F485803
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 922 | 360 | 922 | 395 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1784820|Ga0436365_1784820_14_1279 |
| Length | 421 |
| Sequence | LLSPALFSGGVVPIYHTLGQVPRKRHTAMRKADGGVYAEQLMGHEGFTGTSSLLYHVHQPTTVQSVRRVRELVWEADDDATLKHRHFRTSQARAGGSPTLDRTPLLFNADIGMLYVEPDEQDAHFYRNAQADEVVYVAKGKGVLETQFGDLPYRDGDYVVIHRGIMHRWRLDKASPQKFVVFESRGHVRWPKRYRNEFGQLVEGAPYSERDIRRPMELKTHDEMGDFPILVKQYDGLNELVLDHHPFDVVGWDGYFYPWIFNIHDFEPIVGRVHQPPPVHQTFQGDGFVICSFCPRPYDFDPNAIPAPYNHSNVDSDEVLYYASEEFMSRKGIEFGSVTHHPDGIPHGPHPGRYEASIGQKFTNELAVMMDSFRPLKVAKAATTIEDPSYHRSWIEAQHERVSAQKSGAPNAGGPALPLTD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 222 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 231 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 315 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 316 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 317 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 318 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 320 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 322 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 323 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 324 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 325 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 326 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 327 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 328 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 333 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 334 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 336 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 337 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 355 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 356 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 358 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.98 |
| Nodule | 0 |
| Rhizoplane | 4.01 |
| Rhizosphere | 94.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_10044833 | 3300004799 | Bacteria | 3477 |
| 2 | Ga0058862_12681691 | 3300004803 | Bacteria | 2756 |
| 3 | Ga0065704_10112978 | 3300005289 | Bacteria | 1922 |
| 4 | Ga0065712_10068461 | 3300005290 | Bacteria | 10472 |
| 5 | Ga0065712_10087269 | 3300005290 | Bacteria | 2588 |
| 6 | Ga0065712_10155362 | 3300005290 | Bacteria | 1339 |
| 7 | Ga0065715_10001248 | 3300005293 | Bacteria | 12812 |
| 8 | Ga0065707_10007385 | 3300005295 | Bacteria | 2621 |
| 9 | Ga0065707_10085732 | 3300005295 | Bacteria | 5923 |
| 10 | Ga0065707_10147578 | 3300005295 | Bacteria | 1696 |
| 11 | Ga0070658_10007500 | 3300005327 | Bacteria | 8802 |
| 12 | Ga0070658_10013583 | 3300005327 | Bacteria | 6533 |
| 13 | Ga0070658_10118707 | 3300005327 | Bacteria | 2196 |
| 14 | Ga0070658_10210928 | 3300005327 | Bacteria | 1641 |
| 15 | Ga0070676_10001729 | 3300005328 | Bacteria | 11110 |
| 16 | Ga0070676_10025287 | 3300005328 | Bacteria | 3354 |
| 17 | Ga0070683_100000506 | 3300005329 | Bacteria | 27303 |
| 18 | Ga0070683_100004796 | 3300005329 | Bacteria | 11190 |
| 19 | Ga0070683_100026723 | 3300005329 | Bacteria | 5201 |
| 20 | Ga0070683_100090149 | 3300005329 | Bacteria | 2878 |
| 21 | Ga0070683_100097740 | 3300005329 | Bacteria | 2762 |
| 22 | Ga0070683_100364290 | 3300005329 | Unclassified | 1377 |
| 23 | Ga0070690_100011022 | 3300005330 | Bacteria | 5279 |
| 24 | Ga0070670_100014299 | 3300005331 | Bacteria | 6810 |
| 25 | Ga0070670_100045579 | 3300005331 | Bacteria | 3770 |
| 26 | Ga0070677_10016654 | 3300005333 | Bacteria | 2620 |
| 27 | Ga0068869_100007356 | 3300005334 | Bacteria | 7028 |
| 28 | Ga0068869_100027937 | 3300005334 | Bacteria | 3937 |
| 29 | Ga0070680_100001150 | 3300005336 | Bacteria | 18989 |
| 30 | Ga0070680_100002220 | 3300005336 | Bacteria | 14321 |
| 31 | Ga0070680_100015762 | 3300005336 | Bacteria | 5934 |
| 32 | Ga0070680_100109013 | 3300005336 | Bacteria | 2304 |
| 33 | Ga0070680_100177268 | 3300005336 | Bacteria | 1794 |
| 34 | Ga0070680_100187638 | 3300005336 | Bacteria | 1742 |
| 35 | Ga0070680_100246993 | 3300005336 | Bacteria | 1509 |
| 36 | Ga0070682_100001803 | 3300005337 | Bacteria | 11960 |
| 37 | Ga0068868_100041382 | 3300005338 | Bacteria | 3590 |
| 38 | Ga0070660_100006566 | 3300005339 | Bacteria | 8071 |
| 39 | Ga0070660_100009811 | 3300005339 | Bacteria | 6749 |
| 40 | Ga0070660_100052733 | 3300005339 | Bacteria | 3136 |
| 41 | Ga0070660_100054075 | 3300005339 | Bacteria | 3098 |
| 42 | Ga0070660_100071160 | 3300005339 | Bacteria | 2715 |
| 43 | Ga0070660_100227058 | 3300005339 | Bacteria | 1519 |
| 44 | Ga0070689_100023013 | 3300005340 | Bacteria | 4659 |
| 45 | Ga0070689_100043232 | 3300005340 | Bacteria | 3462 |
| 46 | Ga0070689_100091258 | 3300005340 | Bacteria | 2401 |
| 47 | Ga0070691_10003961 | 3300005341 | Bacteria | 6701 |
| 48 | Ga0070661_100013735 | 3300005344 | Bacteria | 5688 |
| 49 | Ga0070692_10006257 | 3300005345 | Bacteria | 5157 |
| 50 | Ga0070692_10025337 | 3300005345 | Bacteria | 2922 |
| 51 | Ga0070668_100001256 | 3300005347 | Bacteria | 18100 |
| 52 | Ga0070668_100059097 | 3300005347 | Bacteria | 2967 |
| 53 | Ga0070669_100061421 | 3300005353 | Bacteria | 2761 |
| 54 | Ga0070669_100107514 | 3300005353 | Bacteria | 2113 |
| 55 | Ga0070675_100004386 | 3300005354 | Bacteria | 10764 |
| 56 | Ga0070675_100060255 | 3300005354 | Bacteria | 3133 |
| 57 | Ga0070675_100305732 | 3300005354 | Unclassified | 1402 |
| 58 | Ga0070671_100014034 | 3300005355 | Bacteria | 6468 |
| 59 | Ga0070671_100034859 | 3300005355 | Bacteria | 4167 |
| 60 | Ga0070671_100042215 | 3300005355 | Bacteria | 3791 |
| 61 | Ga0070674_100002002 | 3300005356 | Bacteria | 11153 |
| 62 | Ga0070674_100031297 | 3300005356 | Bacteria | 3525 |
| 63 | Ga0070673_100024811 | 3300005364 | Bacteria | 4402 |
| 64 | Ga0070673_100032333 | 3300005364 | Unclassified | 3938 |
| 65 | Ga0070688_100001194 | 3300005365 | Bacteria | 12918 |
| 66 | Ga0070688_100033411 | 3300005365 | Bacteria | 3109 |
| 67 | Ga0070659_100006082 | 3300005366 | Bacteria | 8705 |
| 68 | Ga0070659_100055898 | 3300005366 | Bacteria | 3112 |
| 69 | Ga0070659_100101459 | 3300005366 | Bacteria | 2316 |
| 70 | Ga0070659_100131520 | 3300005366 | Bacteria | 2033 |
| 71 | Ga0070659_100179222 | 3300005366 | Bacteria | 1738 |
| 72 | Ga0070667_100005119 | 3300005367 | Bacteria | 10974 |
| 73 | Ga0070667_100172753 | 3300005367 | Bacteria | 1909 |
| 74 | Ga0070667_100231787 | 3300005367 | Bacteria | 1647 |
| 75 | Ga0070709_10026893 | 3300005434 | Bacteria | 3415 |
| 76 | Ga0070714_100001589 | 3300005435 | Bacteria | 16510 |
| 77 | Ga0070714_100035823 | 3300005435 | Bacteria | 4160 |
| 78 | Ga0070714_100043001 | 3300005435 | Bacteria | 3818 |
| 79 | Ga0070713_100000223 | 3300005436 | Bacteria | 37729 |
| 80 | Ga0070701_10027207 | 3300005438 | Bacteria | 2799 |
| 81 | Ga0070701_10041833 | 3300005438 | Bacteria | 2336 |
| 82 | Ga0070711_100077594 | 3300005439 | Bacteria | 2358 |
| 83 | Ga0070711_100103447 | 3300005439 | Bacteria | 2075 |
| 84 | Ga0070700_100024511 | 3300005441 | Bacteria | 3544 |
| 85 | Ga0070694_100070776 | 3300005444 | Bacteria | 2403 |
| 86 | Ga0070694_100127571 | 3300005444 | Bacteria | 1833 |
| 87 | Ga0070694_100154517 | 3300005444 | Bacteria | 1679 |
| 88 | Ga0070708_100000007 | 3300005445 | Bacteria | 146443 |
| 89 | Ga0070708_100030039 | 3300005445 | Bacteria | 4693 |
| 90 | Ga0070708_100030224 | 3300005445 | Bacteria | 4682 |
| 91 | Ga0070708_100109496 | 3300005445 | Bacteria | 2538 |
| 92 | Ga0070678_100054667 | 3300005456 | Bacteria | 2911 |
| 93 | Ga0070662_100005443 | 3300005457 | Bacteria | 8132 |
| 94 | Ga0070681_10000978 | 3300005458 | Bacteria | 24153 |
| 95 | Ga0070681_10001876 | 3300005458 | Bacteria | 18970 |
| 96 | Ga0070681_10016210 | 3300005458 | Bacteria | 7431 |
| 97 | Ga0070681_10016523 | 3300005458 | Bacteria | 7370 |
| 98 | Ga0070681_10027504 | 3300005458 | Bacteria | 5717 |
| 99 | Ga0070681_10035919 | 3300005458 | Bacteria | 4978 |
| 100 | Ga0070681_10038262 | 3300005458 | Bacteria | 4810 |
| 101 | Ga0070681_10065418 | 3300005458 | Bacteria | 3604 |
| 102 | Ga0070681_10093955 | 3300005458 | Bacteria | 2948 |
| 103 | Ga0070681_10194808 | 3300005458 | Bacteria | 1946 |
| 104 | Ga0070681_10264515 | 3300005458 | Bacteria | 1632 |
| 105 | Ga0068867_100037723 | 3300005459 | Bacteria | 3514 |
| 106 | Ga0068867_100053382 | 3300005459 | Bacteria | 2985 |
| 107 | Ga0068867_100054180 | 3300005459 | Bacteria | 2963 |
| 108 | Ga0070685_10007599 | 3300005466 | Bacteria | 5546 |
| 109 | Ga0070706_100036892 | 3300005467 | Bacteria | 4515 |
| 110 | Ga0070707_100001546 | 3300005468 | Bacteria | 22369 |
| 111 | Ga0070707_100026308 | 3300005468 | Bacteria | 5524 |
| 112 | Ga0070707_100029839 | 3300005468 | Bacteria | 5190 |
| 113 | Ga0070707_100036399 | 3300005468 | Bacteria | 4696 |
| 114 | Ga0070707_100151413 | 3300005468 | Bacteria | 2259 |
| 115 | Ga0070698_100000304 | 3300005471 | Bacteria | 50155 |
| 116 | Ga0070698_100016906 | 3300005471 | Bacteria | 7693 |
| 117 | Ga0070698_100017768 | 3300005471 | Bacteria | 7491 |
| 118 | Ga0070698_100091070 | 3300005471 | Bacteria | 3032 |
| 119 | Ga0070699_100085936 | 3300005518 | Bacteria | 2745 |
| 120 | Ga0070699_100087671 | 3300005518 | Bacteria | 2717 |
| 121 | Ga0070699_100093379 | 3300005518 | Bacteria | 2633 |
| 122 | Ga0070699_100134093 | 3300005518 | Bacteria | 2184 |
| 123 | Ga0070679_100007387 | 3300005530 | Bacteria | 10270 |
| 124 | Ga0070679_100011988 | 3300005530 | Bacteria | 8275 |
| 125 | Ga0070679_100015830 | 3300005530 | Bacteria | 7256 |
| 126 | Ga0070679_100020198 | 3300005530 | Bacteria | 6493 |
| 127 | Ga0070679_100026564 | 3300005530 | Bacteria | 5691 |
| 128 | Ga0070679_100054355 | 3300005530 | Bacteria | 3986 |
| 129 | Ga0070679_100099059 | 3300005530 | Bacteria | 2902 |
| 130 | Ga0070679_100104869 | 3300005530 | Bacteria | 2813 |
| 131 | Ga0070679_100236446 | 3300005530 | Bacteria | 1786 |
| 132 | Ga0070684_100000532 | 3300005535 | Bacteria | 26110 |
| 133 | Ga0070684_100003959 | 3300005535 | Bacteria | 11219 |
| 134 | Ga0070684_100006038 | 3300005535 | Bacteria | 9333 |
| 135 | Ga0070684_100014509 | 3300005535 | Bacteria | 6386 |
| 136 | Ga0070684_100015321 | 3300005535 | Bacteria | 6239 |
| 137 | Ga0070684_100142317 | 3300005535 | Bacteria | 2169 |
| 138 | Ga0070684_100158616 | 3300005535 | Bacteria | 2052 |
| 139 | Ga0070684_100255519 | 3300005535 | Bacteria | 1602 |
| 140 | Ga0070697_100028334 | 3300005536 | Bacteria | 4484 |
| 141 | Ga0070697_100075136 | 3300005536 | Bacteria | 2777 |
| 142 | Ga0068853_100014834 | 3300005539 | Bacteria | 6398 |
| 143 | Ga0070672_100008586 | 3300005543 | Bacteria | 6997 |
| 144 | Ga0070672_100010531 | 3300005543 | Bacteria | 6418 |
| 145 | Ga0070672_100092229 | 3300005543 | Bacteria | 2445 |
| 146 | Ga0070686_100016804 | 3300005544 | Bacteria | 4262 |
| 147 | Ga0070696_100000366 | 3300005546 | Bacteria | 27619 |
| 148 | Ga0070696_100000824 | 3300005546 | Bacteria | 19978 |
| 149 | Ga0070696_100004572 | 3300005546 | Bacteria | 9237 |
| 150 | Ga0070696_100022348 | 3300005546 | Bacteria | 4296 |
| 151 | Ga0070696_100101642 | 3300005546 | Bacteria | 2061 |
| 152 | Ga0070693_100002493 | 3300005547 | Bacteria | 8483 |
| 153 | Ga0070693_100122508 | 3300005547 | Bacteria | 1614 |
| 154 | Ga0070665_100030040 | 3300005548 | Bacteria | 5469 |
| 155 | Ga0070665_100037055 | 3300005548 | Bacteria | 4904 |
| 156 | Ga0070665_100211391 | 3300005548 | Bacteria | 1941 |
| 157 | Ga0070704_100008321 | 3300005549 | Bacteria | 6214 |
| 158 | Ga0068855_100061263 | 3300005563 | Bacteria | 4397 |
| 159 | Ga0068855_100068640 | 3300005563 | Bacteria | 4126 |
| 160 | Ga0068855_100209375 | 3300005563 | Bacteria | 2192 |
| 161 | Ga0070664_100026278 | 3300005564 | Bacteria | 4828 |
| 162 | Ga0070664_100097643 | 3300005564 | Bacteria | 2551 |
| 163 | Ga0068857_100007819 | 3300005577 | Bacteria | 9218 |
| 164 | Ga0068857_100019015 | 3300005577 | Bacteria | 6027 |
| 165 | Ga0068857_100042460 | 3300005577 | Bacteria | 4035 |
| 166 | Ga0068857_100050761 | 3300005577 | Bacteria | 3679 |
| 167 | Ga0068854_100015847 | 3300005578 | Bacteria | 5008 |
| 168 | Ga0068856_100237183 | 3300005614 | Bacteria | 1839 |
| 169 | Ga0068856_100248510 | 3300005614 | Bacteria | 1794 |
| 170 | Ga0068856_100279572 | 3300005614 | Bacteria | 1686 |
| 171 | Ga0070702_100095839 | 3300005615 | Bacteria | 1809 |
| 172 | Ga0068859_100007707 | 3300005617 | Bacteria | 10932 |
| 173 | Ga0068859_100080324 | 3300005617 | Bacteria | 3302 |
| 174 | Ga0068859_100162246 | 3300005617 | Bacteria | 2314 |
| 175 | Ga0068859_100341696 | 3300005617 | Bacteria | 1591 |
| 176 | Ga0068864_100032756 | 3300005618 | Bacteria | 4417 |
| 177 | Ga0068864_100041997 | 3300005618 | Bacteria | 3912 |
| 178 | Ga0068864_100200477 | 3300005618 | Bacteria | 1833 |
| 179 | Ga0068866_10014044 | 3300005718 | Bacteria | 3526 |
| 180 | Ga0068861_100001399 | 3300005719 | Bacteria | 15155 |
| 181 | Ga0068851_10025230 | 3300005834 | Bacteria | 2915 |
| 182 | Ga0068870_10005763 | 3300005840 | Bacteria | 5429 |
| 183 | Ga0068863_100039343 | 3300005841 | Bacteria | 4500 |
| 184 | Ga0068863_100130271 | 3300005841 | Bacteria | 2401 |
| 185 | Ga0068858_100035928 | 3300005842 | Bacteria | 4595 |
| 186 | Ga0068860_100010585 | 3300005843 | Bacteria | 9110 |
| 187 | Ga0068862_100003461 | 3300005844 | Bacteria | 13576 |
| 188 | Ga0068862_100071909 | 3300005844 | Bacteria | 2987 |
| 189 | Ga0068862_100221115 | 3300005844 | Bacteria | 1714 |
| 190 | Ga0081455_10027499 | 3300005937 | Bacteria | 5212 |
| 191 | Ga0081455_10218649 | 3300005937 | Bacteria | 1414 |
| 192 | Ga0081538_10088963 | 3300005981 | Bacteria | 1605 |
| 193 | Ga0081539_10000290 | 3300005985 | Bacteria | 113852 |
| 194 | Ga0081539_10026740 | 3300005985 | Bacteria | 3671 |
| 195 | Ga0081539_10038333 | 3300005985 | Unclassified | 2841 |
| 196 | Ga0070716_100011367 | 3300006173 | Bacteria | 4482 |
| 197 | Ga0070712_100025778 | 3300006175 | Bacteria | 3911 |
| 198 | Ga0070712_100095463 | 3300006175 | Bacteria | 2188 |
| 199 | Ga0075367_10009362 | 3300006178 | Bacteria | 5116 |
| 200 | Ga0075367_10025360 | 3300006178 | Bacteria | 3353 |
| 201 | Ga0075367_10084254 | 3300006178 | Bacteria | 1927 |
| 202 | Ga0097621_100012962 | 3300006237 | Bacteria | 6195 |
| 203 | Ga0075370_10059486 | 3300006353 | Unclassified | 2175 |
| 204 | Ga0068871_100082468 | 3300006358 | Bacteria | 2666 |
| 205 | Ga0075428_100033303 | 3300006844 | Bacteria | 5690 |
| 206 | Ga0075428_100037388 | 3300006844 | Bacteria | 5345 |
| 207 | Ga0075428_100143933 | 3300006844 | Bacteria | 2591 |
| 208 | Ga0075428_100173631 | 3300006844 | Bacteria | 2335 |
| 209 | Ga0075430_100005544 | 3300006846 | Bacteria | 10658 |
| 210 | Ga0075430_100018306 | 3300006846 | Bacteria | 5962 |
| 211 | Ga0075430_100057193 | 3300006846 | Bacteria | 3281 |
| 212 | Ga0075430_100072796 | 3300006846 | Bacteria | 2882 |
| 213 | Ga0075431_100000825 | 3300006847 | Bacteria | 27053 |
| 214 | Ga0075431_100130776 | 3300006847 | Bacteria | 2589 |
| 215 | Ga0075431_100238536 | 3300006847 | Bacteria | 1850 |
| 216 | Ga0075433_10069477 | 3300006852 | Bacteria | 3094 |
| 217 | Ga0075433_10123858 | 3300006852 | Bacteria | 2296 |
| 218 | Ga0075433_10176100 | 3300006852 | Bacteria | 1904 |
| 219 | Ga0075434_100006320 | 3300006871 | Bacteria | 10860 |
| 220 | Ga0075434_100026438 | 3300006871 | Bacteria | 5684 |
| 221 | Ga0075434_100057505 | 3300006871 | Bacteria | 3865 |
| 222 | Ga0075434_100071500 | 3300006871 | Bacteria | 3461 |
| 223 | Ga0075434_100077810 | 3300006871 | Bacteria | 3312 |
| 224 | Ga0075429_100002304 | 3300006880 | Bacteria | 16026 |
| 225 | Ga0068865_100008155 | 3300006881 | Bacteria | 6465 |
| 226 | Ga0068865_100017197 | 3300006881 | Bacteria | 4647 |
| 227 | Ga0068865_100182146 | 3300006881 | Bacteria | 1618 |
| 228 | Ga0075436_100035378 | 3300006914 | Bacteria | 3446 |
| 229 | Ga0097620_100007707 | 3300006931 | Bacteria | 10932 |
| 230 | Ga0097620_100080316 | 3300006931 | Bacteria | 3302 |
| 231 | Ga0097620_100162221 | 3300006931 | Bacteria | 2314 |
| 232 | Ga0097620_100341683 | 3300006931 | Bacteria | 1591 |
| 233 | Ga0075435_100232064 | 3300007076 | Bacteria | 1568 |
| 234 | Ga0075435_100241615 | 3300007076 | Bacteria | 1536 |
| 235 | Ga0099795_10009855 | 3300007788 | Bacteria | 2788 |
| 236 | Ga0105240_10229668 | 3300009093 | Bacteria | 2157 |
| 237 | Ga0111539_10073804 | 3300009094 | Bacteria | 4021 |
| 238 | Ga0111539_10155614 | 3300009094 | Bacteria | 2675 |
| 239 | Ga0111539_10187877 | 3300009094 | Bacteria | 2412 |
| 240 | Ga0111539_10248186 | 3300009094 | Bacteria | 2073 |
| 241 | Ga0111539_10315906 | 3300009094 | Bacteria | 1818 |
| 242 | Ga0111539_10500062 | 3300009094 | Bacteria | 1416 |
| 243 | Ga0105245_10062376 | 3300009098 | Bacteria | 3363 |
| 244 | Ga0105245_10114676 | 3300009098 | Bacteria | 2510 |
| 245 | Ga0105245_10145948 | 3300009098 | Bacteria | 2232 |
| 246 | Ga0105245_10298097 | 3300009098 | Bacteria | 1581 |
| 247 | Ga0105245_10305719 | 3300009098 | Bacteria | 1562 |
| 248 | Ga0114129_10001902 | 3300009147 | Bacteria | 28442 |
| 249 | Ga0114129_10004330 | 3300009147 | Bacteria | 20068 |
| 250 | Ga0114129_10006598 | 3300009147 | Bacteria | 16471 |
| 251 | Ga0114129_10018551 | 3300009147 | Bacteria | 9906 |
| 252 | Ga0114129_10036775 | 3300009147 | Bacteria | 6913 |
| 253 | Ga0114129_10038801 | 3300009147 | Bacteria | 6714 |
| 254 | Ga0114129_10178696 | 3300009147 | Bacteria | 2889 |
| 255 | Ga0114129_10335293 | 3300009147 | Bacteria | 2007 |
| 256 | Ga0114129_10385035 | 3300009147 | Bacteria | 1851 |
| 257 | Ga0105243_10087572 | 3300009148 | Bacteria | 2557 |
| 258 | Ga0105243_10351424 | 3300009148 | Bacteria | 1354 |
| 259 | Ga0105241_10000050 | 3300009174 | Bacteria | 95122 |
| 260 | Ga0105241_10150396 | 3300009174 | Bacteria | 1904 |
| 261 | Ga0105241_10236463 | 3300009174 | Bacteria | 1542 |
| 262 | Ga0105242_10004361 | 3300009176 | Bacteria | 11010 |
| 263 | Ga0105242_10064719 | 3300009176 | Bacteria | 3015 |
| 264 | Ga0105242_10145674 | 3300009176 | Bacteria | 2060 |
| 265 | Ga0105242_10174504 | 3300009176 | Bacteria | 1891 |
| 266 | Ga0105248_10013902 | 3300009177 | Bacteria | 8857 |
| 267 | Ga0105248_10014499 | 3300009177 | Bacteria | 8676 |
| 268 | Ga0105248_10036692 | 3300009177 | Bacteria | 5482 |
| 269 | Ga0105248_10077842 | 3300009177 | Bacteria | 3728 |
| 270 | Ga0105248_10107543 | 3300009177 | Bacteria | 3145 |
| 271 | Ga0105248_10110041 | 3300009177 | Bacteria | 3106 |
| 272 | Ga0105248_10294906 | 3300009177 | Bacteria | 1826 |
| 273 | Ga0105248_10309276 | 3300009177 | Bacteria | 1780 |
| 274 | Ga0105248_10320811 | 3300009177 | Bacteria | 1745 |
| 275 | Ga0105237_10093750 | 3300009545 | Bacteria | 2991 |
| 276 | Ga0105237_10138912 | 3300009545 | Bacteria | 2424 |
| 277 | Ga0105238_10031538 | 3300009551 | Bacteria | 5396 |
| 278 | Ga0105238_10225284 | 3300009551 | Bacteria | 1851 |
| 279 | Ga0105249_10001395 | 3300009553 | Bacteria | 21132 |
| 280 | Ga0105249_10002382 | 3300009553 | Bacteria | 16317 |
| 281 | Ga0105249_10024865 | 3300009553 | Bacteria | 5387 |
| 282 | Ga0105249_10170406 | 3300009553 | Bacteria | 2110 |
| 283 | Ga0099796_10007713 | 3300010159 | Bacteria | 2827 |
| 284 | Ga0105239_10017961 | 3300010375 | Bacteria | 7822 |
| 285 | Ga0105239_10036411 | 3300010375 | Bacteria | 5402 |
| 286 | Ga0105239_10038711 | 3300010375 | Bacteria | 5225 |
| 287 | Ga0105239_10242297 | 3300010375 | Bacteria | 2024 |
| 288 | Ga0105246_10004459 | 3300011119 | Bacteria | 8522 |
| 289 | Ga0157373_10021800 | 3300013100 | Bacteria | 4648 |
| 290 | Ga0157370_10002257 | 3300013104 | Bacteria | 23417 |
| 291 | Ga0157370_10158501 | 3300013104 | Bacteria | 2106 |
| 292 | Ga0157369_10000703 | 3300013105 | Bacteria | 43189 |
| 293 | Ga0157369_10104405 | 3300013105 | Bacteria | 3017 |
| 294 | Ga0157369_10153156 | 3300013105 | Bacteria | 2436 |
| 295 | Ga0157378_10005920 | 3300013297 | Bacteria | 10713 |
| 296 | Ga0163162_10004539 | 3300013306 | Bacteria | 13375 |
| 297 | Ga0163162_10041311 | 3300013306 | Bacteria | 4614 |
| 298 | Ga0163162_10081707 | 3300013306 | Bacteria | 3302 |
| 299 | Ga0163162_10088110 | 3300013306 | Bacteria | 3183 |
| 300 | Ga0163162_10110140 | 3300013306 | Bacteria | 2851 |
| 301 | Ga0163162_10162081 | 3300013306 | Bacteria | 2358 |
| 302 | Ga0163162_10416745 | 3300013306 | Bacteria | 1475 |
| 303 | Ga0157372_10006571 | 3300013307 | Bacteria | 12373 |
| 304 | Ga0157372_10012150 | 3300013307 | Bacteria | 9172 |
| 305 | Ga0157372_10014410 | 3300013307 | Bacteria | 8456 |
| 306 | Ga0157372_10026080 | 3300013307 | Bacteria | 6358 |
| 307 | Ga0157372_10028311 | 3300013307 | Bacteria | 6115 |
| 308 | Ga0157372_10059881 | 3300013307 | Bacteria | 4261 |
| 309 | Ga0157372_10060145 | 3300013307 | Bacteria | 4251 |
| 310 | Ga0157372_10100853 | 3300013307 | Bacteria | 3295 |
| 311 | Ga0157372_10234355 | 3300013307 | Bacteria | 2129 |
| 312 | Ga0157372_10481477 | 3300013307 | Bacteria | 1447 |
| 313 | Ga0157375_10016669 | 3300013308 | Bacteria | 6608 |
| 314 | Ga0157375_10063176 | 3300013308 | Bacteria | 3682 |
| 315 | Ga0157375_10148606 | 3300013308 | Bacteria | 2476 |
| 316 | Ga0157375_10151762 | 3300013308 | Bacteria | 2453 |
| 317 | Ga0157375_10277758 | 3300013308 | Bacteria | 1838 |
| 318 | Ga0157375_10508599 | 3300013308 | Bacteria | 1368 |
| 319 | Ga0163163_10049135 | 3300014325 | Bacteria | 4150 |
| 320 | Ga0163163_10248393 | 3300014325 | Bacteria | 1830 |
| 321 | Ga0157380_10002276 | 3300014326 | Bacteria | 12905 |
| 322 | Ga0157380_10011979 | 3300014326 | Bacteria | 6274 |
| 323 | Ga0157377_10024661 | 3300014745 | Bacteria | 3199 |
| 324 | Ga0157379_10061745 | 3300014968 | Bacteria | 3351 |
| 325 | Ga0157379_10086168 | 3300014968 | Bacteria | 2816 |
| 326 | Ga0157379_10233051 | 3300014968 | Bacteria | 1669 |
| 327 | Ga0157376_10034816 | 3300014969 | Bacteria | 4069 |
| 328 | Ga0157376_10215033 | 3300014969 | Bacteria | 1777 |
| 329 | Ga0157376_10240300 | 3300014969 | Bacteria | 1687 |
| 330 | Ga0163161_10090582 | 3300017792 | Bacteria | 2263 |
| 331 | Ga0163161_10163396 | 3300017792 | Bacteria | 1699 |
| 332 | Ga0206356_11274886 | 3300020070 | Bacteria | 3315 |
| 333 | Ga0213876_10010769 | 3300021384 | Bacteria | 4901 |
| 334 | Ga0207697_10003283 | 3300025315 | Bacteria | 8041 |
| 335 | Ga0207656_10042204 | 3300025321 | Bacteria | 1940 |
| 336 | Ga0207642_10010217 | 3300025899 | Bacteria | 3297 |
| 337 | Ga0207688_10014055 | 3300025901 | Bacteria | 4353 |
| 338 | Ga0207688_10090047 | 3300025901 | Bacteria | 1761 |
| 339 | Ga0207680_10087969 | 3300025903 | Bacteria | 1968 |
| 340 | Ga0207647_10033949 | 3300025904 | Bacteria | 3261 |
| 341 | Ga0207699_10075953 | 3300025906 | Bacteria | 2068 |
| 342 | Ga0207699_10094264 | 3300025906 | Bacteria | 1885 |
| 343 | Ga0207645_10000203 | 3300025907 | Bacteria | 48457 |
| 344 | Ga0207645_10041414 | 3300025907 | Bacteria | 2948 |
| 345 | Ga0207645_10123777 | 3300025907 | Bacteria | 1680 |
| 346 | Ga0207643_10007454 | 3300025908 | Bacteria | 5872 |
| 347 | Ga0207643_10014845 | 3300025908 | Bacteria | 4235 |
| 348 | Ga0207643_10075917 | 3300025908 | Bacteria | 1940 |
| 349 | Ga0207705_10000772 | 3300025909 | Bacteria | 26312 |
| 350 | Ga0207705_10029065 | 3300025909 | Bacteria | 3942 |
| 351 | Ga0207684_10030486 | 3300025910 | Bacteria | 4590 |
| 352 | Ga0207684_10136243 | 3300025910 | Bacteria | 2108 |
| 353 | Ga0207654_10000482 | 3300025911 | Bacteria | 22772 |
| 354 | Ga0207707_10003701 | 3300025912 | Bacteria | 13550 |
| 355 | Ga0207707_10016312 | 3300025912 | Bacteria | 6479 |
| 356 | Ga0207707_10020807 | 3300025912 | Bacteria | 5731 |
| 357 | Ga0207707_10021064 | 3300025912 | Bacteria | 5696 |
| 358 | Ga0207707_10025112 | 3300025912 | Bacteria | 5212 |
| 359 | Ga0207707_10076140 | 3300025912 | Bacteria | 2928 |
| 360 | Ga0207707_10148080 | 3300025912 | Bacteria | 2052 |
| 361 | Ga0207695_10047168 | 3300025913 | Bacteria | 4562 |
| 362 | Ga0207695_10150376 | 3300025913 | Bacteria | 2268 |
| 363 | Ga0207693_10043614 | 3300025915 | Bacteria | 3528 |
| 364 | Ga0207693_10150039 | 3300025915 | Bacteria | 1833 |
| 365 | Ga0207663_10053600 | 3300025916 | Bacteria | 2521 |
| 366 | Ga0207663_10058928 | 3300025916 | Bacteria | 2426 |
| 367 | Ga0207663_10080454 | 3300025916 | Bacteria | 2130 |
| 368 | Ga0207663_10192157 | 3300025916 | Bacteria | 1466 |
| 369 | Ga0207660_10001029 | 3300025917 | Bacteria | 18463 |
| 370 | Ga0207660_10012858 | 3300025917 | Bacteria | 5481 |
| 371 | Ga0207660_10070167 | 3300025917 | Bacteria | 2546 |
| 372 | Ga0207660_10086151 | 3300025917 | Bacteria | 2319 |
| 373 | Ga0207660_10268349 | 3300025917 | Bacteria | 1351 |
| 374 | Ga0207662_10003049 | 3300025918 | Bacteria | 8550 |
| 375 | Ga0207662_10010835 | 3300025918 | Bacteria | 5039 |
| 376 | Ga0207662_10013467 | 3300025918 | Bacteria | 4574 |
| 377 | Ga0207662_10020139 | 3300025918 | Bacteria | 3805 |
| 378 | Ga0207657_10005682 | 3300025919 | Bacteria | 13012 |
| 379 | Ga0207657_10013961 | 3300025919 | Bacteria | 7858 |
| 380 | Ga0207657_10039831 | 3300025919 | Bacteria | 4171 |
| 381 | Ga0207657_10040913 | 3300025919 | Bacteria | 4103 |
| 382 | Ga0207657_10081718 | 3300025919 | Bacteria | 2713 |
| 383 | Ga0207657_10137201 | 3300025919 | Bacteria | 2001 |
| 384 | Ga0207657_10200205 | 3300025919 | Bacteria | 1607 |
| 385 | Ga0207652_10008351 | 3300025921 | Bacteria | 8328 |
| 386 | Ga0207652_10015274 | 3300025921 | Bacteria | 6233 |
| 387 | Ga0207652_10020240 | 3300025921 | Bacteria | 5477 |
| 388 | Ga0207652_10061155 | 3300025921 | Bacteria | 3251 |
| 389 | Ga0207652_10195138 | 3300025921 | Bacteria | 1821 |
| 390 | Ga0207646_10003329 | 3300025922 | Bacteria | 18270 |
| 391 | Ga0207681_10006835 | 3300025923 | Bacteria | 6998 |
| 392 | Ga0207681_10011214 | 3300025923 | Bacteria | 5504 |
| 393 | Ga0207681_10015976 | 3300025923 | Bacteria | 4689 |
| 394 | Ga0207681_10036254 | 3300025923 | Bacteria | 3253 |
| 395 | Ga0207681_10140363 | 3300025923 | Bacteria | 1799 |
| 396 | Ga0207681_10190537 | 3300025923 | Bacteria | 1569 |
| 397 | Ga0207694_10026287 | 3300025924 | Bacteria | 4427 |
| 398 | Ga0207650_10015045 | 3300025925 | Bacteria | 5382 |
| 399 | Ga0207650_10079944 | 3300025925 | Bacteria | 2477 |
| 400 | Ga0207659_10002780 | 3300025926 | Bacteria | 10441 |
| 401 | Ga0207659_10041529 | 3300025926 | Bacteria | 3221 |
| 402 | Ga0207659_10118629 | 3300025926 | Bacteria | 2024 |
| 403 | Ga0207700_10000633 | 3300025928 | Bacteria | 20583 |
| 404 | Ga0207664_10009762 | 3300025929 | Bacteria | 6751 |
| 405 | Ga0207664_10032021 | 3300025929 | Bacteria | 4028 |
| 406 | Ga0207664_10052560 | 3300025929 | Bacteria | 3223 |
| 407 | Ga0207664_10206374 | 3300025929 | Bacteria | 1698 |
| 408 | Ga0207644_10029906 | 3300025931 | Bacteria | 3782 |
| 409 | Ga0207690_10013782 | 3300025932 | Bacteria | 4867 |
| 410 | Ga0207690_10023216 | 3300025932 | Bacteria | 3869 |
| 411 | Ga0207690_10058650 | 3300025932 | Bacteria | 2604 |
| 412 | Ga0207690_10078522 | 3300025932 | Bacteria | 2298 |
| 413 | Ga0207690_10099354 | 3300025932 | Bacteria | 2075 |
| 414 | Ga0207706_10001427 | 3300025933 | Bacteria | 23910 |
| 415 | Ga0207706_10005277 | 3300025933 | Bacteria | 12051 |
| 416 | Ga0207706_10017143 | 3300025933 | Bacteria | 6531 |
| 417 | Ga0207706_10280857 | 3300025933 | Bacteria | 1452 |
| 418 | Ga0207686_10024071 | 3300025934 | Bacteria | 3523 |
| 419 | Ga0207709_10095522 | 3300025935 | Bacteria | 1953 |
| 420 | Ga0207669_10023012 | 3300025937 | Bacteria | 3320 |
| 421 | Ga0207704_10020086 | 3300025938 | Bacteria | 3525 |
| 422 | Ga0207704_10039326 | 3300025938 | Bacteria | 2753 |
| 423 | Ga0207665_10005720 | 3300025939 | Bacteria | 8279 |
| 424 | Ga0207691_10003767 | 3300025940 | Bacteria | 14725 |
| 425 | Ga0207691_10005100 | 3300025940 | Bacteria | 12672 |
| 426 | Ga0207691_10034713 | 3300025940 | Bacteria | 4689 |
| 427 | Ga0207691_10057744 | 3300025940 | Bacteria | 3531 |
| 428 | Ga0207691_10108619 | 3300025940 | Bacteria | 2469 |
| 429 | Ga0207691_10121497 | 3300025940 | Bacteria | 2314 |
| 430 | Ga0207711_10035232 | 3300025941 | Bacteria | 4242 |
| 431 | Ga0207711_10078595 | 3300025941 | Bacteria | 2878 |
| 432 | Ga0207711_10154094 | 3300025941 | Bacteria | 2075 |
| 433 | Ga0207711_10230850 | 3300025941 | Bacteria | 1695 |
| 434 | Ga0207689_10002072 | 3300025942 | Bacteria | 18927 |
| 435 | Ga0207689_10004964 | 3300025942 | Bacteria | 11983 |
| 436 | Ga0207661_10001605 | 3300025944 | Bacteria | 15380 |
| 437 | Ga0207661_10006778 | 3300025944 | Bacteria | 8110 |
| 438 | Ga0207661_10016943 | 3300025944 | Bacteria | 5382 |
| 439 | Ga0207661_10043299 | 3300025944 | Bacteria | 3553 |
| 440 | Ga0207661_10142790 | 3300025944 | Bacteria | 2062 |
| 441 | Ga0207661_10157345 | 3300025944 | Bacteria | 1969 |
| 442 | Ga0207679_10017014 | 3300025945 | Bacteria | 4837 |
| 443 | Ga0207679_10019179 | 3300025945 | Bacteria | 4592 |
| 444 | Ga0207667_10036553 | 3300025949 | Bacteria | 5263 |
| 445 | Ga0207667_10060764 | 3300025949 | Bacteria | 3955 |
| 446 | Ga0207667_10079459 | 3300025949 | Bacteria | 3399 |
| 447 | Ga0207667_10131050 | 3300025949 | Bacteria | 2582 |
| 448 | Ga0207667_10186358 | 3300025949 | Bacteria | 2130 |
| 449 | Ga0207651_10022450 | 3300025960 | Unclassified | 3859 |
| 450 | Ga0207651_10045920 | 3300025960 | Bacteria | 2933 |
| 451 | Ga0207651_10073134 | 3300025960 | Bacteria | 2436 |
| 452 | Ga0207651_10079602 | 3300025960 | Bacteria | 2355 |
| 453 | Ga0207651_10161934 | 3300025960 | Bacteria | 1755 |
| 454 | Ga0207712_10019275 | 3300025961 | Bacteria | 4454 |
| 455 | Ga0207712_10030495 | 3300025961 | Bacteria | 3626 |
| 456 | Ga0207712_10267604 | 3300025961 | Bacteria | 1389 |
| 457 | Ga0207668_10004208 | 3300025972 | Bacteria | 8435 |
| 458 | Ga0207668_10075221 | 3300025972 | Bacteria | 2427 |
| 459 | Ga0207668_10118421 | 3300025972 | Bacteria | 2001 |
| 460 | Ga0207640_10090896 | 3300025981 | Bacteria | 2113 |
| 461 | Ga0207658_10071854 | 3300025986 | Bacteria | 2622 |
| 462 | Ga0207677_10170257 | 3300026023 | Bacteria | 1702 |
| 463 | Ga0207703_10035822 | 3300026035 | Bacteria | 3946 |
| 464 | Ga0207678_10009416 | 3300026067 | Bacteria | 8594 |
| 465 | Ga0207678_10048061 | 3300026067 | Bacteria | 3689 |
| 466 | Ga0207708_10068592 | 3300026075 | Bacteria | 2714 |
| 467 | Ga0207708_10084624 | 3300026075 | Bacteria | 2439 |
| 468 | Ga0207708_10110984 | 3300026075 | Bacteria | 2128 |
| 469 | Ga0207702_10009373 | 3300026078 | Bacteria | 8220 |
| 470 | Ga0207702_10125561 | 3300026078 | Bacteria | 2303 |
| 471 | Ga0207702_10241636 | 3300026078 | Bacteria | 1692 |
| 472 | Ga0207641_10036965 | 3300026088 | Bacteria | 4077 |
| 473 | Ga0207648_10016956 | 3300026089 | Bacteria | 6637 |
| 474 | Ga0207648_10047220 | 3300026089 | Bacteria | 3775 |
| 475 | Ga0207648_10062016 | 3300026089 | Bacteria | 3260 |
| 476 | Ga0207648_10082606 | 3300026089 | Bacteria | 2802 |
| 477 | Ga0207648_10130704 | 3300026089 | Bacteria | 2210 |
| 478 | Ga0207648_10172456 | 3300026089 | Bacteria | 1913 |
| 479 | Ga0207648_10341575 | 3300026089 | Bacteria | 1348 |
| 480 | Ga0207676_10021319 | 3300026095 | Bacteria | 4754 |
| 481 | Ga0207676_10026664 | 3300026095 | Bacteria | 4297 |
| 482 | Ga0207676_10060304 | 3300026095 | Bacteria | 3000 |
| 483 | Ga0207674_10000548 | 3300026116 | Bacteria | 49225 |
| 484 | Ga0207674_10006791 | 3300026116 | Bacteria | 13425 |
| 485 | Ga0207674_10029472 | 3300026116 | Bacteria | 5778 |
| 486 | Ga0207674_10030455 | 3300026116 | Bacteria | 5672 |
| 487 | Ga0207674_10145927 | 3300026116 | Bacteria | 2325 |
| 488 | Ga0207674_10175426 | 3300026116 | Bacteria | 2096 |
| 489 | Ga0207675_100004371 | 3300026118 | Bacteria | 13659 |
| 490 | Ga0207675_100012918 | 3300026118 | Bacteria | 7797 |
| 491 | Ga0207675_100142424 | 3300026118 | Bacteria | 2278 |
| 492 | Ga0207683_10010379 | 3300026121 | Bacteria | 7946 |
| 493 | Ga0207683_10074787 | 3300026121 | Bacteria | 2998 |
| 494 | Ga0207683_10185328 | 3300026121 | Bacteria | 1888 |
| 495 | Ga0207698_10113617 | 3300026142 | Bacteria | 2276 |
| 496 | Ga0207698_10128839 | 3300026142 | Bacteria | 2158 |
| 497 | Ga0207698_10156592 | 3300026142 | Bacteria | 1986 |
| 498 | Ga0209968_1003659 | 3300027526 | Bacteria | 2304 |
| 499 | Ga0209999_1003194 | 3300027543 | Bacteria | 2924 |
| 500 | Ga0209971_1003303 | 3300027682 | Bacteria | 3833 |
| 501 | Ga0209971_1008991 | 3300027682 | Bacteria | 2370 |
| 502 | Ga0209971_1015199 | 3300027682 | Bacteria | 1824 |
| 503 | Ga0209998_10024192 | 3300027717 | Bacteria | 1316 |
| 504 | Ga0209974_10019510 | 3300027876 | Bacteria | 2248 |
| 505 | Ga0209974_10034082 | 3300027876 | Bacteria | 1690 |
| 506 | Ga0207428_10170192 | 3300027907 | Bacteria | 1650 |
| 507 | Ga0268266_10103390 | 3300028379 | Bacteria | 2514 |
| 508 | Ga0268265_10002887 | 3300028380 | Bacteria | 12619 |
| 509 | Ga0268265_10068941 | 3300028380 | Bacteria | 2745 |
| 510 | Ga0268264_10001217 | 3300028381 | Bacteria | 24741 |
| 511 | Ga0268264_10095681 | 3300028381 | Bacteria | 2570 |
| 512 | Ga0265340_10030526 | 3300031247 | Bacteria | 2701 |
| 513 | Ga0307408_100000777 | 3300031548 | Bacteria | 25671 |
| 514 | Ga0307408_100030129 | 3300031548 | Bacteria | 3766 |
| 515 | Ga0307408_100166013 | 3300031548 | Bacteria | 1758 |
| 516 | Ga0307408_100227783 | 3300031548 | Bacteria | 1524 |
| 517 | Ga0265314_10024708 | 3300031711 | Bacteria | 4549 |
| 518 | Ga0316576_10004090 | 3300031727 | Bacteria | 8693 |
| 519 | Ga0316576_10043850 | 3300031727 | Bacteria | 3229 |
| 520 | Ga0316578_10022388 | 3300031728 | Bacteria | 3523 |
| 521 | Ga0316578_10181871 | 3300031728 | Bacteria | 1267 |
| 522 | Ga0307405_10001938 | 3300031731 | Bacteria | 8926 |
| 523 | Ga0307405_10003504 | 3300031731 | Bacteria | 7223 |
| 524 | Ga0307405_10021160 | 3300031731 | Bacteria | 3652 |
| 525 | Ga0307405_10041855 | 3300031731 | Bacteria | 2785 |
| 526 | Ga0307405_10063028 | 3300031731 | Bacteria | 2350 |
| 527 | Ga0316577_10001955 | 3300031733 | Bacteria | 9997 |
| 528 | Ga0307413_10003160 | 3300031824 | Bacteria | 6877 |
| 529 | Ga0307413_10029335 | 3300031824 | Bacteria | 3076 |
| 530 | Ga0307413_10046486 | 3300031824 | Bacteria | 2581 |
| 531 | Ga0307413_10120817 | 3300031824 | Bacteria | 1774 |
| 532 | Ga0307413_10189684 | 3300031824 | Bacteria | 1474 |
| 533 | Ga0307410_10000624 | 3300031852 | Bacteria | 14594 |
| 534 | Ga0307410_10015033 | 3300031852 | Bacteria | 4577 |
| 535 | Ga0307410_10032618 | 3300031852 | Bacteria | 3354 |
| 536 | Ga0307410_10035531 | 3300031852 | Bacteria | 3237 |
| 537 | Ga0307410_10037181 | 3300031852 | Bacteria | 3177 |
| 538 | Ga0307410_10047216 | 3300031852 | Bacteria | 2877 |
| 539 | Ga0307410_10049335 | 3300031852 | Bacteria | 2825 |
| 540 | Ga0307410_10073931 | 3300031852 | Bacteria | 2372 |
| 541 | Ga0307410_10105352 | 3300031852 | Bacteria | 2030 |
| 542 | Ga0307406_10003417 | 3300031901 | Bacteria | 8650 |
| 543 | Ga0307406_10036579 | 3300031901 | Bacteria | 3026 |
| 544 | Ga0307406_10042025 | 3300031901 | Bacteria | 2852 |
| 545 | Ga0307406_10046624 | 3300031901 | Bacteria | 2728 |
| 546 | Ga0307406_10066057 | 3300031901 | Bacteria | 2353 |
| 547 | Ga0307406_10067054 | 3300031901 | Bacteria | 2338 |
| 548 | Ga0307406_10267678 | 3300031901 | Bacteria | 1296 |
| 549 | Ga0307407_10000215 | 3300031903 | Bacteria | 17494 |
| 550 | Ga0307407_10006344 | 3300031903 | Bacteria | 5240 |
| 551 | Ga0307407_10009125 | 3300031903 | Bacteria | 4602 |
| 552 | Ga0307407_10011201 | 3300031903 | Bacteria | 4257 |
| 553 | Ga0307407_10025119 | 3300031903 | Bacteria | 3136 |
| 554 | Ga0307407_10029111 | 3300031903 | Bacteria | 2962 |
| 555 | Ga0307407_10031145 | 3300031903 | Bacteria | 2886 |
| 556 | Ga0307407_10148971 | 3300031903 | Bacteria | 1518 |
| 557 | Ga0307412_10087544 | 3300031911 | Bacteria | 2170 |
| 558 | Ga0307412_10161126 | 3300031911 | Bacteria | 1667 |
| 559 | Ga0307409_100000657 | 3300031995 | Bacteria | 15306 |
| 560 | Ga0307409_100005431 | 3300031995 | Bacteria | 7335 |
| 561 | Ga0307409_100063198 | 3300031995 | Bacteria | 2902 |
| 562 | Ga0307409_100068741 | 3300031995 | Bacteria | 2803 |
| 563 | Ga0307409_100089862 | 3300031995 | Bacteria | 2512 |
| 564 | Ga0307409_100106901 | 3300031995 | Bacteria | 2337 |
| 565 | Ga0307409_100114409 | 3300031995 | Bacteria | 2270 |
| 566 | Ga0307409_100123248 | 3300031995 | Bacteria | 2199 |
| 567 | Ga0307409_100140614 | 3300031995 | Bacteria | 2079 |
| 568 | Ga0307409_100197987 | 3300031995 | Bacteria | 1794 |
| 569 | Ga0307409_100328508 | 3300031995 | Bacteria | 1434 |
| 570 | Ga0307409_100332750 | 3300031995 | Bacteria | 1426 |
| 571 | Ga0307416_100000226 | 3300032002 | Bacteria | 29922 |
| 572 | Ga0307416_100012079 | 3300032002 | Bacteria | 5799 |
| 573 | Ga0307416_100012828 | 3300032002 | Bacteria | 5668 |
| 574 | Ga0307416_100072619 | 3300032002 | Bacteria | 2865 |
| 575 | Ga0307416_100121873 | 3300032002 | Bacteria | 2326 |
| 576 | Ga0307416_100123440 | 3300032002 | Bacteria | 2314 |
| 577 | Ga0307416_100177210 | 3300032002 | Bacteria | 1993 |
| 578 | Ga0307416_100218838 | 3300032002 | Bacteria | 1824 |
| 579 | Ga0307414_10013736 | 3300032004 | Bacteria | 4830 |
| 580 | Ga0307414_10039699 | 3300032004 | Bacteria | 3173 |
| 581 | Ga0307414_10047904 | 3300032004 | Bacteria | 2945 |
| 582 | Ga0307414_10150727 | 3300032004 | Bacteria | 1834 |
| 583 | Ga0307411_10001007 | 3300032005 | Bacteria | 10869 |
| 584 | Ga0307411_10026785 | 3300032005 | Bacteria | 3476 |
| 585 | Ga0307411_10056730 | 3300032005 | Bacteria | 2583 |
| 586 | Ga0307411_10064065 | 3300032005 | Bacteria | 2459 |
| 587 | Ga0307411_10068954 | 3300032005 | Bacteria | 2386 |
| 588 | Ga0307411_10082100 | 3300032005 | Bacteria | 2222 |
| 589 | Ga0307411_10155778 | 3300032005 | Bacteria | 1704 |
| 590 | Ga0307411_10207731 | 3300032005 | Bacteria | 1509 |
| 591 | Ga0307411_10217962 | 3300032005 | Bacteria | 1478 |
| 592 | Ga0307415_100000602 | 3300032126 | Bacteria | 15746 |
| 593 | Ga0307415_100012639 | 3300032126 | Bacteria | 4889 |
| 594 | Ga0307415_100034014 | 3300032126 | Bacteria | 3313 |
| 595 | Ga0307415_100051322 | 3300032126 | Bacteria | 2798 |
| 596 | Ga0307415_100143166 | 3300032126 | Bacteria | 1829 |
| 597 | Ga0307415_100150170 | 3300032126 | Bacteria | 1792 |
| 598 | Ga0307415_100164152 | 3300032126 | Bacteria | 1725 |
| 599 | Ga0307415_100171236 | 3300032126 | Bacteria | 1693 |
| 600 | Ga0307415_100258219 | 3300032126 | Bacteria | 1420 |
| 601 | Ga0373944_0001350 | 3300035089 | Bacteria | 6173 |
| 602 | Ga0373956_0017747 | 3300035119 | Bacteria | 3005 |
| 603 | Ga0373957_0044243 | 3300035120 | Bacteria | 1684 |
| 604 | Ga0373943_0004041 | 3300035170 | Bacteria | 6672 |
| 605 | Ga0373943_0028374 | 3300035170 | Bacteria | 2637 |
| 606 | Ga0373943_0064689 | 3300035170 | Bacteria | 1837 |
| 607 | Ga0373946_0010509 | 3300035171 | Bacteria | 3427 |
| 608 | Ga0373955_0064029 | 3300035172 | Bacteria | 2037 |
| 609 | Ga0373961_0018201 | 3300035241 | Bacteria | 1832 |
| 610 | Ga0373924_0012365 | 3300035410 | Bacteria | 3188 |
| 611 | Ga0373931_0127269 | 3300035691 | Bacteria | 1462 |
| 612 | Ga0373931_0129736 | 3300035691 | Bacteria | 1450 |
| 613 | Ga0373935_0084549 | 3300035692 | Bacteria | 2067 |
| 614 | Ga0373927_0003399 | 3300035695 | Bacteria | 11447 |
| 615 | Ga0373927_0008881 | 3300035695 | Bacteria | 6749 |
| 616 | Ga0373933_0002172 | 3300035724 | Bacteria | 11228 |
| 617 | Ga0373947_0000123 | 3300035725 | Bacteria | 39071 |
| 618 | Ga0373947_0056991 | 3300035725 | Bacteria | 2363 |
| 619 | Ga0373937_0024715 | 3300036401 | Bacteria | 5421 |
| 620 | Ga0373937_0025310 | 3300036401 | Bacteria | 5357 |
| 621 | Ga0373937_0095959 | 3300036401 | Bacteria | 2749 |
| 622 | Ga0373937_0193017 | 3300036401 | Bacteria | 1914 |
| 623 | Ga0316582_0002786 | 3300036647 | Bacteria | 8332 |
| 624 | Ga0316584_0001769 | 3300036712 | Bacteria | 13290 |
| 625 | Ga0373925_0000419 | 3300037068 | Bacteria | 43184 |
| 626 | Ga0373925_0001690 | 3300037068 | Bacteria | 18555 |
| 627 | Ga0373925_0115497 | 3300037068 | Bacteria | 2078 |
| 628 | Ga0395899_0074662 | 3300037312 | Bacteria | 2477 |
| 629 | Ga0395900_0047025 | 3300037418 | Bacteria | 4443 |
| 630 | Ga0395900_0306746 | 3300037418 | Unclassified | 1572 |
| 631 | Ga0395905_0054851 | 3300037471 | Bacteria | 3730 |
| 632 | Ga0395905_0084769 | 3300037471 | Bacteria | 2969 |
| 633 | Ga0395905_0208209 | 3300037471 | Bacteria | 1833 |
| 634 | Ga0395901_0036042 | 3300038443 | Bacteria | 5111 |
| 635 | Ga0242420_008901 | 3300038996 | Bacteria | 1638 |
| 636 | Ga0436365_1410016 | 3300039437 | Bacteria | 5149 |
| 637 | Ga0436365_1784820 | 3300039437 | Bacteria | 1420 |
| 638 | Ga0450896_000471 | 3300042133 | Bacteria | 4172 |
| 639 | Ga0439464_0057400 | 3300042439 | Bacteria | 1135 |
| 640 | Ga0451577_0000005 | 3300042876 | Bacteria | 712599 |
| 641 | Ga0451577_0036570 | 3300042876 | Bacteria | 4419 |
| 642 | Ga0451577_0066903 | 3300042876 | Unclassified | 3204 |
| 643 | Ga0453683_0072907 | 3300044673 | Bacteria | 2149 |
| 644 | Ga0453683_0112401 | 3300044673 | Bacteria | 1713 |
| 645 | Ga0466966_0086770 | 3300044684 | Bacteria | 1945 |
| 646 | Ga0466959_0100461 | 3300045049 | Bacteria | 2071 |
| 647 | Ga0466959_0110690 | 3300045049 | Bacteria | 1960 |
| 648 | Ga0451576_0024257 | 3300045051 | Bacteria | 6553 |
| 649 | Ga0451576_0066367 | 3300045051 | Bacteria | 3757 |
| 650 | Ga0451576_0399997 | 3300045051 | Bacteria | 1440 |
| 651 | Ga0466967_0048290 | 3300045976 | Bacteria | 3716 |
| 652 | Ga0466967_0065164 | 3300045976 | Bacteria | 3242 |
| 653 | Ga0495592_0034643 | 3300046454 | Bacteria | 3805 |
| 654 | Ga0495592_0217349 | 3300046454 | Bacteria | 1280 |
| 655 | Ga0495603_0010885 | 3300046455 | Bacteria | 5519 |
| 656 | Ga0495603_0024609 | 3300046455 | Bacteria | 3642 |
| 657 | Ga0495629_0007989 | 3300046459 | Bacteria | 7784 |
| 658 | Ga0495629_0076455 | 3300046459 | Bacteria | 2338 |
| 659 | Ga0495629_0076931 | 3300046459 | Bacteria | 2329 |
| 660 | Ga0495629_0097417 | 3300046459 | Bacteria | 2052 |
| 661 | Ga0495638_0040481 | 3300046460 | Bacteria | 2953 |
| 662 | Ga0495651_0006822 | 3300046462 | Bacteria | 8722 |
| 663 | Ga0495651_0020785 | 3300046462 | Bacteria | 5095 |
| 664 | Ga0495651_0028761 | 3300046462 | Bacteria | 4331 |
| 665 | Ga0495653_0004013 | 3300046463 | Bacteria | 11888 |
| 666 | Ga0495653_0102397 | 3300046463 | Bacteria | 2072 |
| 667 | Ga0495580_0000872 | 3300046472 | Bacteria | 26075 |
| 668 | Ga0495580_0037719 | 3300046472 | Bacteria | 3466 |
| 669 | Ga0495580_0058023 | 3300046472 | Bacteria | 2724 |
| 670 | Ga0495582_0000388 | 3300046473 | Bacteria | 23923 |
| 671 | Ga0495582_0033461 | 3300046473 | Bacteria | 2826 |
| 672 | Ga0495582_0070374 | 3300046473 | Bacteria | 1935 |
| 673 | Ga0495639_0000117 | 3300046475 | Bacteria | 40157 |
| 674 | Ga0495639_0015918 | 3300046475 | Bacteria | 3261 |
| 675 | Ga0495664_0020063 | 3300046477 | Bacteria | 3851 |
| 676 | Ga0495594_0007118 | 3300046499 | Bacteria | 5754 |
| 677 | Ga0495594_0012963 | 3300046499 | Bacteria | 4347 |
| 678 | Ga0495594_0014285 | 3300046499 | Bacteria | 4156 |
| 679 | Ga0495596_0037909 | 3300046500 | Bacteria | 1906 |
| 680 | Ga0495608_0036480 | 3300046511 | Bacteria | 3310 |
| 681 | Ga0495618_0067214 | 3300046514 | Bacteria | 2279 |
| 682 | Ga0495618_0083113 | 3300046514 | Bacteria | 2046 |
| 683 | Ga0495628_0027091 | 3300046516 | Bacteria | 4666 |
| 684 | Ga0495630_0007914 | 3300046517 | Bacteria | 7623 |
| 685 | Ga0495630_0092394 | 3300046517 | Bacteria | 2287 |
| 686 | Ga0495630_0097933 | 3300046517 | Bacteria | 2218 |
| 687 | Ga0495666_0012929 | 3300046526 | Bacteria | 4160 |
| 688 | Ga0495652_0011768 | 3300046529 | Bacteria | 7905 |
| 689 | Ga0495652_0022862 | 3300046529 | Bacteria | 5547 |
| 690 | Ga0495665_0000362 | 3300046531 | Bacteria | 22903 |
| 691 | Ga0495586_0004632 | 3300046535 | Bacteria | 7352 |
| 692 | Ga0495586_0017841 | 3300046535 | Bacteria | 3776 |
| 693 | Ga0495587_0001834 | 3300046536 | Bacteria | 14174 |
| 694 | Ga0495587_0003085 | 3300046536 | Bacteria | 11130 |
| 695 | Ga0495587_0005095 | 3300046536 | Bacteria | 8587 |
| 696 | Ga0495587_0131896 | 3300046536 | Bacteria | 1428 |
| 697 | Ga0495645_0002661 | 3300046543 | Bacteria | 12139 |
| 698 | Ga0495645_0018448 | 3300046543 | Bacteria | 5010 |
| 699 | Ga0495667_0010411 | 3300046559 | Bacteria | 6293 |
| 700 | Ga0495667_0011841 | 3300046559 | Bacteria | 5909 |
| 701 | Ga0495667_0037956 | 3300046559 | Bacteria | 3209 |
| 702 | Ga0495634_0105490 | 3300046642 | Bacteria | 1817 |
| 703 | Ga0495635_0022487 | 3300046663 | Bacteria | 4391 |
| 704 | Ga0495635_0036000 | 3300046663 | Bacteria | 3432 |
| 705 | Ga0495588_0007207 | 3300046674 | Bacteria | 5049 |
| 706 | Ga0495588_0008939 | 3300046674 | Bacteria | 4612 |
| 707 | Ga0495657_0003641 | 3300046675 | Bacteria | 12510 |
| 708 | Ga0495657_0056374 | 3300046675 | Bacteria | 2617 |
| 709 | Ga0495599_0003334 | 3300046678 | Bacteria | 9379 |
| 710 | Ga0495599_0050452 | 3300046678 | Bacteria | 2607 |
| 711 | Ga0495623_0009653 | 3300046679 | Bacteria | 6266 |
| 712 | Ga0495623_0033095 | 3300046679 | Bacteria | 3318 |
| 713 | Ga0495623_0063108 | 3300046679 | Bacteria | 2320 |
| 714 | Ga0495646_0008083 | 3300046680 | Bacteria | 6687 |
| 715 | Ga0495647_0003235 | 3300046681 | Bacteria | 5212 |
| 716 | Ga0495658_0000095 | 3300046683 | Bacteria | 46039 |
| 717 | Ga0495658_0055479 | 3300046683 | Bacteria | 2257 |
| 718 | Ga0495613_0040549 | 3300046689 | Bacteria | 3450 |
| 719 | Ga0495613_0044415 | 3300046689 | Bacteria | 3288 |
| 720 | Ga0495613_0068611 | 3300046689 | Bacteria | 2586 |
| 721 | Ga0495613_0226536 | 3300046689 | Bacteria | 1311 |
| 722 | Ga0495600_0001787 | 3300046809 | Bacteria | 12024 |
| 723 | Ga0495581_0000662 | 3300047315 | Bacteria | 18083 |
| 724 | Ga0495581_0084229 | 3300047315 | Bacteria | 1842 |
| 725 | Ga0495604_0120774 | 3300047317 | Bacteria | 1897 |
| 726 | Ga0495674_0081175 | 3300047319 | Bacteria | 2782 |
| 727 | Ga0495674_0081416 | 3300047319 | Bacteria | 2777 |
| 728 | Ga0495674_0089153 | 3300047319 | Bacteria | 2637 |
| 729 | Ga0495672_0016122 | 3300047320 | Bacteria | 5048 |
| 730 | Ga0495672_0029516 | 3300047320 | Bacteria | 3453 |
| 731 | Ga0495680_0027537 | 3300047322 | Bacteria | 4668 |
| 732 | Ga0495680_0037480 | 3300047322 | Bacteria | 3883 |
| 733 | Ga0495680_0085821 | 3300047322 | Bacteria | 2370 |
| 734 | Ga0495684_0007844 | 3300047471 | Bacteria | 8261 |
| 735 | Ga0495684_0010866 | 3300047471 | Bacteria | 7040 |
| 736 | Ga0495684_0065305 | 3300047471 | Bacteria | 2766 |
| 737 | Ga0495593_0013460 | 3300047673 | Bacteria | 4665 |
| 738 | Ga0495593_0032872 | 3300047673 | Bacteria | 2827 |
| 739 | Ga0495602_0003256 | 3300048088 | Bacteria | 16762 |
| 740 | Ga0495602_0019139 | 3300048088 | Bacteria | 6809 |
| 741 | Ga0495614_0000104 | 3300048089 | Bacteria | 28897 |
| 742 | Ga0496103_0122742 | 3300048906 | Bacteria | 1656 |
| 743 | Ga0496104_0002179 | 3300048907 | Bacteria | 16999 |
| 744 | Ga0496104_0023962 | 3300048907 | Bacteria | 5614 |
| 745 | Ga0496104_0045729 | 3300048907 | Bacteria | 4119 |
| 746 | Ga0496105_0023253 | 3300048908 | Bacteria | 5026 |
| 747 | Ga0496105_0077666 | 3300048908 | Bacteria | 2742 |
| 748 | Ga0496106_0069033 | 3300048909 | Bacteria | 2697 |
| 749 | Ga0496106_0093356 | 3300048909 | Bacteria | 2325 |
| 750 | Ga0496108_0000799 | 3300048911 | Bacteria | 24565 |
| 751 | Ga0496108_0000912 | 3300048911 | Bacteria | 22995 |
| 752 | Ga0496108_0001419 | 3300048911 | Bacteria | 18887 |
| 753 | Ga0496108_0052844 | 3300048911 | Bacteria | 3406 |
| 754 | Ga0496108_0073271 | 3300048911 | Bacteria | 2891 |
| 755 | Ga0496109_0000316 | 3300048912 | Bacteria | 45455 |
| 756 | Ga0496109_0002146 | 3300048912 | Bacteria | 16401 |
| 757 | Ga0496109_0003320 | 3300048912 | Bacteria | 13450 |
| 758 | Ga0496109_0003739 | 3300048912 | Bacteria | 12719 |
| 759 | Ga0496109_0171286 | 3300048912 | Bacteria | 2037 |
| 760 | Ga0496110_0282850 | 3300048913 | Bacteria | 1510 |
| 761 | Ga0496112_0000406 | 3300048915 | Bacteria | 28243 |
| 762 | Ga0496112_0005001 | 3300048915 | Bacteria | 11373 |
| 763 | Ga0496112_0005923 | 3300048915 | Bacteria | 10661 |
| 764 | Ga0496112_0010713 | 3300048915 | Bacteria | 8334 |
| 765 | Ga0496112_0021742 | 3300048915 | Bacteria | 6103 |
| 766 | Ga0496112_0045567 | 3300048915 | Bacteria | 4299 |
| 767 | Ga0496112_0112644 | 3300048915 | Bacteria | 2691 |
| 768 | Ga0496112_0123619 | 3300048915 | Bacteria | 2559 |
| 769 | Ga0496112_0147083 | 3300048915 | Bacteria | 2324 |
| 770 | Ga0496113_0000919 | 3300048916 | Bacteria | 15572 |
| 771 | Ga0496113_0001446 | 3300048916 | Bacteria | 13200 |
| 772 | Ga0496113_0002607 | 3300048916 | Bacteria | 10546 |
| 773 | Ga0496113_0004653 | 3300048916 | Bacteria | 8460 |
| 774 | Ga0496114_0001537 | 3300048917 | Bacteria | 17479 |
| 775 | Ga0496114_0023676 | 3300048917 | Bacteria | 5011 |
| 776 | Ga0496115_0024238 | 3300048918 | Bacteria | 4714 |
| 777 | Ga0496115_0030353 | 3300048918 | Bacteria | 4252 |
| 778 | Ga0496115_0132684 | 3300048918 | Bacteria | 2053 |
| 779 | Ga0501032_0165469 | 3300049569 | Bacteria | 1451 |
| 780 | Ga0501033_0128168 | 3300049570 | Bacteria | 1839 |
| 781 | Ga0501033_0131997 | 3300049570 | Bacteria | 1809 |
| 782 | Ga0501034_0055921 | 3300049571 | Bacteria | 3971 |
| 783 | Ga0501034_0085676 | 3300049571 | Bacteria | 3152 |
| 784 | Ga0501034_0218232 | 3300049571 | Bacteria | 1860 |
| 785 | Ga0501036_0039617 | 3300049572 | Bacteria | 3987 |
| 786 | Ga0501036_0161162 | 3300049572 | Bacteria | 1891 |
| 787 | Ga0501037_0111814 | 3300049573 | Bacteria | 1967 |
| 788 | Ga0501038_0026378 | 3300049574 | Bacteria | 5175 |
| 789 | Ga0501038_0207569 | 3300049574 | Bacteria | 1569 |
| 790 | Ga0501038_0241455 | 3300049574 | Bacteria | 1434 |
| 791 | Ga0501039_0017723 | 3300049575 | Bacteria | 5463 |
| 792 | Ga0501039_0211671 | 3300049575 | Bacteria | 1524 |
| 793 | Ga0501040_0022105 | 3300049576 | Bacteria | 4255 |
| 794 | Ga0501043_0045483 | 3300049579 | Bacteria | 3453 |
| 795 | Ga0501043_0046584 | 3300049579 | Bacteria | 3410 |
| 796 | Ga0501043_0079879 | 3300049579 | Bacteria | 2570 |
| 797 | Ga0501047_0013952 | 3300049581 | Bacteria | 7635 |
| 798 | Ga0501047_0059971 | 3300049581 | Bacteria | 3673 |
| 799 | Ga0501047_0204205 | 3300049581 | Bacteria | 1836 |
| 800 | Ga0501048_0024006 | 3300049582 | Bacteria | 4453 |
| 801 | Ga0501048_0043790 | 3300049582 | Bacteria | 3203 |
| 802 | Ga0501067_0006496 | 3300049583 | Bacteria | 6483 |
| 803 | Ga0501067_0006937 | 3300049583 | Bacteria | 6285 |
| 804 | Ga0501068_0013505 | 3300049584 | Bacteria | 4648 |
| 805 | Ga0501068_0069777 | 3300049584 | Bacteria | 2143 |
| 806 | Ga0501069_0009746 | 3300049585 | Bacteria | 5074 |
| 807 | Ga0501069_0012716 | 3300049585 | Bacteria | 4480 |
| 808 | Ga0501069_0017267 | 3300049585 | Bacteria | 3882 |
| 809 | Ga0501070_0005114 | 3300049586 | Bacteria | 11181 |
| 810 | Ga0501070_0042518 | 3300049586 | Bacteria | 3785 |
| 811 | Ga0501070_0189980 | 3300049586 | Bacteria | 1688 |
| 812 | Ga0501071_0074358 | 3300049587 | Bacteria | 2479 |
| 813 | Ga0501071_0079192 | 3300049587 | Bacteria | 2402 |
| 814 | Ga0501072_0002466 | 3300049588 | Bacteria | 13854 |
| 815 | Ga0501073_0015156 | 3300049589 | Bacteria | 5591 |
| 816 | Ga0501073_0020760 | 3300049589 | Bacteria | 4736 |
| 817 | Ga0501074_0011079 | 3300049590 | Bacteria | 6546 |
| 818 | Ga0501074_0012984 | 3300049590 | Bacteria | 6054 |
| 819 | Ga0501074_0028718 | 3300049590 | Bacteria | 4031 |
| 820 | Ga0501075_0008809 | 3300049591 | Bacteria | 7033 |
| 821 | Ga0501075_0104160 | 3300049591 | Bacteria | 2156 |
| 822 | Ga0501075_0232195 | 3300049591 | Bacteria | 1407 |
| 823 | Ga0501076_0051980 | 3300049592 | Bacteria | 3245 |
| 824 | Ga0501076_0103602 | 3300049592 | Bacteria | 2295 |
| 825 | Ga0501077_0000220 | 3300049593 | Bacteria | 33560 |
| 826 | Ga0501202_005496 | 3300049652 | Bacteria | 2246 |
| 827 | Ga0501209_001097 | 3300049656 | Bacteria | 3653 |
| 828 | Ga0501216_001896 | 3300049660 | Bacteria | 2898 |
| 829 | Ga0501217_003558 | 3300049661 | Bacteria | 3153 |
| 830 | Ga0501224_000370 | 3300049664 | Bacteria | 5288 |
| 831 | Ga0501230_007275 | 3300049667 | Bacteria | 1637 |
| 832 | Ga0501235_000080 | 3300049669 | Bacteria | 15218 |
| 833 | Ga0501235_004051 | 3300049669 | Bacteria | 3171 |
| 834 | Ga0501239_001225 | 3300049672 | Bacteria | 2168 |
| 835 | Ga0501247_001369 | 3300049677 | Bacteria | 2327 |
| 836 | Ga0501249_005008 | 3300049679 | Bacteria | 2705 |
| 837 | Ga0501249_027364 | 3300049679 | Bacteria | 1261 |
| 838 | Ga0501257_005583 | 3300049686 | Bacteria | 2776 |
| 839 | Ga0501259_004005 | 3300049688 | Bacteria | 2341 |
| 840 | Ga0501221_003394 | 3300049704 | Bacteria | 2618 |
| 841 | Ga0501225_0001718 | 3300049705 | Bacteria | 6859 |
| 842 | Ga0501225_0022550 | 3300049705 | Bacteria | 1738 |
| 843 | Ga0501225_0037153 | 3300049705 | Bacteria | 1342 |
| 844 | Ga0501079_0174662 | 3300049741 | Bacteria | 1675 |
| 845 | Ga0501079_0255190 | 3300049741 | Bacteria | 1371 |
| 846 | Ga0501080_0026027 | 3300049742 | Bacteria | 5435 |
| 847 | Ga0501080_0031362 | 3300049742 | Bacteria | 4952 |
| 848 | Ga0501080_0041539 | 3300049742 | Bacteria | 4284 |
| 849 | Ga0501081_0039771 | 3300049743 | Bacteria | 3219 |
| 850 | Ga0501081_0092066 | 3300049743 | Bacteria | 2133 |
| 851 | Ga0501083_0017773 | 3300049744 | Bacteria | 4960 |
| 852 | Ga0501083_0025367 | 3300049744 | Bacteria | 4104 |
| 853 | Ga0501083_0044259 | 3300049744 | Bacteria | 3013 |
| 854 | Ga0501263_000245 | 3300049760 | Bacteria | 3533 |
| 855 | Ga0501266_001036 | 3300049763 | Bacteria | 3588 |
| 856 | Ga0501268_000756 | 3300049765 | Bacteria | 3716 |
| 857 | Ga0501268_000875 | 3300049765 | Bacteria | 3518 |
| 858 | Ga0501268_012958 | 3300049765 | Bacteria | 1340 |
| 859 | Ga0501272_003614 | 3300049769 | Bacteria | 1579 |
| 860 | Ga0501273_001040 | 3300049770 | Bacteria | 2503 |
| 861 | Ga0501283_012061 | 3300049779 | Bacteria | 1294 |
| 862 | Ga0501035_0052506 | 3300049822 | Bacteria | 3647 |
| 863 | Ga0501044_0008920 | 3300049823 | Bacteria | 10960 |
| 864 | Ga0501045_0033116 | 3300049824 | Bacteria | 3747 |
| 865 | Ga0501045_0111354 | 3300049824 | Bacteria | 2030 |
| 866 | Ga0501045_0130833 | 3300049824 | Bacteria | 1865 |
| 867 | Ga0501204_003158 | 3300049850 | Bacteria | 1716 |
| 868 | nmdc:mga05p37_114403_c1 | 3300050507 | Bacteria | 3316 |
| 869 | nmdc:mga05p37_142513_c1 | 3300050507 | Bacteria | 2935 |
| 870 | nmdc:mga05p37_154357_c1 | 3300050507 | Bacteria | 2806 |
| 871 | nmdc:mga05p37_16091_c1 | 3300050507 | Bacteria | 9005 |
| 872 | nmdc:mga05p37_1766_c1 | 3300050507 | Bacteria | 25251 |
| 873 | nmdc:mga05p37_654_c1 | 3300050507 | Bacteria | 38315 |
| 874 | nmdc:mga05p37_97298_c1 | 3300050507 | Bacteria | 3625 |
| 875 | nmdc:mga09592_12192_c1 | 3300050508 | Bacteria | 6996 |
| 876 | nmdc:mga09592_1607_c1 | 3300050508 | Bacteria | 10119 |
| 877 | nmdc:mga09592_24034_c1 | 3300050508 | Bacteria | 5037 |
| 878 | nmdc:mga0qj67_100788_c1 | 3300050509 | Bacteria | 2328 |
| 879 | nmdc:mga0qj67_17085_c1 | 3300050509 | Bacteria | 5513 |
| 880 | nmdc:mga0qj67_262491_c1 | 3300050509 | Bacteria | 1401 |
| 881 | nmdc:mga0qj67_28563_c1 | 3300050509 | Bacteria | 4330 |
| 882 | nmdc:mga0qj67_83913_c1 | 3300050509 | Bacteria | 2554 |
| 883 | nmdc:mga06r32_18090_c1 | 3300050510 | Bacteria | 6444 |
| 884 | nmdc:mga06r32_23503_c1 | 3300050510 | Bacteria | 5704 |
| 885 | nmdc:mga06r32_282034_c1 | 3300050510 | Bacteria | 1648 |
| 886 | nmdc:mga06r32_29595_c1 | 3300050510 | Bacteria | 5134 |
| 887 | nmdc:mga06r32_77742_c1 | 3300050510 | Bacteria | 3224 |
| 888 | nmdc:mga08y16_120559_c1 | 3300050511 | Bacteria | 2729 |
| 889 | nmdc:mga08y16_502246_c1 | 3300050511 | Bacteria | 1232 |
| 890 | nmdc:mga08y16_84919_c1 | 3300050511 | Bacteria | 3299 |
| 891 | nmdc:mga0n895_10584_c1 | 3300050512 | Bacteria | 8162 |
| 892 | nmdc:mga0n895_11550_c1 | 3300050512 | Bacteria | 7887 |
| 893 | nmdc:mga0n895_122780_c1 | 3300050512 | Bacteria | 2619 |
| 894 | nmdc:mga0n895_185619_c1 | 3300050512 | Bacteria | 2110 |
| 895 | nmdc:mga0n895_322158_c1 | 3300050512 | Bacteria | 1566 |
| 896 | nmdc:mga0n895_40532_c1 | 3300050512 | Bacteria | 4523 |
| 897 | nmdc:mga0n895_94203_c1 | 3300050512 | Bacteria | 2998 |
| 898 | nmdc:mga08x19_201063_c1 | 3300050514 | Bacteria | 1366 |
| 899 | nmdc:mga0a205_138780_c1 | 3300050515 | Bacteria | 2331 |
| 900 | nmdc:mga0a205_209681_c1 | 3300050515 | Bacteria | 1837 |
| 901 | nmdc:mga0a205_25678_c1 | 3300050515 | Bacteria | 5614 |
| 902 | nmdc:mga0a205_89028_c1 | 3300050515 | Bacteria | 2984 |
| 903 | Ga0495595_0011150 | 3300053084 | Bacteria | 3754 |
| 904 | Ga0495595_0073157 | 3300053084 | Bacteria | 1623 |
| 905 | Ga0495619_0006382 | 3300053085 | Bacteria | 7474 |
| 906 | Ga0495619_0025490 | 3300053085 | Bacteria | 3798 |
| 907 | Ga0500555_000103 | 3300053103 | Bacteria | 40277 |
| 908 | Ga0500568_0001868 | 3300053139 | Bacteria | 12968 |
| 909 | Ga0500616_0000178 | 3300053153 | Bacteria | 106208 |
| 910 | Ga0500645_000157 | 3300053730 | Bacteria | 52818 |
| 911 | Ga0500645_018454 | 3300053730 | Bacteria | 2179 |
| 912 | Ga0501084_0007102 | 3300054114 | Bacteria | 9228 |
| 913 | Ga0501084_0008692 | 3300054114 | Bacteria | 8398 |
| 914 | Ga0501084_0018949 | 3300054114 | Bacteria | 5730 |
| 915 | Ga0501084_0039422 | 3300054114 | Bacteria | 3951 |
| 916 | Ga0590071_000231 | 3300059421 | Bacteria | 16375 |
| 917 | Ga0590074_008417 | 3300059423 | Bacteria | 1718 |
| 918 | Ga0501082_0008232 | 3300060353 | Bacteria | 8992 |
| 919 | Ga0501082_0032750 | 3300060353 | Bacteria | 4484 |
| 920 | Ga0501082_0091470 | 3300060353 | Bacteria | 2627 |
| 921 | Ga0501082_0106768 | 3300060353 | Bacteria | 2422 |
| 922 | Ga0530510_0007306 | 3300061734 | Bacteria | 7688 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_322158_c1 | nmdc:mga0n895_322158_c1_356_1312 | 318 |
| 2 | 3300042439 | Ga0439464_0057400 | Ga0439464_0057400_24_1016 | 330 |
| 3 | 3300046517 | Ga0495630_0092394 | Ga0495630_0092394_1241_2254 | 337 |
| 4 | 3300049574 | Ga0501038_0207569 | Ga0501038_0207569_509_1546 | 345 |
| 5 | 3300050511 | nmdc:mga08y16_502246_c1 | nmdc:mga08y16_502246_c1_50_1090 | 346 |
| 6 | 3300025933 | Ga0207706_10280857 | Ga0207706_102808572 | 351 |
| 7 | 3300009148 | Ga0105243_10351424 | Ga0105243_103514241 | 352 |
| 8 | 3300049574 | Ga0501038_0241455 | Ga0501038_0241455_64_1131 | 355 |
| 9 | 3300037471 | Ga0395905_0208209 | Ga0395905_0208209_696_1805 | 364 |
| 10 | 3300050509 | nmdc:mga0qj67_83913_c1 | nmdc:mga0qj67_83913_c1_228_1331 | 366 |
| 11 | 3300005334 | Ga0068869_100027937 | Ga0068869_1000279372 | 367 |
| 12 | 3300005367 | Ga0070667_100172753 | Ga0070667_1001727532 | 367 |
| 13 | 3300045049 | Ga0466959_0100461 | Ga0466959_0100461_944_2047 | 367 |
| 14 | 3300046642 | Ga0495634_0105490 | Ga0495634_0105490_699_1802 | 367 |
| 15 | 3300049824 | Ga0501045_0130833 | Ga0501045_0130833_751_1854 | 367 |
| 16 | 3300048906 | Ga0496103_0122742 | Ga0496103_0122742_512_1618 | 368 |
| 17 | 3300005544 | Ga0070686_100016804 | Ga0070686_1000168044 | 369 |
| 18 | 3300025918 | Ga0207662_10010835 | Ga0207662_100108354 | 369 |
| 19 | 3300025923 | Ga0207681_10140363 | Ga0207681_101403632 | 369 |
| 20 | 3300037068 | Ga0373925_0115497 | Ga0373925_0115497_934_2046 | 370 |
| 21 | 3300047315 | Ga0495581_0084229 | Ga0495581_0084229_15_1127 | 370 |
| 22 | 3300042876 | Ga0451577_0066903 | Ga0451577_0066903_1988_3139 | 373 |
| 23 | 3300006847 | Ga0075431_100000825 | Ga0075431_1000008255 | 374 |
| 24 | 3300027682 | Ga0209971_1015199 | Ga0209971_10151992 | 374 |
| 25 | 3300053103 | Ga0500555_000103 | Ga0500555_000103_16399_17559 | 374 |
| 26 | 3300053730 | Ga0500645_000157 | Ga0500645_000157_15069_16229 | 374 |
| 27 | 3300048908 | Ga0496105_0077666 | Ga0496105_0077666_661_1788 | 375 |
| 28 | 3300027717 | Ga0209998_10024192 | Ga0209998_100241921 | 377 |
| 29 | 3300014969 | Ga0157376_10034816 | Ga0157376_100348161 | 378 |
| 30 | 3300037471 | Ga0395905_0054851 | Ga0395905_0054851_163_1320 | 378 |
| 31 | 3300048917 | Ga0496114_0023676 | Ga0496114_0023676_175_1311 | 378 |
| 32 | 3300044673 | Ga0453683_0072907 | Ga0453683_0072907_606_1751 | 380 |
| 33 | 3300031995 | Ga0307409_100328508 | Ga0307409_1003285082 | 381 |
| 34 | 3300005459 | Ga0068867_100053382 | Ga0068867_1000533822 | 382 |
| 35 | 3300005577 | Ga0068857_100050761 | Ga0068857_1000507614 | 382 |
| 36 | 3300005617 | Ga0068859_100162246 | Ga0068859_1001622461 | 382 |
| 37 | 3300006931 | Ga0097620_100162221 | Ga0097620_1001622211 | 382 |
| 38 | 3300009176 | Ga0105242_10064719 | Ga0105242_100647194 | 382 |
| 39 | 3300014326 | Ga0157380_10002276 | Ga0157380_100022768 | 382 |
| 40 | 3300014745 | Ga0157377_10024661 | Ga0157377_100246612 | 382 |
| 41 | 3300026089 | Ga0207648_10047220 | Ga0207648_100472203 | 382 |
| 42 | 3300026116 | Ga0207674_10175426 | Ga0207674_101754262 | 382 |
| 43 | 3300045051 | Ga0451576_0024257 | Ga0451576_0024257_2462_3613 | 382 |
| 44 | 3300005329 | Ga0070683_100097740 | Ga0070683_1000977402 | 383 |
| 45 | 3300005535 | Ga0070684_100142317 | Ga0070684_1001423173 | 383 |
| 46 | 3300042133 | Ga0450896_000471 | Ga0450896_000471_1779_2930 | 383 |
| 47 | 3300049571 | Ga0501034_0085676 | Ga0501034_0085676_1544_2695 | 383 |
| 48 | 3300050510 | nmdc:mga06r32_282034_c1 | nmdc:mga06r32_282034_c1_126_1277 | 383 |
| 49 | 3300005290 | Ga0065712_10068461 | Ga0065712_100684614 | 384 |
| 50 | 3300005293 | Ga0065715_10001248 | Ga0065715_100012487 | 384 |
| 51 | 3300005329 | Ga0070683_100364290 | Ga0070683_1003642901 | 384 |
| 52 | 3300005331 | Ga0070670_100014299 | Ga0070670_1000142992 | 384 |
| 53 | 3300005340 | Ga0070689_100043232 | Ga0070689_1000432322 | 384 |
| 54 | 3300005354 | Ga0070675_100305732 | Ga0070675_1003057321 | 384 |
| 55 | 3300005364 | Ga0070673_100024811 | Ga0070673_1000248113 | 384 |
| 56 | 3300005364 | Ga0070673_100032333 | Ga0070673_1000323332 | 384 |
| 57 | 3300005365 | Ga0070688_100001194 | Ga0070688_1000011945 | 384 |
| 58 | 3300005438 | Ga0070701_10041833 | Ga0070701_100418332 | 384 |
| 59 | 3300005466 | Ga0070685_10007599 | Ga0070685_100075991 | 384 |
| 60 | 3300005543 | Ga0070672_100010531 | Ga0070672_1000105312 | 384 |
| 61 | 3300005548 | Ga0070665_100030040 | Ga0070665_1000300402 | 384 |
| 62 | 3300005614 | Ga0068856_100248510 | Ga0068856_1002485102 | 384 |
| 63 | 3300005617 | Ga0068859_100341696 | Ga0068859_1003416962 | 384 |
| 64 | 3300005618 | Ga0068864_100032756 | Ga0068864_1000327563 | 384 |
| 65 | 3300005841 | Ga0068863_100039343 | Ga0068863_1000393432 | 384 |
| 66 | 3300005985 | Ga0081539_10038333 | Ga0081539_100383332 | 384 |
| 67 | 3300006237 | Ga0097621_100012962 | Ga0097621_1000129623 | 384 |
| 68 | 3300006353 | Ga0075370_10059486 | Ga0075370_100594862 | 384 |
| 69 | 3300006358 | Ga0068871_100082468 | Ga0068871_1000824683 | 384 |
| 70 | 3300006844 | Ga0075428_100033303 | Ga0075428_1000333032 | 384 |
| 71 | 3300006880 | Ga0075429_100002304 | Ga0075429_1000023042 | 384 |
| 72 | 3300006931 | Ga0097620_100341683 | Ga0097620_1003416832 | 384 |
| 73 | 3300009147 | Ga0114129_10004330 | Ga0114129_1000433012 | 384 |
| 74 | 3300009174 | Ga0105241_10236463 | Ga0105241_102364632 | 384 |
| 75 | 3300009177 | Ga0105248_10014499 | Ga0105248_100144996 | 384 |
| 76 | 3300009177 | Ga0105248_10110041 | Ga0105248_101100412 | 384 |
| 77 | 3300009553 | Ga0105249_10024865 | Ga0105249_100248654 | 384 |
| 78 | 3300010375 | Ga0105239_10242297 | Ga0105239_102422972 | 384 |
| 79 | 3300013306 | Ga0163162_10110140 | Ga0163162_101101402 | 384 |
| 80 | 3300013308 | Ga0157375_10508599 | Ga0157375_105085991 | 384 |
| 81 | 3300014325 | Ga0163163_10248393 | Ga0163163_102483932 | 384 |
| 82 | 3300014969 | Ga0157376_10215033 | Ga0157376_102150332 | 384 |
| 83 | 3300025899 | Ga0207642_10010217 | Ga0207642_100102172 | 384 |
| 84 | 3300025901 | Ga0207688_10090047 | Ga0207688_100900472 | 384 |
| 85 | 3300025903 | Ga0207680_10087969 | Ga0207680_100879691 | 384 |
| 86 | 3300025925 | Ga0207650_10015045 | Ga0207650_100150453 | 384 |
| 87 | 3300025926 | Ga0207659_10118629 | Ga0207659_101186292 | 384 |
| 88 | 3300025940 | Ga0207691_10005100 | Ga0207691_100051005 | 384 |
| 89 | 3300025941 | Ga0207711_10035232 | Ga0207711_100352322 | 384 |
| 90 | 3300025941 | Ga0207711_10154094 | Ga0207711_101540941 | 384 |
| 91 | 3300025960 | Ga0207651_10022450 | Ga0207651_100224502 | 384 |
| 92 | 3300025960 | Ga0207651_10045920 | Ga0207651_100459202 | 384 |
| 93 | 3300025961 | Ga0207712_10267604 | Ga0207712_102676041 | 384 |
| 94 | 3300025972 | Ga0207668_10118421 | Ga0207668_101184211 | 384 |
| 95 | 3300026075 | Ga0207708_10068592 | Ga0207708_100685922 | 384 |
| 96 | 3300026088 | Ga0207641_10036965 | Ga0207641_100369652 | 384 |
| 97 | 3300026095 | Ga0207676_10060304 | Ga0207676_100603042 | 384 |
| 98 | 3300026121 | Ga0207683_10074787 | Ga0207683_100747872 | 384 |
| 99 | 3300026142 | Ga0207698_10128839 | Ga0207698_101288392 | 384 |
| 100 | 3300028380 | Ga0268265_10068941 | Ga0268265_100689412 | 384 |
| 101 | 3300031727 | Ga0316576_10043850 | Ga0316576_100438504 | 384 |
| 102 | 3300031728 | Ga0316578_10022388 | Ga0316578_100223883 | 384 |
| 103 | 3300048908 | Ga0496105_0023253 | Ga0496105_0023253_1527_2681 | 384 |
| 104 | 3300048911 | Ga0496108_0073271 | Ga0496108_0073271_1508_2662 | 384 |
| 105 | 3300048912 | Ga0496109_0002146 | Ga0496109_0002146_3928_5082 | 384 |
| 106 | 3300048915 | Ga0496112_0021742 | Ga0496112_0021742_3175_4329 | 384 |
| 107 | 3300048916 | Ga0496113_0002607 | Ga0496113_0002607_4051_5205 | 384 |
| 108 | 3300048917 | Ga0496114_0001537 | Ga0496114_0001537_1381_2535 | 384 |
| 109 | 3300050507 | nmdc:mga05p37_654_c1 | nmdc:mga05p37_654_c1_4858_6012 | 384 |
| 110 | 3300050508 | nmdc:mga09592_1607_c1 | nmdc:mga09592_1607_c1_1370_2524 | 384 |
| 111 | 3300053730 | Ga0500645_018454 | Ga0500645_018454_1013_2167 | 384 |
| 112 | 3300005295 | Ga0065707_10007385 | Ga0065707_100073852 | 385 |
| 113 | 3300009147 | Ga0114129_10038801 | Ga0114129_100388012 | 385 |
| 114 | 3300009148 | Ga0105243_10087572 | Ga0105243_100875722 | 385 |
| 115 | 3300027682 | Ga0209971_1003303 | Ga0209971_10033033 | 385 |
| 116 | 3300027876 | Ga0209974_10034082 | Ga0209974_100340822 | 385 |
| 117 | 3300031548 | Ga0307408_100030129 | Ga0307408_1000301293 | 385 |
| 118 | 3300031852 | Ga0307410_10047216 | Ga0307410_100472162 | 385 |
| 119 | 3300032002 | Ga0307416_100072619 | Ga0307416_1000726192 | 385 |
| 120 | 3300035692 | Ga0373935_0084549 | Ga0373935_0084549_263_1420 | 385 |
| 121 | 3300035695 | Ga0373927_0003399 | Ga0373927_0003399_2118_3275 | 385 |
| 122 | 3300037068 | Ga0373925_0000419 | Ga0373925_0000419_17580_18737 | 385 |
| 123 | 3300037418 | Ga0395900_0306746 | Ga0395900_0306746_341_1498 | 385 |
| 124 | 3300049572 | Ga0501036_0039617 | Ga0501036_0039617_2314_3471 | 385 |
| 125 | 3300049575 | Ga0501039_0211671 | Ga0501039_0211671_29_1186 | 385 |
| 126 | 3300049582 | Ga0501048_0043790 | Ga0501048_0043790_1175_2332 | 385 |
| 127 | 3300049591 | Ga0501075_0008809 | Ga0501075_0008809_387_1544 | 385 |
| 128 | 3300049592 | Ga0501076_0051980 | Ga0501076_0051980_737_1894 | 385 |
| 129 | 3300050507 | nmdc:mga05p37_97298_c1 | nmdc:mga05p37_97298_c1_2163_3320 | 385 |
| 130 | 3300060353 | Ga0501082_0091470 | Ga0501082_0091470_153_1310 | 385 |
| 131 | 3300005290 | Ga0065712_10155362 | Ga0065712_101553621 | 386 |
| 132 | 3300005356 | Ga0070674_100002002 | Ga0070674_1000020027 | 386 |
| 133 | 3300006178 | Ga0075367_10009362 | Ga0075367_100093623 | 386 |
| 134 | 3300006178 | Ga0075367_10025360 | Ga0075367_100253603 | 386 |
| 135 | 3300006178 | Ga0075367_10084254 | Ga0075367_100842542 | 386 |
| 136 | 3300009545 | Ga0105237_10093750 | Ga0105237_100937503 | 386 |
| 137 | 3300044673 | Ga0453683_0112401 | Ga0453683_0112401_139_1302 | 386 |
| 138 | 3300046460 | Ga0495638_0040481 | Ga0495638_0040481_266_1426 | 386 |
| 139 | 3300047320 | Ga0495672_0029516 | Ga0495672_0029516_2216_3376 | 386 |
| 140 | 3300053139 | Ga0500568_0001868 | Ga0500568_0001868_7539_8699 | 386 |
| 141 | 3300053153 | Ga0500616_0000178 | Ga0500616_0000178_75431_76591 | 386 |
| 142 | 3300005444 | Ga0070694_100070776 | Ga0070694_1000707762 | 387 |
| 143 | 3300006844 | Ga0075428_100173631 | Ga0075428_1001736312 | 387 |
| 144 | 3300006847 | Ga0075431_100238536 | Ga0075431_1002385362 | 387 |
| 145 | 3300009147 | Ga0114129_10006598 | Ga0114129_1000659810 | 387 |
| 146 | 3300009147 | Ga0114129_10335293 | Ga0114129_103352932 | 387 |
| 147 | 3300026075 | Ga0207708_10084624 | Ga0207708_100846242 | 387 |
| 148 | 3300049571 | Ga0501034_0218232 | Ga0501034_0218232_429_1601 | 387 |
| 149 | 3300050507 | nmdc:mga05p37_142513_c1 | nmdc:mga05p37_142513_c1_821_1984 | 387 |
| 150 | 3300050507 | nmdc:mga05p37_1766_c1 | nmdc:mga05p37_1766_c1_17821_19005 | 387 |
| 151 | 3300005563 | Ga0068855_100068640 | Ga0068855_1000686403 | 389 |
| 152 | 3300007076 | Ga0075435_100232064 | Ga0075435_1002320641 | 389 |
| 153 | 3300009094 | Ga0111539_10155614 | Ga0111539_101556142 | 389 |
| 154 | 3300020070 | Ga0206356_11274886 | Ga0206356_112748862 | 389 |
| 155 | 3300025949 | Ga0207667_10036553 | Ga0207667_100365532 | 389 |
| 156 | 3300031728 | Ga0316578_10181871 | Ga0316578_101818711 | 389 |
| 157 | 3300031727 | Ga0316576_10004090 | Ga0316576_100040904 | 390 |
| 158 | 3300031733 | Ga0316577_10001955 | Ga0316577_100019558 | 390 |
| 159 | 3300036647 | Ga0316582_0002786 | Ga0316582_0002786_3831_5003 | 390 |
| 160 | 3300036712 | Ga0316584_0001769 | Ga0316584_0001769_1185_2357 | 390 |
| 161 | 3300049686 | Ga0501257_005583 | Ga0501257_005583_312_1484 | 390 |
| 162 | 3300049572 | Ga0501036_0161162 | Ga0501036_0161162_701_1876 | 391 |
| 163 | 3300005341 | Ga0070691_10003961 | Ga0070691_100039615 | 393 |
| 164 | 3300031247 | Ga0265340_10030526 | Ga0265340_100305263 | 393 |
| 165 | 3300031711 | Ga0265314_10024708 | Ga0265314_100247082 | 393 |
| 166 | 3300048918 | Ga0496115_0030353 | Ga0496115_0030353_2014_3198 | 393 |
| 167 | 3300026089 | Ga0207648_10341575 | Ga0207648_103415751 | 394 |
| 168 | 3300031731 | Ga0307405_10003504 | Ga0307405_100035042 | 394 |
| 169 | 3300031731 | Ga0307405_10063028 | Ga0307405_100630281 | 394 |
| 170 | 3300031824 | Ga0307413_10189684 | Ga0307413_101896841 | 394 |
| 171 | 3300031901 | Ga0307406_10042025 | Ga0307406_100420252 | 394 |
| 172 | 3300031901 | Ga0307406_10067054 | Ga0307406_100670542 | 394 |
| 173 | 3300031911 | Ga0307412_10087544 | Ga0307412_100875442 | 394 |
| 174 | 3300031995 | Ga0307409_100123248 | Ga0307409_1001232481 | 394 |
| 175 | 3300031995 | Ga0307409_100332750 | Ga0307409_1003327502 | 394 |
| 176 | 3300032002 | Ga0307416_100123440 | Ga0307416_1001234401 | 394 |
| 177 | 3300032002 | Ga0307416_100177210 | Ga0307416_1001772102 | 394 |
| 178 | 3300032004 | Ga0307414_10013736 | Ga0307414_100137363 | 394 |
| 179 | 3300032005 | Ga0307411_10064065 | Ga0307411_100640651 | 394 |
| 180 | 3300032005 | Ga0307411_10207731 | Ga0307411_102077311 | 394 |
| 181 | 3300032126 | Ga0307415_100034014 | Ga0307415_1000340143 | 394 |
| 182 | 3300032126 | Ga0307415_100150170 | Ga0307415_1001501702 | 394 |
| 183 | 3300032126 | Ga0307415_100171236 | Ga0307415_1001712362 | 394 |
| 184 | 3300005471 | Ga0070698_100016906 | Ga0070698_1000169065 | 395 |
| 185 | 3300005518 | Ga0070699_100134093 | Ga0070699_1001340932 | 395 |
| 186 | 3300005546 | Ga0070696_100000366 | Ga0070696_10000036610 | 395 |
| 187 | 3300005614 | Ga0068856_100279572 | Ga0068856_1002795721 | 395 |
| 188 | 3300005985 | Ga0081539_10000290 | Ga0081539_1000029019 | 395 |
| 189 | 3300013307 | Ga0157372_10028311 | Ga0157372_100283112 | 395 |
| 190 | 3300021384 | Ga0213876_10010769 | Ga0213876_100107693 | 395 |
| 191 | 3300026078 | Ga0207702_10241636 | Ga0207702_102416362 | 395 |
| 192 | 3300031731 | Ga0307405_10001938 | Ga0307405_100019384 | 395 |
| 193 | 3300031852 | Ga0307410_10032618 | Ga0307410_100326181 | 395 |
| 194 | 3300031852 | Ga0307410_10035531 | Ga0307410_100355313 | 395 |
| 195 | 3300031901 | Ga0307406_10003417 | Ga0307406_100034174 | 395 |
| 196 | 3300031901 | Ga0307406_10267678 | Ga0307406_102676781 | 395 |
| 197 | 3300031903 | Ga0307407_10000215 | Ga0307407_100002159 | 395 |
| 198 | 3300031903 | Ga0307407_10029111 | Ga0307407_100291111 | 395 |
| 199 | 3300031903 | Ga0307407_10031145 | Ga0307407_100311452 | 395 |
| 200 | 3300031911 | Ga0307412_10161126 | Ga0307412_101611261 | 395 |
| 201 | 3300031995 | Ga0307409_100089862 | Ga0307409_1000898621 | 395 |
| 202 | 3300031995 | Ga0307409_100106901 | Ga0307409_1001069012 | 395 |
| 203 | 3300031995 | Ga0307409_100197987 | Ga0307409_1001979872 | 395 |
| 204 | 3300032004 | Ga0307414_10150727 | Ga0307414_101507272 | 395 |
| 205 | 3300032005 | Ga0307411_10056730 | Ga0307411_100567302 | 395 |
| 206 | 3300032005 | Ga0307411_10217962 | Ga0307411_102179621 | 395 |
| 207 | 3300032126 | Ga0307415_100051322 | Ga0307415_1000513222 | 395 |
| 208 | 3300039437 | Ga0436365_1410016 | Ga0436365_1410016_790_1998 | 395 |
| 209 | 3300048918 | Ga0496115_0132684 | Ga0496115_0132684_556_1743 | 395 |
| 210 | 3300049765 | Ga0501268_012958 | Ga0501268_012958_111_1313 | 395 |
| 211 | 3300005295 | Ga0065707_10147578 | Ga0065707_101475782 | 396 |
| 212 | 3300005339 | Ga0070660_100006566 | Ga0070660_1000065663 | 396 |
| 213 | 3300005339 | Ga0070660_100054075 | Ga0070660_1000540752 | 396 |
| 214 | 3300005339 | Ga0070660_100227058 | Ga0070660_1002270581 | 396 |
| 215 | 3300005347 | Ga0070668_100059097 | Ga0070668_1000590973 | 396 |
| 216 | 3300005353 | Ga0070669_100061421 | Ga0070669_1000614211 | 396 |
| 217 | 3300005353 | Ga0070669_100107514 | Ga0070669_1001075141 | 396 |
| 218 | 3300005355 | Ga0070671_100034859 | Ga0070671_1000348592 | 396 |
| 219 | 3300005366 | Ga0070659_100101459 | Ga0070659_1001014592 | 396 |
| 220 | 3300005435 | Ga0070714_100001589 | Ga0070714_10000158913 | 396 |
| 221 | 3300005444 | Ga0070694_100127571 | Ga0070694_1001275712 | 396 |
| 222 | 3300005445 | Ga0070708_100030039 | Ga0070708_1000300392 | 396 |
| 223 | 3300005458 | Ga0070681_10035919 | Ga0070681_100359194 | 396 |
| 224 | 3300005468 | Ga0070707_100029839 | Ga0070707_1000298392 | 396 |
| 225 | 3300005471 | Ga0070698_100000304 | Ga0070698_10000030433 | 396 |
| 226 | 3300005471 | Ga0070698_100017768 | Ga0070698_1000177682 | 396 |
| 227 | 3300005471 | Ga0070698_100091070 | Ga0070698_1000910702 | 396 |
| 228 | 3300005518 | Ga0070699_100085936 | Ga0070699_1000859362 | 396 |
| 229 | 3300005530 | Ga0070679_100099059 | Ga0070679_1000990592 | 396 |
| 230 | 3300005536 | Ga0070697_100028334 | Ga0070697_1000283344 | 396 |
| 231 | 3300005543 | Ga0070672_100092229 | Ga0070672_1000922292 | 396 |
| 232 | 3300005548 | Ga0070665_100037055 | Ga0070665_1000370553 | 396 |
| 233 | 3300005549 | Ga0070704_100008321 | Ga0070704_1000083215 | 396 |
| 234 | 3300005577 | Ga0068857_100042460 | Ga0068857_1000424602 | 396 |
| 235 | 3300005840 | Ga0068870_10005763 | Ga0068870_100057632 | 396 |
| 236 | 3300005844 | Ga0068862_100003461 | Ga0068862_10000346111 | 396 |
| 237 | 3300006844 | Ga0075428_100143933 | Ga0075428_1001439332 | 396 |
| 238 | 3300006846 | Ga0075430_100005544 | Ga0075430_1000055449 | 396 |
| 239 | 3300006846 | Ga0075430_100018306 | Ga0075430_1000183065 | 396 |
| 240 | 3300006846 | Ga0075430_100057193 | Ga0075430_1000571934 | 396 |
| 241 | 3300006846 | Ga0075430_100072796 | Ga0075430_1000727962 | 396 |
| 242 | 3300006847 | Ga0075431_100130776 | Ga0075431_1001307762 | 396 |
| 243 | 3300006871 | Ga0075434_100026438 | Ga0075434_1000264384 | 396 |
| 244 | 3300006871 | Ga0075434_100071500 | Ga0075434_1000715002 | 396 |
| 245 | 3300006871 | Ga0075434_100077810 | Ga0075434_1000778102 | 396 |
| 246 | 3300007076 | Ga0075435_100241615 | Ga0075435_1002416152 | 396 |
| 247 | 3300009094 | Ga0111539_10073804 | Ga0111539_100738042 | 396 |
| 248 | 3300009094 | Ga0111539_10187877 | Ga0111539_101878772 | 396 |
| 249 | 3300009098 | Ga0105245_10114676 | Ga0105245_101146762 | 396 |
| 250 | 3300009147 | Ga0114129_10001902 | Ga0114129_100019027 | 396 |
| 251 | 3300009176 | Ga0105242_10004361 | Ga0105242_100043614 | 396 |
| 252 | 3300009176 | Ga0105242_10145674 | Ga0105242_101456742 | 396 |
| 253 | 3300009176 | Ga0105242_10174504 | Ga0105242_101745041 | 396 |
| 254 | 3300009177 | Ga0105248_10013902 | Ga0105248_100139022 | 396 |
| 255 | 3300009177 | Ga0105248_10107543 | Ga0105248_101075432 | 396 |
| 256 | 3300009177 | Ga0105248_10294906 | Ga0105248_102949062 | 396 |
| 257 | 3300009177 | Ga0105248_10320811 | Ga0105248_103208111 | 396 |
| 258 | 3300009553 | Ga0105249_10002382 | Ga0105249_100023823 | 396 |
| 259 | 3300010375 | Ga0105239_10017961 | Ga0105239_100179615 | 396 |
| 260 | 3300013100 | Ga0157373_10021800 | Ga0157373_100218002 | 396 |
| 261 | 3300013105 | Ga0157369_10000703 | Ga0157369_1000070311 | 396 |
| 262 | 3300013306 | Ga0163162_10041311 | Ga0163162_100413115 | 396 |
| 263 | 3300013306 | Ga0163162_10416745 | Ga0163162_104167451 | 396 |
| 264 | 3300013307 | Ga0157372_10012150 | Ga0157372_100121503 | 396 |
| 265 | 3300013307 | Ga0157372_10014410 | Ga0157372_100144106 | 396 |
| 266 | 3300013307 | Ga0157372_10026080 | Ga0157372_100260807 | 396 |
| 267 | 3300013307 | Ga0157372_10059881 | Ga0157372_100598813 | 396 |
| 268 | 3300013308 | Ga0157375_10016669 | Ga0157375_100166694 | 396 |
| 269 | 3300013308 | Ga0157375_10151762 | Ga0157375_101517622 | 396 |
| 270 | 3300013308 | Ga0157375_10277758 | Ga0157375_102777581 | 396 |
| 271 | 3300014325 | Ga0163163_10049135 | Ga0163163_100491353 | 396 |
| 272 | 3300014326 | Ga0157380_10011979 | Ga0157380_100119793 | 396 |
| 273 | 3300014968 | Ga0157379_10086168 | Ga0157379_100861682 | 396 |
| 274 | 3300014969 | Ga0157376_10240300 | Ga0157376_102403002 | 396 |
| 275 | 3300025908 | Ga0207643_10007454 | Ga0207643_100074542 | 396 |
| 276 | 3300025909 | Ga0207705_10000772 | Ga0207705_1000077210 | 396 |
| 277 | 3300025912 | Ga0207707_10003701 | Ga0207707_100037012 | 396 |
| 278 | 3300025915 | Ga0207693_10150039 | Ga0207693_101500392 | 396 |
| 279 | 3300025916 | Ga0207663_10053600 | Ga0207663_100536002 | 396 |
| 280 | 3300025917 | Ga0207660_10086151 | Ga0207660_100861512 | 396 |
| 281 | 3300025917 | Ga0207660_10268349 | Ga0207660_102683491 | 396 |
| 282 | 3300025919 | Ga0207657_10005682 | Ga0207657_100056825 | 396 |
| 283 | 3300025919 | Ga0207657_10137201 | Ga0207657_101372012 | 396 |
| 284 | 3300025919 | Ga0207657_10200205 | Ga0207657_102002052 | 396 |
| 285 | 3300025921 | Ga0207652_10195138 | Ga0207652_101951382 | 396 |
| 286 | 3300025923 | Ga0207681_10006835 | Ga0207681_100068355 | 396 |
| 287 | 3300025923 | Ga0207681_10190537 | Ga0207681_101905372 | 396 |
| 288 | 3300025929 | Ga0207664_10009762 | Ga0207664_100097623 | 396 |
| 289 | 3300025931 | Ga0207644_10029906 | Ga0207644_100299062 | 396 |
| 290 | 3300025937 | Ga0207669_10023012 | Ga0207669_100230123 | 396 |
| 291 | 3300025940 | Ga0207691_10108619 | Ga0207691_101086192 | 396 |
| 292 | 3300025941 | Ga0207711_10078595 | Ga0207711_100785952 | 396 |
| 293 | 3300025941 | Ga0207711_10230850 | Ga0207711_102308502 | 396 |
| 294 | 3300025942 | Ga0207689_10002072 | Ga0207689_100020729 | 396 |
| 295 | 3300025944 | Ga0207661_10016943 | Ga0207661_100169432 | 396 |
| 296 | 3300025949 | Ga0207667_10079459 | Ga0207667_100794592 | 396 |
| 297 | 3300025960 | Ga0207651_10079602 | Ga0207651_100796022 | 396 |
| 298 | 3300025961 | Ga0207712_10030495 | Ga0207712_100304952 | 396 |
| 299 | 3300026089 | Ga0207648_10130704 | Ga0207648_101307042 | 396 |
| 300 | 3300026116 | Ga0207674_10029472 | Ga0207674_100294723 | 396 |
| 301 | 3300026118 | Ga0207675_100012918 | Ga0207675_1000129187 | 396 |
| 302 | 3300026118 | Ga0207675_100142424 | Ga0207675_1001424242 | 396 |
| 303 | 3300027682 | Ga0209971_1008991 | Ga0209971_10089912 | 396 |
| 304 | 3300027907 | Ga0207428_10170192 | Ga0207428_101701922 | 396 |
| 305 | 3300028380 | Ga0268265_10002887 | Ga0268265_100028872 | 396 |
| 306 | 3300028381 | Ga0268264_10001217 | Ga0268264_100012178 | 396 |
| 307 | 3300031548 | Ga0307408_100166013 | Ga0307408_1001660131 | 396 |
| 308 | 3300031731 | Ga0307405_10041855 | Ga0307405_100418554 | 396 |
| 309 | 3300031852 | Ga0307410_10105352 | Ga0307410_101053522 | 396 |
| 310 | 3300031995 | Ga0307409_100005431 | Ga0307409_1000054313 | 396 |
| 311 | 3300032002 | Ga0307416_100012828 | Ga0307416_1000128284 | 396 |
| 312 | 3300032005 | Ga0307411_10082100 | Ga0307411_100821002 | 396 |
| 313 | 3300035691 | Ga0373931_0127269 | Ga0373931_0127269_71_1264 | 396 |
| 314 | 3300042876 | Ga0451577_0000005 | Ga0451577_0000005_379840_381033 | 396 |
| 315 | 3300042876 | Ga0451577_0036570 | Ga0451577_0036570_2753_3949 | 396 |
| 316 | 3300045051 | Ga0451576_0399997 | Ga0451576_0399997_29_1234 | 396 |
| 317 | 3300046459 | Ga0495629_0076931 | Ga0495629_0076931_1110_2303 | 396 |
| 318 | 3300046536 | Ga0495587_0131896 | Ga0495587_0131896_138_1331 | 396 |
| 319 | 3300048907 | Ga0496104_0045729 | Ga0496104_0045729_2368_3561 | 396 |
| 320 | 3300048909 | Ga0496106_0093356 | Ga0496106_0093356_683_1876 | 396 |
| 321 | 3300048911 | Ga0496108_0000912 | Ga0496108_0000912_8401_9594 | 396 |
| 322 | 3300048912 | Ga0496109_0003320 | Ga0496109_0003320_10591_11784 | 396 |
| 323 | 3300048915 | Ga0496112_0005001 | Ga0496112_0005001_9820_11013 | 396 |
| 324 | 3300048915 | Ga0496112_0005923 | Ga0496112_0005923_4394_5587 | 396 |
| 325 | 3300048916 | Ga0496113_0001446 | Ga0496113_0001446_8098_9291 | 396 |
| 326 | 3300049569 | Ga0501032_0165469 | Ga0501032_0165469_170_1360 | 396 |
| 327 | 3300049579 | Ga0501043_0045483 | Ga0501043_0045483_2224_3414 | 396 |
| 328 | 3300049581 | Ga0501047_0059971 | Ga0501047_0059971_246_1436 | 396 |
| 329 | 3300049581 | Ga0501047_0204205 | Ga0501047_0204205_422_1612 | 396 |
| 330 | 3300049583 | Ga0501067_0006496 | Ga0501067_0006496_1166_2359 | 396 |
| 331 | 3300049583 | Ga0501067_0006937 | Ga0501067_0006937_3213_4406 | 396 |
| 332 | 3300049584 | Ga0501068_0013505 | Ga0501068_0013505_3182_4375 | 396 |
| 333 | 3300049585 | Ga0501069_0009746 | Ga0501069_0009746_3586_4779 | 396 |
| 334 | 3300049585 | Ga0501069_0017267 | Ga0501069_0017267_1439_2632 | 396 |
| 335 | 3300049586 | Ga0501070_0005114 | Ga0501070_0005114_6785_7978 | 396 |
| 336 | 3300049586 | Ga0501070_0042518 | Ga0501070_0042518_2466_3656 | 396 |
| 337 | 3300049586 | Ga0501070_0189980 | Ga0501070_0189980_446_1639 | 396 |
| 338 | 3300049587 | Ga0501071_0074358 | Ga0501071_0074358_1143_2336 | 396 |
| 339 | 3300049588 | Ga0501072_0002466 | Ga0501072_0002466_1387_2580 | 396 |
| 340 | 3300049589 | Ga0501073_0015156 | Ga0501073_0015156_2787_3980 | 396 |
| 341 | 3300049589 | Ga0501073_0020760 | Ga0501073_0020760_3057_4250 | 396 |
| 342 | 3300049590 | Ga0501074_0011079 | Ga0501074_0011079_351_1544 | 396 |
| 343 | 3300049590 | Ga0501074_0012984 | Ga0501074_0012984_1787_2980 | 396 |
| 344 | 3300049591 | Ga0501075_0232195 | Ga0501075_0232195_77_1270 | 396 |
| 345 | 3300049652 | Ga0501202_005496 | Ga0501202_005496_886_2076 | 396 |
| 346 | 3300049656 | Ga0501209_001097 | Ga0501209_001097_1105_2295 | 396 |
| 347 | 3300049661 | Ga0501217_003558 | Ga0501217_003558_1351_2541 | 396 |
| 348 | 3300049664 | Ga0501224_000370 | Ga0501224_000370_1139_2329 | 396 |
| 349 | 3300049667 | Ga0501230_007275 | Ga0501230_007275_431_1621 | 396 |
| 350 | 3300049669 | Ga0501235_000080 | Ga0501235_000080_758_1948 | 396 |
| 351 | 3300049672 | Ga0501239_001225 | Ga0501239_001225_567_1757 | 396 |
| 352 | 3300049677 | Ga0501247_001369 | Ga0501247_001369_1022_2212 | 396 |
| 353 | 3300049679 | Ga0501249_005008 | Ga0501249_005008_1448_2638 | 396 |
| 354 | 3300049688 | Ga0501259_004005 | Ga0501259_004005_61_1251 | 396 |
| 355 | 3300049705 | Ga0501225_0001718 | Ga0501225_0001718_829_2019 | 396 |
| 356 | 3300049742 | Ga0501080_0026027 | Ga0501080_0026027_3422_4615 | 396 |
| 357 | 3300049742 | Ga0501080_0031362 | Ga0501080_0031362_3204_4397 | 396 |
| 358 | 3300049742 | Ga0501080_0041539 | Ga0501080_0041539_302_1495 | 396 |
| 359 | 3300049743 | Ga0501081_0039771 | Ga0501081_0039771_407_1600 | 396 |
| 360 | 3300049743 | Ga0501081_0092066 | Ga0501081_0092066_42_1235 | 396 |
| 361 | 3300049744 | Ga0501083_0017773 | Ga0501083_0017773_1439_2632 | 396 |
| 362 | 3300049744 | Ga0501083_0044259 | Ga0501083_0044259_1388_2581 | 396 |
| 363 | 3300049763 | Ga0501266_001036 | Ga0501266_001036_2289_3479 | 396 |
| 364 | 3300049765 | Ga0501268_000756 | Ga0501268_000756_2353_3543 | 396 |
| 365 | 3300049850 | Ga0501204_003158 | Ga0501204_003158_479_1669 | 396 |
| 366 | 3300050507 | nmdc:mga05p37_114403_c1 | nmdc:mga05p37_114403_c1_1436_2626 | 396 |
| 367 | 3300050507 | nmdc:mga05p37_16091_c1 | nmdc:mga05p37_16091_c1_5135_6328 | 396 |
| 368 | 3300050508 | nmdc:mga09592_12192_c1 | nmdc:mga09592_12192_c1_694_1887 | 396 |
| 369 | 3300050508 | nmdc:mga09592_24034_c1 | nmdc:mga09592_24034_c1_3756_4952 | 396 |
| 370 | 3300050509 | nmdc:mga0qj67_17085_c1 | nmdc:mga0qj67_17085_c1_169_1362 | 396 |
| 371 | 3300050509 | nmdc:mga0qj67_262491_c1 | nmdc:mga0qj67_262491_c1_138_1331 | 396 |
| 372 | 3300050509 | nmdc:mga0qj67_28563_c1 | nmdc:mga0qj67_28563_c1_2077_3276 | 396 |
| 373 | 3300050510 | nmdc:mga06r32_29595_c1 | nmdc:mga06r32_29595_c1_1125_2318 | 396 |
| 374 | 3300050510 | nmdc:mga06r32_77742_c1 | nmdc:mga06r32_77742_c1_372_1565 | 396 |
| 375 | 3300050512 | nmdc:mga0n895_10584_c1 | nmdc:mga0n895_10584_c1_4821_6014 | 396 |
| 376 | 3300050512 | nmdc:mga0n895_122780_c1 | nmdc:mga0n895_122780_c1_719_1912 | 396 |
| 377 | 3300050512 | nmdc:mga0n895_185619_c1 | nmdc:mga0n895_185619_c1_379_1572 | 396 |
| 378 | 3300050512 | nmdc:mga0n895_40532_c1 | nmdc:mga0n895_40532_c1_1440_2645 | 396 |
| 379 | 3300050512 | nmdc:mga0n895_94203_c1 | nmdc:mga0n895_94203_c1_1723_2916 | 396 |
| 380 | 3300050514 | nmdc:mga08x19_201063_c1 | nmdc:mga08x19_201063_c1_119_1312 | 396 |
| 381 | 3300050515 | nmdc:mga0a205_209681_c1 | nmdc:mga0a205_209681_c1_298_1491 | 396 |
| 382 | 3300050515 | nmdc:mga0a205_25678_c1 | nmdc:mga0a205_25678_c1_3906_5099 | 396 |
| 383 | 3300054114 | Ga0501084_0007102 | Ga0501084_0007102_3584_4777 | 396 |
| 384 | 3300054114 | Ga0501084_0039422 | Ga0501084_0039422_377_1570 | 396 |
| 385 | 3300060353 | Ga0501082_0008232 | Ga0501082_0008232_3283_4476 | 396 |
| 386 | 3300004803 | Ga0058862_12681691 | Ga0058862_126816913 | 397 |
| 387 | 3300005290 | Ga0065712_10087269 | Ga0065712_100872692 | 397 |
| 388 | 3300005295 | Ga0065707_10085732 | Ga0065707_100857323 | 397 |
| 389 | 3300005327 | Ga0070658_10007500 | Ga0070658_100075003 | 397 |
| 390 | 3300005327 | Ga0070658_10013583 | Ga0070658_100135834 | 397 |
| 391 | 3300005327 | Ga0070658_10210928 | Ga0070658_102109281 | 397 |
| 392 | 3300005328 | Ga0070676_10001729 | Ga0070676_1000172911 | 397 |
| 393 | 3300005328 | Ga0070676_10025287 | Ga0070676_100252873 | 397 |
| 394 | 3300005329 | Ga0070683_100004796 | Ga0070683_10000479610 | 397 |
| 395 | 3300005329 | Ga0070683_100090149 | Ga0070683_1000901493 | 397 |
| 396 | 3300005330 | Ga0070690_100011022 | Ga0070690_1000110221 | 397 |
| 397 | 3300005333 | Ga0070677_10016654 | Ga0070677_100166542 | 397 |
| 398 | 3300005334 | Ga0068869_100007356 | Ga0068869_1000073565 | 397 |
| 399 | 3300005336 | Ga0070680_100001150 | Ga0070680_1000011502 | 397 |
| 400 | 3300005336 | Ga0070680_100015762 | Ga0070680_1000157624 | 397 |
| 401 | 3300005336 | Ga0070680_100246993 | Ga0070680_1002469931 | 397 |
| 402 | 3300005337 | Ga0070682_100001803 | Ga0070682_1000018037 | 397 |
| 403 | 3300005339 | Ga0070660_100009811 | Ga0070660_1000098113 | 397 |
| 404 | 3300005340 | Ga0070689_100023013 | Ga0070689_1000230131 | 397 |
| 405 | 3300005344 | Ga0070661_100013735 | Ga0070661_1000137352 | 397 |
| 406 | 3300005345 | Ga0070692_10006257 | Ga0070692_100062573 | 397 |
| 407 | 3300005345 | Ga0070692_10025337 | Ga0070692_100253372 | 397 |
| 408 | 3300005347 | Ga0070668_100001256 | Ga0070668_1000012569 | 397 |
| 409 | 3300005354 | Ga0070675_100004386 | Ga0070675_1000043866 | 397 |
| 410 | 3300005354 | Ga0070675_100060255 | Ga0070675_1000602552 | 397 |
| 411 | 3300005355 | Ga0070671_100014034 | Ga0070671_1000140344 | 397 |
| 412 | 3300005355 | Ga0070671_100042215 | Ga0070671_1000422151 | 397 |
| 413 | 3300005356 | Ga0070674_100031297 | Ga0070674_1000312972 | 397 |
| 414 | 3300005366 | Ga0070659_100055898 | Ga0070659_1000558981 | 397 |
| 415 | 3300005366 | Ga0070659_100131520 | Ga0070659_1001315202 | 397 |
| 416 | 3300005367 | Ga0070667_100005119 | Ga0070667_1000051196 | 397 |
| 417 | 3300005367 | Ga0070667_100231787 | Ga0070667_1002317872 | 397 |
| 418 | 3300005434 | Ga0070709_10026893 | Ga0070709_100268932 | 397 |
| 419 | 3300005435 | Ga0070714_100035823 | Ga0070714_1000358234 | 397 |
| 420 | 3300005436 | Ga0070713_100000223 | Ga0070713_10000022314 | 397 |
| 421 | 3300005438 | Ga0070701_10027207 | Ga0070701_100272072 | 397 |
| 422 | 3300005439 | Ga0070711_100077594 | Ga0070711_1000775942 | 397 |
| 423 | 3300005441 | Ga0070700_100024511 | Ga0070700_1000245113 | 397 |
| 424 | 3300005444 | Ga0070694_100154517 | Ga0070694_1001545172 | 397 |
| 425 | 3300005445 | Ga0070708_100030224 | Ga0070708_1000302246 | 397 |
| 426 | 3300005445 | Ga0070708_100109496 | Ga0070708_1001094962 | 397 |
| 427 | 3300005456 | Ga0070678_100054667 | Ga0070678_1000546672 | 397 |
| 428 | 3300005457 | Ga0070662_100005443 | Ga0070662_1000054434 | 397 |
| 429 | 3300005458 | Ga0070681_10000978 | Ga0070681_1000097813 | 397 |
| 430 | 3300005458 | Ga0070681_10001876 | Ga0070681_1000187619 | 397 |
| 431 | 3300005458 | Ga0070681_10016210 | Ga0070681_100162105 | 397 |
| 432 | 3300005458 | Ga0070681_10016523 | Ga0070681_100165232 | 397 |
| 433 | 3300005458 | Ga0070681_10027504 | Ga0070681_100275041 | 397 |
| 434 | 3300005458 | Ga0070681_10065418 | Ga0070681_100654182 | 397 |
| 435 | 3300005458 | Ga0070681_10093955 | Ga0070681_100939552 | 397 |
| 436 | 3300005459 | Ga0068867_100054180 | Ga0068867_1000541802 | 397 |
| 437 | 3300005468 | Ga0070707_100001546 | Ga0070707_1000015469 | 397 |
| 438 | 3300005468 | Ga0070707_100036399 | Ga0070707_1000363992 | 397 |
| 439 | 3300005468 | Ga0070707_100151413 | Ga0070707_1001514132 | 397 |
| 440 | 3300005518 | Ga0070699_100093379 | Ga0070699_1000933792 | 397 |
| 441 | 3300005530 | Ga0070679_100007387 | Ga0070679_1000073877 | 397 |
| 442 | 3300005530 | Ga0070679_100015830 | Ga0070679_1000158307 | 397 |
| 443 | 3300005530 | Ga0070679_100020198 | Ga0070679_1000201983 | 397 |
| 444 | 3300005530 | Ga0070679_100026564 | Ga0070679_1000265643 | 397 |
| 445 | 3300005530 | Ga0070679_100104869 | Ga0070679_1001048692 | 397 |
| 446 | 3300005535 | Ga0070684_100000532 | Ga0070684_10000053215 | 397 |
| 447 | 3300005535 | Ga0070684_100003959 | Ga0070684_1000039593 | 397 |
| 448 | 3300005535 | Ga0070684_100014509 | Ga0070684_1000145091 | 397 |
| 449 | 3300005539 | Ga0068853_100014834 | Ga0068853_1000148343 | 397 |
| 450 | 3300005543 | Ga0070672_100008586 | Ga0070672_1000085866 | 397 |
| 451 | 3300005546 | Ga0070696_100000824 | Ga0070696_10000082410 | 397 |
| 452 | 3300005546 | Ga0070696_100004572 | Ga0070696_1000045722 | 397 |
| 453 | 3300005546 | Ga0070696_100022348 | Ga0070696_1000223482 | 397 |
| 454 | 3300005546 | Ga0070696_100101642 | Ga0070696_1001016422 | 397 |
| 455 | 3300005547 | Ga0070693_100002493 | Ga0070693_1000024932 | 397 |
| 456 | 3300005547 | Ga0070693_100122508 | Ga0070693_1001225082 | 397 |
| 457 | 3300005548 | Ga0070665_100211391 | Ga0070665_1002113912 | 397 |
| 458 | 3300005563 | Ga0068855_100209375 | Ga0068855_1002093751 | 397 |
| 459 | 3300005564 | Ga0070664_100026278 | Ga0070664_1000262783 | 397 |
| 460 | 3300005564 | Ga0070664_100097643 | Ga0070664_1000976432 | 397 |
| 461 | 3300005577 | Ga0068857_100007819 | Ga0068857_1000078192 | 397 |
| 462 | 3300005577 | Ga0068857_100019015 | Ga0068857_1000190152 | 397 |
| 463 | 3300005615 | Ga0070702_100095839 | Ga0070702_1000958391 | 397 |
| 464 | 3300005617 | Ga0068859_100007707 | Ga0068859_1000077075 | 397 |
| 465 | 3300005719 | Ga0068861_100001399 | Ga0068861_1000013992 | 397 |
| 466 | 3300005834 | Ga0068851_10025230 | Ga0068851_100252302 | 397 |
| 467 | 3300005841 | Ga0068863_100130271 | Ga0068863_1001302712 | 397 |
| 468 | 3300005842 | Ga0068858_100035928 | Ga0068858_1000359282 | 397 |
| 469 | 3300005843 | Ga0068860_100010585 | Ga0068860_1000105853 | 397 |
| 470 | 3300005844 | Ga0068862_100221115 | Ga0068862_1002211152 | 397 |
| 471 | 3300005937 | Ga0081455_10027499 | Ga0081455_100274992 | 397 |
| 472 | 3300005937 | Ga0081455_10218649 | Ga0081455_102186491 | 397 |
| 473 | 3300005981 | Ga0081538_10088963 | Ga0081538_100889632 | 397 |
| 474 | 3300005985 | Ga0081539_10026740 | Ga0081539_100267402 | 397 |
| 475 | 3300006173 | Ga0070716_100011367 | Ga0070716_1000113673 | 397 |
| 476 | 3300006175 | Ga0070712_100025778 | Ga0070712_1000257782 | 397 |
| 477 | 3300006175 | Ga0070712_100095463 | Ga0070712_1000954632 | 397 |
| 478 | 3300006844 | Ga0075428_100037388 | Ga0075428_1000373883 | 397 |
| 479 | 3300006852 | Ga0075433_10069477 | Ga0075433_100694772 | 397 |
| 480 | 3300006852 | Ga0075433_10123858 | Ga0075433_101238582 | 397 |
| 481 | 3300006852 | Ga0075433_10176100 | Ga0075433_101761001 | 397 |
| 482 | 3300006871 | Ga0075434_100006320 | Ga0075434_1000063202 | 397 |
| 483 | 3300006871 | Ga0075434_100057505 | Ga0075434_1000575053 | 397 |
| 484 | 3300006881 | Ga0068865_100008155 | Ga0068865_1000081553 | 397 |
| 485 | 3300006881 | Ga0068865_100017197 | Ga0068865_1000171972 | 397 |
| 486 | 3300006881 | Ga0068865_100182146 | Ga0068865_1001821462 | 397 |
| 487 | 3300006914 | Ga0075436_100035378 | Ga0075436_1000353782 | 397 |
| 488 | 3300006931 | Ga0097620_100007707 | Ga0097620_1000077075 | 397 |
| 489 | 3300009093 | Ga0105240_10229668 | Ga0105240_102296682 | 397 |
| 490 | 3300009094 | Ga0111539_10248186 | Ga0111539_102481862 | 397 |
| 491 | 3300009094 | Ga0111539_10315906 | Ga0111539_103159062 | 397 |
| 492 | 3300009094 | Ga0111539_10500062 | Ga0111539_105000621 | 397 |
| 493 | 3300009098 | Ga0105245_10298097 | Ga0105245_102980971 | 397 |
| 494 | 3300009147 | Ga0114129_10018551 | Ga0114129_100185512 | 397 |
| 495 | 3300009147 | Ga0114129_10036775 | Ga0114129_100367753 | 397 |
| 496 | 3300009147 | Ga0114129_10178696 | Ga0114129_101786963 | 397 |
| 497 | 3300009147 | Ga0114129_10385035 | Ga0114129_103850352 | 397 |
| 498 | 3300009174 | Ga0105241_10150396 | Ga0105241_101503961 | 397 |
| 499 | 3300009177 | Ga0105248_10036692 | Ga0105248_100366925 | 397 |
| 500 | 3300009177 | Ga0105248_10077842 | Ga0105248_100778422 | 397 |
| 501 | 3300009177 | Ga0105248_10309276 | Ga0105248_103092762 | 397 |
| 502 | 3300009553 | Ga0105249_10001395 | Ga0105249_100013959 | 397 |
| 503 | 3300009553 | Ga0105249_10170406 | Ga0105249_101704061 | 397 |
| 504 | 3300010375 | Ga0105239_10038711 | Ga0105239_100387113 | 397 |
| 505 | 3300013105 | Ga0157369_10104405 | Ga0157369_101044051 | 397 |
| 506 | 3300013297 | Ga0157378_10005920 | Ga0157378_1000592011 | 397 |
| 507 | 3300013306 | Ga0163162_10004539 | Ga0163162_100045398 | 397 |
| 508 | 3300013306 | Ga0163162_10088110 | Ga0163162_100881102 | 397 |
| 509 | 3300013306 | Ga0163162_10162081 | Ga0163162_101620812 | 397 |
| 510 | 3300013307 | Ga0157372_10100853 | Ga0157372_101008531 | 397 |
| 511 | 3300013307 | Ga0157372_10234355 | Ga0157372_102343551 | 397 |
| 512 | 3300013307 | Ga0157372_10481477 | Ga0157372_104814772 | 397 |
| 513 | 3300013308 | Ga0157375_10063176 | Ga0157375_100631763 | 397 |
| 514 | 3300013308 | Ga0157375_10148606 | Ga0157375_101486062 | 397 |
| 515 | 3300014968 | Ga0157379_10061745 | Ga0157379_100617452 | 397 |
| 516 | 3300014968 | Ga0157379_10233051 | Ga0157379_102330512 | 397 |
| 517 | 3300017792 | Ga0163161_10090582 | Ga0163161_100905821 | 397 |
| 518 | 3300017792 | Ga0163161_10163396 | Ga0163161_101633962 | 397 |
| 519 | 3300025315 | Ga0207697_10003283 | Ga0207697_100032836 | 397 |
| 520 | 3300025321 | Ga0207656_10042204 | Ga0207656_100422042 | 397 |
| 521 | 3300025901 | Ga0207688_10014055 | Ga0207688_100140551 | 397 |
| 522 | 3300025904 | Ga0207647_10033949 | Ga0207647_100339492 | 397 |
| 523 | 3300025906 | Ga0207699_10094264 | Ga0207699_100942642 | 397 |
| 524 | 3300025907 | Ga0207645_10000203 | Ga0207645_1000020316 | 397 |
| 525 | 3300025907 | Ga0207645_10041414 | Ga0207645_100414142 | 397 |
| 526 | 3300025907 | Ga0207645_10123777 | Ga0207645_101237772 | 397 |
| 527 | 3300025908 | Ga0207643_10014845 | Ga0207643_100148452 | 397 |
| 528 | 3300025909 | Ga0207705_10029065 | Ga0207705_100290654 | 397 |
| 529 | 3300025910 | Ga0207684_10136243 | Ga0207684_101362432 | 397 |
| 530 | 3300025912 | Ga0207707_10016312 | Ga0207707_100163125 | 397 |
| 531 | 3300025912 | Ga0207707_10020807 | Ga0207707_100208072 | 397 |
| 532 | 3300025912 | Ga0207707_10021064 | Ga0207707_100210642 | 397 |
| 533 | 3300025912 | Ga0207707_10025112 | Ga0207707_100251121 | 397 |
| 534 | 3300025912 | Ga0207707_10148080 | Ga0207707_101480802 | 397 |
| 535 | 3300025915 | Ga0207693_10043614 | Ga0207693_100436143 | 397 |
| 536 | 3300025916 | Ga0207663_10058928 | Ga0207663_100589282 | 397 |
| 537 | 3300025916 | Ga0207663_10192157 | Ga0207663_101921571 | 397 |
| 538 | 3300025917 | Ga0207660_10001029 | Ga0207660_1000102913 | 397 |
| 539 | 3300025917 | Ga0207660_10012858 | Ga0207660_100128584 | 397 |
| 540 | 3300025918 | Ga0207662_10003049 | Ga0207662_100030492 | 397 |
| 541 | 3300025918 | Ga0207662_10013467 | Ga0207662_100134672 | 397 |
| 542 | 3300025918 | Ga0207662_10020139 | Ga0207662_100201391 | 397 |
| 543 | 3300025919 | Ga0207657_10040913 | Ga0207657_100409135 | 397 |
| 544 | 3300025919 | Ga0207657_10081718 | Ga0207657_100817182 | 397 |
| 545 | 3300025921 | Ga0207652_10008351 | Ga0207652_100083513 | 397 |
| 546 | 3300025921 | Ga0207652_10020240 | Ga0207652_100202401 | 397 |
| 547 | 3300025922 | Ga0207646_10003329 | Ga0207646_1000332912 | 397 |
| 548 | 3300025923 | Ga0207681_10011214 | Ga0207681_100112141 | 397 |
| 549 | 3300025923 | Ga0207681_10015976 | Ga0207681_100159764 | 397 |
| 550 | 3300025926 | Ga0207659_10002780 | Ga0207659_100027804 | 397 |
| 551 | 3300025926 | Ga0207659_10041529 | Ga0207659_100415293 | 397 |
| 552 | 3300025928 | Ga0207700_10000633 | Ga0207700_100006331 | 397 |
| 553 | 3300025929 | Ga0207664_10032021 | Ga0207664_100320214 | 397 |
| 554 | 3300025929 | Ga0207664_10206374 | Ga0207664_102063742 | 397 |
| 555 | 3300025932 | Ga0207690_10013782 | Ga0207690_100137823 | 397 |
| 556 | 3300025932 | Ga0207690_10023216 | Ga0207690_100232161 | 397 |
| 557 | 3300025932 | Ga0207690_10058650 | Ga0207690_100586501 | 397 |
| 558 | 3300025932 | Ga0207690_10099354 | Ga0207690_100993542 | 397 |
| 559 | 3300025933 | Ga0207706_10001427 | Ga0207706_100014271 | 397 |
| 560 | 3300025933 | Ga0207706_10005277 | Ga0207706_1000527713 | 397 |
| 561 | 3300025933 | Ga0207706_10017143 | Ga0207706_100171432 | 397 |
| 562 | 3300025934 | Ga0207686_10024071 | Ga0207686_100240713 | 397 |
| 563 | 3300025935 | Ga0207709_10095522 | Ga0207709_100955222 | 397 |
| 564 | 3300025938 | Ga0207704_10020086 | Ga0207704_100200862 | 397 |
| 565 | 3300025938 | Ga0207704_10039326 | Ga0207704_100393262 | 397 |
| 566 | 3300025939 | Ga0207665_10005720 | Ga0207665_100057202 | 397 |
| 567 | 3300025940 | Ga0207691_10003767 | Ga0207691_100037674 | 397 |
| 568 | 3300025940 | Ga0207691_10034713 | Ga0207691_100347132 | 397 |
| 569 | 3300025940 | Ga0207691_10057744 | Ga0207691_100577443 | 397 |
| 570 | 3300025940 | Ga0207691_10121497 | Ga0207691_101214972 | 397 |
| 571 | 3300025942 | Ga0207689_10004964 | Ga0207689_100049647 | 397 |
| 572 | 3300025944 | Ga0207661_10006778 | Ga0207661_100067788 | 397 |
| 573 | 3300025944 | Ga0207661_10043299 | Ga0207661_100432991 | 397 |
| 574 | 3300025944 | Ga0207661_10142790 | Ga0207661_101427902 | 397 |
| 575 | 3300025945 | Ga0207679_10017014 | Ga0207679_100170144 | 397 |
| 576 | 3300025945 | Ga0207679_10019179 | Ga0207679_100191794 | 397 |
| 577 | 3300025949 | Ga0207667_10131050 | Ga0207667_101310502 | 397 |
| 578 | 3300025960 | Ga0207651_10073134 | Ga0207651_100731342 | 397 |
| 579 | 3300025960 | Ga0207651_10161934 | Ga0207651_101619341 | 397 |
| 580 | 3300025961 | Ga0207712_10019275 | Ga0207712_100192753 | 397 |
| 581 | 3300025972 | Ga0207668_10004208 | Ga0207668_100042083 | 397 |
| 582 | 3300025972 | Ga0207668_10075221 | Ga0207668_100752212 | 397 |
| 583 | 3300026023 | Ga0207677_10170257 | Ga0207677_101702572 | 397 |
| 584 | 3300026067 | Ga0207678_10048061 | Ga0207678_100480611 | 397 |
| 585 | 3300026078 | Ga0207702_10009373 | Ga0207702_100093735 | 397 |
| 586 | 3300026089 | Ga0207648_10016956 | Ga0207648_100169565 | 397 |
| 587 | 3300026089 | Ga0207648_10062016 | Ga0207648_100620162 | 397 |
| 588 | 3300026089 | Ga0207648_10172456 | Ga0207648_101724562 | 397 |
| 589 | 3300026095 | Ga0207676_10021319 | Ga0207676_100213192 | 397 |
| 590 | 3300026116 | Ga0207674_10000548 | Ga0207674_1000054822 | 397 |
| 591 | 3300026116 | Ga0207674_10006791 | Ga0207674_1000679111 | 397 |
| 592 | 3300026116 | Ga0207674_10030455 | Ga0207674_100304552 | 397 |
| 593 | 3300026116 | Ga0207674_10145927 | Ga0207674_101459272 | 397 |
| 594 | 3300026118 | Ga0207675_100004371 | Ga0207675_10000437111 | 397 |
| 595 | 3300026121 | Ga0207683_10010379 | Ga0207683_100103798 | 397 |
| 596 | 3300026121 | Ga0207683_10185328 | Ga0207683_101853282 | 397 |
| 597 | 3300026142 | Ga0207698_10113617 | Ga0207698_101136172 | 397 |
| 598 | 3300026142 | Ga0207698_10156592 | Ga0207698_101565922 | 397 |
| 599 | 3300027876 | Ga0209974_10019510 | Ga0209974_100195101 | 397 |
| 600 | 3300028379 | Ga0268266_10103390 | Ga0268266_101033901 | 397 |
| 601 | 3300028381 | Ga0268264_10095681 | Ga0268264_100956812 | 397 |
| 602 | 3300031548 | Ga0307408_100000777 | Ga0307408_1000007773 | 397 |
| 603 | 3300031548 | Ga0307408_100227783 | Ga0307408_1002277831 | 397 |
| 604 | 3300031731 | Ga0307405_10021160 | Ga0307405_100211602 | 397 |
| 605 | 3300031824 | Ga0307413_10003160 | Ga0307413_100031602 | 397 |
| 606 | 3300031824 | Ga0307413_10029335 | Ga0307413_100293352 | 397 |
| 607 | 3300031824 | Ga0307413_10046486 | Ga0307413_100464862 | 397 |
| 608 | 3300031824 | Ga0307413_10120817 | Ga0307413_101208172 | 397 |
| 609 | 3300031852 | Ga0307410_10000624 | Ga0307410_100006242 | 397 |
| 610 | 3300031852 | Ga0307410_10015033 | Ga0307410_100150332 | 397 |
| 611 | 3300031852 | Ga0307410_10037181 | Ga0307410_100371812 | 397 |
| 612 | 3300031852 | Ga0307410_10049335 | Ga0307410_100493352 | 397 |
| 613 | 3300031852 | Ga0307410_10073931 | Ga0307410_100739312 | 397 |
| 614 | 3300031901 | Ga0307406_10036579 | Ga0307406_100365791 | 397 |
| 615 | 3300031901 | Ga0307406_10046624 | Ga0307406_100466242 | 397 |
| 616 | 3300031901 | Ga0307406_10066057 | Ga0307406_100660572 | 397 |
| 617 | 3300031903 | Ga0307407_10006344 | Ga0307407_100063444 | 397 |
| 618 | 3300031903 | Ga0307407_10009125 | Ga0307407_100091253 | 397 |
| 619 | 3300031903 | Ga0307407_10011201 | Ga0307407_100112012 | 397 |
| 620 | 3300031903 | Ga0307407_10025119 | Ga0307407_100251191 | 397 |
| 621 | 3300031903 | Ga0307407_10148971 | Ga0307407_101489711 | 397 |
| 622 | 3300031995 | Ga0307409_100000657 | Ga0307409_1000006571 | 397 |
| 623 | 3300031995 | Ga0307409_100063198 | Ga0307409_1000631982 | 397 |
| 624 | 3300031995 | Ga0307409_100068741 | Ga0307409_1000687412 | 397 |
| 625 | 3300031995 | Ga0307409_100114409 | Ga0307409_1001144092 | 397 |
| 626 | 3300031995 | Ga0307409_100140614 | Ga0307409_1001406142 | 397 |
| 627 | 3300032002 | Ga0307416_100000226 | Ga0307416_10000022616 | 397 |
| 628 | 3300032002 | Ga0307416_100012079 | Ga0307416_1000120795 | 397 |
| 629 | 3300032002 | Ga0307416_100121873 | Ga0307416_1001218732 | 397 |
| 630 | 3300032002 | Ga0307416_100218838 | Ga0307416_1002188382 | 397 |
| 631 | 3300032004 | Ga0307414_10039699 | Ga0307414_100396993 | 397 |
| 632 | 3300032004 | Ga0307414_10047904 | Ga0307414_100479042 | 397 |
| 633 | 3300032005 | Ga0307411_10001007 | Ga0307411_100010073 | 397 |
| 634 | 3300032005 | Ga0307411_10026785 | Ga0307411_100267852 | 397 |
| 635 | 3300032005 | Ga0307411_10068954 | Ga0307411_100689542 | 397 |
| 636 | 3300032005 | Ga0307411_10155778 | Ga0307411_101557782 | 397 |
| 637 | 3300032126 | Ga0307415_100000602 | Ga0307415_1000006022 | 397 |
| 638 | 3300032126 | Ga0307415_100012639 | Ga0307415_1000126392 | 397 |
| 639 | 3300032126 | Ga0307415_100143166 | Ga0307415_1001431662 | 397 |
| 640 | 3300032126 | Ga0307415_100164152 | Ga0307415_1001641521 | 397 |
| 641 | 3300032126 | Ga0307415_100258219 | Ga0307415_1002582192 | 397 |
| 642 | 3300035089 | Ga0373944_0001350 | Ga0373944_0001350_1225_2418 | 397 |
| 643 | 3300035119 | Ga0373956_0017747 | Ga0373956_0017747_480_1673 | 397 |
| 644 | 3300035120 | Ga0373957_0044243 | Ga0373957_0044243_250_1443 | 397 |
| 645 | 3300035170 | Ga0373943_0004041 | Ga0373943_0004041_4201_5394 | 397 |
| 646 | 3300035171 | Ga0373946_0010509 | Ga0373946_0010509_1753_2946 | 397 |
| 647 | 3300035172 | Ga0373955_0064029 | Ga0373955_0064029_654_1847 | 397 |
| 648 | 3300035241 | Ga0373961_0018201 | Ga0373961_0018201_601_1794 | 397 |
| 649 | 3300035410 | Ga0373924_0012365 | Ga0373924_0012365_823_2016 | 397 |
| 650 | 3300035691 | Ga0373931_0129736 | Ga0373931_0129736_207_1400 | 397 |
| 651 | 3300035695 | Ga0373927_0008881 | Ga0373927_0008881_4052_5245 | 397 |
| 652 | 3300035724 | Ga0373933_0002172 | Ga0373933_0002172_146_1339 | 397 |
| 653 | 3300035725 | Ga0373947_0000123 | Ga0373947_0000123_32224_33417 | 397 |
| 654 | 3300036401 | Ga0373937_0025310 | Ga0373937_0025310_2656_3849 | 397 |
| 655 | 3300036401 | Ga0373937_0193017 | Ga0373937_0193017_470_1663 | 397 |
| 656 | 3300037068 | Ga0373925_0001690 | Ga0373925_0001690_628_1821 | 397 |
| 657 | 3300038996 | Ga0242420_008901 | Ga0242420_008901_188_1381 | 397 |
| 658 | 3300045051 | Ga0451576_0066367 | Ga0451576_0066367_2457_3650 | 397 |
| 659 | 3300045976 | Ga0466967_0048290 | Ga0466967_0048290_763_1956 | 397 |
| 660 | 3300045976 | Ga0466967_0065164 | Ga0466967_0065164_757_1950 | 397 |
| 661 | 3300046454 | Ga0495592_0034643 | Ga0495592_0034643_808_2001 | 397 |
| 662 | 3300046455 | Ga0495603_0010885 | Ga0495603_0010885_1684_2877 | 397 |
| 663 | 3300046455 | Ga0495603_0024609 | Ga0495603_0024609_1767_2960 | 397 |
| 664 | 3300046459 | Ga0495629_0007989 | Ga0495629_0007989_6099_7292 | 397 |
| 665 | 3300046459 | Ga0495629_0097417 | Ga0495629_0097417_806_1999 | 397 |
| 666 | 3300046462 | Ga0495651_0028761 | Ga0495651_0028761_19_1212 | 397 |
| 667 | 3300046463 | Ga0495653_0004013 | Ga0495653_0004013_3856_5049 | 397 |
| 668 | 3300046472 | Ga0495580_0000872 | Ga0495580_0000872_8142_9335 | 397 |
| 669 | 3300046472 | Ga0495580_0037719 | Ga0495580_0037719_1497_2690 | 397 |
| 670 | 3300046472 | Ga0495580_0058023 | Ga0495580_0058023_821_2014 | 397 |
| 671 | 3300046473 | Ga0495582_0000388 | Ga0495582_0000388_18295_19488 | 397 |
| 672 | 3300046473 | Ga0495582_0033461 | Ga0495582_0033461_1130_2323 | 397 |
| 673 | 3300046475 | Ga0495639_0000117 | Ga0495639_0000117_5948_7141 | 397 |
| 674 | 3300046477 | Ga0495664_0020063 | Ga0495664_0020063_778_1971 | 397 |
| 675 | 3300046499 | Ga0495594_0007118 | Ga0495594_0007118_340_1533 | 397 |
| 676 | 3300046499 | Ga0495594_0012963 | Ga0495594_0012963_2863_4056 | 397 |
| 677 | 3300046499 | Ga0495594_0014285 | Ga0495594_0014285_1157_2350 | 397 |
| 678 | 3300046500 | Ga0495596_0037909 | Ga0495596_0037909_564_1757 | 397 |
| 679 | 3300046511 | Ga0495608_0036480 | Ga0495608_0036480_225_1418 | 397 |
| 680 | 3300046514 | Ga0495618_0067214 | Ga0495618_0067214_564_1757 | 397 |
| 681 | 3300046514 | Ga0495618_0083113 | Ga0495618_0083113_525_1718 | 397 |
| 682 | 3300046516 | Ga0495628_0027091 | Ga0495628_0027091_886_2079 | 397 |
| 683 | 3300046517 | Ga0495630_0007914 | Ga0495630_0007914_658_1851 | 397 |
| 684 | 3300046517 | Ga0495630_0097933 | Ga0495630_0097933_914_2107 | 397 |
| 685 | 3300046526 | Ga0495666_0012929 | Ga0495666_0012929_2283_3476 | 397 |
| 686 | 3300046529 | Ga0495652_0022862 | Ga0495652_0022862_1643_2836 | 397 |
| 687 | 3300046531 | Ga0495665_0000362 | Ga0495665_0000362_20206_21399 | 397 |
| 688 | 3300046535 | Ga0495586_0017841 | Ga0495586_0017841_1085_2278 | 397 |
| 689 | 3300046536 | Ga0495587_0001834 | Ga0495587_0001834_9283_10476 | 397 |
| 690 | 3300046543 | Ga0495645_0018448 | Ga0495645_0018448_3324_4517 | 397 |
| 691 | 3300046559 | Ga0495667_0011841 | Ga0495667_0011841_664_1857 | 397 |
| 692 | 3300046559 | Ga0495667_0037956 | Ga0495667_0037956_875_2068 | 397 |
| 693 | 3300046663 | Ga0495635_0022487 | Ga0495635_0022487_1888_3081 | 397 |
| 694 | 3300046674 | Ga0495588_0008939 | Ga0495588_0008939_2190_3383 | 397 |
| 695 | 3300046675 | Ga0495657_0003641 | Ga0495657_0003641_1937_3130 | 397 |
| 696 | 3300046675 | Ga0495657_0056374 | Ga0495657_0056374_1125_2318 | 397 |
| 697 | 3300046678 | Ga0495599_0050452 | Ga0495599_0050452_259_1452 | 397 |
| 698 | 3300046679 | Ga0495623_0033095 | Ga0495623_0033095_558_1751 | 397 |
| 699 | 3300046680 | Ga0495646_0008083 | Ga0495646_0008083_233_1426 | 397 |
| 700 | 3300046681 | Ga0495647_0003235 | Ga0495647_0003235_886_2079 | 397 |
| 701 | 3300046683 | Ga0495658_0000095 | Ga0495658_0000095_15260_16453 | 397 |
| 702 | 3300046683 | Ga0495658_0055479 | Ga0495658_0055479_429_1622 | 397 |
| 703 | 3300046689 | Ga0495613_0040549 | Ga0495613_0040549_2237_3430 | 397 |
| 704 | 3300046689 | Ga0495613_0044415 | Ga0495613_0044415_1992_3185 | 397 |
| 705 | 3300046689 | Ga0495613_0068611 | Ga0495613_0068611_1321_2514 | 397 |
| 706 | 3300046809 | Ga0495600_0001787 | Ga0495600_0001787_8008_9201 | 397 |
| 707 | 3300047315 | Ga0495581_0000662 | Ga0495581_0000662_6960_8153 | 397 |
| 708 | 3300047317 | Ga0495604_0120774 | Ga0495604_0120774_559_1752 | 397 |
| 709 | 3300047319 | Ga0495674_0081416 | Ga0495674_0081416_565_1758 | 397 |
| 710 | 3300047319 | Ga0495674_0089153 | Ga0495674_0089153_225_1418 | 397 |
| 711 | 3300047320 | Ga0495672_0016122 | Ga0495672_0016122_1384_2577 | 397 |
| 712 | 3300047322 | Ga0495680_0027537 | Ga0495680_0027537_2389_3582 | 397 |
| 713 | 3300047322 | Ga0495680_0037480 | Ga0495680_0037480_1638_2831 | 397 |
| 714 | 3300047471 | Ga0495684_0007844 | Ga0495684_0007844_2156_3349 | 397 |
| 715 | 3300047673 | Ga0495593_0013460 | Ga0495593_0013460_1283_2476 | 397 |
| 716 | 3300048088 | Ga0495602_0019139 | Ga0495602_0019139_4772_5965 | 397 |
| 717 | 3300048089 | Ga0495614_0000104 | Ga0495614_0000104_15237_16430 | 397 |
| 718 | 3300048907 | Ga0496104_0002179 | Ga0496104_0002179_14019_15212 | 397 |
| 719 | 3300048907 | Ga0496104_0023962 | Ga0496104_0023962_393_1586 | 397 |
| 720 | 3300048909 | Ga0496106_0069033 | Ga0496106_0069033_772_1977 | 397 |
| 721 | 3300048911 | Ga0496108_0000799 | Ga0496108_0000799_21692_22885 | 397 |
| 722 | 3300048911 | Ga0496108_0001419 | Ga0496108_0001419_14875_16068 | 397 |
| 723 | 3300048911 | Ga0496108_0052844 | Ga0496108_0052844_958_2151 | 397 |
| 724 | 3300048912 | Ga0496109_0000316 | Ga0496109_0000316_22943_24136 | 397 |
| 725 | 3300048912 | Ga0496109_0003739 | Ga0496109_0003739_5261_6454 | 397 |
| 726 | 3300048912 | Ga0496109_0171286 | Ga0496109_0171286_517_1710 | 397 |
| 727 | 3300048913 | Ga0496110_0282850 | Ga0496110_0282850_197_1390 | 397 |
| 728 | 3300048915 | Ga0496112_0000406 | Ga0496112_0000406_20730_21923 | 397 |
| 729 | 3300048915 | Ga0496112_0010713 | Ga0496112_0010713_1623_2816 | 397 |
| 730 | 3300048915 | Ga0496112_0045567 | Ga0496112_0045567_2005_3198 | 397 |
| 731 | 3300048915 | Ga0496112_0112644 | Ga0496112_0112644_708_1901 | 397 |
| 732 | 3300048915 | Ga0496112_0147083 | Ga0496112_0147083_639_1844 | 397 |
| 733 | 3300048916 | Ga0496113_0000919 | Ga0496113_0000919_11148_12341 | 397 |
| 734 | 3300048916 | Ga0496113_0004653 | Ga0496113_0004653_721_1914 | 397 |
| 735 | 3300048918 | Ga0496115_0024238 | Ga0496115_0024238_265_1458 | 397 |
| 736 | 3300049570 | Ga0501033_0131997 | Ga0501033_0131997_567_1760 | 397 |
| 737 | 3300049574 | Ga0501038_0026378 | Ga0501038_0026378_3540_4733 | 397 |
| 738 | 3300049575 | Ga0501039_0017723 | Ga0501039_0017723_3167_4360 | 397 |
| 739 | 3300049576 | Ga0501040_0022105 | Ga0501040_0022105_2424_3617 | 397 |
| 740 | 3300049579 | Ga0501043_0079879 | Ga0501043_0079879_734_1927 | 397 |
| 741 | 3300049582 | Ga0501048_0024006 | Ga0501048_0024006_990_2183 | 397 |
| 742 | 3300049584 | Ga0501068_0069777 | Ga0501068_0069777_106_1299 | 397 |
| 743 | 3300049585 | Ga0501069_0012716 | Ga0501069_0012716_1010_2203 | 397 |
| 744 | 3300049587 | Ga0501071_0079192 | Ga0501071_0079192_761_1954 | 397 |
| 745 | 3300049590 | Ga0501074_0028718 | Ga0501074_0028718_746_1939 | 397 |
| 746 | 3300049591 | Ga0501075_0104160 | Ga0501075_0104160_417_1610 | 397 |
| 747 | 3300049592 | Ga0501076_0103602 | Ga0501076_0103602_96_1289 | 397 |
| 748 | 3300049593 | Ga0501077_0000220 | Ga0501077_0000220_2647_3840 | 397 |
| 749 | 3300049660 | Ga0501216_001896 | Ga0501216_001896_505_1698 | 397 |
| 750 | 3300049669 | Ga0501235_004051 | Ga0501235_004051_312_1505 | 397 |
| 751 | 3300049679 | Ga0501249_027364 | Ga0501249_027364_55_1248 | 397 |
| 752 | 3300049704 | Ga0501221_003394 | Ga0501221_003394_29_1222 | 397 |
| 753 | 3300049705 | Ga0501225_0022550 | Ga0501225_0022550_75_1268 | 397 |
| 754 | 3300049705 | Ga0501225_0037153 | Ga0501225_0037153_136_1329 | 397 |
| 755 | 3300049741 | Ga0501079_0174662 | Ga0501079_0174662_427_1620 | 397 |
| 756 | 3300049741 | Ga0501079_0255190 | Ga0501079_0255190_49_1242 | 397 |
| 757 | 3300049744 | Ga0501083_0025367 | Ga0501083_0025367_678_1871 | 397 |
| 758 | 3300049760 | Ga0501263_000245 | Ga0501263_000245_2115_3308 | 397 |
| 759 | 3300049765 | Ga0501268_000875 | Ga0501268_000875_175_1368 | 397 |
| 760 | 3300049769 | Ga0501272_003614 | Ga0501272_003614_189_1382 | 397 |
| 761 | 3300049770 | Ga0501273_001040 | Ga0501273_001040_11_1204 | 397 |
| 762 | 3300049779 | Ga0501283_012061 | Ga0501283_012061_15_1208 | 397 |
| 763 | 3300049824 | Ga0501045_0033116 | Ga0501045_0033116_1754_2947 | 397 |
| 764 | 3300049824 | Ga0501045_0111354 | Ga0501045_0111354_726_1919 | 397 |
| 765 | 3300050507 | nmdc:mga05p37_154357_c1 | nmdc:mga05p37_154357_c1_17_1210 | 397 |
| 766 | 3300050509 | nmdc:mga0qj67_100788_c1 | nmdc:mga0qj67_100788_c1_600_1793 | 397 |
| 767 | 3300050510 | nmdc:mga06r32_18090_c1 | nmdc:mga06r32_18090_c1_4033_5226 | 397 |
| 768 | 3300050510 | nmdc:mga06r32_23503_c1 | nmdc:mga06r32_23503_c1_970_2163 | 397 |
| 769 | 3300050511 | nmdc:mga08y16_120559_c1 | nmdc:mga08y16_120559_c1_168_1361 | 397 |
| 770 | 3300050511 | nmdc:mga08y16_84919_c1 | nmdc:mga08y16_84919_c1_1536_2729 | 397 |
| 771 | 3300050512 | nmdc:mga0n895_11550_c1 | nmdc:mga0n895_11550_c1_1291_2484 | 397 |
| 772 | 3300050515 | nmdc:mga0a205_138780_c1 | nmdc:mga0a205_138780_c1_328_1521 | 397 |
| 773 | 3300050515 | nmdc:mga0a205_89028_c1 | nmdc:mga0a205_89028_c1_1105_2298 | 397 |
| 774 | 3300053084 | Ga0495595_0073157 | Ga0495595_0073157_420_1613 | 397 |
| 775 | 3300053085 | Ga0495619_0006382 | Ga0495619_0006382_5074_6267 | 397 |
| 776 | 3300054114 | Ga0501084_0008692 | Ga0501084_0008692_3902_5095 | 397 |
| 777 | 3300054114 | Ga0501084_0018949 | Ga0501084_0018949_639_1832 | 397 |
| 778 | 3300059421 | Ga0590071_000231 | Ga0590071_000231_15108_16301 | 397 |
| 779 | 3300059423 | Ga0590074_008417 | Ga0590074_008417_95_1288 | 397 |
| 780 | 3300060353 | Ga0501082_0032750 | Ga0501082_0032750_131_1324 | 397 |
| 781 | 3300060353 | Ga0501082_0106768 | Ga0501082_0106768_1095_2288 | 397 |
| 782 | 3300061734 | Ga0530510_0007306 | Ga0530510_0007306_635_1828 | 397 |
| 783 | 3300005289 | Ga0065704_10112978 | Ga0065704_101129782 | 398 |
| 784 | 3300005336 | Ga0070680_100002220 | Ga0070680_1000022207 | 398 |
| 785 | 3300005336 | Ga0070680_100109013 | Ga0070680_1001090131 | 398 |
| 786 | 3300005336 | Ga0070680_100177268 | Ga0070680_1001772682 | 398 |
| 787 | 3300005338 | Ga0068868_100041382 | Ga0068868_1000413822 | 398 |
| 788 | 3300005339 | Ga0070660_100052733 | Ga0070660_1000527332 | 398 |
| 789 | 3300005366 | Ga0070659_100006082 | Ga0070659_1000060822 | 398 |
| 790 | 3300005458 | Ga0070681_10038262 | Ga0070681_100382622 | 398 |
| 791 | 3300005458 | Ga0070681_10194808 | Ga0070681_101948082 | 398 |
| 792 | 3300005458 | Ga0070681_10264515 | Ga0070681_102645152 | 398 |
| 793 | 3300005459 | Ga0068867_100037723 | Ga0068867_1000377232 | 398 |
| 794 | 3300005467 | Ga0070706_100036892 | Ga0070706_1000368922 | 398 |
| 795 | 3300005518 | Ga0070699_100087671 | Ga0070699_1000876712 | 398 |
| 796 | 3300005530 | Ga0070679_100011988 | Ga0070679_1000119882 | 398 |
| 797 | 3300005530 | Ga0070679_100236446 | Ga0070679_1002364462 | 398 |
| 798 | 3300005536 | Ga0070697_100075136 | Ga0070697_1000751362 | 398 |
| 799 | 3300005718 | Ga0068866_10014044 | Ga0068866_100140442 | 398 |
| 800 | 3300005844 | Ga0068862_100071909 | Ga0068862_1000719092 | 398 |
| 801 | 3300007788 | Ga0099795_10009855 | Ga0099795_100098552 | 398 |
| 802 | 3300009098 | Ga0105245_10062376 | Ga0105245_100623763 | 398 |
| 803 | 3300009098 | Ga0105245_10305719 | Ga0105245_103057192 | 398 |
| 804 | 3300010159 | Ga0099796_10007713 | Ga0099796_100077132 | 398 |
| 805 | 3300013307 | Ga0157372_10006571 | Ga0157372_100065715 | 398 |
| 806 | 3300025910 | Ga0207684_10030486 | Ga0207684_100304862 | 398 |
| 807 | 3300025912 | Ga0207707_10076140 | Ga0207707_100761402 | 398 |
| 808 | 3300025919 | Ga0207657_10039831 | Ga0207657_100398312 | 398 |
| 809 | 3300025921 | Ga0207652_10015274 | Ga0207652_100152742 | 398 |
| 810 | 3300025921 | Ga0207652_10061155 | Ga0207652_100611554 | 398 |
| 811 | 3300025923 | Ga0207681_10036254 | Ga0207681_100362542 | 398 |
| 812 | 3300025932 | Ga0207690_10078522 | Ga0207690_100785222 | 398 |
| 813 | 3300026075 | Ga0207708_10110984 | Ga0207708_101109842 | 398 |
| 814 | 3300026089 | Ga0207648_10082606 | Ga0207648_100826062 | 398 |
| 815 | 3300027526 | Ga0209968_1003659 | Ga0209968_10036592 | 398 |
| 816 | 3300027543 | Ga0209999_1003194 | Ga0209999_10031942 | 398 |
| 817 | 3300035170 | Ga0373943_0028374 | Ga0373943_0028374_513_1709 | 398 |
| 818 | 3300046674 | Ga0495588_0007207 | Ga0495588_0007207_2007_3203 | 398 |
| 819 | 3300048915 | Ga0496112_0123619 | Ga0496112_0123619_1020_2216 | 398 |
| 820 | 3300005327 | Ga0070658_10118707 | Ga0070658_101187071 | 399 |
| 821 | 3300005329 | Ga0070683_100000506 | Ga0070683_10000050612 | 399 |
| 822 | 3300005331 | Ga0070670_100045579 | Ga0070670_1000455794 | 399 |
| 823 | 3300005339 | Ga0070660_100071160 | Ga0070660_1000711602 | 399 |
| 824 | 3300005340 | Ga0070689_100091258 | Ga0070689_1000912581 | 399 |
| 825 | 3300005365 | Ga0070688_100033411 | Ga0070688_1000334112 | 399 |
| 826 | 3300005435 | Ga0070714_100043001 | Ga0070714_1000430014 | 399 |
| 827 | 3300005439 | Ga0070711_100103447 | Ga0070711_1001034472 | 399 |
| 828 | 3300005535 | Ga0070684_100006038 | Ga0070684_1000060382 | 399 |
| 829 | 3300005535 | Ga0070684_100255519 | Ga0070684_1002555192 | 399 |
| 830 | 3300005578 | Ga0068854_100015847 | Ga0068854_1000158472 | 399 |
| 831 | 3300005617 | Ga0068859_100080324 | Ga0068859_1000803243 | 399 |
| 832 | 3300005618 | Ga0068864_100200477 | Ga0068864_1002004771 | 399 |
| 833 | 3300006931 | Ga0097620_100080316 | Ga0097620_1000803163 | 399 |
| 834 | 3300009545 | Ga0105237_10138912 | Ga0105237_101389122 | 399 |
| 835 | 3300009551 | Ga0105238_10031538 | Ga0105238_100315385 | 399 |
| 836 | 3300009551 | Ga0105238_10225284 | Ga0105238_102252842 | 399 |
| 837 | 3300013104 | Ga0157370_10158501 | Ga0157370_101585012 | 399 |
| 838 | 3300013105 | Ga0157369_10153156 | Ga0157369_101531562 | 399 |
| 839 | 3300013306 | Ga0163162_10081707 | Ga0163162_100817072 | 399 |
| 840 | 3300013307 | Ga0157372_10060145 | Ga0157372_100601453 | 399 |
| 841 | 3300025908 | Ga0207643_10075917 | Ga0207643_100759172 | 399 |
| 842 | 3300025913 | Ga0207695_10150376 | Ga0207695_101503762 | 399 |
| 843 | 3300025916 | Ga0207663_10080454 | Ga0207663_100804542 | 399 |
| 844 | 3300025919 | Ga0207657_10013961 | Ga0207657_100139617 | 399 |
| 845 | 3300025924 | Ga0207694_10026287 | Ga0207694_100262874 | 399 |
| 846 | 3300025929 | Ga0207664_10052560 | Ga0207664_100525602 | 399 |
| 847 | 3300025944 | Ga0207661_10001605 | Ga0207661_100016059 | 399 |
| 848 | 3300025949 | Ga0207667_10060764 | Ga0207667_100607644 | 399 |
| 849 | 3300025981 | Ga0207640_10090896 | Ga0207640_100908962 | 399 |
| 850 | 3300025986 | Ga0207658_10071854 | Ga0207658_100718542 | 399 |
| 851 | 3300026067 | Ga0207678_10009416 | Ga0207678_100094167 | 399 |
| 852 | 3300036401 | Ga0373937_0095959 | Ga0373937_0095959_551_1750 | 399 |
| 853 | 3300037312 | Ga0395899_0074662 | Ga0395899_0074662_39_1274 | 399 |
| 854 | 3300037418 | Ga0395900_0047025 | Ga0395900_0047025_1255_2490 | 399 |
| 855 | 3300037471 | Ga0395905_0084769 | Ga0395905_0084769_1626_2861 | 399 |
| 856 | 3300038443 | Ga0395901_0036042 | Ga0395901_0036042_1244_2479 | 399 |
| 857 | 3300039437 | Ga0436365_1784820 | Ga0436365_1784820_14_1279 | 399 |
| 858 | 3300044684 | Ga0466966_0086770 | Ga0466966_0086770_663_1862 | 399 |
| 859 | 3300045049 | Ga0466959_0110690 | Ga0466959_0110690_10_1209 | 399 |
| 860 | 3300046454 | Ga0495592_0217349 | Ga0495592_0217349_43_1242 | 399 |
| 861 | 3300046459 | Ga0495629_0076455 | Ga0495629_0076455_134_1333 | 399 |
| 862 | 3300046462 | Ga0495651_0006822 | Ga0495651_0006822_5490_6689 | 399 |
| 863 | 3300046463 | Ga0495653_0102397 | Ga0495653_0102397_764_1963 | 399 |
| 864 | 3300046529 | Ga0495652_0011768 | Ga0495652_0011768_465_1664 | 399 |
| 865 | 3300046536 | Ga0495587_0005095 | Ga0495587_0005095_4468_5667 | 399 |
| 866 | 3300046559 | Ga0495667_0010411 | Ga0495667_0010411_1011_2210 | 399 |
| 867 | 3300046663 | Ga0495635_0036000 | Ga0495635_0036000_183_1382 | 399 |
| 868 | 3300046678 | Ga0495599_0003334 | Ga0495599_0003334_3585_4784 | 399 |
| 869 | 3300046679 | Ga0495623_0063108 | Ga0495623_0063108_775_1974 | 399 |
| 870 | 3300047322 | Ga0495680_0085821 | Ga0495680_0085821_1131_2330 | 399 |
| 871 | 3300047471 | Ga0495684_0010866 | Ga0495684_0010866_3071_4270 | 399 |
| 872 | 3300047471 | Ga0495684_0065305 | Ga0495684_0065305_851_2050 | 399 |
| 873 | 3300048088 | Ga0495602_0003256 | Ga0495602_0003256_10909_12108 | 399 |
| 874 | 3300053085 | Ga0495619_0025490 | Ga0495619_0025490_2352_3551 | 399 |
| 875 | 3300005329 | Ga0070683_100026723 | Ga0070683_1000267233 | 400 |
| 876 | 3300005445 | Ga0070708_100000007 | Ga0070708_10000000779 | 400 |
| 877 | 3300005468 | Ga0070707_100026308 | Ga0070707_1000263083 | 400 |
| 878 | 3300005535 | Ga0070684_100015321 | Ga0070684_1000153216 | 400 |
| 879 | 3300005535 | Ga0070684_100158616 | Ga0070684_1001586162 | 400 |
| 880 | 3300005563 | Ga0068855_100061263 | Ga0068855_1000612632 | 400 |
| 881 | 3300009174 | Ga0105241_10000050 | Ga0105241_1000005024 | 400 |
| 882 | 3300013104 | Ga0157370_10002257 | Ga0157370_1000225712 | 400 |
| 883 | 3300025906 | Ga0207699_10075953 | Ga0207699_100759531 | 400 |
| 884 | 3300025911 | Ga0207654_10000482 | Ga0207654_100004826 | 400 |
| 885 | 3300025913 | Ga0207695_10047168 | Ga0207695_100471683 | 400 |
| 886 | 3300025944 | Ga0207661_10157345 | Ga0207661_101573451 | 400 |
| 887 | 3300025949 | Ga0207667_10186358 | Ga0207667_101863582 | 400 |
| 888 | 3300035170 | Ga0373943_0064689 | Ga0373943_0064689_462_1664 | 400 |
| 889 | 3300035725 | Ga0373947_0056991 | Ga0373947_0056991_658_1860 | 400 |
| 890 | 3300036401 | Ga0373937_0024715 | Ga0373937_0024715_2294_3496 | 400 |
| 891 | 3300046462 | Ga0495651_0020785 | Ga0495651_0020785_1187_2389 | 400 |
| 892 | 3300046473 | Ga0495582_0070374 | Ga0495582_0070374_662_1864 | 400 |
| 893 | 3300046475 | Ga0495639_0015918 | Ga0495639_0015918_1082_2284 | 400 |
| 894 | 3300046535 | Ga0495586_0004632 | Ga0495586_0004632_1112_2314 | 400 |
| 895 | 3300046536 | Ga0495587_0003085 | Ga0495587_0003085_4118_5320 | 400 |
| 896 | 3300046543 | Ga0495645_0002661 | Ga0495645_0002661_9329_10531 | 400 |
| 897 | 3300046679 | Ga0495623_0009653 | Ga0495623_0009653_3815_5017 | 400 |
| 898 | 3300046689 | Ga0495613_0226536 | Ga0495613_0226536_83_1285 | 400 |
| 899 | 3300047319 | Ga0495674_0081175 | Ga0495674_0081175_557_1759 | 400 |
| 900 | 3300047673 | Ga0495593_0032872 | Ga0495593_0032872_651_1853 | 400 |
| 901 | 3300053084 | Ga0495595_0011150 | Ga0495595_0011150_1524_2726 | 400 |
| 902 | 3300005366 | Ga0070659_100179222 | Ga0070659_1001792222 | 402 |
| 903 | 3300005614 | Ga0068856_100237183 | Ga0068856_1002371832 | 402 |
| 904 | 3300005618 | Ga0068864_100041997 | Ga0068864_1000419973 | 402 |
| 905 | 3300009098 | Ga0105245_10145948 | Ga0105245_101459482 | 402 |
| 906 | 3300010375 | Ga0105239_10036411 | Ga0105239_100364111 | 402 |
| 907 | 3300011119 | Ga0105246_10004459 | Ga0105246_100044592 | 402 |
| 908 | 3300025925 | Ga0207650_10079944 | Ga0207650_100799442 | 402 |
| 909 | 3300026035 | Ga0207703_10035822 | Ga0207703_100358223 | 402 |
| 910 | 3300026078 | Ga0207702_10125561 | Ga0207702_101255611 | 402 |
| 911 | 3300026095 | Ga0207676_10026664 | Ga0207676_100266643 | 402 |
| 912 | 3300049570 | Ga0501033_0128168 | Ga0501033_0128168_564_1778 | 402 |
| 913 | 3300049571 | Ga0501034_0055921 | Ga0501034_0055921_27_1241 | 402 |
| 914 | 3300049573 | Ga0501037_0111814 | Ga0501037_0111814_730_1944 | 402 |
| 915 | 3300049579 | Ga0501043_0046584 | Ga0501043_0046584_493_1707 | 402 |
| 916 | 3300049581 | Ga0501047_0013952 | Ga0501047_0013952_329_1543 | 402 |
| 917 | 3300049822 | Ga0501035_0052506 | Ga0501035_0052506_1190_2404 | 402 |
| 918 | 3300049823 | Ga0501044_0008920 | Ga0501044_0008920_8565_9779 | 402 |
| 919 | 3300004799 | Ga0058863_10044833 | Ga0058863_100448332 | 405 |
| 920 | 3300005336 | Ga0070680_100187638 | Ga0070680_1001876382 | 405 |
| 921 | 3300005530 | Ga0070679_100054355 | Ga0070679_1000543554 | 405 |
| 922 | 3300025917 | Ga0207660_10070167 | Ga0207660_100701672 | 405 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fjs-assembly2.cif.gz_D | crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution | 0.823 | 91 | 179 |
| 4aq6-assembly2.cif.gz_K | substrate bound homogentisate 1,2-dioxygenase | 0.8217 | 2 | 405 |
| 4aq6-assembly2.cif.gz_K | substrate bound homogentisate 1,2-dioxygenase | 0.8179 | 2 | 405 |
| 4aq2-assembly2.cif.gz_L | resting state of homogentisate 1,2-dioxygenase | 0.8009 | 1 | 405 |
| 4aq2-assembly2.cif.gz_L | resting state of homogentisate 1,2-dioxygenase | 0.7991 | 1 | 405 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G3V6C2_268_404_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8289 | 256 | 368 | 2.60.120.10 |
| af_Q2G2J4_1_140_2.60.120.280 | Mainly Beta;Sandwich;Jelly Rolls;Regulatory protein AraC | 0.8254 | 96 | 179 | 2.60.120.280 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8199 | 90 | 179 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8168 | 91 | 179 | 2.60.120.10 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8139 | 91 | 179 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E3LUX1-F1-model_v4 | Homogentisate 1,2-dioxygenase | 0.985 | 1 | 389 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A838R873-F1-model_v4 | Homogentisate 1,2-dioxygenase | 0.9843 | 1 | 277 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A7V9PIP7-F1-model_v4 | Homogentisate 1,2-dioxygenase | 0.9827 | 1 | 405 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A382JM78-F1-model_v4 | Homogentisate 1,2-dioxygenase N-terminal domain-containing protein | 0.982 | 10 | 389 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A838R873-F1-model_v4 | Homogentisate 1,2-dioxygenase | 0.9808 | 1 | 277 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar