga0451576_0024257 Ga0451576_0024257_2462_3613 382
44 3300005329 Ga0070683_100097740 Ga0070683_1000977402 383
45 3300005535 Ga0070684_100142317 Ga0070684_1001423173 383
46 3300042133 Ga0450896_000471 Ga0450896_000471_1779_2930 383
47 3300049571 Ga0501034_0085676 Ga0501034_0085676_1544_2695 383
48 3300050510 nmdc:mga06r32_282034_c1 nmdc:mga06r32_282034_c1_126_1277 383
49 3300005290 Ga0065712_10068461 Ga0065712_100684614 384
50 3300005293 Ga0065715_10001248 Ga0065715_100012487 384
51 3300005329 Ga0070683_100364290 Ga0070683_1003642901 384
52 3300005331 Ga0070670_100014299 Ga0070670_1000142992 384
53 3300005340 Ga0070689_100043232 Ga0070689_1000432322 384
54 3300005354 Ga0070675_100305732 Ga0070675_1003057321 384
55 3300005364 Ga0070673_100024811 Ga0070673_1000248113 384
56 3300005364 Ga0070673_100032333 Ga0070673_1000323332 384
57 3300005365 Ga0070688_100001194 Ga0070688_1000011945 384
58 3300005438 Ga0070701_10041833 Ga0070701_100418332 384
59 3300005466 Ga0070685_10007599 Ga0070685_100075991 384
60 3300005543 Ga0070672_100010531 Ga0070672_1000105312 384
61 3300005548 Ga0070665_100030040 Ga0070665_1000300402 384
62 3300005614 Ga0068856_100248510 Ga0068856_1002485102 384
63 3300005617 Ga0068859_100341696 Ga0068859_1003416962 384
64 3300005618 Ga0068864_100032756 Ga0068864_1000327563 384
65 3300005841 Ga0068863_100039343 Ga0068863_1000393432 384
66 3300005985 Ga0081539_10038333 Ga0081539_100383332 384
67 3300006237 Ga0097621_100012962 Ga0097621_1000129623 384
68 3300006353 Ga0075370_10059486 Ga0075370_100594862 384
69 3300006358 Ga0068871_100082468 Ga0068871_1000824683 384
70 3300006844 Ga0075428_100033303 Ga0075428_1000333032 384
71 3300006880 Ga0075429_100002304 Ga0075429_1000023042 384
72 3300006931 Ga0097620_100341683 Ga0097620_1003416832 384
73 3300009147 Ga0114129_10004330 Ga0114129_1000433012 384
74 3300009174 Ga0105241_10236463 Ga0105241_102364632 384
75 3300009177 Ga0105248_10014499 Ga0105248_100144996 384
76 3300009177 Ga0105248_10110041 Ga0105248_101100412 384
77 3300009553 Ga0105249_10024865 Ga0105249_100248654 384
78 3300010375 Ga0105239_10242297 Ga0105239_102422972 384
79 3300013306 Ga0163162_10110140 Ga0163162_101101402 384
80 3300013308 Ga0157375_10508599 Ga0157375_105085991 384
81 3300014325 Ga0163163_10248393 Ga0163163_102483932 384
82 3300014969 Ga0157376_10215033 Ga0157376_102150332 384
83 3300025899 Ga0207642_10010217 Ga0207642_100102172 384
84 3300025901 Ga0207688_10090047 Ga0207688_100900472 384
85 3300025903 Ga0207680_10087969 Ga0207680_100879691 384
86 3300025925 Ga0207650_10015045 Ga0207650_100150453 384
87 3300025926 Ga0207659_10118629 Ga0207659_101186292 384
88 3300025940 Ga0207691_10005100 Ga0207691_100051005 384
89 3300025941 Ga0207711_10035232 Ga0207711_100352322 384
90 3300025941 Ga0207711_10154094 Ga0207711_101540941 384
91 3300025960 Ga0207651_10022450 Ga0207651_100224502 384
92 3300025960 Ga0207651_10045920 Ga0207651_100459202 384
93 3300025961 Ga0207712_10267604 Ga0207712_102676041 384
94 3300025972 Ga0207668_10118421 Ga0207668_101184211 384
95 3300026075 Ga0207708_10068592 Ga0207708_100685922 384
96 3300026088 Ga0207641_10036965 Ga0207641_100369652 384
97 3300026095 Ga0207676_10060304 Ga0207676_100603042 384
98 3300026121 Ga0207683_10074787 Ga0207683_100747872 384
99 3300026142 Ga0207698_10128839 Ga0207698_101288392 384
100 3300028380 Ga0268265_10068941 Ga0268265_100689412 384
101 3300031727 Ga0316576_10043850 Ga0316576_100438504 384
102 3300031728 Ga0316578_10022388 Ga0316578_100223883 384
103 3300048908 Ga0496105_0023253 Ga0496105_0023253_1527_2681 384
104 3300048911 Ga0496108_0073271 Ga0496108_0073271_1508_2662 384
105 3300048912 Ga0496109_0002146 Ga0496109_0002146_3928_5082 384
106 3300048915 Ga0496112_0021742 Ga0496112_0021742_3175_4329 384
107 3300048916 Ga0496113_0002607 Ga0496113_0002607_4051_5205 384
108 3300048917 Ga0496114_0001537 Ga0496114_0001537_1381_2535 384
109 3300050507 nmdc:mga05p37_654_c1 nmdc:mga05p37_654_c1_4858_6012 384
110 3300050508 nmdc:mga09592_1607_c1 nmdc:mga09592_1607_c1_1370_2524 384
111 3300053730 Ga0500645_018454 Ga0500645_018454_1013_2167 384
112 3300005295 Ga0065707_10007385 Ga0065707_100073852 385
113 3300009147 Ga0114129_10038801 Ga0114129_100388012 385
114 3300009148 Ga0105243_10087572 Ga0105243_100875722 385
115 3300027682 Ga0209971_1003303 Ga0209971_10033033 385
116 3300027876 Ga0209974_10034082 Ga0209974_100340822 385
117 3300031548 Ga0307408_100030129 Ga0307408_1000301293 385
118 3300031852 Ga0307410_10047216 Ga0307410_100472162 385
119 3300032002 Ga0307416_100072619 Ga0307416_1000726192 385
120 3300035692 Ga0373935_0084549 Ga0373935_0084549_263_1420 385
121 3300035695 Ga0373927_0003399 Ga0373927_0003399_2118_3275 385
122 3300037068 Ga0373925_0000419 Ga0373925_0000419_17580_18737 385
123 3300037418 Ga0395900_0306746 Ga0395900_0306746_341_1498 385
124 3300049572 Ga0501036_0039617 Ga0501036_0039617_2314_3471 385
125 3300049575 Ga0501039_0211671 Ga0501039_0211671_29_1186 385
126 3300049582 Ga0501048_0043790 Ga0501048_0043790_1175_2332 385
127 3300049591 Ga0501075_0008809 Ga0501075_0008809_387_1544 385
128 3300049592 Ga0501076_0051980 Ga0501076_0051980_737_1894 385
129 3300050507 nmdc:mga05p37_97298_c1 nmdc:mga05p37_97298_c1_2163_3320 385
130 3300060353 Ga0501082_0091470 Ga0501082_0091470_153_1310 385
131 3300005290 Ga0065712_10155362 Ga0065712_101553621 386
132 3300005356 Ga0070674_100002002 Ga0070674_1000020027 386
133 3300006178 Ga0075367_10009362 Ga0075367_100093623 386
134 3300006178 Ga0075367_10025360 Ga0075367_100253603 386
135 3300006178 Ga0075367_10084254 Ga0075367_100842542 386
136 3300009545 Ga0105237_10093750 Ga0105237_100937503 386
137 3300044673 Ga0453683_0112401 Ga0453683_0112401_139_1302 386
138 3300046460 Ga0495638_0040481 Ga0495638_0040481_266_1426 386
139 3300047320 Ga0495672_0029516 Ga0495672_0029516_2216_3376 386
140 3300053139 Ga0500568_0001868 Ga0500568_0001868_7539_8699 386
141 3300053153 Ga0500616_0000178 Ga0500616_0000178_75431_76591 386
142 3300005444 Ga0070694_100070776 Ga0070694_1000707762 387
143 3300006844 Ga0075428_100173631 Ga0075428_1001736312 387
144 3300006847 Ga0075431_100238536 Ga0075431_1002385362 387
145 3300009147 Ga0114129_10006598 Ga0114129_1000659810 387
146 3300009147 Ga0114129_10335293 Ga0114129_103352932 387
147 3300026075 Ga0207708_10084624 Ga0207708_100846242 387
148 3300049571 Ga0501034_0218232 Ga0501034_0218232_429_1601 387
149 3300050507 nmdc:mga05p37_142513_c1 nmdc:mga05p37_142513_c1_821_1984 387
150 3300050507 nmdc:mga05p37_1766_c1 nmdc:mga05p37_1766_c1_17821_19005 387
151 3300005563 Ga0068855_100068640 Ga0068855_1000686403 389
152 3300007076 Ga0075435_100232064 Ga0075435_1002320641 389
153 3300009094 Ga0111539_10155614 Ga0111539_101556142 389
154 3300020070 Ga0206356_11274886 Ga0206356_112748862 389
155 3300025949 Ga0207667_10036553 Ga0207667_100365532 389
156 3300031728 Ga0316578_10181871 Ga0316578_101818711 389
157 3300031727 Ga0316576_10004090 Ga0316576_100040904 390
158 3300031733 Ga0316577_10001955 Ga0316577_100019558 390
159 3300036647 Ga0316582_0002786 Ga0316582_0002786_3831_5003 390
160 3300036712 Ga0316584_0001769 Ga0316584_0001769_1185_2357 390
161 3300049686 Ga0501257_005583 Ga0501257_005583_312_1484 390
162 3300049572 Ga0501036_0161162 Ga0501036_0161162_701_1876 391
163 3300005341 Ga0070691_10003961 Ga0070691_100039615 393
164 3300031247 Ga0265340_10030526 Ga0265340_100305263 393
165 3300031711 Ga0265314_10024708 Ga0265314_100247082 393
166 3300048918 Ga0496115_0030353 Ga0496115_0030353_2014_3198 393
167 3300026089 Ga0207648_10341575 Ga0207648_103415751 394
168 3300031731 Ga0307405_10003504 Ga0307405_100035042 394
169 3300031731 Ga0307405_10063028 Ga0307405_100630281 394
170 3300031824 Ga0307413_10189684 Ga0307413_101896841 394
171 3300031901 Ga0307406_10042025 Ga0307406_100420252 394
172 3300031901 Ga0307406_10067054 Ga0307406_100670542 394
173 3300031911 Ga0307412_10087544 Ga0307412_100875442 394
174 3300031995 Ga0307409_100123248 Ga0307409_1001232481 394
175 3300031995 Ga0307409_100332750 Ga0307409_1003327502 394
176 3300032002 Ga0307416_100123440 Ga0307416_1001234401 394
177 3300032002 Ga0307416_100177210 Ga0307416_1001772102 394
178 3300032004 Ga0307414_10013736 Ga0307414_100137363 394
179 3300032005 Ga0307411_10064065 Ga0307411_100640651 394
180 3300032005 Ga0307411_10207731 Ga0307411_102077311 394
181 3300032126 Ga0307415_100034014 Ga0307415_1000340143 394
182 3300032126 Ga0307415_100150170 Ga0307415_1001501702 394
183 3300032126 Ga0307415_100171236 Ga0307415_1001712362 394
184 3300005471 Ga0070698_100016906 Ga0070698_1000169065 395
185 3300005518 Ga0070699_100134093 Ga0070699_1001340932 395
186 3300005546 Ga0070696_100000366 Ga0070696_10000036610 395
187 3300005614 Ga0068856_100279572 Ga0068856_1002795721 395
188 3300005985 Ga0081539_10000290 Ga0081539_1000029019 395
189 3300013307 Ga0157372_10028311 Ga0157372_100283112 395
190 3300021384 Ga0213876_10010769 Ga0213876_100107693 395
191 3300026078 Ga0207702_10241636 Ga0207702_102416362 395
192 3300031731 Ga0307405_10001938 Ga0307405_100019384 395
193 3300031852 Ga0307410_10032618 Ga0307410_100326181 395
194 3300031852 Ga0307410_10035531 Ga0307410_100355313 395
195 3300031901 Ga0307406_10003417 Ga0307406_100034174 395
196 3300031901 Ga0307406_10267678 Ga0307406_102676781 395
197 3300031903 Ga0307407_10000215 Ga0307407_100002159 395
198 3300031903 Ga0307407_10029111 Ga0307407_100291111 395
199 3300031903 Ga0307407_10031145 Ga0307407_100311452 395
200 3300031911 Ga0307412_10161126 Ga0307412_101611261 395
201 3300031995 Ga0307409_100089862 Ga0307409_1000898621 395
202 3300031995 Ga0307409_100106901 Ga0307409_1001069012 395
203 3300031995 Ga0307409_100197987 Ga0307409_1001979872 395
204 3300032004 Ga0307414_10150727 Ga0307414_101507272 395
205 3300032005 Ga0307411_10056730 Ga0307411_100567302 395
206 3300032005 Ga0307411_10217962 Ga0307411_102179621 395
207 3300032126 Ga0307415_100051322 Ga0307415_1000513222 395
208 3300039437 Ga0436365_1410016 Ga0436365_1410016_790_1998 395
209 3300048918 Ga0496115_0132684 Ga0496115_0132684_556_1743 395
210 3300049765 Ga0501268_012958 Ga0501268_012958_111_1313 395
211 3300005295 Ga0065707_10147578 Ga0065707_101475782 396
212 3300005339 Ga0070660_100006566 Ga0070660_1000065663 396
213 3300005339 Ga0070660_100054075 Ga0070660_1000540752 396
214 3300005339 Ga0070660_100227058 Ga0070660_1002270581 396
215 3300005347 Ga0070668_100059097 Ga0070668_1000590973 396
216 3300005353 Ga0070669_100061421 Ga0070669_1000614211 396
217 3300005353 Ga0070669_100107514 Ga0070669_1001075141 396
218 3300005355 Ga0070671_100034859 Ga0070671_1000348592 396
219 3300005366 Ga0070659_100101459 Ga0070659_1001014592 396
220 3300005435 Ga0070714_100001589 Ga0070714_10000158913 396
221 3300005444 Ga0070694_100127571 Ga0070694_1001275712 396
222 3300005445 Ga0070708_100030039 Ga0070708_1000300392 396
223 3300005458 Ga0070681_10035919 Ga0070681_100359194 396
224 3300005468 Ga0070707_100029839 Ga0070707_1000298392 396
225 3300005471 Ga0070698_100000304 Ga0070698_10000030433 396
226 3300005471 Ga0070698_100017768 Ga0070698_1000177682 396
227 3300005471 Ga0070698_100091070 Ga0070698_1000910702 396
228 3300005518 Ga0070699_100085936 Ga0070699_1000859362 396
229 3300005530 Ga0070679_100099059 Ga0070679_1000990592 396
230 3300005536 Ga0070697_100028334 Ga0070697_1000283344 396
231 3300005543 Ga0070672_100092229 Ga0070672_1000922292 396
232 3300005548 Ga0070665_100037055 Ga0070665_1000370553 396
233 3300005549 Ga0070704_100008321 Ga0070704_1000083215 396
234 3300005577 Ga0068857_100042460 Ga0068857_1000424602 396
235 3300005840 Ga0068870_10005763 Ga0068870_100057632 396
236 3300005844 Ga0068862_100003461 Ga0068862_10000346111 396
237 3300006844 Ga0075428_100143933 Ga0075428_1001439332 396
238 3300006846 Ga0075430_100005544 Ga0075430_1000055449 396
239 3300006846 Ga0075430_100018306 Ga0075430_1000183065 396
240 3300006846 Ga0075430_100057193 Ga0075430_1000571934 396
241 3300006846 Ga0075430_100072796 Ga0075430_1000727962 396
242 3300006847 Ga0075431_100130776 Ga0075431_1001307762 396
243 3300006871 Ga0075434_100026438 Ga0075434_1000264384 396
244 3300006871 Ga0075434_100071500 Ga0075434_1000715002 396
245 3300006871 Ga0075434_100077810 Ga0075434_1000778102 396
246 3300007076 Ga0075435_100241615 Ga0075435_1002416152 396
247 3300009094 Ga0111539_10073804 Ga0111539_100738042 396
248 3300009094 Ga0111539_10187877 Ga0111539_101878772 396
249 3300009098 Ga0105245_10114676 Ga0105245_101146762 396
250 3300009147 Ga0114129_10001902 Ga0114129_100019027 396
251 3300009176 Ga0105242_10004361 Ga0105242_100043614 396
252 3300009176 Ga0105242_10145674 Ga0105242_101456742 396
253 3300009176 Ga0105242_10174504 Ga0105242_101745041 396
254 3300009177 Ga0105248_10013902 Ga0105248_100139022 396
255 3300009177 Ga0105248_10107543 Ga0105248_101075432 396
256 3300009177 Ga0105248_10294906 Ga0105248_102949062 396
257 3300009177 Ga0105248_10320811 Ga0105248_103208111 396
258 3300009553 Ga0105249_10002382 Ga0105249_100023823 396
259 3300010375 Ga0105239_10017961 Ga0105239_100179615 396
260 3300013100 Ga0157373_10021800 Ga0157373_100218002 396
261 3300013105 Ga0157369_10000703 Ga0157369_1000070311 396
262 3300013306 Ga0163162_10041311 Ga0163162_100413115 396
263 3300013306 Ga0163162_10416745 Ga0163162_104167451 396
264 3300013307 Ga0157372_10012150 Ga0157372_100121503 396
265 3300013307 Ga0157372_10014410 Ga0157372_100144106 396
266 3300013307 Ga0157372_10026080 Ga0157372_100260807 396
267 3300013307 Ga0157372_10059881 Ga0157372_100598813 396
268 3300013308 Ga0157375_10016669 Ga0157375_100166694 396
269 3300013308 Ga0157375_10151762 Ga0157375_101517622 396
270 3300013308 Ga0157375_10277758 Ga0157375_102777581 396
271 3300014325 Ga0163163_10049135 Ga0163163_100491353 396
272 3300014326 Ga0157380_10011979 Ga0157380_100119793 396
273 3300014968 Ga0157379_10086168 Ga0157379_100861682 396
274 3300014969 Ga0157376_10240300 Ga0157376_102403002 396
275 3300025908 Ga0207643_10007454 Ga0207643_100074542 396
276 3300025909 Ga0207705_10000772 Ga0207705_1000077210 396
277 3300025912 Ga0207707_10003701 Ga0207707_100037012 396
278 3300025915 Ga0207693_10150039 Ga0207693_101500392 396
279 3300025916 Ga0207663_10053600 Ga0207663_100536002 396
280 3300025917 Ga0207660_10086151 Ga0207660_100861512 396
281 3300025917 Ga0207660_10268349 Ga0207660_102683491 396
282 3300025919 Ga0207657_10005682 Ga0207657_100056825 396
283 3300025919 Ga0207657_10137201 Ga0207657_101372012 396
284 3300025919 Ga0207657_10200205 Ga0207657_102002052 396
285 3300025921 Ga0207652_10195138 Ga0207652_101951382 396
286 3300025923 Ga0207681_10006835 Ga0207681_100068355 396
287 3300025923 Ga0207681_10190537 Ga0207681_101905372 396
288 3300025929 Ga0207664_10009762 Ga0207664_100097623 396
289 3300025931 Ga0207644_10029906 Ga0207644_100299062 396
290 3300025937 Ga0207669_10023012 Ga0207669_100230123 396
291 3300025940 Ga0207691_10108619 Ga0207691_101086192 396
292 3300025941 Ga0207711_10078595 Ga0207711_100785952 396
293 3300025941 Ga0207711_10230850 Ga0207711_102308502 396
294 3300025942 Ga0207689_10002072 Ga0207689_100020729 396
295 3300025944 Ga0207661_10016943 Ga0207661_100169432 396
296 3300025949 Ga0207667_10079459 Ga0207667_100794592 396
297 3300025960 Ga0207651_10079602 Ga0207651_100796022 396
298 3300025961 Ga0207712_10030495 Ga0207712_100304952 396
299 3300026089 Ga0207648_10130704 Ga0207648_101307042 396
300 3300026116 Ga0207674_10029472 Ga0207674_100294723 396
301 3300026118 Ga0207675_100012918 Ga0207675_1000129187 396
302 3300026118 Ga0207675_100142424 Ga0207675_1001424242 396
303 3300027682 Ga0209971_1008991 Ga0209971_10089912 396
304 3300027907 Ga0207428_10170192 Ga0207428_101701922 396
305 3300028380 Ga0268265_10002887 Ga0268265_100028872 396
306 3300028381 Ga0268264_10001217 Ga0268264_100012178 396
307 3300031548 Ga0307408_100166013 Ga0307408_1001660131 396
308 3300031731 Ga0307405_10041855 Ga0307405_100418554 396
309 3300031852 Ga0307410_10105352 Ga0307410_101053522 396
310 3300031995 Ga0307409_100005431 Ga0307409_1000054313 396
311 3300032002 Ga0307416_100012828 Ga0307416_1000128284 396
312 3300032005 Ga0307411_10082100 Ga0307411_100821002 396
313 3300035691 Ga0373931_0127269 Ga0373931_0127269_71_1264 396
314 3300042876 Ga0451577_0000005 Ga0451577_0000005_379840_381033 396
315 3300042876 Ga0451577_0036570 Ga0451577_0036570_2753_3949 396
316 3300045051 Ga0451576_0399997 Ga0451576_0399997_29_1234 396
317 3300046459 Ga0495629_0076931 Ga0495629_0076931_1110_2303 396
318 3300046536 Ga0495587_0131896 Ga0495587_0131896_138_1331 396
319 3300048907 Ga0496104_0045729 Ga0496104_0045729_2368_3561 396
320 3300048909 Ga0496106_0093356 Ga0496106_0093356_683_1876 396
321 3300048911 Ga0496108_0000912 Ga0496108_0000912_8401_9594 396
322 3300048912 Ga0496109_0003320 Ga0496109_0003320_10591_11784 396
323 3300048915 Ga0496112_0005001 Ga0496112_0005001_9820_11013 396
324 3300048915 Ga0496112_0005923 Ga0496112_0005923_4394_5587 396
325 3300048916 Ga0496113_0001446 Ga0496113_0001446_8098_9291 396
326 3300049569 Ga0501032_0165469 Ga0501032_0165469_170_1360 396
327 3300049579 Ga0501043_0045483 Ga0501043_0045483_2224_3414 396
328 3300049581 Ga0501047_0059971 Ga0501047_0059971_246_1436 396
329 3300049581 Ga0501047_0204205 Ga0501047_0204205_422_1612 396
330 3300049583 Ga0501067_0006496 Ga0501067_0006496_1166_2359 396
331 3300049583 Ga0501067_0006937 Ga0501067_0006937_3213_4406 396
332 3300049584 Ga0501068_0013505 Ga0501068_0013505_3182_4375 396
333 3300049585 Ga0501069_0009746 Ga0501069_0009746_3586_4779 396
334 3300049585 Ga0501069_0017267 Ga0501069_0017267_1439_2632 396
335 3300049586 Ga0501070_0005114 Ga0501070_0005114_6785_7978 396
336 3300049586 Ga0501070_0042518 Ga0501070_0042518_2466_3656 396
337 3300049586 Ga0501070_0189980 Ga0501070_0189980_446_1639 396
338 3300049587 Ga0501071_0074358 Ga0501071_0074358_1143_2336 396
339 3300049588 Ga0501072_0002466 Ga0501072_0002466_1387_2580 396
340 3300049589 Ga0501073_0015156 Ga0501073_0015156_2787_3980 396
341 3300049589 Ga0501073_0020760 Ga0501073_0020760_3057_4250 396
342 3300049590 Ga0501074_0011079 Ga0501074_0011079_351_1544 396
343 3300049590 Ga0501074_0012984 Ga0501074_0012984_1787_2980 396
344 3300049591 Ga0501075_0232195 Ga0501075_0232195_77_1270 396
345 3300049652 Ga0501202_005496 Ga0501202_005496_886_2076 396
346 3300049656 Ga0501209_001097 Ga0501209_001097_1105_2295 396
347 3300049661 Ga0501217_003558 Ga0501217_003558_1351_2541 396
348 3300049664 Ga0501224_000370 Ga0501224_000370_1139_2329 396
349 3300049667 Ga0501230_007275 Ga0501230_007275_431_1621 396
350 3300049669 Ga0501235_000080 Ga0501235_000080_758_1948 396
351 3300049672 Ga0501239_001225 Ga0501239_001225_567_1757 396
352 3300049677 Ga0501247_001369 Ga0501247_001369_1022_2212 396
353 3300049679 Ga0501249_005008 Ga0501249_005008_1448_2638 396
354 3300049688 Ga0501259_004005 Ga0501259_004005_61_1251 396
355 3300049705 Ga0501225_0001718 Ga0501225_0001718_829_2019 396
356 3300049742 Ga0501080_0026027 Ga0501080_0026027_3422_4615 396
357 3300049742 Ga0501080_0031362 Ga0501080_0031362_3204_4397 396
358 3300049742 Ga0501080_0041539 Ga0501080_0041539_302_1495 396
359 3300049743 Ga0501081_0039771 Ga0501081_0039771_407_1600 396
360 3300049743 Ga0501081_0092066 Ga0501081_0092066_42_1235 396
361 3300049744 Ga0501083_0017773 Ga0501083_0017773_1439_2632 396
362 3300049744 Ga0501083_0044259 Ga0501083_0044259_1388_2581 396
363 3300049763 Ga0501266_001036 Ga0501266_001036_2289_3479 396
364 3300049765 Ga0501268_000756 Ga0501268_000756_2353_3543 396
365 3300049850 Ga0501204_003158 Ga0501204_003158_479_1669 396
366 3300050507 nmdc:mga05p37_114403_c1 nmdc:mga05p37_114403_c1_1436_2626 396
367 3300050507 nmdc:mga05p37_16091_c1 nmdc:mga05p37_16091_c1_5135_6328 396
368 3300050508 nmdc:mga09592_12192_c1 nmdc:mga09592_12192_c1_694_1887 396
369 3300050508 nmdc:mga09592_24034_c1 nmdc:mga09592_24034_c1_3756_4952 396
370 3300050509 nmdc:mga0qj67_17085_c1 nmdc:mga0qj67_17085_c1_169_1362 396
371 3300050509 nmdc:mga0qj67_262491_c1 nmdc:mga0qj67_262491_c1_138_1331 396
372 3300050509 nmdc:mga0qj67_28563_c1 nmdc:mga0qj67_28563_c1_2077_3276 396
373 3300050510 nmdc:mga06r32_29595_c1 nmdc:mga06r32_29595_c1_1125_2318 396
374 3300050510 nmdc:mga06r32_77742_c1 nmdc:mga06r32_77742_c1_372_1565 396
375 3300050512 nmdc:mga0n895_10584_c1 nmdc:mga0n895_10584_c1_4821_6014 396
376 3300050512 nmdc:mga0n895_122780_c1 nmdc:mga0n895_122780_c1_719_1912 396
377 3300050512 nmdc:mga0n895_185619_c1 nmdc:mga0n895_185619_c1_379_1572 396
378 3300050512 nmdc:mga0n895_40532_c1 nmdc:mga0n895_40532_c1_1440_2645 396
379 3300050512 nmdc:mga0n895_94203_c1 nmdc:mga0n895_94203_c1_1723_2916 396
380 3300050514 nmdc:mga08x19_201063_c1 nmdc:mga08x19_201063_c1_119_1312 396
381 3300050515 nmdc:mga0a205_209681_c1 nmdc:mga0a205_209681_c1_298_1491 396
382 3300050515 nmdc:mga0a205_25678_c1 nmdc:mga0a205_25678_c1_3906_5099 396
383 3300054114 Ga0501084_0007102 Ga0501084_0007102_3584_4777 396
384 3300054114 Ga0501084_0039422 Ga0501084_0039422_377_1570 396
385 3300060353 Ga0501082_0008232 Ga0501082_0008232_3283_4476 396
386 3300004803 Ga0058862_12681691 Ga0058862_126816913 397
387 3300005290 Ga0065712_10087269 Ga0065712_100872692 397
388 3300005295 Ga0065707_10085732 Ga0065707_100857323 397
389 3300005327 Ga0070658_10007500 Ga0070658_100075003 397
390 3300005327 Ga0070658_10013583 Ga0070658_100135834 397
391 3300005327 Ga0070658_10210928 Ga0070658_102109281 397
392 3300005328 Ga0070676_10001729 Ga0070676_1000172911 397
393 3300005328 Ga0070676_10025287 Ga0070676_100252873 397
394 3300005329 Ga0070683_100004796 Ga0070683_10000479610 397
395 3300005329 Ga0070683_100090149 Ga0070683_1000901493 397
396 3300005330 Ga0070690_100011022 Ga0070690_1000110221 397
397 3300005333 Ga0070677_10016654 Ga0070677_100166542 397
398 3300005334 Ga0068869_100007356 Ga0068869_1000073565 397
399 3300005336 Ga0070680_100001150 Ga0070680_1000011502 397
400 3300005336 Ga0070680_100015762 Ga0070680_1000157624 397
401 3300005336 Ga0070680_100246993 Ga0070680_1002469931 397
402 3300005337 Ga0070682_100001803 Ga0070682_1000018037 397
403 3300005339 Ga0070660_100009811 Ga0070660_1000098113 397
404 3300005340 Ga0070689_100023013 Ga0070689_1000230131 397
405 3300005344 Ga0070661_100013735 Ga0070661_1000137352 397
406 3300005345 Ga0070692_10006257 Ga0070692_100062573 397
407 3300005345 Ga0070692_10025337 Ga0070692_100253372 397
408 3300005347 Ga0070668_100001256 Ga0070668_1000012569 397
409 3300005354 Ga0070675_100004386 Ga0070675_1000043866 397
410 3300005354 Ga0070675_100060255 Ga0070675_1000602552 397
411 3300005355 Ga0070671_100014034 Ga0070671_1000140344 397
412 3300005355 Ga0070671_100042215 Ga0070671_1000422151 397
413 3300005356 Ga0070674_100031297 Ga0070674_1000312972 397
414 3300005366 Ga0070659_100055898 Ga0070659_1000558981 397
415 3300005366 Ga0070659_100131520 Ga0070659_1001315202 397
416 3300005367 Ga0070667_100005119 Ga0070667_1000051196 397
417 3300005367 Ga0070667_100231787 Ga0070667_1002317872 397
418 3300005434 Ga0070709_10026893 Ga0070709_100268932 397
419 3300005435 Ga0070714_100035823 Ga0070714_1000358234 397
420 3300005436 Ga0070713_100000223 Ga0070713_10000022314 397
421 3300005438 Ga0070701_10027207 Ga0070701_100272072 397
422 3300005439 Ga0070711_100077594 Ga0070711_1000775942 397
423 3300005441 Ga0070700_100024511 Ga0070700_1000245113 397
424 3300005444 Ga0070694_100154517 Ga0070694_1001545172 397
425 3300005445 Ga0070708_100030224 Ga0070708_1000302246 397
426 3300005445 Ga0070708_100109496 Ga0070708_1001094962 397
427 3300005456 Ga0070678_100054667 Ga0070678_1000546672 397
428 3300005457 Ga0070662_100005443 Ga0070662_1000054434 397
429 3300005458 Ga0070681_10000978 Ga0070681_1000097813 397
430 3300005458 Ga0070681_10001876 Ga0070681_1000187619 397
431 3300005458 Ga0070681_10016210 Ga0070681_100162105 397
432 3300005458 Ga0070681_10016523 Ga0070681_100165232 397
433 3300005458 Ga0070681_10027504 Ga0070681_100275041 397
434 3300005458 Ga0070681_10065418 Ga0070681_100654182 397
435 3300005458 Ga0070681_10093955 Ga0070681_100939552 397
436 3300005459 Ga0068867_100054180 Ga0068867_1000541802 397
437 3300005468 Ga0070707_100001546 Ga0070707_1000015469 397
438 3300005468 Ga0070707_100036399 Ga0070707_1000363992 397
439 3300005468 Ga0070707_100151413 Ga0070707_1001514132 397
440 3300005518 Ga0070699_100093379 Ga0070699_1000933792 397
441 3300005530 Ga0070679_100007387 Ga0070679_1000073877 397
442 3300005530 Ga0070679_100015830 Ga0070679_1000158307 397
443 3300005530 Ga0070679_100020198 Ga0070679_1000201983 397
444 3300005530 Ga0070679_100026564 Ga0070679_1000265643 397
445 3300005530 Ga0070679_100104869 Ga0070679_1001048692 397
446 3300005535 Ga0070684_100000532 Ga0070684_10000053215 397
447 3300005535 Ga0070684_100003959 Ga0070684_1000039593 397
448 3300005535 Ga0070684_100014509 Ga0070684_1000145091 397
449 3300005539 Ga0068853_100014834 Ga0068853_1000148343 397
450 3300005543 Ga0070672_100008586 Ga0070672_1000085866 397
451 3300005546 Ga0070696_100000824 Ga0070696_10000082410 397
452 3300005546 Ga0070696_100004572 Ga0070696_1000045722 397
453 3300005546 Ga0070696_100022348 Ga0070696_1000223482 397
454 3300005546 Ga0070696_100101642 Ga0070696_1001016422 397
455 3300005547 Ga0070693_100002493 Ga0070693_1000024932 397
456 3300005547 Ga0070693_100122508 Ga0070693_1001225082 397
457 3300005548 Ga0070665_100211391 Ga0070665_1002113912 397
458 3300005563 Ga0068855_100209375 Ga0068855_1002093751 397
459 3300005564 Ga0070664_100026278 Ga0070664_1000262783 397
460 3300005564 Ga0070664_100097643 Ga0070664_1000976432 397
461 3300005577 Ga0068857_100007819 Ga0068857_1000078192 397
462 3300005577 Ga0068857_100019015 Ga0068857_1000190152 397
463 3300005615 Ga0070702_100095839 Ga0070702_1000958391 397
464 3300005617 Ga0068859_100007707 Ga0068859_1000077075 397
465 3300005719 Ga0068861_100001399 Ga0068861_1000013992 397
466 3300005834 Ga0068851_10025230 Ga0068851_100252302 397
467 3300005841 Ga0068863_100130271 Ga0068863_1001302712 397
468 3300005842 Ga0068858_100035928 Ga0068858_1000359282 397
469 3300005843 Ga0068860_100010585 Ga0068860_1000105853 397
470 3300005844 Ga0068862_100221115 Ga0068862_1002211152 397
471 3300005937 Ga0081455_10027499 Ga0081455_100274992 397
472 3300005937 Ga0081455_10218649 Ga0081455_102186491 397
473 3300005981 Ga0081538_10088963 Ga0081538_100889632 397
474 3300005985 Ga0081539_10026740 Ga0081539_100267402 397
475 3300006173 Ga0070716_100011367 Ga0070716_1000113673 397
476 3300006175 Ga0070712_100025778 Ga0070712_1000257782 397
477 3300006175 Ga0070712_100095463 Ga0070712_1000954632 397
478 3300006844 Ga0075428_100037388 Ga0075428_1000373883 397
479 3300006852 Ga0075433_10069477 Ga0075433_100694772 397
480 3300006852 Ga0075433_10123858 Ga0075433_101238582 397
481 3300006852 Ga0075433_10176100 Ga0075433_101761001 397
482 3300006871 Ga0075434_100006320 Ga0075434_1000063202 397
483 3300006871 Ga0075434_100057505 Ga0075434_1000575053 397
484 3300006881 Ga0068865_100008155 Ga0068865_1000081553 397
485 3300006881 Ga0068865_100017197 Ga0068865_1000171972 397
486 3300006881 Ga0068865_100182146 Ga0068865_1001821462 397
487 3300006914 Ga0075436_100035378 Ga0075436_1000353782 397
488 3300006931 Ga0097620_100007707 Ga0097620_1000077075 397
489 3300009093 Ga0105240_10229668 Ga0105240_102296682 397
490 3300009094 Ga0111539_10248186 Ga0111539_102481862 397
491 3300009094 Ga0111539_10315906 Ga0111539_103159062 397
492 3300009094 Ga0111539_10500062 Ga0111539_105000621 397
493 3300009098 Ga0105245_10298097 Ga0105245_102980971 397
494 3300009147 Ga0114129_10018551 Ga0114129_100185512 397
495 3300009147 Ga0114129_10036775 Ga0114129_100367753 397
496 3300009147 Ga0114129_10178696 Ga0114129_101786963 397
497 3300009147 Ga0114129_10385035 Ga0114129_103850352 397
498 3300009174 Ga0105241_10150396 Ga0105241_101503961 397
499 3300009177 Ga0105248_10036692 Ga0105248_100366925 397
500 3300009177 Ga0105248_10077842 Ga0105248_100778422 397
501 3300009177 Ga0105248_10309276 Ga0105248_103092762 397
502 3300009553 Ga0105249_10001395 Ga0105249_100013959 397
503 3300009553 Ga0105249_10170406 Ga0105249_101704061 397
504 3300010375 Ga0105239_10038711 Ga0105239_100387113 397
505 3300013105 Ga0157369_10104405 Ga0157369_101044051 397
506 3300013297 Ga0157378_10005920 Ga0157378_1000592011 397
507 3300013306 Ga0163162_10004539 Ga0163162_100045398 397
508 3300013306 Ga0163162_10088110 Ga0163162_100881102 397
509 3300013306 Ga0163162_10162081 Ga0163162_101620812 397
510 3300013307 Ga0157372_10100853 Ga0157372_101008531 397
511 3300013307 Ga0157372_10234355 Ga0157372_102343551 397
512 3300013307 Ga0157372_10481477 Ga0157372_104814772 397
513 3300013308 Ga0157375_10063176 Ga0157375_100631763 397
514 3300013308 Ga0157375_10148606 Ga0157375_101486062 397
515 3300014968 Ga0157379_10061745 Ga0157379_100617452 397
516 3300014968 Ga0157379_10233051 Ga0157379_102330512 397
517 3300017792 Ga0163161_10090582 Ga0163161_100905821 397
518 3300017792 Ga0163161_10163396 Ga0163161_101633962 397
519 3300025315 Ga0207697_10003283 Ga0207697_100032836 397
520 3300025321 Ga0207656_10042204 Ga0207656_100422042 397
521 3300025901 Ga0207688_10014055 Ga0207688_100140551 397
522 3300025904 Ga0207647_10033949 Ga0207647_100339492 397
523 3300025906 Ga0207699_10094264 Ga0207699_100942642 397
524 3300025907 Ga0207645_10000203 Ga0207645_1000020316 397
525 3300025907 Ga0207645_10041414 Ga0207645_100414142 397
526 3300025907 Ga0207645_10123777 Ga0207645_101237772 397
527 3300025908 Ga0207643_10014845 Ga0207643_100148452 397
528 3300025909 Ga0207705_10029065 Ga0207705_100290654 397
529 3300025910 Ga0207684_10136243 Ga0207684_101362432 397
530 3300025912 Ga0207707_10016312 Ga0207707_100163125 397
531 3300025912 Ga0207707_10020807 Ga0207707_100208072 397
532 3300025912 Ga0207707_10021064 Ga0207707_100210642 397
533 3300025912 Ga0207707_10025112 Ga0207707_100251121 397
534 3300025912 Ga0207707_10148080 Ga0207707_101480802 397
535 3300025915 Ga0207693_10043614 Ga0207693_100436143 397
536 3300025916 Ga0207663_10058928 Ga0207663_100589282 397
537 3300025916 Ga0207663_10192157 Ga0207663_101921571 397
538 3300025917 Ga0207660_10001029 Ga0207660_1000102913 397
539 3300025917 Ga0207660_10012858 Ga0207660_100128584 397
540 3300025918 Ga0207662_10003049 Ga0207662_100030492 397
541 3300025918 Ga0207662_10013467 Ga0207662_100134672 397
542 3300025918 Ga0207662_10020139 Ga0207662_100201391 397
543 3300025919 Ga0207657_10040913 Ga0207657_100409135 397
544 3300025919 Ga0207657_10081718 Ga0207657_100817182 397
545 3300025921 Ga0207652_10008351 Ga0207652_100083513 397
546 3300025921 Ga0207652_10020240 Ga0207652_100202401 397
547 3300025922 Ga0207646_10003329 Ga0207646_1000332912 397
548 3300025923 Ga0207681_10011214 Ga0207681_100112141 397
549 3300025923 Ga0207681_10015976 Ga0207681_100159764 397
550 3300025926 Ga0207659_10002780 Ga0207659_100027804 397
551 3300025926 Ga0207659_10041529 Ga0207659_100415293 397
552 3300025928 Ga0207700_10000633 Ga0207700_100006331 397
553 3300025929 Ga0207664_10032021 Ga0207664_100320214 397
554 3300025929 Ga0207664_10206374 Ga0207664_102063742 397
555 3300025932 Ga0207690_10013782 Ga0207690_100137823 397
556 3300025932 Ga0207690_10023216 Ga0207690_100232161 397
557 3300025932 Ga0207690_10058650 Ga0207690_100586501 397
558 3300025932 Ga0207690_10099354 Ga0207690_100993542 397
559 3300025933 Ga0207706_10001427 Ga0207706_100014271 397
560 3300025933 Ga0207706_10005277 Ga0207706_1000527713 397
561 3300025933 Ga0207706_10017143 Ga0207706_100171432 397
562 3300025934 Ga0207686_10024071 Ga0207686_100240713 397
563 3300025935 Ga0207709_10095522 Ga0207709_100955222 397
564 3300025938 Ga0207704_10020086 Ga0207704_100200862 397
565 3300025938 Ga0207704_10039326 Ga0207704_100393262 397
566 3300025939 Ga0207665_10005720 Ga0207665_100057202 397
567 3300025940 Ga0207691_10003767 Ga0207691_100037674 397
568 3300025940 Ga0207691_10034713 Ga0207691_100347132 397
569 3300025940 Ga0207691_10057744 Ga0207691_100577443 397
570 3300025940 Ga0207691_10121497 Ga0207691_101214972 397
571 3300025942 Ga0207689_10004964 Ga0207689_100049647 397
572 3300025944 Ga0207661_10006778 Ga0207661_100067788 397
573 3300025944 Ga0207661_10043299 Ga0207661_100432991 397
574 3300025944 Ga0207661_10142790 Ga0207661_101427902 397
575 3300025945 Ga0207679_10017014 Ga0207679_100170144 397
576 3300025945 Ga0207679_10019179 Ga0207679_100191794 397
577 3300025949 Ga0207667_10131050 Ga0207667_101310502 397
578 3300025960 Ga0207651_10073134 Ga0207651_100731342 397
579 3300025960 Ga0207651_10161934 Ga0207651_101619341 397
580 3300025961 Ga0207712_10019275 Ga0207712_100192753 397
581 3300025972 Ga0207668_10004208 Ga0207668_100042083 397
582 3300025972 Ga0207668_10075221 Ga0207668_100752212 397
583 3300026023 Ga0207677_10170257 Ga0207677_101702572 397
584 3300026067 Ga0207678_10048061 Ga0207678_100480611 397
585 3300026078 Ga0207702_10009373 Ga0207702_100093735 397
586 3300026089 Ga0207648_10016956 Ga0207648_100169565 397
587 3300026089 Ga0207648_10062016 Ga0207648_100620162 397
588 3300026089 Ga0207648_10172456 Ga0207648_101724562 397
589 3300026095 Ga0207676_10021319 Ga0207676_100213192 397
590 3300026116 Ga0207674_10000548 Ga0207674_1000054822 397
591 3300026116 Ga0207674_10006791 Ga0207674_1000679111 397
592 3300026116 Ga0207674_10030455 Ga0207674_100304552 397
593 3300026116 Ga0207674_10145927 Ga0207674_101459272 397
594 3300026118 Ga0207675_100004371 Ga0207675_10000437111 397
595 3300026121 Ga0207683_10010379 Ga0207683_100103798 397
596 3300026121 Ga0207683_10185328 Ga0207683_101853282 397
597 3300026142 Ga0207698_10113617 Ga0207698_101136172 397
598 3300026142 Ga0207698_10156592 Ga0207698_101565922 397
599 3300027876 Ga0209974_10019510 Ga0209974_100195101 397
600 3300028379 Ga0268266_10103390 Ga0268266_101033901 397
601 3300028381 Ga0268264_10095681 Ga0268264_100956812 397
602 3300031548 Ga0307408_100000777 Ga0307408_1000007773 397
603 3300031548 Ga0307408_100227783 Ga0307408_1002277831 397
604 3300031731 Ga0307405_10021160 Ga0307405_100211602 397
605 3300031824 Ga0307413_10003160 Ga0307413_100031602 397
606 3300031824 Ga0307413_10029335 Ga0307413_100293352 397
607 3300031824 Ga0307413_10046486 Ga0307413_100464862 397
608 3300031824 Ga0307413_10120817 Ga0307413_101208172 397
609 3300031852 Ga0307410_10000624 Ga0307410_100006242 397
610 3300031852 Ga0307410_10015033 Ga0307410_100150332 397
611 3300031852 Ga0307410_10037181 Ga0307410_100371812 397
612 3300031852 Ga0307410_10049335 Ga0307410_100493352 397
613 3300031852 Ga0307410_10073931 Ga0307410_100739312 397
614 3300031901 Ga0307406_10036579 Ga0307406_100365791 397
615 3300031901 Ga0307406_10046624 Ga0307406_100466242 397
616 3300031901 Ga0307406_10066057 Ga0307406_100660572 397
617 3300031903 Ga0307407_10006344 Ga0307407_100063444 397
618 3300031903 Ga0307407_10009125 Ga0307407_100091253 397
619 3300031903 Ga0307407_10011201 Ga0307407_100112012 397
620 3300031903 Ga0307407_10025119 Ga0307407_100251191 397
621 3300031903 Ga0307407_10148971 Ga0307407_101489711 397
622 3300031995 Ga0307409_100000657 Ga0307409_1000006571 397
623 3300031995 Ga0307409_100063198 Ga0307409_1000631982 397
624 3300031995 Ga0307409_100068741 Ga0307409_1000687412 397
625 3300031995 Ga0307409_100114409 Ga0307409_1001144092 397
626 3300031995 Ga0307409_100140614 Ga0307409_1001406142 397
627 3300032002 Ga0307416_100000226 Ga0307416_10000022616 397
628 3300032002 Ga0307416_100012079 Ga0307416_1000120795 397
629 3300032002 Ga0307416_100121873 Ga0307416_1001218732 397
630 3300032002 Ga0307416_100218838 Ga0307416_1002188382 397
631 3300032004 Ga0307414_10039699 Ga0307414_100396993 397
632 3300032004 Ga0307414_10047904 Ga0307414_100479042 397
633 3300032005 Ga0307411_10001007 Ga0307411_100010073 397
634 3300032005 Ga0307411_10026785 Ga0307411_100267852 397
635 3300032005 Ga0307411_10068954 Ga0307411_100689542 397
636 3300032005 Ga0307411_10155778 Ga0307411_101557782 397
637 3300032126 Ga0307415_100000602 Ga0307415_1000006022 397
638 3300032126 Ga0307415_100012639 Ga0307415_1000126392 397
639 3300032126 Ga0307415_100143166 Ga0307415_1001431662 397
640 3300032126 Ga0307415_100164152 Ga0307415_1001641521 397
641 3300032126 Ga0307415_100258219 Ga0307415_1002582192 397
642 3300035089 Ga0373944_0001350 Ga0373944_0001350_1225_2418 397
643 3300035119 Ga0373956_0017747 Ga0373956_0017747_480_1673 397
644 3300035120 Ga0373957_0044243 Ga0373957_0044243_250_1443 397
645 3300035170 Ga0373943_0004041 Ga0373943_0004041_4201_5394 397
646 3300035171 Ga0373946_0010509 Ga0373946_0010509_1753_2946 397
647 3300035172 Ga0373955_0064029 Ga0373955_0064029_654_1847 397
648 3300035241 Ga0373961_0018201 Ga0373961_0018201_601_1794 397
649 3300035410 Ga0373924_0012365 Ga0373924_0012365_823_2016 397
650 3300035691 Ga0373931_0129736 Ga0373931_0129736_207_1400 397
651 3300035695 Ga0373927_0008881 Ga0373927_0008881_4052_5245 397
652 3300035724 Ga0373933_0002172 Ga0373933_0002172_146_1339 397
653 3300035725 Ga0373947_0000123 Ga0373947_0000123_32224_33417 397
654 3300036401 Ga0373937_0025310 Ga0373937_0025310_2656_3849 397
655 3300036401 Ga0373937_0193017 Ga0373937_0193017_470_1663 397
656 3300037068 Ga0373925_0001690 Ga0373925_0001690_628_1821 397
657 3300038996 Ga0242420_008901 Ga0242420_008901_188_1381 397
658 3300045051 Ga0451576_0066367 Ga0451576_0066367_2457_3650 397
659 3300045976 Ga0466967_0048290 Ga0466967_0048290_763_1956 397
660 3300045976 Ga0466967_0065164 Ga0466967_0065164_757_1950 397
661 3300046454 Ga0495592_0034643 Ga0495592_0034643_808_2001 397
662 3300046455 Ga0495603_0010885 Ga0495603_0010885_1684_2877 397
663 3300046455 Ga0495603_0024609 Ga0495603_0024609_1767_2960 397
664 3300046459 Ga0495629_0007989 Ga0495629_0007989_6099_7292 397
665 3300046459 Ga0495629_0097417 Ga0495629_0097417_806_1999 397
666 3300046462 Ga0495651_0028761 Ga0495651_0028761_19_1212 397
667 3300046463 Ga0495653_0004013 Ga0495653_0004013_3856_5049 397
668 3300046472 Ga0495580_0000872 Ga0495580_0000872_8142_9335 397
669 3300046472 Ga0495580_0037719 Ga0495580_0037719_1497_2690 397
670 3300046472 Ga0495580_0058023 Ga0495580_0058023_821_2014 397
671 3300046473 Ga0495582_0000388 Ga0495582_0000388_18295_19488 397
672 3300046473 Ga0495582_0033461 Ga0495582_0033461_1130_2323 397
673 3300046475 Ga0495639_0000117 Ga0495639_0000117_5948_7141 397
674 3300046477 Ga0495664_0020063 Ga0495664_0020063_778_1971 397
675 3300046499 Ga0495594_0007118 Ga0495594_0007118_340_1533 397
676 3300046499 Ga0495594_0012963 Ga0495594_0012963_2863_4056 397
677 3300046499 Ga0495594_0014285 Ga0495594_0014285_1157_2350 397
678 3300046500 Ga0495596_0037909 Ga0495596_0037909_564_1757 397
679 3300046511 Ga0495608_0036480 Ga0495608_0036480_225_1418 397
680 3300046514 Ga0495618_0067214 Ga0495618_0067214_564_1757 397
681 3300046514 Ga0495618_0083113 Ga0495618_0083113_525_1718 397
682 3300046516 Ga0495628_0027091 Ga0495628_0027091_886_2079 397
683 3300046517 Ga0495630_0007914 Ga0495630_0007914_658_1851 397
684 3300046517 Ga0495630_0097933 Ga0495630_0097933_914_2107 397
685 3300046526 Ga0495666_0012929 Ga0495666_0012929_2283_3476 397
686 3300046529 Ga0495652_0022862 Ga0495652_0022862_1643_2836 397
687 3300046531 Ga0495665_0000362 Ga0495665_0000362_20206_21399 397
688 3300046535 Ga0495586_0017841 Ga0495586_0017841_1085_2278 397
689 3300046536 Ga0495587_0001834 Ga0495587_0001834_9283_10476 397
690 3300046543 Ga0495645_0018448 Ga0495645_0018448_3324_4517 397
691 3300046559 Ga0495667_0011841 Ga0495667_0011841_664_1857 397
692 3300046559 Ga0495667_0037956 Ga0495667_0037956_875_2068 397
693 3300046663 Ga0495635_0022487 Ga0495635_0022487_1888_3081 397
694 3300046674 Ga0495588_0008939 Ga0495588_0008939_2190_3383 397
695 3300046675 Ga0495657_0003641 Ga0495657_0003641_1937_3130 397
696 3300046675 Ga0495657_0056374 Ga0495657_0056374_1125_2318 397
697 3300046678 Ga0495599_0050452 Ga0495599_0050452_259_1452 397
698 3300046679 Ga0495623_0033095 Ga0495623_0033095_558_1751 397
699 3300046680 Ga0495646_0008083 Ga0495646_0008083_233_1426 397
700 3300046681 Ga0495647_0003235 Ga0495647_0003235_886_2079 397
701 3300046683 Ga0495658_0000095 Ga0495658_0000095_15260_16453 397
702 3300046683 Ga0495658_0055479 Ga0495658_0055479_429_1622 397
703 3300046689 Ga0495613_0040549 Ga0495613_0040549_2237_3430 397
704 3300046689 Ga0495613_0044415 Ga0495613_0044415_1992_3185 397
705 3300046689 Ga0495613_0068611 Ga0495613_0068611_1321_2514 397
706 3300046809 Ga0495600_0001787 Ga0495600_0001787_8008_9201 397
707 3300047315 Ga0495581_0000662 Ga0495581_0000662_6960_8153 397
708 3300047317 Ga0495604_0120774 Ga0495604_0120774_559_1752 397
709 3300047319 Ga0495674_0081416 Ga0495674_0081416_565_1758 397
710 3300047319 Ga0495674_0089153 Ga0495674_0089153_225_1418 397
711 3300047320 Ga0495672_0016122 Ga0495672_0016122_1384_2577 397
712 3300047322 Ga0495680_0027537 Ga0495680_0027537_2389_3582 397
713 3300047322 Ga0495680_0037480 Ga0495680_0037480_1638_2831 397
714 3300047471 Ga0495684_0007844 Ga0495684_0007844_2156_3349 397
715 3300047673 Ga0495593_0013460 Ga0495593_0013460_1283_2476 397
716 3300048088 Ga0495602_0019139 Ga0495602_0019139_4772_5965 397
717 3300048089 Ga0495614_0000104 Ga0495614_0000104_15237_16430 397
718 3300048907 Ga0496104_0002179 Ga0496104_0002179_14019_15212 397
719 3300048907 Ga0496104_0023962 Ga0496104_0023962_393_1586 397
720 3300048909 Ga0496106_0069033 Ga0496106_0069033_772_1977 397
721 3300048911 Ga0496108_0000799 Ga0496108_0000799_21692_22885 397
722 3300048911 Ga0496108_0001419 Ga0496108_0001419_14875_16068 397
723 3300048911 Ga0496108_0052844 Ga0496108_0052844_958_2151 397
724 3300048912 Ga0496109_0000316 Ga0496109_0000316_22943_24136 397
725 3300048912 Ga0496109_0003739 Ga0496109_0003739_5261_6454 397
726 3300048912 Ga0496109_0171286 Ga0496109_0171286_517_1710 397
727 3300048913 Ga0496110_0282850 Ga0496110_0282850_197_1390 397
728 3300048915 Ga0496112_0000406 Ga0496112_0000406_20730_21923 397
729 3300048915 Ga0496112_0010713 Ga0496112_0010713_1623_2816 397
730 3300048915 Ga0496112_0045567 Ga0496112_0045567_2005_3198 397
731 3300048915 Ga0496112_0112644 Ga0496112_0112644_708_1901 397
732 3300048915 Ga0496112_0147083 Ga0496112_0147083_639_1844 397
733 3300048916 Ga0496113_0000919 Ga0496113_0000919_11148_12341 397
734 3300048916 Ga0496113_0004653 Ga0496113_0004653_721_1914 397
735 3300048918 Ga0496115_0024238 Ga0496115_0024238_265_1458 397
736 3300049570 Ga0501033_0131997 Ga0501033_0131997_567_1760 397
737 3300049574 Ga0501038_0026378 Ga0501038_0026378_3540_4733 397
738 3300049575 Ga0501039_0017723 Ga0501039_0017723_3167_4360 397
739 3300049576 Ga0501040_0022105 Ga0501040_0022105_2424_3617 397
740 3300049579 Ga0501043_0079879 Ga0501043_0079879_734_1927 397
741 3300049582 Ga0501048_0024006 Ga0501048_0024006_990_2183 397
742 3300049584 Ga0501068_0069777 Ga0501068_0069777_106_1299 397
743 3300049585 Ga0501069_0012716 Ga0501069_0012716_1010_2203 397
744 3300049587 Ga0501071_0079192 Ga0501071_0079192_761_1954 397
745 3300049590 Ga0501074_0028718 Ga0501074_0028718_746_1939 397
746 3300049591 Ga0501075_0104160 Ga0501075_0104160_417_1610 397
747 3300049592 Ga0501076_0103602 Ga0501076_0103602_96_1289 397
748 3300049593 Ga0501077_0000220 Ga0501077_0000220_2647_3840 397
749 3300049660 Ga0501216_001896 Ga0501216_001896_505_1698 397
750 3300049669 Ga0501235_004051 Ga0501235_004051_312_1505 397
751 3300049679 Ga0501249_027364 Ga0501249_027364_55_1248 397
752 3300049704 Ga0501221_003394 Ga0501221_003394_29_1222 397
753 3300049705 Ga0501225_0022550 Ga0501225_0022550_75_1268 397
754 3300049705 Ga0501225_0037153 Ga0501225_0037153_136_1329 397
755 3300049741 Ga0501079_0174662 Ga0501079_0174662_427_1620 397
756 3300049741 Ga0501079_0255190 Ga0501079_0255190_49_1242 397
757 3300049744 Ga0501083_0025367 Ga0501083_0025367_678_1871 397
758 3300049760 Ga0501263_000245 Ga0501263_000245_2115_3308 397
759 3300049765 Ga0501268_000875 Ga0501268_000875_175_1368 397
760 3300049769 Ga0501272_003614 Ga0501272_003614_189_1382 397
761 3300049770 Ga0501273_001040 Ga0501273_001040_11_1204 397
762 3300049779 Ga0501283_012061 Ga0501283_012061_15_1208 397
763 3300049824 Ga0501045_0033116 Ga0501045_0033116_1754_2947 397
764 3300049824 Ga0501045_0111354 Ga0501045_0111354_726_1919 397
765 3300050507 nmdc:mga05p37_154357_c1 nmdc:mga05p37_154357_c1_17_1210 397
766 3300050509 nmdc:mga0qj67_100788_c1 nmdc:mga0qj67_100788_c1_600_1793 397
767 3300050510 nmdc:mga06r32_18090_c1 nmdc:mga06r32_18090_c1_4033_5226 397
768 3300050510 nmdc:mga06r32_23503_c1 nmdc:mga06r32_23503_c1_970_2163 397
769 3300050511 nmdc:mga08y16_120559_c1 nmdc:mga08y16_120559_c1_168_1361 397
770 3300050511 nmdc:mga08y16_84919_c1 nmdc:mga08y16_84919_c1_1536_2729 397
771 3300050512 nmdc:mga0n895_11550_c1 nmdc:mga0n895_11550_c1_1291_2484 397
772 3300050515 nmdc:mga0a205_138780_c1 nmdc:mga0a205_138780_c1_328_1521 397
773 3300050515 nmdc:mga0a205_89028_c1 nmdc:mga0a205_89028_c1_1105_2298 397
774 3300053084 Ga0495595_0073157 Ga0495595_0073157_420_1613 397
775 3300053085 Ga0495619_0006382 Ga0495619_0006382_5074_6267 397
776 3300054114 Ga0501084_0008692 Ga0501084_0008692_3902_5095 397
777 3300054114 Ga0501084_0018949 Ga0501084_0018949_639_1832 397
778 3300059421 Ga0590071_000231 Ga0590071_000231_15108_16301 397
779 3300059423 Ga0590074_008417 Ga0590074_008417_95_1288 397
780 3300060353 Ga0501082_0032750 Ga0501082_0032750_131_1324 397
781 3300060353 Ga0501082_0106768 Ga0501082_0106768_1095_2288 397
782 3300061734 Ga0530510_0007306 Ga0530510_0007306_635_1828 397
783 3300005289 Ga0065704_10112978 Ga0065704_101129782 398
784 3300005336 Ga0070680_100002220 Ga0070680_1000022207 398
785 3300005336 Ga0070680_100109013 Ga0070680_1001090131 398
786 3300005336 Ga0070680_100177268 Ga0070680_1001772682 398
787 3300005338 Ga0068868_100041382 Ga0068868_1000413822 398
788 3300005339 Ga0070660_100052733 Ga0070660_1000527332 398
789 3300005366 Ga0070659_100006082 Ga0070659_1000060822 398
790 3300005458 Ga0070681_10038262 Ga0070681_100382622 398
791 3300005458 Ga0070681_10194808 Ga0070681_101948082 398
792 3300005458 Ga0070681_10264515 Ga0070681_102645152 398
793 3300005459 Ga0068867_100037723 Ga0068867_1000377232 398
794 3300005467 Ga0070706_100036892 Ga0070706_1000368922 398
795 3300005518 Ga0070699_100087671 Ga0070699_1000876712 398
796 3300005530 Ga0070679_100011988 Ga0070679_1000119882 398
797 3300005530 Ga0070679_100236446 Ga0070679_1002364462 398
798 3300005536 Ga0070697_100075136 Ga0070697_1000751362 398
799 3300005718 Ga0068866_10014044 Ga0068866_100140442 398
800 3300005844 Ga0068862_100071909 Ga0068862_1000719092 398
801 3300007788 Ga0099795_10009855 Ga0099795_100098552 398
802 3300009098 Ga0105245_10062376 Ga0105245_100623763 398
803 3300009098 Ga0105245_10305719 Ga0105245_103057192 398
804 3300010159 Ga0099796_10007713 Ga0099796_100077132 398
805 3300013307 Ga0157372_10006571 Ga0157372_100065715 398
806 3300025910 Ga0207684_10030486 Ga0207684_100304862 398
807 3300025912 Ga0207707_10076140 Ga0207707_100761402 398
808 3300025919 Ga0207657_10039831 Ga0207657_100398312 398
809 3300025921 Ga0207652_10015274 Ga0207652_100152742 398
810 3300025921 Ga0207652_10061155 Ga0207652_100611554 398
811 3300025923 Ga0207681_10036254 Ga0207681_100362542 398
812 3300025932 Ga0207690_10078522 Ga0207690_100785222 398
813 3300026075 Ga0207708_10110984 Ga0207708_101109842 398
814 3300026089 Ga0207648_10082606 Ga0207648_100826062 398
815 3300027526 Ga0209968_1003659 Ga0209968_10036592 398
816 3300027543 Ga0209999_1003194 Ga0209999_10031942 398
817 3300035170 Ga0373943_0028374 Ga0373943_0028374_513_1709 398
818 3300046674 Ga0495588_0007207 Ga0495588_0007207_2007_3203 398
819 3300048915 Ga0496112_0123619 Ga0496112_0123619_1020_2216 398
820 3300005327 Ga0070658_10118707 Ga0070658_101187071 399
821 3300005329 Ga0070683_100000506 Ga0070683_10000050612 399
822 3300005331 Ga0070670_100045579 Ga0070670_1000455794 399
823 3300005339 Ga0070660_100071160 Ga0070660_1000711602 399
824 3300005340 Ga0070689_100091258 Ga0070689_1000912581 399
825 3300005365 Ga0070688_100033411 Ga0070688_1000334112 399
826 3300005435 Ga0070714_100043001 Ga0070714_1000430014 399
827 3300005439 Ga0070711_100103447 Ga0070711_1001034472 399
828 3300005535 Ga0070684_100006038 Ga0070684_1000060382 399
829 3300005535 Ga0070684_100255519 Ga0070684_1002555192 399
830 3300005578 Ga0068854_100015847 Ga0068854_1000158472 399
831 3300005617 Ga0068859_100080324 Ga0068859_1000803243 399
832 3300005618 Ga0068864_100200477 Ga0068864_1002004771 399
833 3300006931 Ga0097620_100080316 Ga0097620_1000803163 399
834 3300009545 Ga0105237_10138912 Ga0105237_101389122 399
835 3300009551 Ga0105238_10031538 Ga0105238_100315385 399
836 3300009551 Ga0105238_10225284 Ga0105238_102252842 399
837 3300013104 Ga0157370_10158501 Ga0157370_101585012 399
838 3300013105 Ga0157369_10153156 Ga0157369_101531562 399
839 3300013306 Ga0163162_10081707 Ga0163162_100817072 399
840 3300013307 Ga0157372_10060145 Ga0157372_100601453 399
841 3300025908 Ga0207643_10075917 Ga0207643_100759172 399
842 3300025913 Ga0207695_10150376 Ga0207695_101503762 399
843 3300025916 Ga0207663_10080454 Ga0207663_100804542 399
844 3300025919 Ga0207657_10013961 Ga0207657_100139617 399
845 3300025924 Ga0207694_10026287 Ga0207694_100262874 399
846 3300025929 Ga0207664_10052560 Ga0207664_100525602 399
847 3300025944 Ga0207661_10001605 Ga0207661_100016059 399
848 3300025949 Ga0207667_10060764 Ga0207667_100607644 399
849 3300025981 Ga0207640_10090896 Ga0207640_100908962 399
850 3300025986 Ga0207658_10071854 Ga0207658_100718542 399
851 3300026067 Ga0207678_10009416 Ga0207678_100094167 399
852 3300036401 Ga0373937_0095959 Ga0373937_0095959_551_1750 399
853 3300037312 Ga0395899_0074662 Ga0395899_0074662_39_1274 399
854 3300037418 Ga0395900_0047025 Ga0395900_0047025_1255_2490 399
855 3300037471 Ga0395905_0084769 Ga0395905_0084769_1626_2861 399
856 3300038443 Ga0395901_0036042 Ga0395901_0036042_1244_2479 399
857 3300039437 Ga0436365_1784820 Ga0436365_1784820_14_1279 399
858 3300044684 Ga0466966_0086770 Ga0466966_0086770_663_1862 399
859 3300045049 Ga0466959_0110690 Ga0466959_0110690_10_1209 399
860 3300046454 Ga0495592_0217349 Ga0495592_0217349_43_1242 399
861 3300046459 Ga0495629_0076455 Ga0495629_0076455_134_1333 399
862 3300046462 Ga0495651_0006822 Ga0495651_0006822_5490_6689 399
863 3300046463 Ga0495653_0102397 Ga0495653_0102397_764_1963 399
864 3300046529 Ga0495652_0011768 Ga0495652_0011768_465_1664 399
865 3300046536 Ga0495587_0005095 Ga0495587_0005095_4468_5667 399
866 3300046559 Ga0495667_0010411 Ga0495667_0010411_1011_2210 399
867 3300046663 Ga0495635_0036000 Ga0495635_0036000_183_1382 399
868 3300046678 Ga0495599_0003334 Ga0495599_0003334_3585_4784 399
869 3300046679 Ga0495623_0063108 Ga0495623_0063108_775_1974 399
870 3300047322 Ga0495680_0085821 Ga0495680_0085821_1131_2330 399
871 3300047471 Ga0495684_0010866 Ga0495684_0010866_3071_4270 399
872 3300047471 Ga0495684_0065305 Ga0495684_0065305_851_2050 399
873 3300048088 Ga0495602_0003256 Ga0495602_0003256_10909_12108 399
874 3300053085 Ga0495619_0025490 Ga0495619_0025490_2352_3551 399
875 3300005329 Ga0070683_100026723 Ga0070683_1000267233 400
876 3300005445 Ga0070708_100000007 Ga0070708_10000000779 400
877 3300005468 Ga0070707_100026308 Ga0070707_1000263083 400
878 3300005535 Ga0070684_100015321 Ga0070684_1000153216 400
879 3300005535 Ga0070684_100158616 Ga0070684_1001586162 400
880 3300005563 Ga0068855_100061263 Ga0068855_1000612632 400
881 3300009174 Ga0105241_10000050 Ga0105241_1000005024 400
882 3300013104 Ga0157370_10002257 Ga0157370_1000225712 400
883 3300025906 Ga0207699_10075953 Ga0207699_100759531 400
884 3300025911 Ga0207654_10000482 Ga0207654_100004826 400
885 3300025913 Ga0207695_10047168 Ga0207695_100471683 400
886 3300025944 Ga0207661_10157345 Ga0207661_101573451 400
887 3300025949 Ga0207667_10186358 Ga0207667_101863582 400
888 3300035170 Ga0373943_0064689 Ga0373943_0064689_462_1664 400
889 3300035725 Ga0373947_0056991 Ga0373947_0056991_658_1860 400
890 3300036401 Ga0373937_0024715 Ga0373937_0024715_2294_3496 400
891 3300046462 Ga0495651_0020785 Ga0495651_0020785_1187_2389 400
892 3300046473 Ga0495582_0070374 Ga0495582_0070374_662_1864 400
893 3300046475 Ga0495639_0015918 Ga0495639_0015918_1082_2284 400
894 3300046535 Ga0495586_0004632 Ga0495586_0004632_1112_2314 400
895 3300046536 Ga0495587_0003085 Ga0495587_0003085_4118_5320 400
896 3300046543 Ga0495645_0002661 Ga0495645_0002661_9329_10531 400
897 3300046679 Ga0495623_0009653 Ga0495623_0009653_3815_5017 400
898 3300046689 Ga0495613_0226536 Ga0495613_0226536_83_1285 400
899 3300047319 Ga0495674_0081175 Ga0495674_0081175_557_1759 400
900 3300047673 Ga0495593_0032872 Ga0495593_0032872_651_1853 400
901 3300053084 Ga0495595_0011150 Ga0495595_0011150_1524_2726 400
902 3300005366 Ga0070659_100179222 Ga0070659_1001792222 402
903 3300005614 Ga0068856_100237183 Ga0068856_1002371832 402
904 3300005618 Ga0068864_100041997 Ga0068864_1000419973 402
905 3300009098 Ga0105245_10145948 Ga0105245_101459482 402
906 3300010375 Ga0105239_10036411 Ga0105239_100364111 402
907 3300011119 Ga0105246_10004459 Ga0105246_100044592 402
908 3300025925 Ga0207650_10079944 Ga0207650_100799442 402
909 3300026035 Ga0207703_10035822 Ga0207703_100358223 402
910 3300026078 Ga0207702_10125561 Ga0207702_101255611 402
911 3300026095 Ga0207676_10026664 Ga0207676_100266643 402
912 3300049570 Ga0501033_0128168 Ga0501033_0128168_564_1778 402
913 3300049571 Ga0501034_0055921 Ga0501034_0055921_27_1241 402
914 3300049573 Ga0501037_0111814 Ga0501037_0111814_730_1944 402
915 3300049579 Ga0501043_0046584 Ga0501043_0046584_493_1707 402
916 3300049581 Ga0501047_0013952 Ga0501047_0013952_329_1543 402
917 3300049822 Ga0501035_0052506 Ga0501035_0052506_1190_2404 402
918 3300049823 Ga0501044_0008920 Ga0501044_0008920_8565_9779 402
919 3300004799 Ga0058863_10044833 Ga0058863_100448332 405
920 3300005336 Ga0070680_100187638 Ga0070680_1001876382 405
921 3300005530 Ga0070679_100054355 Ga0070679_1000543554 405
922 3300025917 Ga0207660_10070167 Ga0207660_100701672 405

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20510

HgmA_N

Homogentisate 1,2-dioxygenase N-terminal

105

263

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.823 91 179
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.8217 2 405
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.8179 2 405
4aq2-assembly2.cif.gz_L resting state of homogentisate 1,2-dioxygenase 0.8009 1 405
4aq2-assembly2.cif.gz_L resting state of homogentisate 1,2-dioxygenase 0.7991 1 405
ID Description Score Start End Superfamily
af_G3V6C2_268_404_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8289 256 368 2.60.120.10
af_Q2G2J4_1_140_2.60.120.280 Mainly Beta;Sandwich;Jelly Rolls;Regulatory protein AraC 0.8254 96 179 2.60.120.280
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8199 90 179 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8168 91 179 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8139 91 179 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2E3LUX1-F1-model_v4 Homogentisate 1,2-dioxygenase 0.985 1 389 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A838R873-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9843 1 277 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A7V9PIP7-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9827 1 405 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A382JM78-F1-model_v4 Homogentisate 1,2-dioxygenase N-terminal domain-containing protein 0.982 10 389 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A838R873-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9808 1 277 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.35 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map