F485822
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 923 | 457 | 696 | 369 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100002049|Ga0070664_1000020497 |
| Length | 411 |
| Sequence | LLTGLARYKAPTLFPLFALARHSMQIQRKTALIVGVLVVLAIAAWALGRPAKTRLAAPTAIPVRVVKVVQQDVPRFVSGIGTVLSLHSVVIRPQVDGILTQLLVKEGQPVKAGDLLATIDDRSIRASLDQAKAQLGENQAQLQVALINLKRYKELSIDDGVSKQTYDQQQALVNQLKATAQGNQAAIDAAKVQLSYTQIRSPVSGRVGIRTVDEGNFLRTSDAQGLFSVTQIDPIAVEFSLPQQMLPTLQGLIAAPTQASVDAYLGADTDGQTGDLLGEGHLSLIDNQISSTTGTLRAKAEFNNPSQRLWPGQLVTIKIQTALDKNALVVPPTVVQRGLDSHFVYRVNGDKVEIVPVQVTYQNSDVNLITGVQAGDVLVSDGQSRLKAGAQVEVLKDPPQTIQTVDAKVQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 10 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 11 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 12 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 13 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 14 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 15 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 16 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 17 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 18 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 19 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 20 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 21 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 22 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 23 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 24 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 25 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 26 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 27 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 28 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 29 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 30 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 31 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 32 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 33 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 34 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 35 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 36 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 37 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 38 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 39 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 40 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 41 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 42 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 43 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 44 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 45 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 46 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 47 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 48 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 49 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 50 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 51 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 52 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 53 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 54 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 55 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 56 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 57 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 58 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 59 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 60 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 61 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 62 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 63 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 64 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 65 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 66 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 67 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 68 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 69 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 70 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 71 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 72 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 73 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 74 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 75 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 76 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 77 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 78 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 79 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 80 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 81 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 82 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 83 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 84 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 85 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 86 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 87 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 88 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 89 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 90 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 91 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 92 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 93 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 94 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 95 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 96 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 97 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 98 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 99 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 100 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 101 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 102 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 103 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 104 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 105 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 106 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 107 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 108 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 109 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 110 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 111 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 112 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 113 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 114 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 115 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 116 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 117 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 118 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 119 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 120 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 121 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 122 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 123 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 124 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 125 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 126 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 127 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 128 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 129 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 130 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 131 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 132 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 133 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 134 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 135 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 136 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 137 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 138 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 139 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 140 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 141 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 142 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 143 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 144 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 145 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 146 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 147 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 148 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 149 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 150 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 151 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 152 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 153 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 154 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 155 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 156 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 157 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 158 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 159 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 160 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 161 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 162 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 163 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 164 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 165 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 166 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 167 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 168 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 169 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 170 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 171 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 172 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 173 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 174 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 175 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 176 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 177 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 178 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 179 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 180 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 181 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 182 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 183 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 184 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 185 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 186 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 187 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 188 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 189 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 190 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 191 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 192 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 193 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 194 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 195 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 196 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 197 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 198 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 199 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 200 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 201 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 202 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 203 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 204 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 205 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 206 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 207 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 208 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 209 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 210 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 211 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 212 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 213 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 214 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 215 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 216 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 217 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 218 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 219 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 220 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 221 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 226 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 229 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 230 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 231 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 232 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 233 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 234 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 243 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 251 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 252 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 253 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 254 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 265 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 267 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 269 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 270 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 289 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 291 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 292 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 293 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 294 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 295 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 296 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 297 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 298 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 299 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 300 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 301 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 302 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 303 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 304 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 305 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 306 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 307 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 308 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 309 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 310 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 311 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 312 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 313 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 314 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 315 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 316 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 317 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 318 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 319 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 320 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 321 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 322 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 323 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 324 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 325 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 326 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 327 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 328 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 329 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 330 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 331 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 332 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 399 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 400 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 401 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 402 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 403 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 407 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 408 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 409 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 410 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 411 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 412 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 413 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 414 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 419 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 420 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 423 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 424 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 425 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 426 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 428 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 429 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 430 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 431 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 432 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 433 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 434 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 435 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 436 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 437 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 438 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 439 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 440 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 441 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 442 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 443 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 444 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 445 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 446 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 447 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 448 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 449 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 450 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 451 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 452 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 453 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 454 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 455 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 456 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 457 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.41 |
| Metatranscriptomes | 0 |
| Isolates | 24.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.53 |
| Nodule | 2.82 |
| Rhizoplane | 7.48 |
| Rhizosphere | 68.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_63 | 2124908027 | Bacteria | 63450 |
| 2 | MRS1b_contig_4266420 | 2162886011 | Bacteria | 3394 |
| 3 | JGI25162J39368_1000466 | 3300002737 | Bacteria | 31322 |
| 4 | JGI25162J39368_1000491 | 3300002737 | Bacteria | 30089 |
| 5 | JGI25163J39215_1000427 | 3300002771 | Bacteria | 13075 |
| 6 | JGI25163J39215_1001580 | 3300002771 | Bacteria | 3457 |
| 7 | JGI25164J39214_1000318 | 3300002772 | Bacteria | 31322 |
| 8 | JGI25164J39214_1000334 | 3300002772 | Bacteria | 30089 |
| 9 | JGI25165J46597_1000590 | 3300003214 | Bacteria | 31322 |
| 10 | JGI25165J46597_1000616 | 3300003214 | Bacteria | 30089 |
| 11 | Ga0055538_1000036 | 3300003751 | Bacteria | 190579 |
| 12 | Ga0055539_1000047 | 3300003752 | Bacteria | 190579 |
| 13 | Ga0055533_1000058 | 3300003756 | Bacteria | 190579 |
| 14 | Ga0055532_1000234 | 3300003758 | Bacteria | 40769 |
| 15 | Ga0055525_1000113 | 3300003759 | Bacteria | 124686 |
| 16 | Ga0055535_1007641 | 3300003761 | Bacteria | 2038 |
| 17 | Ga0055536_1000707 | 3300003781 | Bacteria | 22391 |
| 18 | Ga0055536_1000920 | 3300003781 | Bacteria | 18991 |
| 19 | Ga0055536_1001795 | 3300003781 | Bacteria | 12644 |
| 20 | Ga0055536_1030098 | 3300003781 | Bacteria | 1445 |
| 21 | Ga0055530_10000626 | 3300003791 | Bacteria | 30520 |
| 22 | Ga0055530_10001090 | 3300003791 | Bacteria | 21342 |
| 23 | Ga0055530_10002576 | 3300003791 | Bacteria | 11495 |
| 24 | Ga0055530_10014502 | 3300003791 | Bacteria | 2621 |
| 25 | Ga0055530_10028988 | 3300003791 | Bacteria | 1486 |
| 26 | Ga0055540_1000363 | 3300003792 | Bacteria | 38285 |
| 27 | Ga0055540_1000484 | 3300003792 | Bacteria | 30520 |
| 28 | Ga0055540_1000824 | 3300003792 | Bacteria | 20865 |
| 29 | Ga0055540_1024703 | 3300003792 | Bacteria | 1486 |
| 30 | Ga0055531_10000348 | 3300003794 | Bacteria | 45293 |
| 31 | Ga0055531_10037159 | 3300003794 | Bacteria | 1486 |
| 32 | Ga0055531_10037169 | 3300003794 | Bacteria | 1486 |
| 33 | Ga0055541_1000034 | 3300003841 | Bacteria | 190579 |
| 34 | Ga0065714_10000844 | 3300005288 | Bacteria | 2327 |
| 35 | Ga0065714_10003333 | 3300005288 | Bacteria | 7463 |
| 36 | Ga0065714_10003597 | 3300005288 | Bacteria | 8306 |
| 37 | Ga0065714_10009519 | 3300005288 | Bacteria | 2734 |
| 38 | Ga0065714_10012453 | 3300005288 | Bacteria | 1971 |
| 39 | Ga0065714_10013075 | 3300005288 | Bacteria | 1965 |
| 40 | Ga0065714_10022700 | 3300005288 | Bacteria | 1684 |
| 41 | Ga0065714_10065847 | 3300005288 | Bacteria | 8302 |
| 42 | Ga0065714_10073983 | 3300005288 | Bacteria | 3100 |
| 43 | Ga0065714_10075530 | 3300005288 | Bacteria | 2887 |
| 44 | Ga0065704_10003208 | 3300005289 | Bacteria | 5850 |
| 45 | Ga0065704_10008374 | 3300005289 | Bacteria | 2402 |
| 46 | Ga0065704_10081781 | 3300005289 | Bacteria | 3702 |
| 47 | Ga0065712_10000524 | 3300005290 | Bacteria | 15878 |
| 48 | Ga0065712_10067964 | 3300005290 | Bacteria | 18936 |
| 49 | Ga0065712_10088845 | 3300005290 | Bacteria | 2500 |
| 50 | Ga0065715_10006155 | 3300005293 | Bacteria | 4916 |
| 51 | Ga0070670_100000460 | 3300005331 | Bacteria | 32951 |
| 52 | Ga0070670_100002191 | 3300005331 | Bacteria | 16051 |
| 53 | Ga0070661_100001513 | 3300005344 | Bacteria | 16157 |
| 54 | Ga0070669_100000570 | 3300005353 | Bacteria | 27388 |
| 55 | Ga0070662_100000950 | 3300005457 | Bacteria | 17741 |
| 56 | Ga0070662_100086801 | 3300005457 | Bacteria | 2341 |
| 57 | Ga0068853_100001285 | 3300005539 | Bacteria | 17999 |
| 58 | Ga0070665_100030810 | 3300005548 | Bacteria | 5398 |
| 59 | Ga0070664_100002049 | 3300005564 | Bacteria | 16138 |
| 60 | Ga0068854_100042072 | 3300005578 | Bacteria | 3232 |
| 61 | Ga0068851_10000006 | 3300005834 | Bacteria | 258116 |
| 62 | Ga0075432_10003850 | 3300006058 | Bacteria | 5115 |
| 63 | Ga0075432_10004264 | 3300006058 | Bacteria | 4870 |
| 64 | Ga0075432_10024634 | 3300006058 | Bacteria | 2063 |
| 65 | Ga0075432_10050357 | 3300006058 | Bacteria | 1469 |
| 66 | Ga0075362_10027786 | 3300006177 | Bacteria | 2424 |
| 67 | Ga0075436_100049882 | 3300006914 | Bacteria | 2888 |
| 68 | Ga0079104_1000385 | 3300006946 | Bacteria | 51277 |
| 69 | Ga0079104_1001193 | 3300006946 | Bacteria | 18584 |
| 70 | Ga0105251_10000057 | 3300009011 | Bacteria | 104178 |
| 71 | Ga0105251_10000697 | 3300009011 | Bacteria | 31001 |
| 72 | Ga0105251_10000702 | 3300009011 | Bacteria | 30884 |
| 73 | Ga0105251_10000933 | 3300009011 | Bacteria | 26175 |
| 74 | Ga0105251_10001234 | 3300009011 | Bacteria | 22139 |
| 75 | Ga0105251_10002815 | 3300009011 | Bacteria | 13171 |
| 76 | Ga0105251_10003989 | 3300009011 | Bacteria | 10443 |
| 77 | Ga0105251_10004637 | 3300009011 | Bacteria | 9264 |
| 78 | Ga0105251_10005221 | 3300009011 | Bacteria | 8562 |
| 79 | Ga0105251_10017648 | 3300009011 | Bacteria | 3818 |
| 80 | Ga0105251_10043442 | 3300009011 | Bacteria | 2176 |
| 81 | Ga0105251_10063011 | 3300009011 | Bacteria | 1740 |
| 82 | Ga0105244_10000303 | 3300009036 | Bacteria | 47776 |
| 83 | Ga0105244_10000703 | 3300009036 | Bacteria | 29061 |
| 84 | Ga0105244_10001491 | 3300009036 | Bacteria | 18784 |
| 85 | Ga0105244_10003141 | 3300009036 | Bacteria | 12025 |
| 86 | Ga0105244_10010379 | 3300009036 | Bacteria | 5652 |
| 87 | Ga0105244_10011887 | 3300009036 | Bacteria | 5186 |
| 88 | Ga0105244_10017940 | 3300009036 | Bacteria | 3985 |
| 89 | Ga0105244_10024689 | 3300009036 | Bacteria | 3277 |
| 90 | Ga0105244_10030982 | 3300009036 | Bacteria | 2841 |
| 91 | Ga0105244_10040077 | 3300009036 | Bacteria | 2434 |
| 92 | Ga0105244_10078168 | 3300009036 | Bacteria | 1641 |
| 93 | Ga0105250_10000216 | 3300009092 | Bacteria | 47921 |
| 94 | Ga0105250_10000784 | 3300009092 | Bacteria | 19143 |
| 95 | Ga0105250_10003850 | 3300009092 | Bacteria | 7031 |
| 96 | Ga0105250_10008147 | 3300009092 | Bacteria | 4462 |
| 97 | Ga0105250_10033451 | 3300009092 | Bacteria | 2065 |
| 98 | Ga0105250_10070599 | 3300009092 | Bacteria | 1410 |
| 99 | Ga0105250_10085461 | 3300009092 | Bacteria | 1281 |
| 100 | Ga0105243_10000797 | 3300009148 | Bacteria | 30148 |
| 101 | Ga0105243_10001439 | 3300009148 | Bacteria | 20949 |
| 102 | Ga0105243_10006863 | 3300009148 | Bacteria | 8776 |
| 103 | Ga0105243_10016100 | 3300009148 | Bacteria | 5657 |
| 104 | Ga0105243_10151476 | 3300009148 | Bacteria | 1990 |
| 105 | Ga0105242_10003570 | 3300009176 | Bacteria | 12100 |
| 106 | Ga0105242_10176737 | 3300009176 | Bacteria | 1880 |
| 107 | Ga0105237_10001380 | 3300009545 | Bacteria | 32072 |
| 108 | Ga0105249_10029027 | 3300009553 | Bacteria | 4995 |
| 109 | Ga0105246_10000391 | 3300011119 | Bacteria | 23473 |
| 110 | Ga0105246_10009116 | 3300011119 | Bacteria | 6110 |
| 111 | Ga0105246_10074401 | 3300011119 | Bacteria | 2401 |
| 112 | Ga0157345_1000168 | 3300012498 | Bacteria | 10784 |
| 113 | Ga0157373_10001638 | 3300013100 | Bacteria | 17082 |
| 114 | Ga0157373_10003948 | 3300013100 | Bacteria | 11198 |
| 115 | Ga0157373_10009036 | 3300013100 | Bacteria | 7374 |
| 116 | Ga0157373_10021586 | 3300013100 | Bacteria | 4675 |
| 117 | Ga0157373_10022523 | 3300013100 | Bacteria | 4571 |
| 118 | Ga0157373_10026009 | 3300013100 | Bacteria | 4229 |
| 119 | Ga0157373_10029445 | 3300013100 | Bacteria | 3955 |
| 120 | Ga0157373_10130859 | 3300013100 | Bacteria | 1765 |
| 121 | Ga0157371_10000389 | 3300013102 | Bacteria | 55195 |
| 122 | Ga0157371_10001815 | 3300013102 | Bacteria | 21543 |
| 123 | Ga0157371_10006382 | 3300013102 | Bacteria | 9746 |
| 124 | Ga0157371_10156117 | 3300013102 | Bacteria | 1628 |
| 125 | Ga0157370_10001195 | 3300013104 | Bacteria | 32389 |
| 126 | Ga0157370_10007745 | 3300013104 | Bacteria | 11643 |
| 127 | Ga0157370_10013518 | 3300013104 | Bacteria | 8404 |
| 128 | Ga0157370_10044892 | 3300013104 | Bacteria | 4244 |
| 129 | Ga0157370_10153937 | 3300013104 | Bacteria | 2139 |
| 130 | Ga0157369_10003869 | 3300013105 | Bacteria | 17782 |
| 131 | Ga0157369_10008334 | 3300013105 | Bacteria | 11881 |
| 132 | Ga0157369_10009828 | 3300013105 | Bacteria | 10935 |
| 133 | Ga0157369_10010281 | 3300013105 | Bacteria | 10675 |
| 134 | Ga0157369_10197670 | 3300013105 | Bacteria | 2111 |
| 135 | Ga0163162_10017157 | 3300013306 | Bacteria | 7084 |
| 136 | Ga0163162_10103441 | 3300013306 | Bacteria | 2942 |
| 137 | Ga0163162_10120582 | 3300013306 | Bacteria | 2727 |
| 138 | Ga0157372_10008635 | 3300013307 | Bacteria | 10823 |
| 139 | Ga0157375_10001660 | 3300013308 | Bacteria | 19146 |
| 140 | Ga0157375_10015584 | 3300013308 | Bacteria | 6807 |
| 141 | Ga0157375_10250014 | 3300013308 | Bacteria | 1934 |
| 142 | Ga0182008_10001819 | 3300014497 | Bacteria | 13896 |
| 143 | Ga0182008_10004237 | 3300014497 | Bacteria | 8411 |
| 144 | Ga0182008_10004590 | 3300014497 | Bacteria | 8041 |
| 145 | Ga0182008_10021636 | 3300014497 | Bacteria | 3302 |
| 146 | Ga0182008_10021661 | 3300014497 | Bacteria | 3300 |
| 147 | Ga0182008_10076278 | 3300014497 | Bacteria | 1649 |
| 148 | Ga0182008_10097362 | 3300014497 | Bacteria | 1452 |
| 149 | Ga0182006_1000460 | 3300015261 | Bacteria | 32021 |
| 150 | Ga0182006_1001369 | 3300015261 | Bacteria | 14847 |
| 151 | Ga0182006_1002230 | 3300015261 | Bacteria | 10725 |
| 152 | Ga0182006_1016495 | 3300015261 | Bacteria | 3150 |
| 153 | Ga0182006_1018001 | 3300015261 | Bacteria | 2991 |
| 154 | Ga0182006_1028606 | 3300015261 | Bacteria | 2265 |
| 155 | Ga0182007_10001924 | 3300015262 | Bacteria | 10769 |
| 156 | Ga0182007_10006306 | 3300015262 | Bacteria | 5101 |
| 157 | Ga0182005_1002172 | 3300015265 | Bacteria | 7236 |
| 158 | Ga0182005_1005392 | 3300015265 | Bacteria | 3999 |
| 159 | Ga0163161_10007473 | 3300017792 | Bacteria | 7552 |
| 160 | Ga0163161_10008880 | 3300017792 | Bacteria | 6948 |
| 161 | Ga0163161_10009143 | 3300017792 | Bacteria | 6848 |
| 162 | Ga0163161_10018873 | 3300017792 | Bacteria | 4834 |
| 163 | Ga0163161_10024982 | 3300017792 | Bacteria | 4224 |
| 164 | Ga0163161_10177202 | 3300017792 | Bacteria | 1633 |
| 165 | Ga0163161_10183063 | 3300017792 | Bacteria | 1607 |
| 166 | Ga0209760_100232 | 3300025207 | Bacteria | 23924 |
| 167 | Ga0209760_100348 | 3300025207 | Bacteria | 13255 |
| 168 | Ga0209784_100050 | 3300025224 | Bacteria | 191780 |
| 169 | Ga0209566_100063 | 3300025225 | Bacteria | 191780 |
| 170 | Ga0209674_100084 | 3300025226 | Bacteria | 191780 |
| 171 | Ga0209147_100083 | 3300025229 | Bacteria | 191212 |
| 172 | Ga0209563_100084 | 3300025230 | Bacteria | 191780 |
| 173 | Ga0209563_100384 | 3300025230 | Bacteria | 15984 |
| 174 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 175 | Ga0207427_100038 | 3300025231 | Bacteria | 292975 |
| 176 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 177 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 178 | Ga0209258_100113 | 3300025242 | Bacteria | 191178 |
| 179 | Ga0209646_1000463 | 3300025246 | Bacteria | 20587 |
| 180 | Ga0209677_100047 | 3300025253 | Bacteria | 191780 |
| 181 | Ga0209759_1013387 | 3300025256 | Bacteria | 2222 |
| 182 | Ga0209233_1000059 | 3300025261 | Bacteria | 414562 |
| 183 | Ga0209233_1000074 | 3300025261 | Bacteria | 357367 |
| 184 | Ga0209565_1000133 | 3300025263 | Bacteria | 104054 |
| 185 | Ga0209675_1010730 | 3300025291 | Bacteria | 3101 |
| 186 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 187 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 188 | Ga0209676_1000125 | 3300025292 | Bacteria | 191565 |
| 189 | Ga0209676_1000306 | 3300025292 | Bacteria | 97332 |
| 190 | Ga0209676_1000541 | 3300025292 | Bacteria | 58348 |
| 191 | Ga0209676_1001114 | 3300025292 | Bacteria | 29761 |
| 192 | Ga0209676_1003086 | 3300025292 | Bacteria | 10727 |
| 193 | Ga0209676_1017856 | 3300025292 | Bacteria | 2494 |
| 194 | Ga0209758_1014824 | 3300025297 | Bacteria | 4103 |
| 195 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 196 | Ga0209050_1000019 | 3300025298 | Bacteria | 608757 |
| 197 | Ga0209050_1000027 | 3300025298 | Bacteria | 483261 |
| 198 | Ga0209050_1000065 | 3300025298 | Bacteria | 313668 |
| 199 | Ga0209050_1000425 | 3300025298 | Bacteria | 77756 |
| 200 | Ga0209050_1027548 | 3300025298 | Bacteria | 1870 |
| 201 | Ga0209051_1000065 | 3300025303 | Bacteria | 231445 |
| 202 | Ga0209051_1000134 | 3300025303 | Bacteria | 138380 |
| 203 | Ga0209051_1000504 | 3300025303 | Bacteria | 49506 |
| 204 | Ga0209051_1000800 | 3300025303 | Bacteria | 33041 |
| 205 | Ga0209051_1001829 | 3300025303 | Bacteria | 16828 |
| 206 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 207 | Ga0209257_1000119 | 3300025304 | Bacteria | 225893 |
| 208 | Ga0209257_1001367 | 3300025304 | Bacteria | 29437 |
| 209 | Ga0207656_10000023 | 3300025321 | Bacteria | 98957 |
| 210 | Ga0207696_1000112 | 3300025711 | Bacteria | 154384 |
| 211 | Ga0207696_1000210 | 3300025711 | Bacteria | 88330 |
| 212 | Ga0207696_1000248 | 3300025711 | Bacteria | 72501 |
| 213 | Ga0207696_1000314 | 3300025711 | Bacteria | 53800 |
| 214 | Ga0207696_1002258 | 3300025711 | Bacteria | 9587 |
| 215 | Ga0207696_1010241 | 3300025711 | Bacteria | 3449 |
| 216 | Ga0207696_1017983 | 3300025711 | Bacteria | 2330 |
| 217 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 218 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 219 | Ga0207655_1000311 | 3300025728 | Bacteria | 72337 |
| 220 | Ga0207655_1000430 | 3300025728 | Bacteria | 56432 |
| 221 | Ga0207655_1000630 | 3300025728 | Bacteria | 42308 |
| 222 | Ga0207655_1001102 | 3300025728 | Bacteria | 26443 |
| 223 | Ga0207655_1001977 | 3300025728 | Bacteria | 17506 |
| 224 | Ga0207655_1002309 | 3300025728 | Bacteria | 15671 |
| 225 | Ga0207655_1002514 | 3300025728 | Bacteria | 14766 |
| 226 | Ga0207655_1002625 | 3300025728 | Bacteria | 14255 |
| 227 | Ga0207655_1007805 | 3300025728 | Bacteria | 6892 |
| 228 | Ga0207655_1010819 | 3300025728 | Bacteria | 5499 |
| 229 | Ga0207655_1016339 | 3300025728 | Bacteria | 4066 |
| 230 | Ga0207655_1018288 | 3300025728 | Bacteria | 3728 |
| 231 | Ga0207655_1049437 | 3300025728 | Bacteria | 1717 |
| 232 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 233 | Ga0207713_1000138 | 3300025735 | Bacteria | 111150 |
| 234 | Ga0207713_1000244 | 3300025735 | Bacteria | 69698 |
| 235 | Ga0207713_1000604 | 3300025735 | Bacteria | 35350 |
| 236 | Ga0207713_1000728 | 3300025735 | Bacteria | 30769 |
| 237 | Ga0207713_1001356 | 3300025735 | Bacteria | 19952 |
| 238 | Ga0207713_1002068 | 3300025735 | Bacteria | 14999 |
| 239 | Ga0207713_1003039 | 3300025735 | Bacteria | 11697 |
| 240 | Ga0207713_1011342 | 3300025735 | Bacteria | 4857 |
| 241 | Ga0207713_1037600 | 3300025735 | Bacteria | 2062 |
| 242 | Ga0207713_1049118 | 3300025735 | Bacteria | 1694 |
| 243 | Ga0207713_1049554 | 3300025735 | Bacteria | 1682 |
| 244 | Ga0207671_10001052 | 3300025914 | Bacteria | 33499 |
| 245 | Ga0207649_10000004 | 3300025920 | Bacteria | 360726 |
| 246 | Ga0207681_10000474 | 3300025923 | Bacteria | 28140 |
| 247 | Ga0207681_10001097 | 3300025923 | Bacteria | 17539 |
| 248 | Ga0207650_10000183 | 3300025925 | Bacteria | 72930 |
| 249 | Ga0207650_10000393 | 3300025925 | Bacteria | 39925 |
| 250 | Ga0207706_10002563 | 3300025933 | Bacteria | 17721 |
| 251 | Ga0207706_10044926 | 3300025933 | Bacteria | 3914 |
| 252 | Ga0207686_10002963 | 3300025934 | Bacteria | 9152 |
| 253 | Ga0207709_10000224 | 3300025935 | Bacteria | 71687 |
| 254 | Ga0207709_10000827 | 3300025935 | Bacteria | 23857 |
| 255 | Ga0207709_10002785 | 3300025935 | Bacteria | 10768 |
| 256 | Ga0207679_10000043 | 3300025945 | Bacteria | 123125 |
| 257 | Ga0207639_10001525 | 3300026041 | Bacteria | 15560 |
| 258 | Ga0209281_1000015 | 3300027111 | Bacteria | 590084 |
| 259 | Ga0209281_1000049 | 3300027111 | Bacteria | 322274 |
| 260 | Ga0209281_1004383 | 3300027111 | Bacteria | 4242 |
| 261 | Ga0209281_1010894 | 3300027111 | Bacteria | 2056 |
| 262 | Ga0209371_1002332 | 3300027312 | Bacteria | 10798 |
| 263 | Ga0207428_10072044 | 3300027907 | Bacteria | 2713 |
| 264 | Ga0207428_10123269 | 3300027907 | Bacteria | 1986 |
| 265 | Ga0207428_10224282 | 3300027907 | Bacteria | 1408 |
| 266 | Ga0307517_10017207 | 3300028786 | Bacteria | 9439 |
| 267 | Ga0268256_1002399 | 3300030500 | Bacteria | 9603 |
| 268 | Ga0316179_1033450 | 3300030734 | Bacteria | 1616 |
| 269 | Ga0316178_1159376 | 3300030735 | Bacteria | 11862 |
| 270 | Ga0307408_100000950 | 3300031548 | Bacteria | 22493 |
| 271 | Ga0307408_100010388 | 3300031548 | Bacteria | 6138 |
| 272 | Ga0307408_100020209 | 3300031548 | Bacteria | 4491 |
| 273 | Ga0307405_10000606 | 3300031731 | Bacteria | 13779 |
| 274 | Ga0307405_10001648 | 3300031731 | Bacteria | 9498 |
| 275 | Ga0307405_10023066 | 3300031731 | Bacteria | 3530 |
| 276 | Ga0307413_10016578 | 3300031824 | Bacteria | 3810 |
| 277 | Ga0307413_10165310 | 3300031824 | Bacteria | 1559 |
| 278 | Ga0307406_10073169 | 3300031901 | Bacteria | 2252 |
| 279 | Ga0307407_10017831 | 3300031903 | Bacteria | 3573 |
| 280 | Ga0307412_10003759 | 3300031911 | Bacteria | 8436 |
| 281 | Ga0307412_10021866 | 3300031911 | Bacteria | 3912 |
| 282 | Ga0307412_10146500 | 3300031911 | Bacteria | 1736 |
| 283 | Ga0307409_100100062 | 3300031995 | Bacteria | 2402 |
| 284 | Ga0307416_100076510 | 3300032002 | Bacteria | 2805 |
| 285 | Ga0307416_100169436 | 3300032002 | Bacteria | 2030 |
| 286 | Ga0307411_10031700 | 3300032005 | Bacteria | 3256 |
| 287 | Ga0307411_10159191 | 3300032005 | Bacteria | 1688 |
| 288 | Ga0307510_10007242 | 3300033180 | Bacteria | 13215 |
| 289 | Ga0237819_00235 | 3300038705 | Bacteria | 20293 |
| 290 | Ga0439438_000458 | 3300041405 | Bacteria | 18423 |
| 291 | Ga0439438_000769 | 3300041405 | Bacteria | 14359 |
| 292 | Ga0439438_001721 | 3300041405 | Bacteria | 9631 |
| 293 | Ga0439438_002770 | 3300041405 | Bacteria | 7338 |
| 294 | Ga0439438_007219 | 3300041405 | Bacteria | 3820 |
| 295 | Ga0439438_017844 | 3300041405 | Bacteria | 2032 |
| 296 | Ga0439438_033701 | 3300041405 | Bacteria | 1351 |
| 297 | Ga0439447_002188 | 3300041407 | Bacteria | 7162 |
| 298 | Ga0439447_002464 | 3300041407 | Bacteria | 6734 |
| 299 | Ga0439447_004618 | 3300041407 | Bacteria | 4696 |
| 300 | Ga0439447_012908 | 3300041407 | Bacteria | 2386 |
| 301 | Ga0439447_023244 | 3300041407 | Bacteria | 1616 |
| 302 | Ga0439466_0000907 | 3300041411 | Bacteria | 11278 |
| 303 | Ga0439466_0000971 | 3300041411 | Bacteria | 11031 |
| 304 | Ga0439466_0004087 | 3300041411 | Bacteria | 5637 |
| 305 | Ga0439466_0006046 | 3300041411 | Bacteria | 4608 |
| 306 | Ga0439466_0021556 | 3300041411 | Bacteria | 2281 |
| 307 | Ga0439432_000157 | 3300042006 | Bacteria | 23222 |
| 308 | Ga0439432_006567 | 3300042006 | Bacteria | 4146 |
| 309 | Ga0439432_010237 | 3300042006 | Bacteria | 3253 |
| 310 | Ga0439432_025391 | 3300042006 | Bacteria | 1944 |
| 311 | Ga0439451_000588 | 3300042009 | Bacteria | 6878 |
| 312 | Ga0439451_003860 | 3300042009 | Bacteria | 3045 |
| 313 | Ga0439451_004573 | 3300042009 | Bacteria | 2815 |
| 314 | Ga0439451_005410 | 3300042009 | Bacteria | 2603 |
| 315 | Ga0439451_005677 | 3300042009 | Bacteria | 2551 |
| 316 | Ga0439451_006249 | 3300042009 | Bacteria | 2434 |
| 317 | Ga0439452_000372 | 3300042010 | Bacteria | 27160 |
| 318 | Ga0439452_000450 | 3300042010 | Bacteria | 23166 |
| 319 | Ga0439452_000554 | 3300042010 | Bacteria | 19780 |
| 320 | Ga0439452_002394 | 3300042010 | Bacteria | 6951 |
| 321 | Ga0439452_017767 | 3300042010 | Bacteria | 1904 |
| 322 | Ga0439456_000018 | 3300042013 | Bacteria | 62369 |
| 323 | Ga0439456_007241 | 3300042013 | Bacteria | 2273 |
| 324 | Ga0439456_009072 | 3300042013 | Bacteria | 2054 |
| 325 | Ga0439463_001422 | 3300042016 | Bacteria | 6354 |
| 326 | Ga0439463_002314 | 3300042016 | Bacteria | 4868 |
| 327 | Ga0439463_030525 | 3300042016 | Bacteria | 1359 |
| 328 | Ga0450911_000500 | 3300042115 | Bacteria | 12461 |
| 329 | Ga0450911_002319 | 3300042115 | Bacteria | 3803 |
| 330 | Ga0450919_001003 | 3300042121 | Bacteria | 3652 |
| 331 | Ga0450920_000365 | 3300042122 | Bacteria | 6963 |
| 332 | Ga0450922_001018 | 3300042124 | Bacteria | 2814 |
| 333 | Ga0450890_000379 | 3300042127 | Bacteria | 6487 |
| 334 | Ga0450900_000110 | 3300042136 | Bacteria | 4610 |
| 335 | Ga0450902_002840 | 3300042137 | Bacteria | 2483 |
| 336 | Ga0450902_004975 | 3300042137 | Bacteria | 1994 |
| 337 | Ga0450903_000730 | 3300042138 | Bacteria | 6497 |
| 338 | Ga0450904_000764 | 3300042139 | Bacteria | 5547 |
| 339 | Ga0450905_000235 | 3300042142 | Bacteria | 6398 |
| 340 | Ga0450906_001133 | 3300042145 | Bacteria | 5903 |
| 341 | Ga0450906_001361 | 3300042145 | Bacteria | 5347 |
| 342 | Ga0450906_003145 | 3300042145 | Bacteria | 3567 |
| 343 | Ga0450907_000153 | 3300042146 | Bacteria | 25822 |
| 344 | Ga0450907_005901 | 3300042146 | Bacteria | 2055 |
| 345 | Ga0439446_0001615 | 3300042156 | Bacteria | 5195 |
| 346 | Ga0450908_007144 | 3300042184 | Bacteria | 2109 |
| 347 | Ga0439434_0001096 | 3300042435 | Bacteria | 7842 |
| 348 | Ga0439460_0007686 | 3300042461 | Bacteria | 2702 |
| 349 | Ga0439460_0038964 | 3300042461 | Bacteria | 1387 |
| 350 | Ga0450918_006776 | 3300042531 | Bacteria | 2038 |
| 351 | Ga0439440_0000511 | 3300042993 | Bacteria | 6515 |
| 352 | Ga0495617_000368 | 3300046452 | Bacteria | 24923 |
| 353 | Ga0495617_005624 | 3300046452 | Bacteria | 4433 |
| 354 | Ga0495617_007797 | 3300046452 | Bacteria | 3705 |
| 355 | Ga0495617_061880 | 3300046452 | Bacteria | 1237 |
| 356 | Ga0495627_000021 | 3300046453 | Bacteria | 282454 |
| 357 | Ga0495627_003934 | 3300046453 | Bacteria | 6353 |
| 358 | Ga0495627_011885 | 3300046453 | Bacteria | 3106 |
| 359 | Ga0495627_024437 | 3300046453 | Bacteria | 1969 |
| 360 | Ga0495627_024787 | 3300046453 | Bacteria | 1951 |
| 361 | Ga0495603_0023331 | 3300046455 | Bacteria | 3745 |
| 362 | Ga0495590_0001991 | 3300046457 | Bacteria | 8601 |
| 363 | Ga0495591_000085 | 3300046458 | Bacteria | 105096 |
| 364 | Ga0495591_001774 | 3300046458 | Bacteria | 12795 |
| 365 | Ga0495591_004507 | 3300046458 | Bacteria | 6786 |
| 366 | Ga0495591_009372 | 3300046458 | Bacteria | 3900 |
| 367 | Ga0495591_009721 | 3300046458 | Bacteria | 3792 |
| 368 | Ga0495638_0003108 | 3300046460 | Bacteria | 13156 |
| 369 | Ga0495638_0004890 | 3300046460 | Bacteria | 10071 |
| 370 | Ga0495638_0008486 | 3300046460 | Bacteria | 7281 |
| 371 | Ga0495638_0009068 | 3300046460 | Bacteria | 7010 |
| 372 | Ga0495638_0050775 | 3300046460 | Bacteria | 2589 |
| 373 | Ga0495653_0006511 | 3300046463 | Bacteria | 9583 |
| 374 | Ga0495653_0075055 | 3300046463 | Bacteria | 2517 |
| 375 | Ga0495650_0001943 | 3300046471 | Bacteria | 18280 |
| 376 | Ga0495650_0005328 | 3300046471 | Bacteria | 8397 |
| 377 | Ga0495650_0040248 | 3300046471 | Bacteria | 2008 |
| 378 | Ga0495650_0043657 | 3300046471 | Bacteria | 1900 |
| 379 | Ga0495650_0043784 | 3300046471 | Bacteria | 1896 |
| 380 | Ga0495582_0017973 | 3300046473 | Bacteria | 3865 |
| 381 | Ga0495605_0000014 | 3300046474 | Bacteria | 305393 |
| 382 | Ga0495605_0001107 | 3300046474 | Bacteria | 17963 |
| 383 | Ga0495605_0001302 | 3300046474 | Bacteria | 16539 |
| 384 | Ga0495605_0022897 | 3300046474 | Bacteria | 3291 |
| 385 | Ga0495605_0037402 | 3300046474 | Bacteria | 2442 |
| 386 | Ga0495605_0054802 | 3300046474 | Bacteria | 1929 |
| 387 | Ga0495639_0000338 | 3300046475 | Bacteria | 22658 |
| 388 | Ga0495584_0000726 | 3300046491 | Bacteria | 21744 |
| 389 | Ga0495584_0005797 | 3300046491 | Bacteria | 6512 |
| 390 | Ga0495584_0005937 | 3300046491 | Bacteria | 6435 |
| 391 | Ga0495584_0017434 | 3300046491 | Bacteria | 3656 |
| 392 | Ga0495584_0020571 | 3300046491 | Bacteria | 3350 |
| 393 | Ga0495584_0053357 | 3300046491 | Bacteria | 2034 |
| 394 | Ga0495585_0004196 | 3300046492 | Bacteria | 9409 |
| 395 | Ga0495585_0017751 | 3300046492 | Bacteria | 4108 |
| 396 | Ga0495585_0044256 | 3300046492 | Bacteria | 2487 |
| 397 | Ga0495585_0090870 | 3300046492 | Bacteria | 1644 |
| 398 | Ga0495596_0004590 | 3300046500 | Bacteria | 6697 |
| 399 | Ga0495607_0000807 | 3300046501 | Bacteria | 29654 |
| 400 | Ga0495607_0000913 | 3300046501 | Bacteria | 27527 |
| 401 | Ga0495607_0002741 | 3300046501 | Bacteria | 14046 |
| 402 | Ga0495607_0004224 | 3300046501 | Bacteria | 10655 |
| 403 | Ga0495607_0011228 | 3300046501 | Bacteria | 5975 |
| 404 | Ga0495607_0015890 | 3300046501 | Bacteria | 4868 |
| 405 | Ga0495607_0019670 | 3300046501 | Bacteria | 4285 |
| 406 | Ga0495607_0030302 | 3300046501 | Bacteria | 3323 |
| 407 | Ga0495607_0037772 | 3300046501 | Bacteria | 2898 |
| 408 | Ga0495607_0078543 | 3300046501 | Bacteria | 1820 |
| 409 | Ga0495583_0000066 | 3300046506 | Bacteria | 191372 |
| 410 | Ga0495583_0001467 | 3300046506 | Bacteria | 23652 |
| 411 | Ga0495583_0001499 | 3300046506 | Bacteria | 23250 |
| 412 | Ga0495583_0002420 | 3300046506 | Bacteria | 16014 |
| 413 | Ga0495583_0009697 | 3300046506 | Bacteria | 5719 |
| 414 | Ga0495606_0000144 | 3300046507 | Bacteria | 122857 |
| 415 | Ga0495606_0005024 | 3300046507 | Bacteria | 12892 |
| 416 | Ga0495606_0015552 | 3300046507 | Bacteria | 5854 |
| 417 | Ga0495606_0019081 | 3300046507 | Bacteria | 5116 |
| 418 | Ga0495606_0019825 | 3300046507 | Bacteria | 4981 |
| 419 | Ga0495606_0025205 | 3300046507 | Bacteria | 4265 |
| 420 | Ga0495606_0082622 | 3300046507 | Bacteria | 1993 |
| 421 | Ga0495610_0002992 | 3300046512 | Bacteria | 13609 |
| 422 | Ga0495610_0018448 | 3300046512 | Bacteria | 3940 |
| 423 | Ga0495610_0019144 | 3300046512 | Bacteria | 3839 |
| 424 | Ga0495610_0029274 | 3300046512 | Bacteria | 2902 |
| 425 | Ga0495610_0050563 | 3300046512 | Bacteria | 2028 |
| 426 | Ga0495610_0053014 | 3300046512 | Bacteria | 1967 |
| 427 | Ga0495616_0004472 | 3300046513 | Bacteria | 8803 |
| 428 | Ga0495616_0005088 | 3300046513 | Bacteria | 8175 |
| 429 | Ga0495616_0013091 | 3300046513 | Bacteria | 4690 |
| 430 | Ga0495616_0014716 | 3300046513 | Bacteria | 4370 |
| 431 | Ga0495616_0032435 | 3300046513 | Bacteria | 2728 |
| 432 | Ga0495616_0052375 | 3300046513 | Bacteria | 2032 |
| 433 | Ga0495620_0000027 | 3300046515 | Bacteria | 123465 |
| 434 | Ga0495620_0000048 | 3300046515 | Bacteria | 106392 |
| 435 | Ga0495620_0008973 | 3300046515 | Bacteria | 5342 |
| 436 | Ga0495620_0013908 | 3300046515 | Bacteria | 4106 |
| 437 | Ga0495631_0001079 | 3300046518 | Bacteria | 16944 |
| 438 | Ga0495631_0002617 | 3300046518 | Bacteria | 10048 |
| 439 | Ga0495631_0013760 | 3300046518 | Bacteria | 3921 |
| 440 | Ga0495631_0014861 | 3300046518 | Bacteria | 3748 |
| 441 | Ga0495631_0043545 | 3300046518 | Bacteria | 1980 |
| 442 | Ga0495631_0044133 | 3300046518 | Bacteria | 1965 |
| 443 | Ga0495632_0000299 | 3300046519 | Bacteria | 47952 |
| 444 | Ga0495632_0001675 | 3300046519 | Bacteria | 18148 |
| 445 | Ga0495632_0006735 | 3300046519 | Bacteria | 7345 |
| 446 | Ga0495632_0011832 | 3300046519 | Bacteria | 5074 |
| 447 | Ga0495632_0013263 | 3300046519 | Bacteria | 4710 |
| 448 | Ga0495632_0013786 | 3300046519 | Bacteria | 4596 |
| 449 | Ga0495632_0015231 | 3300046519 | Bacteria | 4322 |
| 450 | Ga0495632_0022041 | 3300046519 | Bacteria | 3421 |
| 451 | Ga0495632_0035196 | 3300046519 | Bacteria | 2557 |
| 452 | Ga0495637_0001320 | 3300046520 | Bacteria | 14878 |
| 453 | Ga0495637_0004137 | 3300046520 | Bacteria | 7551 |
| 454 | Ga0495637_0008667 | 3300046520 | Bacteria | 4989 |
| 455 | Ga0495637_0009514 | 3300046520 | Bacteria | 4735 |
| 456 | Ga0495637_0010811 | 3300046520 | Bacteria | 4400 |
| 457 | Ga0495637_0011363 | 3300046520 | Bacteria | 4281 |
| 458 | Ga0495637_0011717 | 3300046520 | Bacteria | 4208 |
| 459 | Ga0495637_0016377 | 3300046520 | Bacteria | 3465 |
| 460 | Ga0495637_0016400 | 3300046520 | Bacteria | 3463 |
| 461 | Ga0495637_0043908 | 3300046520 | Bacteria | 1905 |
| 462 | Ga0495637_0045890 | 3300046520 | Bacteria | 1850 |
| 463 | Ga0495643_0000186 | 3300046522 | Bacteria | 99683 |
| 464 | Ga0495643_0000457 | 3300046522 | Bacteria | 51945 |
| 465 | Ga0495643_0001019 | 3300046522 | Bacteria | 28587 |
| 466 | Ga0495643_0013408 | 3300046522 | Bacteria | 4907 |
| 467 | Ga0495643_0023039 | 3300046522 | Bacteria | 3544 |
| 468 | Ga0495643_0023963 | 3300046522 | Bacteria | 3464 |
| 469 | Ga0495643_0036906 | 3300046522 | Bacteria | 2682 |
| 470 | Ga0495643_0037694 | 3300046522 | Bacteria | 2649 |
| 471 | Ga0495644_0001547 | 3300046523 | Bacteria | 9384 |
| 472 | Ga0495644_0002956 | 3300046523 | Bacteria | 6753 |
| 473 | Ga0495644_0004612 | 3300046523 | Bacteria | 5414 |
| 474 | Ga0495644_0022305 | 3300046523 | Bacteria | 2413 |
| 475 | Ga0495648_0000393 | 3300046524 | Bacteria | 47938 |
| 476 | Ga0495648_0002023 | 3300046524 | Bacteria | 19228 |
| 477 | Ga0495648_0013764 | 3300046524 | Bacteria | 5962 |
| 478 | Ga0495648_0020044 | 3300046524 | Bacteria | 4677 |
| 479 | Ga0495648_0029611 | 3300046524 | Bacteria | 3631 |
| 480 | Ga0495648_0040891 | 3300046524 | Bacteria | 2934 |
| 481 | Ga0495648_0061183 | 3300046524 | Bacteria | 2237 |
| 482 | Ga0495648_0091032 | 3300046524 | Bacteria | 1707 |
| 483 | Ga0495648_0108214 | 3300046524 | Bacteria | 1518 |
| 484 | Ga0495648_0118945 | 3300046524 | Bacteria | 1423 |
| 485 | Ga0495666_0002545 | 3300046526 | Bacteria | 9046 |
| 486 | Ga0495642_0001731 | 3300046528 | Bacteria | 9397 |
| 487 | Ga0495642_0002058 | 3300046528 | Bacteria | 8362 |
| 488 | Ga0495654_0003039 | 3300046530 | Bacteria | 10448 |
| 489 | Ga0495654_0008433 | 3300046530 | Bacteria | 5694 |
| 490 | Ga0495654_0010961 | 3300046530 | Bacteria | 4922 |
| 491 | Ga0495654_0011390 | 3300046530 | Bacteria | 4814 |
| 492 | Ga0495654_0028026 | 3300046530 | Bacteria | 2882 |
| 493 | Ga0495654_0041792 | 3300046530 | Bacteria | 2279 |
| 494 | Ga0495654_0045995 | 3300046530 | Bacteria | 2151 |
| 495 | Ga0495654_0083936 | 3300046530 | Bacteria | 1488 |
| 496 | Ga0495654_0085016 | 3300046530 | Bacteria | 1476 |
| 497 | Ga0495587_0018365 | 3300046536 | Bacteria | 4338 |
| 498 | Ga0495587_0048288 | 3300046536 | Bacteria | 2520 |
| 499 | Ga0495609_0000006 | 3300046538 | Bacteria | 431833 |
| 500 | Ga0495609_0000024 | 3300046538 | Bacteria | 264100 |
| 501 | Ga0495609_0025096 | 3300046538 | Bacteria | 2734 |
| 502 | Ga0495609_0034965 | 3300046538 | Bacteria | 2276 |
| 503 | Ga0495609_0048549 | 3300046538 | Bacteria | 1896 |
| 504 | Ga0495597_0000005 | 3300046542 | Bacteria | 286580 |
| 505 | Ga0495597_0001399 | 3300046542 | Bacteria | 17432 |
| 506 | Ga0495597_0002877 | 3300046542 | Bacteria | 10510 |
| 507 | Ga0495597_0034665 | 3300046542 | Bacteria | 2280 |
| 508 | Ga0495597_0035812 | 3300046542 | Bacteria | 2237 |
| 509 | Ga0495597_0041702 | 3300046542 | Bacteria | 2048 |
| 510 | Ga0495622_0000881 | 3300046557 | Bacteria | 16384 |
| 511 | Ga0495622_0000886 | 3300046557 | Bacteria | 16327 |
| 512 | Ga0495622_0015504 | 3300046557 | Bacteria | 3543 |
| 513 | Ga0495622_0037999 | 3300046557 | Bacteria | 2241 |
| 514 | Ga0495633_0000030 | 3300046558 | Bacteria | 197184 |
| 515 | Ga0495633_0013001 | 3300046558 | Bacteria | 4404 |
| 516 | Ga0495633_0050371 | 3300046558 | Bacteria | 1963 |
| 517 | Ga0495656_0002588 | 3300046615 | Bacteria | 6034 |
| 518 | Ga0495668_0006319 | 3300046616 | Bacteria | 7794 |
| 519 | Ga0495668_0010985 | 3300046616 | Bacteria | 5449 |
| 520 | Ga0495668_0016180 | 3300046616 | Bacteria | 4338 |
| 521 | Ga0495611_0000552 | 3300046648 | Bacteria | 21884 |
| 522 | Ga0495611_0003058 | 3300046648 | Bacteria | 7436 |
| 523 | Ga0495625_0005658 | 3300046660 | Bacteria | 11318 |
| 524 | Ga0495625_0021767 | 3300046660 | Bacteria | 4927 |
| 525 | Ga0495625_0034884 | 3300046660 | Bacteria | 3710 |
| 526 | Ga0495625_0056209 | 3300046660 | Bacteria | 2803 |
| 527 | Ga0495625_0065598 | 3300046660 | Bacteria | 2559 |
| 528 | Ga0495625_0091661 | 3300046660 | Bacteria | 2100 |
| 529 | Ga0495659_0007381 | 3300046664 | Bacteria | 3488 |
| 530 | Ga0495661_0000015 | 3300046665 | Bacteria | 223740 |
| 531 | Ga0495661_0000331 | 3300046665 | Bacteria | 51388 |
| 532 | Ga0495661_0002477 | 3300046665 | Bacteria | 14198 |
| 533 | Ga0495661_0006019 | 3300046665 | Bacteria | 8556 |
| 534 | Ga0495661_0008982 | 3300046665 | Bacteria | 6878 |
| 535 | Ga0495661_0032366 | 3300046665 | Bacteria | 3305 |
| 536 | Ga0495661_0043799 | 3300046665 | Bacteria | 2748 |
| 537 | Ga0495588_0006165 | 3300046674 | Bacteria | 5383 |
| 538 | Ga0495646_0099575 | 3300046680 | Bacteria | 1668 |
| 539 | Ga0495669_0001163 | 3300046684 | Bacteria | 10942 |
| 540 | Ga0495624_0039210 | 3300046690 | Bacteria | 3037 |
| 541 | Ga0495670_0004255 | 3300046691 | Bacteria | 7012 |
| 542 | Ga0495670_0016945 | 3300046691 | Bacteria | 3581 |
| 543 | Ga0495671_0001353 | 3300046692 | Bacteria | 16630 |
| 544 | Ga0495671_0011760 | 3300046692 | Bacteria | 4798 |
| 545 | Ga0495671_0012398 | 3300046692 | Bacteria | 4658 |
| 546 | Ga0495671_0013458 | 3300046692 | Bacteria | 4430 |
| 547 | Ga0495649_0000188 | 3300046694 | Bacteria | 54294 |
| 548 | Ga0495649_0004634 | 3300046694 | Bacteria | 8940 |
| 549 | Ga0495649_0039002 | 3300046694 | Bacteria | 2604 |
| 550 | Ga0495649_0068790 | 3300046694 | Bacteria | 1899 |
| 551 | Ga0495589_0000639 | 3300046794 | Bacteria | 22912 |
| 552 | Ga0495589_0002072 | 3300046794 | Bacteria | 11351 |
| 553 | Ga0495589_0010280 | 3300046794 | Bacteria | 4863 |
| 554 | Ga0495589_0010374 | 3300046794 | Bacteria | 4839 |
| 555 | Ga0495589_0057734 | 3300046794 | Bacteria | 1908 |
| 556 | Ga0495660_0000853 | 3300046810 | Bacteria | 22502 |
| 557 | Ga0495660_0002432 | 3300046810 | Bacteria | 11876 |
| 558 | Ga0495660_0017050 | 3300046810 | Bacteria | 4182 |
| 559 | Ga0495660_0029684 | 3300046810 | Bacteria | 3083 |
| 560 | Ga0495660_0048228 | 3300046810 | Bacteria | 2329 |
| 561 | Ga0495660_0063174 | 3300046810 | Bacteria | 1983 |
| 562 | Ga0495660_0068778 | 3300046810 | Bacteria | 1883 |
| 563 | Ga0495604_0069929 | 3300047317 | Bacteria | 2659 |
| 564 | Ga0495636_0002970 | 3300047318 | Bacteria | 6557 |
| 565 | Ga0495674_0108731 | 3300047319 | Bacteria | 2352 |
| 566 | Ga0495672_0001146 | 3300047320 | Bacteria | 26793 |
| 567 | Ga0495672_0005377 | 3300047320 | Bacteria | 10183 |
| 568 | Ga0495672_0009355 | 3300047320 | Bacteria | 7109 |
| 569 | Ga0495672_0019146 | 3300047320 | Bacteria | 4525 |
| 570 | Ga0495672_0020693 | 3300047320 | Bacteria | 4305 |
| 571 | Ga0495672_0022225 | 3300047320 | Bacteria | 4127 |
| 572 | Ga0495672_0034796 | 3300047320 | Bacteria | 3108 |
| 573 | Ga0495672_0049027 | 3300047320 | Bacteria | 2501 |
| 574 | Ga0495676_0123928 | 3300047321 | Bacteria | 1875 |
| 575 | Ga0495680_0006252 | 3300047322 | Bacteria | 11099 |
| 576 | Ga0495683_0000056 | 3300047323 | Bacteria | 118944 |
| 577 | Ga0495683_0001305 | 3300047323 | Bacteria | 16741 |
| 578 | Ga0495683_0003033 | 3300047323 | Bacteria | 9878 |
| 579 | Ga0495683_0012723 | 3300047323 | Bacteria | 4415 |
| 580 | Ga0495683_0027200 | 3300047323 | Bacteria | 2925 |
| 581 | Ga0495683_0050655 | 3300047323 | Bacteria | 2077 |
| 582 | Ga0495687_006803 | 3300047443 | Bacteria | 6906 |
| 583 | Ga0495687_013603 | 3300047443 | Bacteria | 4234 |
| 584 | Ga0495675_0005561 | 3300047444 | Bacteria | 7688 |
| 585 | Ga0495677_0031595 | 3300047445 | Bacteria | 1927 |
| 586 | Ga0495679_000121 | 3300047446 | Bacteria | 68858 |
| 587 | Ga0495679_001510 | 3300047446 | Bacteria | 13148 |
| 588 | Ga0495673_0000955 | 3300047469 | Bacteria | 26127 |
| 589 | Ga0495673_0002216 | 3300047469 | Bacteria | 13985 |
| 590 | Ga0495673_0004159 | 3300047469 | Bacteria | 9151 |
| 591 | Ga0495673_0005804 | 3300047469 | Bacteria | 7386 |
| 592 | Ga0495673_0009263 | 3300047469 | Bacteria | 5461 |
| 593 | Ga0495673_0009615 | 3300047469 | Bacteria | 5332 |
| 594 | Ga0495673_0013304 | 3300047469 | Bacteria | 4326 |
| 595 | Ga0495673_0015211 | 3300047469 | Bacteria | 3971 |
| 596 | Ga0495673_0023647 | 3300047469 | Bacteria | 2984 |
| 597 | Ga0495673_0026465 | 3300047469 | Bacteria | 2772 |
| 598 | Ga0495673_0071113 | 3300047469 | Bacteria | 1463 |
| 599 | Ga0495681_0000894 | 3300047470 | Bacteria | 23021 |
| 600 | Ga0495681_0003240 | 3300047470 | Bacteria | 11355 |
| 601 | Ga0495681_0007949 | 3300047470 | Bacteria | 6697 |
| 602 | Ga0495681_0008887 | 3300047470 | Bacteria | 6242 |
| 603 | Ga0495681_0009632 | 3300047470 | Bacteria | 5931 |
| 604 | Ga0495681_0011180 | 3300047470 | Bacteria | 5368 |
| 605 | Ga0495681_0015723 | 3300047470 | Bacteria | 4272 |
| 606 | Ga0495681_0081583 | 3300047470 | Bacteria | 1442 |
| 607 | Ga0495686_0043947 | 3300047472 | Bacteria | 2829 |
| 608 | Ga0495686_0056996 | 3300047472 | Bacteria | 2439 |
| 609 | Ga0495686_0110101 | 3300047472 | Bacteria | 1652 |
| 610 | Ga0495593_0021452 | 3300047673 | Bacteria | 3608 |
| 611 | Ga0495602_0118187 | 3300048088 | Bacteria | 2139 |
| 612 | Ga0495626_0001815 | 3300048091 | Bacteria | 16091 |
| 613 | Ga0495626_0003575 | 3300048091 | Bacteria | 9913 |
| 614 | Ga0495626_0010617 | 3300048091 | Bacteria | 4901 |
| 615 | Ga0495626_0013501 | 3300048091 | Bacteria | 4243 |
| 616 | Ga0495626_0047244 | 3300048091 | Bacteria | 2001 |
| 617 | Ga0495626_0120278 | 3300048091 | Bacteria | 1129 |
| 618 | Ga0496102_0003520 | 3300048905 | Bacteria | 13269 |
| 619 | Ga0496110_0095268 | 3300048913 | Bacteria | 2666 |
| 620 | Ga0496110_0111591 | 3300048913 | Bacteria | 2458 |
| 621 | Ga0496110_0154226 | 3300048913 | Bacteria | 2080 |
| 622 | Ga0496111_0057676 | 3300048914 | Bacteria | 2811 |
| 623 | Ga0496112_0280583 | 3300048915 | Bacteria | 1613 |
| 624 | Ga0496114_0005544 | 3300048917 | Bacteria | 9888 |
| 625 | Ga0496116_0000853 | 3300048919 | Bacteria | 38103 |
| 626 | Ga0496116_0002114 | 3300048919 | Bacteria | 21174 |
| 627 | Ga0496116_0025164 | 3300048919 | Bacteria | 4381 |
| 628 | Ga0496117_0000721 | 3300048920 | Bacteria | 52172 |
| 629 | Ga0496117_0001350 | 3300048920 | Bacteria | 35953 |
| 630 | Ga0496117_0001489 | 3300048920 | Bacteria | 33561 |
| 631 | Ga0496117_0003411 | 3300048920 | Bacteria | 18497 |
| 632 | Ga0496117_0009707 | 3300048920 | Bacteria | 8894 |
| 633 | Ga0496118_0000982 | 3300048921 | Bacteria | 44419 |
| 634 | Ga0496118_0001716 | 3300048921 | Bacteria | 31952 |
| 635 | Ga0496118_0029194 | 3300048921 | Bacteria | 4630 |
| 636 | Ga0496118_0035177 | 3300048921 | Bacteria | 4072 |
| 637 | Ga0496119_0029321 | 3300048922 | Bacteria | 3734 |
| 638 | Ga0496119_0131159 | 3300048922 | Bacteria | 1365 |
| 639 | Ga0496120_0008617 | 3300048923 | Bacteria | 7367 |
| 640 | Ga0496121_0003680 | 3300048924 | Bacteria | 21530 |
| 641 | Ga0496121_0035510 | 3300048924 | Bacteria | 4466 |
| 642 | Ga0496121_0131871 | 3300048924 | Bacteria | 1868 |
| 643 | Ga0496122_0001459 | 3300048925 | Bacteria | 38119 |
| 644 | Ga0496122_0008052 | 3300048925 | Bacteria | 11502 |
| 645 | Ga0496122_0008858 | 3300048925 | Bacteria | 10736 |
| 646 | Ga0496122_0019364 | 3300048925 | Bacteria | 6221 |
| 647 | Ga0496122_0033307 | 3300048925 | Bacteria | 4241 |
| 648 | Ga0496123_0001420 | 3300048926 | Bacteria | 33487 |
| 649 | Ga0496123_0006662 | 3300048926 | Bacteria | 11131 |
| 650 | Ga0496123_0013619 | 3300048926 | Bacteria | 6806 |
| 651 | Ga0496123_0038867 | 3300048926 | Bacteria | 3337 |
| 652 | Ga0496123_0079060 | 3300048926 | Bacteria | 2011 |
| 653 | Ga0496123_0106293 | 3300048926 | Bacteria | 1617 |
| 654 | Ga0496124_0000149 | 3300048927 | Bacteria | 143351 |
| 655 | Ga0496124_0004287 | 3300048927 | Bacteria | 16753 |
| 656 | Ga0496124_0005300 | 3300048927 | Bacteria | 14571 |
| 657 | Ga0496124_0006359 | 3300048927 | Bacteria | 12891 |
| 658 | Ga0496124_0014213 | 3300048927 | Bacteria | 7712 |
| 659 | Ga0496124_0017639 | 3300048927 | Bacteria | 6721 |
| 660 | Ga0496124_0019098 | 3300048927 | Bacteria | 6396 |
| 661 | Ga0496124_0091563 | 3300048927 | Bacteria | 2477 |
| 662 | Ga0496124_0150998 | 3300048927 | Bacteria | 1822 |
| 663 | Ga0496125_0001348 | 3300048928 | Bacteria | 36222 |
| 664 | Ga0496125_0005753 | 3300048928 | Bacteria | 13630 |
| 665 | Ga0496125_0006089 | 3300048928 | Bacteria | 13165 |
| 666 | Ga0496125_0052052 | 3300048928 | Bacteria | 3370 |
| 667 | Ga0496125_0080128 | 3300048928 | Bacteria | 2500 |
| 668 | Ga0496126_0027874 | 3300048929 | Bacteria | 5388 |
| 669 | Ga0496126_0033106 | 3300048929 | Bacteria | 4864 |
| 670 | Ga0496126_0155753 | 3300048929 | Bacteria | 1955 |
| 671 | Ga0495678_000063 | 3300049459 | Bacteria | 140183 |
| 672 | Ga0495678_016376 | 3300049459 | Bacteria | 3391 |
| 673 | Ga0495678_021070 | 3300049459 | Bacteria | 2875 |
| 674 | Ga0495678_028893 | 3300049459 | Bacteria | 2333 |
| 675 | Ga0495678_037158 | 3300049459 | Bacteria | 1981 |
| 676 | Ga0495678_048774 | 3300049459 | Bacteria | 1649 |
| 677 | Ga0495682_0000200 | 3300049460 | Bacteria | 48266 |
| 678 | Ga0495682_0009252 | 3300049460 | Bacteria | 3850 |
| 679 | Ga0495682_0024110 | 3300049460 | Bacteria | 2270 |
| 680 | Ga0495682_0027673 | 3300049460 | Bacteria | 2102 |
| 681 | nmdc:mga00v17_47319_c1 | 3300050491 | Bacteria | 2605 |
| 682 | nmdc:mga08x19_72581_c1 | 3300050514 | Bacteria | 2245 |
| 683 | Ga0500643_001822 | 3300053087 | Bacteria | 11654 |
| 684 | Ga0500651_0000028 | 3300053093 | Bacteria | 114592 |
| 685 | Ga0500566_0053661 | 3300053094 | Bacteria | 2300 |
| 686 | Ga0500571_009101 | 3300053110 | Bacteria | 5451 |
| 687 | Ga0500594_0004477 | 3300053118 | Bacteria | 3080 |
| 688 | Ga0500608_074851 | 3300053122 | Bacteria | 1606 |
| 689 | Ga0500626_006689 | 3300053128 | Bacteria | 4629 |
| 690 | Ga0500655_002472 | 3300053133 | Bacteria | 3366 |
| 691 | Ga0500658_0000878 | 3300053134 | Bacteria | 12336 |
| 692 | Ga0500658_0000902 | 3300053134 | Bacteria | 12176 |
| 693 | Ga0500568_0000710 | 3300053139 | Bacteria | 23894 |
| 694 | Ga0500573_0023603 | 3300053140 | Bacteria | 3533 |
| 695 | Ga0500634_0004112 | 3300053161 | Bacteria | 6656 |
| 696 | Ga0500634_0031093 | 3300053161 | Bacteria | 2910 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046452 | Ga0495617_061880 | Ga0495617_061880_279_1223 | 265 |
| 2 | 3300009036 | Ga0105244_10040077 | Ga0105244_100400772 | 285 |
| 3 | 3300017792 | Ga0163161_10018873 | Ga0163161_100188732 | 285 |
| 4 | 3300046518 | Ga0495631_0002617 | Ga0495631_0002617_7416_8675 | 285 |
| 5 | 3300047673 | Ga0495593_0021452 | Ga0495593_0021452_1014_2240 | 285 |
| 6 | 3300048926 | Ga0496123_0106293 | Ga0496123_0106293_329_1555 | 285 |
| 7 | 3300053087 | Ga0500643_001822 | Ga0500643_001822_4181_5407 | 285 |
| 8 | 3300053118 | Ga0500594_0004477 | Ga0500594_0004477_453_1712 | 285 |
| 9 | 3300053134 | Ga0500658_0000902 | Ga0500658_0000902_1595_2854 | 285 |
| 10 | 3300053139 | Ga0500568_0000710 | Ga0500568_0000710_14996_16255 | 285 |
| 11 | 3300053093 | Ga0500651_0000028 | Ga0500651_0000028_1580_2803 | 288 |
| 12 | 3300053094 | Ga0500566_0053661 | Ga0500566_0053661_900_2123 | 288 |
| 13 | 3300053134 | Ga0500658_0000878 | Ga0500658_0000878_1543_2766 | 288 |
| 14 | 3300053161 | Ga0500634_0031093 | Ga0500634_0031093_76_1299 | 288 |
| 15 | 3300048088 | Ga0495602_0118187 | Ga0495602_0118187_515_1741 | 299 |
| 16 | 3300053110 | Ga0500571_009101 | Ga0500571_009101_2609_3835 | 299 |
| 17 | 3300053122 | Ga0500608_074851 | Ga0500608_074851_69_1295 | 299 |
| 18 | 3300053128 | Ga0500626_006689 | Ga0500626_006689_3127_4398 | 299 |
| 19 | 3300053133 | Ga0500655_002472 | Ga0500655_002472_1568_2827 | 304 |
| 20 | 3300003781 | Ga0055536_1030098 | Ga0055536_10300981 | 307 |
| 21 | 3300003791 | Ga0055530_10014502 | Ga0055530_100145022 | 307 |
| 22 | 3300003792 | Ga0055540_1024703 | Ga0055540_10247032 | 307 |
| 23 | 3300003794 | Ga0055531_10037169 | Ga0055531_100371692 | 307 |
| 24 | 3300025263 | Ga0209565_1000133 | Ga0209565_100013313 | 307 |
| 25 | 3300025292 | Ga0209676_1001114 | Ga0209676_10011142 | 307 |
| 26 | 3300025292 | Ga0209676_1017856 | Ga0209676_10178562 | 307 |
| 27 | 3300025297 | Ga0209758_1014824 | Ga0209758_10148243 | 307 |
| 28 | 3300025298 | Ga0209050_1027548 | Ga0209050_10275482 | 307 |
| 29 | 3300025303 | Ga0209051_1001829 | Ga0209051_10018292 | 307 |
| 30 | 3300025304 | Ga0209257_1001367 | Ga0209257_10013672 | 307 |
| 31 | 3300048921 | Ga0496118_0029194 | Ga0496118_0029194_228_1466 | 307 |
| 32 | 3300003791 | Ga0055530_10028988 | Ga0055530_100289882 | 309 |
| 33 | 3300003794 | Ga0055531_10037159 | Ga0055531_100371592 | 309 |
| 34 | 3300025292 | Ga0209676_1000125 | Ga0209676_1000125147 | 309 |
| 35 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012637 | 309 |
| 36 | 3300025303 | Ga0209051_1000134 | Ga0209051_100013485 | 309 |
| 37 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024583 | 309 |
| 38 | 3300046460 | Ga0495638_0009068 | Ga0495638_0009068_1069_2328 | 310 |
| 39 | 3300046524 | Ga0495648_0000393 | Ga0495648_0000393_22592_23719 | 318 |
| 40 | 3300048929 | Ga0496126_0027874 | Ga0496126_0027874_1791_2954 | 319 |
| 41 | 3300048920 | Ga0496117_0001489 | Ga0496117_0001489_27075_28202 | 320 |
| 42 | 3300005289 | Ga0065704_10003208 | Ga0065704_100032084 | 321 |
| 43 | 3300046515 | Ga0495620_0000027 | Ga0495620_0000027_45242_46405 | 321 |
| 44 | 3300046519 | Ga0495632_0000299 | Ga0495632_0000299_22532_23695 | 321 |
| 45 | 3300046522 | Ga0495643_0000457 | Ga0495643_0000457_44049_45212 | 321 |
| 46 | 3300009036 | Ga0105244_10010379 | Ga0105244_100103794 | 324 |
| 47 | 3300009148 | Ga0105243_10006863 | Ga0105243_100068634 | 324 |
| 48 | 3300025728 | Ga0207655_1010819 | Ga0207655_10108194 | 324 |
| 49 | 3300025935 | Ga0207709_10002785 | Ga0207709_100027854 | 324 |
| 50 | 3300005289 | Ga0065704_10081781 | Ga0065704_100817811 | 325 |
| 51 | 3300025728 | Ga0207655_1018288 | Ga0207655_10182883 | 325 |
| 52 | 3300048913 | Ga0496110_0095268 | Ga0496110_0095268_1331_2494 | 325 |
| 53 | 3300048920 | Ga0496117_0009707 | Ga0496117_0009707_5360_6523 | 325 |
| 54 | 3300048921 | Ga0496118_0001716 | Ga0496118_0001716_30610_31773 | 325 |
| 55 | 3300048928 | Ga0496125_0001348 | Ga0496125_0001348_10080_11243 | 325 |
| 56 | 3300009036 | Ga0105244_10017940 | Ga0105244_100179402 | 326 |
| 57 | 3300025711 | Ga0207696_1000248 | Ga0207696_100024834 | 326 |
| 58 | 3300047469 | Ga0495673_0000955 | Ga0495673_0000955_9574_10734 | 328 |
| 59 | 3300046538 | Ga0495609_0025096 | Ga0495609_0025096_10_1170 | 329 |
| 60 | 3300009011 | Ga0105251_10000933 | Ga0105251_100009337 | 331 |
| 61 | 3300009148 | Ga0105243_10016100 | Ga0105243_100161002 | 331 |
| 62 | 3300025728 | Ga0207655_1000005 | Ga0207655_1000005157 | 331 |
| 63 | 3300025728 | Ga0207655_1000015 | Ga0207655_1000015246 | 331 |
| 64 | 3300025735 | Ga0207713_1000604 | Ga0207713_100060417 | 331 |
| 65 | 3300046460 | Ga0495638_0050775 | Ga0495638_0050775_1391_2551 | 332 |
| 66 | 3300046492 | Ga0495585_0090870 | Ga0495585_0090870_589_1620 | 332 |
| 67 | 3300046506 | Ga0495583_0009697 | Ga0495583_0009697_4640_5671 | 332 |
| 68 | 3300046524 | Ga0495648_0040891 | Ga0495648_0040891_1879_2910 | 332 |
| 69 | 3300046524 | Ga0495648_0108214 | Ga0495648_0108214_48_1079 | 332 |
| 70 | 3300048091 | Ga0495626_0120278 | Ga0495626_0120278_25_1056 | 332 |
| 71 | 3300049460 | Ga0495682_0009252 | Ga0495682_0009252_2795_3826 | 332 |
| 72 | 3300046458 | Ga0495591_000085 | Ga0495591_000085_56458_57618 | 333 |
| 73 | 3300046501 | Ga0495607_0000913 | Ga0495607_0000913_12430_13590 | 333 |
| 74 | 3300046538 | Ga0495609_0000006 | Ga0495609_0000006_243153_244313 | 333 |
| 75 | 3300046542 | Ga0495597_0000005 | Ga0495597_0000005_248490_249650 | 333 |
| 76 | 3300046810 | Ga0495660_0002432 | Ga0495660_0002432_2408_3568 | 333 |
| 77 | 3300046474 | Ga0495605_0037402 | Ga0495605_0037402_162_1322 | 334 |
| 78 | 3300046616 | Ga0495668_0016180 | Ga0495668_0016180_2205_3365 | 334 |
| 79 | 3300046810 | Ga0495660_0000853 | Ga0495660_0000853_13290_14450 | 334 |
| 80 | 3300042006 | Ga0439432_010237 | Ga0439432_010237_2190_3230 | 335 |
| 81 | 3300042016 | Ga0439463_030525 | Ga0439463_030525_296_1336 | 335 |
| 82 | 3300046453 | Ga0495627_000021 | Ga0495627_000021_235259_236419 | 337 |
| 83 | 3300053140 | Ga0500573_0023603 | Ga0500573_0023603_1255_2415 | 337 |
| 84 | 3300009011 | Ga0105251_10000697 | Ga0105251_1000069719 | 338 |
| 85 | 3300025735 | Ga0207713_1000138 | Ga0207713_100013868 | 338 |
| 86 | 3300041407 | Ga0439447_023244 | Ga0439447_023244_362_1522 | 338 |
| 87 | 3300042009 | Ga0439451_005677 | Ga0439451_005677_95_1255 | 338 |
| 88 | 3300042115 | Ga0450911_002319 | Ga0450911_002319_2483_3643 | 338 |
| 89 | 3300042461 | Ga0439460_0038964 | Ga0439460_0038964_95_1255 | 338 |
| 90 | 3300046474 | Ga0495605_0001107 | Ga0495605_0001107_2331_3584 | 338 |
| 91 | 3300046530 | Ga0495654_0041792 | Ga0495654_0041792_28_1188 | 338 |
| 92 | 3300049460 | Ga0495682_0000200 | Ga0495682_0000200_2643_3806 | 339 |
| 93 | 3300005288 | Ga0065714_10003597 | Ga0065714_100035973 | 341 |
| 94 | 3300009011 | Ga0105251_10001234 | Ga0105251_100012342 | 341 |
| 95 | 3300025728 | Ga0207655_1049437 | Ga0207655_10494372 | 341 |
| 96 | 3300025735 | Ga0207713_1001356 | Ga0207713_10013567 | 341 |
| 97 | 3300046522 | Ga0495643_0036906 | Ga0495643_0036906_1511_2671 | 341 |
| 98 | 3300048913 | Ga0496110_0111591 | Ga0496110_0111591_1081_2265 | 341 |
| 99 | 3300048927 | Ga0496124_0004287 | Ga0496124_0004287_12027_13190 | 341 |
| 100 | 3300048927 | Ga0496124_0014213 | Ga0496124_0014213_4591_5733 | 341 |
| 101 | 3300048927 | Ga0496124_0017639 | Ga0496124_0017639_5279_6463 | 341 |
| 102 | 3300048928 | Ga0496125_0052052 | Ga0496125_0052052_221_1405 | 341 |
| 103 | 3300048929 | Ga0496126_0033106 | Ga0496126_0033106_324_1508 | 341 |
| 104 | 3300003781 | Ga0055536_1000707 | Ga0055536_100070714 | 342 |
| 105 | 3300003791 | Ga0055530_10000626 | Ga0055530_1000062616 | 342 |
| 106 | 3300003792 | Ga0055540_1000484 | Ga0055540_100048416 | 342 |
| 107 | 3300025292 | Ga0209676_1000006 | Ga0209676_1000006799 | 342 |
| 108 | 3300025298 | Ga0209050_1000065 | Ga0209050_1000065281 | 342 |
| 109 | 3300025303 | Ga0209051_1000504 | Ga0209051_100050414 | 342 |
| 110 | 3300046506 | Ga0495583_0001499 | Ga0495583_0001499_13726_14886 | 342 |
| 111 | 3300046507 | Ga0495606_0000144 | Ga0495606_0000144_2452_3621 | 342 |
| 112 | 3300046538 | Ga0495609_0034965 | Ga0495609_0034965_168_1328 | 342 |
| 113 | 3300046694 | Ga0495649_0000188 | Ga0495649_0000188_1175_2344 | 342 |
| 114 | 3300009092 | Ga0105250_10000784 | Ga0105250_1000078412 | 343 |
| 115 | 3300015261 | Ga0182006_1016495 | Ga0182006_10164952 | 343 |
| 116 | 3300025711 | Ga0207696_1000112 | Ga0207696_100011289 | 343 |
| 117 | 3300042016 | Ga0439463_001422 | Ga0439463_001422_453_1622 | 343 |
| 118 | 3300042142 | Ga0450905_000235 | Ga0450905_000235_2870_4012 | 343 |
| 119 | 3300046501 | Ga0495607_0004224 | Ga0495607_0004224_1675_2835 | 343 |
| 120 | iso_pu_bacteria | 2913036834 | 2913041743 | 344 |
| 121 | iso_pu_bacteria | 2919481497 | 2919484685 | 344 |
| 122 | 3300009011 | Ga0105251_10000057 | Ga0105251_1000005756 | 346 |
| 123 | 3300025735 | Ga0207713_1000014 | Ga0207713_100001443 | 346 |
| 124 | 3300046463 | Ga0495653_0075055 | Ga0495653_0075055_383_1456 | 346 |
| 125 | 3300048091 | Ga0495626_0003575 | Ga0495626_0003575_1151_2311 | 346 |
| 126 | 3300048927 | Ga0496124_0000149 | Ga0496124_0000149_115177_116337 | 346 |
| 127 | 3300009011 | Ga0105251_10017648 | Ga0105251_100176482 | 347 |
| 128 | 3300009148 | Ga0105243_10151476 | Ga0105243_101514761 | 347 |
| 129 | 3300046453 | Ga0495627_011885 | Ga0495627_011885_248_1402 | 347 |
| 130 | 3300046458 | Ga0495591_009721 | Ga0495591_009721_2389_3543 | 347 |
| 131 | 3300046471 | Ga0495650_0005328 | Ga0495650_0005328_2097_3251 | 347 |
| 132 | 3300046474 | Ga0495605_0000014 | Ga0495605_0000014_91854_93008 | 347 |
| 133 | 3300046506 | Ga0495583_0000066 | Ga0495583_0000066_62734_63888 | 347 |
| 134 | 3300046506 | Ga0495583_0002420 | Ga0495583_0002420_5238_6410 | 347 |
| 135 | 3300046512 | Ga0495610_0002992 | Ga0495610_0002992_6695_7849 | 347 |
| 136 | 3300046515 | Ga0495620_0000048 | Ga0495620_0000048_62728_63882 | 347 |
| 137 | 3300046518 | Ga0495631_0014861 | Ga0495631_0014861_1109_2263 | 347 |
| 138 | 3300046520 | Ga0495637_0011717 | Ga0495637_0011717_553_1707 | 347 |
| 139 | 3300046522 | Ga0495643_0001019 | Ga0495643_0001019_5262_6425 | 347 |
| 140 | 3300046524 | Ga0495648_0029611 | Ga0495648_0029611_354_1508 | 347 |
| 141 | 3300046538 | Ga0495609_0000024 | Ga0495609_0000024_216638_217792 | 347 |
| 142 | 3300046542 | Ga0495597_0001399 | Ga0495597_0001399_14056_15210 | 347 |
| 143 | 3300046558 | Ga0495633_0000030 | Ga0495633_0000030_107050_108204 | 347 |
| 144 | 3300046648 | Ga0495611_0003058 | Ga0495611_0003058_123_1277 | 347 |
| 145 | 3300046665 | Ga0495661_0000015 | Ga0495661_0000015_134705_135859 | 347 |
| 146 | 3300046692 | Ga0495671_0011760 | Ga0495671_0011760_3232_4386 | 347 |
| 147 | 3300046794 | Ga0495589_0000639 | Ga0495589_0000639_10614_11768 | 347 |
| 148 | 3300046810 | Ga0495660_0017050 | Ga0495660_0017050_1189_2343 | 347 |
| 149 | 3300047323 | Ga0495683_0000056 | Ga0495683_0000056_62682_63836 | 347 |
| 150 | 3300047446 | Ga0495679_000121 | Ga0495679_000121_56402_57556 | 347 |
| 151 | 3300047469 | Ga0495673_0005804 | Ga0495673_0005804_1664_2818 | 347 |
| 152 | 3300048925 | Ga0496122_0033307 | Ga0496122_0033307_1771_2925 | 347 |
| 153 | 3300048926 | Ga0496123_0038867 | Ga0496123_0038867_1772_2926 | 347 |
| 154 | 3300049459 | Ga0495678_000063 | Ga0495678_000063_87926_89080 | 347 |
| 155 | 3300005288 | Ga0065714_10003333 | Ga0065714_100033334 | 349 |
| 156 | 3300006058 | Ga0075432_10003850 | Ga0075432_100038502 | 349 |
| 157 | 3300006914 | Ga0075436_100049882 | Ga0075436_1000498822 | 349 |
| 158 | 3300046452 | Ga0495617_005624 | Ga0495617_005624_2457_3617 | 349 |
| 159 | 3300046458 | Ga0495591_009372 | Ga0495591_009372_1721_2881 | 349 |
| 160 | 3300046513 | Ga0495616_0014716 | Ga0495616_0014716_1326_2486 | 349 |
| 161 | 3300046660 | Ga0495625_0034884 | Ga0495625_0034884_1276_2436 | 349 |
| 162 | 3300047323 | Ga0495683_0050655 | Ga0495683_0050655_808_1968 | 349 |
| 163 | 3300050514 | nmdc:mga08x19_72581_c1 | nmdc:mga08x19_72581_c1_269_1429 | 349 |
| 164 | 3300013104 | Ga0157370_10007745 | Ga0157370_100077452 | 350 |
| 165 | 3300013306 | Ga0163162_10120582 | Ga0163162_101205822 | 350 |
| 166 | 3300031548 | Ga0307408_100020209 | Ga0307408_1000202092 | 350 |
| 167 | 3300046453 | Ga0495627_003934 | Ga0495627_003934_2759_3919 | 350 |
| 168 | 3300046458 | Ga0495591_001774 | Ga0495591_001774_2489_3649 | 350 |
| 169 | 3300046518 | Ga0495631_0013760 | Ga0495631_0013760_1326_2486 | 350 |
| 170 | 3300046519 | Ga0495632_0035196 | Ga0495632_0035196_24_1184 | 350 |
| 171 | 3300046520 | Ga0495637_0011363 | Ga0495637_0011363_1879_3039 | 350 |
| 172 | 3300046542 | Ga0495597_0002877 | Ga0495597_0002877_477_1637 | 350 |
| 173 | 3300046616 | Ga0495668_0010985 | Ga0495668_0010985_1838_2998 | 350 |
| 174 | 3300046665 | Ga0495661_0032366 | Ga0495661_0032366_931_2091 | 350 |
| 175 | 3300046691 | Ga0495670_0016945 | Ga0495670_0016945_895_2055 | 350 |
| 176 | 3300047320 | Ga0495672_0034796 | Ga0495672_0034796_104_1264 | 350 |
| 177 | 3300047469 | Ga0495673_0009263 | Ga0495673_0009263_1923_3083 | 350 |
| 178 | 3300047469 | Ga0495673_0015211 | Ga0495673_0015211_1737_2897 | 350 |
| 179 | 3300047470 | Ga0495681_0007949 | Ga0495681_0007949_2500_3660 | 350 |
| 180 | 3300013104 | Ga0157370_10153937 | Ga0157370_101539372 | 352 |
| 181 | 3300015261 | Ga0182006_1028606 | Ga0182006_10286061 | 352 |
| 182 | 3300015265 | Ga0182005_1002172 | Ga0182005_10021724 | 352 |
| 183 | 3300046460 | Ga0495638_0008486 | Ga0495638_0008486_3086_4246 | 352 |
| 184 | 3300046474 | Ga0495605_0054802 | Ga0495605_0054802_759_1919 | 352 |
| 185 | 3300046491 | Ga0495584_0020571 | Ga0495584_0020571_1280_2440 | 352 |
| 186 | 3300046500 | Ga0495596_0004590 | Ga0495596_0004590_2452_3612 | 352 |
| 187 | 3300046501 | Ga0495607_0015890 | Ga0495607_0015890_1306_2466 | 352 |
| 188 | 3300046507 | Ga0495606_0025205 | Ga0495606_0025205_3086_4246 | 352 |
| 189 | 3300046512 | Ga0495610_0053014 | Ga0495610_0053014_229_1389 | 352 |
| 190 | 3300046515 | Ga0495620_0008973 | Ga0495620_0008973_2450_3610 | 352 |
| 191 | 3300046519 | Ga0495632_0013786 | Ga0495632_0013786_1082_2242 | 352 |
| 192 | 3300046520 | Ga0495637_0001320 | Ga0495637_0001320_8995_10155 | 352 |
| 193 | 3300046522 | Ga0495643_0023039 | Ga0495643_0023039_1266_2486 | 352 |
| 194 | 3300046522 | Ga0495643_0037694 | Ga0495643_0037694_911_2071 | 352 |
| 195 | 3300046523 | Ga0495644_0004612 | Ga0495644_0004612_2446_3606 | 352 |
| 196 | 3300046524 | Ga0495648_0020044 | Ga0495648_0020044_2436_3596 | 352 |
| 197 | 3300046530 | Ga0495654_0028026 | Ga0495654_0028026_20_1180 | 352 |
| 198 | 3300046536 | Ga0495587_0048288 | Ga0495587_0048288_1221_2381 | 352 |
| 199 | 3300046542 | Ga0495597_0035812 | Ga0495597_0035812_766_1926 | 352 |
| 200 | 3300046660 | Ga0495625_0021767 | Ga0495625_0021767_1350_2510 | 352 |
| 201 | 3300046665 | Ga0495661_0043799 | Ga0495661_0043799_1190_2350 | 352 |
| 202 | 3300046680 | Ga0495646_0099575 | Ga0495646_0099575_117_1277 | 352 |
| 203 | 3300046794 | Ga0495589_0010280 | Ga0495589_0010280_1381_2541 | 352 |
| 204 | 3300046810 | Ga0495660_0048228 | Ga0495660_0048228_1150_2310 | 352 |
| 205 | 3300047317 | Ga0495604_0069929 | Ga0495604_0069929_1108_2268 | 352 |
| 206 | 3300047319 | Ga0495674_0108731 | Ga0495674_0108731_471_1631 | 352 |
| 207 | 3300047323 | Ga0495683_0012723 | Ga0495683_0012723_1832_2992 | 352 |
| 208 | 3300047469 | Ga0495673_0023647 | Ga0495673_0023647_1805_2965 | 352 |
| 209 | 3300047470 | Ga0495681_0009632 | Ga0495681_0009632_2417_3577 | 352 |
| 210 | 3300047472 | Ga0495686_0043947 | Ga0495686_0043947_759_1919 | 352 |
| 211 | 3300048091 | Ga0495626_0001815 | Ga0495626_0001815_9151_10311 | 352 |
| 212 | 3300048905 | Ga0496102_0003520 | Ga0496102_0003520_9997_11157 | 352 |
| 213 | 3300049459 | Ga0495678_021070 | Ga0495678_021070_568_1728 | 352 |
| 214 | 3300042010 | Ga0439452_000372 | Ga0439452_000372_18417_19577 | 353 |
| 215 | 3300009011 | Ga0105251_10043442 | Ga0105251_100434422 | 354 |
| 216 | 3300013104 | Ga0157370_10001195 | Ga0157370_100011952 | 354 |
| 217 | 3300025735 | Ga0207713_1037600 | Ga0207713_10376001 | 354 |
| 218 | 3300027312 | Ga0209371_1002332 | Ga0209371_10023322 | 355 |
| 219 | 3300030500 | Ga0268256_1002399 | Ga0268256_10023992 | 355 |
| 220 | 3300046501 | Ga0495607_0030302 | Ga0495607_0030302_274_1446 | 355 |
| 221 | 3300048917 | Ga0496114_0005544 | Ga0496114_0005544_1891_3054 | 355 |
| 222 | iso_pu_bacteria | 2713897149 | 2715755326 | 355 |
| 223 | 3300046524 | Ga0495648_0002023 | Ga0495648_0002023_7811_8980 | 356 |
| 224 | iso_pu_bacteria | 2619619299 | 2621301640 | 356 |
| 225 | iso_pu_bacteria | 2738541265 | 2738672723 | 356 |
| 226 | iso_pu_bacteria | 2738541282 | 2738751116 | 356 |
| 227 | iso_pu_bacteria | 2738541303 | 2738860157 | 356 |
| 228 | iso_pu_bacteria | 2816332298 | 2817488997 | 356 |
| 229 | 3300009036 | Ga0105244_10000703 | Ga0105244_100007038 | 357 |
| 230 | 3300013102 | Ga0157371_10000389 | Ga0157371_1000038911 | 357 |
| 231 | 3300025728 | Ga0207655_1000430 | Ga0207655_100043029 | 357 |
| 232 | 3300048925 | Ga0496122_0001459 | Ga0496122_0001459_6007_7170 | 357 |
| 233 | 3300048926 | Ga0496123_0001420 | Ga0496123_0001420_26841_28004 | 357 |
| 234 | 3300009011 | Ga0105251_10063011 | Ga0105251_100630112 | 358 |
| 235 | 3300025711 | Ga0207696_1010241 | Ga0207696_10102413 | 358 |
| 236 | 3300025728 | Ga0207655_1000630 | Ga0207655_10006306 | 358 |
| 237 | 3300025735 | Ga0207713_1011342 | Ga0207713_10113425 | 358 |
| 238 | 3300048920 | Ga0496117_0000721 | Ga0496117_0000721_22581_23744 | 358 |
| 239 | 3300048921 | Ga0496118_0000982 | Ga0496118_0000982_33400_34563 | 358 |
| 240 | iso_pu_bacteria | 8021622325 | 8021625301 | 358 |
| 241 | iso_pu_bacteria | 8021626552 | 8021630217 | 358 |
| 242 | 3300047470 | Ga0495681_0011180 | Ga0495681_0011180_3021_4190 | 359 |
| 243 | iso_pu_bacteria | 2923153595 | 2923158667 | 359 |
| 244 | 3300003791 | Ga0055530_10001090 | Ga0055530_100010908 | 360 |
| 245 | 3300003792 | Ga0055540_1000363 | Ga0055540_100036310 | 360 |
| 246 | 3300009036 | Ga0105244_10000303 | Ga0105244_1000030347 | 360 |
| 247 | 3300025292 | Ga0209676_1003086 | Ga0209676_10030867 | 360 |
| 248 | 3300025298 | Ga0209050_1000027 | Ga0209050_1000027265 | 360 |
| 249 | 3300025303 | Ga0209051_1000065 | Ga0209051_1000065177 | 360 |
| 250 | 3300025728 | Ga0207655_1002309 | Ga0207655_10023092 | 360 |
| 251 | 3300046522 | Ga0495643_0000186 | Ga0495643_0000186_58157_59329 | 361 |
| 252 | 3300046660 | Ga0495625_0065598 | Ga0495625_0065598_1206_2378 | 361 |
| 253 | 3300046692 | Ga0495671_0001353 | Ga0495671_0001353_10124_11296 | 361 |
| 254 | 3300046694 | Ga0495649_0039002 | Ga0495649_0039002_145_1317 | 361 |
| 255 | iso_pu_bacteria | 2599185189 | 2599508129 | 361 |
| 256 | iso_pu_bacteria | 2844665904 | 2844666132 | 361 |
| 257 | 3300041411 | Ga0439466_0021556 | Ga0439466_0021556_616_1776 | 362 |
| 258 | iso_pu_bacteria | 2917070673 | 2917075839 | 362 |
| 259 | 3300009011 | Ga0105251_10005221 | Ga0105251_100052212 | 363 |
| 260 | 3300013104 | Ga0157370_10044892 | Ga0157370_100448922 | 363 |
| 261 | 3300028786 | Ga0307517_10017207 | Ga0307517_100172072 | 363 |
| 262 | 3300046471 | Ga0495650_0001943 | Ga0495650_0001943_1348_2508 | 363 |
| 263 | 3300046506 | Ga0495583_0001467 | Ga0495583_0001467_16065_17225 | 363 |
| 264 | 3300046512 | Ga0495610_0019144 | Ga0495610_0019144_1516_2676 | 363 |
| 265 | 3300046519 | Ga0495632_0001675 | Ga0495632_0001675_5756_6916 | 363 |
| 266 | 3300046520 | Ga0495637_0008667 | Ga0495637_0008667_1254_2414 | 363 |
| 267 | 3300046665 | Ga0495661_0000331 | Ga0495661_0000331_19029_20189 | 363 |
| 268 | 3300048925 | Ga0496122_0008858 | Ga0496122_0008858_3442_4608 | 363 |
| 269 | 3300048926 | Ga0496123_0013619 | Ga0496123_0013619_3480_4646 | 363 |
| 270 | 3300048927 | Ga0496124_0019098 | Ga0496124_0019098_4564_5721 | 363 |
| 271 | 3300048928 | Ga0496125_0005753 | Ga0496125_0005753_3733_4899 | 363 |
| 272 | 3300005288 | Ga0065714_10073983 | Ga0065714_100739832 | 365 |
| 273 | 3300006946 | Ga0079104_1001193 | Ga0079104_10011937 | 365 |
| 274 | 3300013100 | Ga0157373_10001638 | Ga0157373_1000163810 | 365 |
| 275 | 3300014497 | Ga0182008_10021636 | Ga0182008_100216362 | 365 |
| 276 | 3300027111 | Ga0209281_1000015 | Ga0209281_1000015312 | 365 |
| 277 | 3300031548 | Ga0307408_100000950 | Ga0307408_10000095014 | 365 |
| 278 | 3300031548 | Ga0307408_100010388 | Ga0307408_1000103884 | 365 |
| 279 | 3300031731 | Ga0307405_10001648 | Ga0307405_100016486 | 365 |
| 280 | 3300031731 | Ga0307405_10023066 | Ga0307405_100230663 | 365 |
| 281 | 3300031824 | Ga0307413_10016578 | Ga0307413_100165784 | 365 |
| 282 | 3300031824 | Ga0307413_10165310 | Ga0307413_101653101 | 365 |
| 283 | 3300031901 | Ga0307406_10073169 | Ga0307406_100731692 | 365 |
| 284 | 3300031903 | Ga0307407_10017831 | Ga0307407_100178313 | 365 |
| 285 | 3300031911 | Ga0307412_10003759 | Ga0307412_100037591 | 365 |
| 286 | 3300031911 | Ga0307412_10021866 | Ga0307412_100218663 | 365 |
| 287 | 3300031995 | Ga0307409_100100062 | Ga0307409_1001000623 | 365 |
| 288 | 3300032002 | Ga0307416_100169436 | Ga0307416_1001694363 | 365 |
| 289 | 3300032005 | Ga0307411_10031700 | Ga0307411_100317002 | 365 |
| 290 | 3300041405 | Ga0439438_000769 | Ga0439438_000769_11254_12411 | 365 |
| 291 | 3300041405 | Ga0439438_007219 | Ga0439438_007219_801_1958 | 365 |
| 292 | 3300041411 | Ga0439466_0006046 | Ga0439466_0006046_992_2149 | 365 |
| 293 | 3300042006 | Ga0439432_006567 | Ga0439432_006567_2859_4016 | 365 |
| 294 | 3300047320 | Ga0495672_0005377 | Ga0495672_0005377_1788_2948 | 365 |
| 295 | 3300005288 | Ga0065714_10009519 | Ga0065714_100095192 | 366 |
| 296 | 3300006058 | Ga0075432_10024634 | Ga0075432_100246342 | 366 |
| 297 | 3300006946 | Ga0079104_1000385 | Ga0079104_100038536 | 366 |
| 298 | 3300014497 | Ga0182008_10004590 | Ga0182008_100045907 | 366 |
| 299 | 3300027111 | Ga0209281_1000049 | Ga0209281_1000049300 | 366 |
| 300 | 3300027907 | Ga0207428_10224282 | Ga0207428_102242822 | 366 |
| 301 | 3300041405 | Ga0439438_033701 | Ga0439438_033701_109_1269 | 366 |
| 302 | 3300041407 | Ga0439447_002464 | Ga0439447_002464_5480_6640 | 366 |
| 303 | 3300041411 | Ga0439466_0000971 | Ga0439466_0000971_9777_10937 | 366 |
| 304 | 3300041411 | Ga0439466_0004087 | Ga0439466_0004087_3530_4690 | 366 |
| 305 | 3300042009 | Ga0439451_005410 | Ga0439451_005410_1421_2581 | 366 |
| 306 | 3300042010 | Ga0439452_017767 | Ga0439452_017767_572_1732 | 366 |
| 307 | 3300042013 | Ga0439456_007241 | Ga0439456_007241_159_1319 | 366 |
| 308 | 3300042016 | Ga0439463_002314 | Ga0439463_002314_3614_4774 | 366 |
| 309 | 3300042121 | Ga0450919_001003 | Ga0450919_001003_2357_3517 | 366 |
| 310 | 3300042127 | Ga0450890_000379 | Ga0450890_000379_618_1778 | 366 |
| 311 | 3300042137 | Ga0450902_004975 | Ga0450902_004975_645_1805 | 366 |
| 312 | 3300042138 | Ga0450903_000730 | Ga0450903_000730_4384_5544 | 366 |
| 313 | 3300042145 | Ga0450906_001133 | Ga0450906_001133_3583_4743 | 366 |
| 314 | 3300042156 | Ga0439446_0001615 | Ga0439446_0001615_95_1255 | 366 |
| 315 | 3300042461 | Ga0439460_0007686 | Ga0439460_0007686_1448_2608 | 366 |
| 316 | 3300042531 | Ga0450918_006776 | Ga0450918_006776_465_1625 | 366 |
| 317 | 3300042993 | Ga0439440_0000511 | Ga0439440_0000511_5064_6224 | 366 |
| 318 | 3300046491 | Ga0495584_0000726 | Ga0495584_0000726_17795_18955 | 366 |
| 319 | 3300046491 | Ga0495584_0005937 | Ga0495584_0005937_4230_5390 | 366 |
| 320 | 3300046520 | Ga0495637_0009514 | Ga0495637_0009514_131_1291 | 366 |
| 321 | 3300046520 | Ga0495637_0016400 | Ga0495637_0016400_322_1482 | 366 |
| 322 | 3300046523 | Ga0495644_0001547 | Ga0495644_0001547_4558_5718 | 366 |
| 323 | 3300046530 | Ga0495654_0045995 | Ga0495654_0045995_626_1786 | 366 |
| 324 | 3300046692 | Ga0495671_0013458 | Ga0495671_0013458_2057_3217 | 366 |
| 325 | 3300047320 | Ga0495672_0009355 | Ga0495672_0009355_465_1601 | 366 |
| 326 | 3300047472 | Ga0495686_0056996 | Ga0495686_0056996_951_2111 | 366 |
| 327 | 3300048927 | Ga0496124_0091563 | Ga0496124_0091563_1240_2406 | 366 |
| 328 | 3300049459 | Ga0495678_037158 | Ga0495678_037158_305_1465 | 366 |
| 329 | 3300050491 | nmdc:mga00v17_47319_c1 | nmdc:mga00v17_47319_c1_434_1594 | 366 |
| 330 | iso_pu_bacteria | 2842805378 | 2842806662 | 366 |
| 331 | 2162886011 | MRS1b_contig_4266420 | MRS1b_0902.00001890 | 367 |
| 332 | 3300002737 | JGI25162J39368_1000466 | JGI25162J39368_100046610 | 367 |
| 333 | 3300002737 | JGI25162J39368_1000491 | JGI25162J39368_100049110 | 367 |
| 334 | 3300002771 | JGI25163J39215_1000427 | JGI25163J39215_10004272 | 367 |
| 335 | 3300002771 | JGI25163J39215_1001580 | JGI25163J39215_10015802 | 367 |
| 336 | 3300002772 | JGI25164J39214_1000318 | JGI25164J39214_10003189 | 367 |
| 337 | 3300002772 | JGI25164J39214_1000334 | JGI25164J39214_100033410 | 367 |
| 338 | 3300003214 | JGI25165J46597_1000590 | JGI25165J46597_100059010 | 367 |
| 339 | 3300003214 | JGI25165J46597_1000616 | JGI25165J46597_100061610 | 367 |
| 340 | 3300005290 | Ga0065712_10067964 | Ga0065712_1006796412 | 367 |
| 341 | 3300006058 | Ga0075432_10004264 | Ga0075432_100042643 | 367 |
| 342 | 3300006177 | Ga0075362_10027786 | Ga0075362_100277862 | 367 |
| 343 | 3300009011 | Ga0105251_10002815 | Ga0105251_100028156 | 367 |
| 344 | 3300009036 | Ga0105244_10024689 | Ga0105244_100246892 | 367 |
| 345 | 3300009148 | Ga0105243_10000797 | Ga0105243_1000079710 | 367 |
| 346 | 3300009553 | Ga0105249_10029027 | Ga0105249_100290273 | 367 |
| 347 | 3300013102 | Ga0157371_10001815 | Ga0157371_1000181512 | 367 |
| 348 | 3300014497 | Ga0182008_10001819 | Ga0182008_100018195 | 367 |
| 349 | 3300014497 | Ga0182008_10021661 | Ga0182008_100216612 | 367 |
| 350 | 3300014497 | Ga0182008_10076278 | Ga0182008_100762782 | 367 |
| 351 | 3300015261 | Ga0182006_1002230 | Ga0182006_10022308 | 367 |
| 352 | 3300015262 | Ga0182007_10001924 | Ga0182007_100019241 | 367 |
| 353 | 3300015265 | Ga0182005_1005392 | Ga0182005_10053921 | 367 |
| 354 | 3300025207 | Ga0209760_100232 | Ga0209760_10023215 | 367 |
| 355 | 3300025207 | Ga0209760_100348 | Ga0209760_1003481 | 367 |
| 356 | 3300025231 | Ga0207427_100007 | Ga0207427_100007551 | 367 |
| 357 | 3300025231 | Ga0207427_100038 | Ga0207427_100038203 | 367 |
| 358 | 3300025233 | Ga0209437_100006 | Ga0209437_100006817 | 367 |
| 359 | 3300025233 | Ga0209437_100009 | Ga0209437_100009830 | 367 |
| 360 | 3300025261 | Ga0209233_1000059 | Ga0209233_1000059178 | 367 |
| 361 | 3300025261 | Ga0209233_1000074 | Ga0209233_1000074203 | 367 |
| 362 | 3300025298 | Ga0209050_1000425 | Ga0209050_10004257 | 367 |
| 363 | 3300025728 | Ga0207655_1001977 | Ga0207655_10019771 | 367 |
| 364 | 3300025735 | Ga0207713_1003039 | Ga0207713_10030394 | 367 |
| 365 | 3300025935 | Ga0207709_10000827 | Ga0207709_1000082710 | 367 |
| 366 | 3300027907 | Ga0207428_10072044 | Ga0207428_100720441 | 367 |
| 367 | 3300041411 | Ga0439466_0000907 | Ga0439466_0000907_4384_5553 | 367 |
| 368 | 3300042009 | Ga0439451_000588 | Ga0439451_000588_4152_5321 | 367 |
| 369 | 3300042009 | Ga0439451_004573 | Ga0439451_004573_1444_2613 | 367 |
| 370 | 3300042010 | Ga0439452_002394 | Ga0439452_002394_4730_5899 | 367 |
| 371 | 3300042013 | Ga0439456_000018 | Ga0439456_000018_45571_46737 | 367 |
| 372 | 3300046452 | Ga0495617_000368 | Ga0495617_000368_16497_17657 | 367 |
| 373 | 3300046452 | Ga0495617_007797 | Ga0495617_007797_2230_3390 | 367 |
| 374 | 3300046457 | Ga0495590_0001991 | Ga0495590_0001991_471_1631 | 367 |
| 375 | 3300046471 | Ga0495650_0043784 | Ga0495650_0043784_386_1546 | 367 |
| 376 | 3300046474 | Ga0495605_0001302 | Ga0495605_0001302_6957_8117 | 367 |
| 377 | 3300046475 | Ga0495639_0000338 | Ga0495639_0000338_12233_13393 | 367 |
| 378 | 3300046491 | Ga0495584_0017434 | Ga0495584_0017434_1077_2237 | 367 |
| 379 | 3300046501 | Ga0495607_0000807 | Ga0495607_0000807_21083_22243 | 367 |
| 380 | 3300046501 | Ga0495607_0019670 | Ga0495607_0019670_2652_3812 | 367 |
| 381 | 3300046501 | Ga0495607_0037772 | Ga0495607_0037772_1656_2816 | 367 |
| 382 | 3300046513 | Ga0495616_0004472 | Ga0495616_0004472_749_1909 | 367 |
| 383 | 3300046513 | Ga0495616_0013091 | Ga0495616_0013091_2421_3581 | 367 |
| 384 | 3300046519 | Ga0495632_0022041 | Ga0495632_0022041_1933_3093 | 367 |
| 385 | 3300046522 | Ga0495643_0023963 | Ga0495643_0023963_1034_2194 | 367 |
| 386 | 3300046523 | Ga0495644_0002956 | Ga0495644_0002956_2387_3547 | 367 |
| 387 | 3300046528 | Ga0495642_0001731 | Ga0495642_0001731_651_1811 | 367 |
| 388 | 3300046530 | Ga0495654_0003039 | Ga0495654_0003039_1914_3074 | 367 |
| 389 | 3300046530 | Ga0495654_0008433 | Ga0495654_0008433_4146_5306 | 367 |
| 390 | 3300046542 | Ga0495597_0041702 | Ga0495597_0041702_104_1264 | 367 |
| 391 | 3300046557 | Ga0495622_0000886 | Ga0495622_0000886_4121_5281 | 367 |
| 392 | 3300046694 | Ga0495649_0004634 | Ga0495649_0004634_329_1489 | 367 |
| 393 | 3300046794 | Ga0495589_0002072 | Ga0495589_0002072_7264_8424 | 367 |
| 394 | 3300047318 | Ga0495636_0002970 | Ga0495636_0002970_1381_2541 | 367 |
| 395 | 3300047320 | Ga0495672_0001146 | Ga0495672_0001146_20145_21305 | 367 |
| 396 | 3300047320 | Ga0495672_0019146 | Ga0495672_0019146_2108_3268 | 367 |
| 397 | 3300047320 | Ga0495672_0020693 | Ga0495672_0020693_2109_3269 | 367 |
| 398 | 3300047323 | Ga0495683_0027200 | Ga0495683_0027200_1575_2735 | 367 |
| 399 | 3300047443 | Ga0495687_006803 | Ga0495687_006803_2273_3433 | 367 |
| 400 | 3300047443 | Ga0495687_013603 | Ga0495687_013603_2992_4152 | 367 |
| 401 | 3300047446 | Ga0495679_001510 | Ga0495679_001510_5755_6921 | 367 |
| 402 | 3300047469 | Ga0495673_0009615 | Ga0495673_0009615_4156_5316 | 367 |
| 403 | 3300048091 | Ga0495626_0010617 | Ga0495626_0010617_3352_4512 | 367 |
| 404 | 3300048915 | Ga0496112_0280583 | Ga0496112_0280583_82_1257 | 367 |
| 405 | 3300048919 | Ga0496116_0000853 | Ga0496116_0000853_26163_27323 | 367 |
| 406 | 3300048919 | Ga0496116_0002114 | Ga0496116_0002114_10963_12123 | 367 |
| 407 | 3300048920 | Ga0496117_0003411 | Ga0496117_0003411_6572_7732 | 367 |
| 408 | 3300048921 | Ga0496118_0035177 | Ga0496118_0035177_1342_2502 | 367 |
| 409 | 3300048924 | Ga0496121_0003680 | Ga0496121_0003680_9576_10736 | 367 |
| 410 | 3300048924 | Ga0496121_0131871 | Ga0496121_0131871_547_1707 | 367 |
| 411 | 3300048925 | Ga0496122_0008052 | Ga0496122_0008052_6770_7930 | 367 |
| 412 | 3300048925 | Ga0496122_0019364 | Ga0496122_0019364_4333_5493 | 367 |
| 413 | 3300048926 | Ga0496123_0006662 | Ga0496123_0006662_349_1509 | 367 |
| 414 | 3300048927 | Ga0496124_0006359 | Ga0496124_0006359_2366_3526 | 367 |
| 415 | 3300049459 | Ga0495678_016376 | Ga0495678_016376_1903_3063 | 367 |
| 416 | iso_pu_bacteria | 2511231024 | 2511376534 | 368 |
| 417 | iso_pu_bacteria | 2599185155 | 2599328232 | 368 |
| 418 | iso_pu_bacteria | 2738543020 | 2739288379 | 368 |
| 419 | iso_pu_bacteria | 2738543021 | 2739293691 | 368 |
| 420 | iso_pu_bacteria | 2765235841 | 2765582013 | 368 |
| 421 | iso_pu_bacteria | 2806310737 | 2807410101 | 368 |
| 422 | iso_pu_bacteria | 2806310745 | 2807458448 | 368 |
| 423 | iso_pu_bacteria | 2826581358 | 2826584042 | 368 |
| 424 | iso_pu_bacteria | 2842815866 | 2842819520 | 368 |
| 425 | iso_pu_bacteria | 2842849001 | 2842849779 | 368 |
| 426 | iso_pu_bacteria | 3007803356 | 3007806979 | 368 |
| 427 | iso_pu_bacteria | 3007872151 | 3007872831 | 368 |
| 428 | iso_pu_bacteria | 8054929484 | 8054933339 | 368 |
| 429 | iso_pu_bacteria | 8056115690 | 8056120493 | 368 |
| 430 | iso_pu_bacteria | 8056120720 | 8056125102 | 368 |
| 431 | iso_pu_bacteria | 8056137416 | 8056142129 | 368 |
| 432 | 3300046491 | Ga0495584_0005797 | Ga0495584_0005797_3565_4725 | 369 |
| 433 | iso_pu_bacteria | 2511231156 | 2511826765 | 369 |
| 434 | iso_pu_bacteria | 2599185188 | 2599502882 | 369 |
| 435 | iso_pu_bacteria | 2599185212 | 2599615090 | 369 |
| 436 | iso_pu_bacteria | 2599185248 | 2599771287 | 369 |
| 437 | iso_pu_bacteria | 2599185289 | 2599885941 | 369 |
| 438 | iso_pu_bacteria | 2599185291 | 2599897655 | 369 |
| 439 | iso_pu_bacteria | 2599185300 | 2599930091 | 369 |
| 440 | iso_pu_bacteria | 2599185302 | 2599945383 | 369 |
| 441 | iso_pu_bacteria | 2599185304 | 2599955655 | 369 |
| 442 | iso_pu_bacteria | 2599185305 | 2599961023 | 369 |
| 443 | iso_pu_bacteria | 2599185306 | 2599969319 | 369 |
| 444 | iso_pu_bacteria | 2599185308 | 2599980660 | 369 |
| 445 | iso_pu_bacteria | 2599185309 | 2599985768 | 369 |
| 446 | iso_pu_bacteria | 2599185310 | 2599990662 | 369 |
| 447 | iso_pu_bacteria | 2599185311 | 2599995980 | 369 |
| 448 | iso_pu_bacteria | 2599185312 | 2600001952 | 369 |
| 449 | iso_pu_bacteria | 2599185313 | 2600005679 | 369 |
| 450 | iso_pu_bacteria | 2599185314 | 2600014476 | 369 |
| 451 | iso_pu_bacteria | 2599185315 | 2600019075 | 369 |
| 452 | iso_pu_bacteria | 2599185316 | 2600025552 | 369 |
| 453 | iso_pu_bacteria | 2599185317 | 2600027832 | 369 |
| 454 | iso_pu_bacteria | 2599185318 | 2600033450 | 369 |
| 455 | iso_pu_bacteria | 2599185319 | 2600040264 | 369 |
| 456 | iso_pu_bacteria | 2599185320 | 2600049367 | 369 |
| 457 | iso_pu_bacteria | 2599185321 | 2600055744 | 369 |
| 458 | iso_pu_bacteria | 2599185322 | 2600061633 | 369 |
| 459 | iso_pu_bacteria | 2599185323 | 2600064252 | 369 |
| 460 | iso_pu_bacteria | 2599185324 | 2600073492 | 369 |
| 461 | iso_pu_bacteria | 2599185325 | 2600077299 | 369 |
| 462 | iso_pu_bacteria | 2600254930 | 2600356999 | 369 |
| 463 | iso_pu_bacteria | 2643221650 | 2644282407 | 369 |
| 464 | iso_pu_bacteria | 2651869719 | 2652547734 | 369 |
| 465 | iso_pu_bacteria | 2667528170 | 2671089750 | 369 |
| 466 | iso_pu_bacteria | 2667528176 | 2671125618 | 369 |
| 467 | iso_pu_bacteria | 2675903515 | 2678265135 | 369 |
| 468 | iso_pu_bacteria | 2744054620 | 2745005591 | 369 |
| 469 | iso_pu_bacteria | 2791355520 | 2794595563 | 369 |
| 470 | iso_pu_bacteria | 2808606361 | 2808855849 | 369 |
| 471 | iso_pu_bacteria | 2808606376 | 2808921943 | 369 |
| 472 | iso_pu_bacteria | 2808606378 | 2808935930 | 369 |
| 473 | iso_pu_bacteria | 2808606380 | 2808944064 | 369 |
| 474 | iso_pu_bacteria | 2808606383 | 2808964278 | 369 |
| 475 | iso_pu_bacteria | 2808606389 | 2808999166 | 369 |
| 476 | iso_pu_bacteria | 2825651385 | 2825655970 | 369 |
| 477 | iso_pu_bacteria | 2842854478 | 2842856373 | 369 |
| 478 | iso_pu_bacteria | 2923586266 | 2923590389 | 369 |
| 479 | iso_pu_bacteria | 2929144301 | 2929149062 | 369 |
| 480 | iso_pu_bacteria | 2931369376 | 2931373516 | 369 |
| 481 | iso_pu_bacteria | 2939651529 | 2939652709 | 369 |
| 482 | iso_pu_bacteria | 2988728565 | 2988730665 | 369 |
| 483 | iso_pu_bacteria | 3007419365 | 3007420583 | 369 |
| 484 | iso_pu_bacteria | 3007866637 | 3007867595 | 369 |
| 485 | iso_pu_bacteria | 8055878733 | 8055879520 | 369 |
| 486 | iso_pu_bacteria | 8056143049 | 8056144327 | 369 |
| 487 | 3300025292 | Ga0209676_1000306 | Ga0209676_100030614 | 370 |
| 488 | iso_pu_bacteria | 2511231011 | 2511293801 | 370 |
| 489 | iso_pu_bacteria | 2554235341 | 2555671967 | 370 |
| 490 | iso_pu_bacteria | 2597489888 | 2597862216 | 370 |
| 491 | iso_pu_bacteria | 2597489889 | 2597867940 | 370 |
| 492 | iso_pu_bacteria | 2599185160 | 2599353869 | 370 |
| 493 | iso_pu_bacteria | 2599185161 | 2599360453 | 370 |
| 494 | iso_pu_bacteria | 2599185162 | 2599366775 | 370 |
| 495 | iso_pu_bacteria | 2599185163 | 2599373564 | 370 |
| 496 | iso_pu_bacteria | 2599185164 | 2599378977 | 370 |
| 497 | iso_pu_bacteria | 2599185165 | 2599386045 | 370 |
| 498 | iso_pu_bacteria | 2599185166 | 2599392423 | 370 |
| 499 | iso_pu_bacteria | 2599185167 | 2599397182 | 370 |
| 500 | iso_pu_bacteria | 2599185168 | 2599404189 | 370 |
| 501 | iso_pu_bacteria | 2599185181 | 2599460703 | 370 |
| 502 | iso_pu_bacteria | 2599185182 | 2599470249 | 370 |
| 503 | iso_pu_bacteria | 2599185186 | 2599489724 | 370 |
| 504 | iso_pu_bacteria | 2599185190 | 2599511081 | 370 |
| 505 | iso_pu_bacteria | 2599185191 | 2599519427 | 370 |
| 506 | iso_pu_bacteria | 2599185288 | 2599879548 | 370 |
| 507 | iso_pu_bacteria | 2599185290 | 2599890455 | 370 |
| 508 | iso_pu_bacteria | 2599185303 | 2599948047 | 370 |
| 509 | iso_pu_bacteria | 2599185356 | 2600213317 | 370 |
| 510 | iso_pu_bacteria | 2600255296 | 2601690811 | 370 |
| 511 | iso_pu_bacteria | 2600255313 | 2601773484 | 370 |
| 512 | iso_pu_bacteria | 2643221571 | 2643869002 | 370 |
| 513 | iso_pu_bacteria | 2643221713 | 2644623899 | 370 |
| 514 | iso_pu_bacteria | 2667528171 | 2671096448 | 370 |
| 515 | iso_pu_bacteria | 2675903420 | 2677897523 | 370 |
| 516 | iso_pu_bacteria | 2721755607 | 2723247109 | 370 |
| 517 | iso_pu_bacteria | 2738541294 | 2738809006 | 370 |
| 518 | iso_pu_bacteria | 2738541309 | 2738896366 | 370 |
| 519 | iso_pu_bacteria | 2773857673 | 2774133509 | 370 |
| 520 | iso_pu_bacteria | 2784132063 | 2784262604 | 370 |
| 521 | iso_pu_bacteria | 2808606385 | 2808975144 | 370 |
| 522 | iso_pu_bacteria | 2808606388 | 2808991217 | 370 |
| 523 | iso_pu_bacteria | 2818991464 | 2819701541 | 370 |
| 524 | iso_pu_bacteria | 2834028612 | 2834028903 | 370 |
| 525 | iso_pu_bacteria | 2842826826 | 2842829996 | 370 |
| 526 | iso_pu_bacteria | 2842837860 | 2842839025 | 370 |
| 527 | iso_pu_bacteria | 2852612431 | 2852615605 | 370 |
| 528 | iso_pu_bacteria | 2852657418 | 2852660627 | 370 |
| 529 | iso_pu_bacteria | 2852667396 | 2852670573 | 370 |
| 530 | iso_pu_bacteria | 2860867994 | 2860868938 | 370 |
| 531 | iso_pu_bacteria | 2908446538 | 2908447686 | 370 |
| 532 | iso_pu_bacteria | 2929189879 | 2929190931 | 370 |
| 533 | iso_pu_bacteria | 2931390751 | 2931391918 | 370 |
| 534 | iso_pu_bacteria | 2935353572 | 2935356825 | 370 |
| 535 | iso_pu_bacteria | 2945928738 | 2945929649 | 370 |
| 536 | iso_pu_bacteria | 2945961074 | 2945965895 | 370 |
| 537 | iso_pu_bacteria | 2946006987 | 2946011934 | 370 |
| 538 | iso_pu_bacteria | 2947233263 | 2947235724 | 370 |
| 539 | iso_pu_bacteria | 3007614139 | 3007615695 | 370 |
| 540 | iso_pu_bacteria | 637000220 | 637322383 | 370 |
| 541 | iso_pu_bacteria | 8019769354 | 8019773623 | 370 |
| 542 | iso_pu_bacteria | 8054347763 | 8054352658 | 370 |
| 543 | iso_pu_bacteria | 8054503363 | 8054504515 | 370 |
| 544 | iso_pu_bacteria | 8055817908 | 8055818946 | 370 |
| 545 | iso_pu_bacteria | 8056131705 | 8056132835 | 370 |
| 546 | iso_pu_bacteria | 8056148874 | 8056149034 | 370 |
| 547 | iso_pu_bacteria | 8056161164 | 8056161305 | 370 |
| 548 | iso_pu_bacteria | 8056569372 | 8056574441 | 370 |
| 549 | iso_pu_bacteria | 8057798959 | 8057804871 | 370 |
| 550 | 3300046520 | Ga0495637_0016377 | Ga0495637_0016377_2093_3253 | 371 |
| 551 | 3300046557 | Ga0495622_0015504 | Ga0495622_0015504_598_1767 | 371 |
| 552 | iso_pu_bacteria | 2511231004 | 2511256902 | 371 |
| 553 | iso_pu_bacteria | 2511231006 | 2511263719 | 371 |
| 554 | iso_pu_bacteria | 2511231007 | 2511272950 | 371 |
| 555 | iso_pu_bacteria | 2511231008 | 2511275932 | 371 |
| 556 | iso_pu_bacteria | 2511231010 | 2511291190 | 371 |
| 557 | iso_pu_bacteria | 2511231012 | 2511300561 | 371 |
| 558 | iso_pu_bacteria | 2511231014 | 2511315535 | 371 |
| 559 | iso_pu_bacteria | 2511231015 | 2511320367 | 371 |
| 560 | iso_pu_bacteria | 2511231016 | 2511323595 | 371 |
| 561 | iso_pu_bacteria | 2511231017 | 2511330753 | 371 |
| 562 | iso_pu_bacteria | 2511231018 | 2511340013 | 371 |
| 563 | iso_pu_bacteria | 2511231019 | 2511342610 | 371 |
| 564 | iso_pu_bacteria | 2511231020 | 2511352485 | 371 |
| 565 | iso_pu_bacteria | 2511231021 | 2511355603 | 371 |
| 566 | iso_pu_bacteria | 2511231022 | 2511363182 | 371 |
| 567 | iso_pu_bacteria | 2511231023 | 2511372677 | 371 |
| 568 | iso_pu_bacteria | 2511231031 | 2511414915 | 371 |
| 569 | iso_pu_bacteria | 2512047018 | 2512324356 | 371 |
| 570 | iso_pu_bacteria | 2582580891 | 2583794462 | 371 |
| 571 | iso_pu_bacteria | 2597489887 | 2597860047 | 371 |
| 572 | iso_pu_bacteria | 2599185185 | 2599482886 | 371 |
| 573 | iso_pu_bacteria | 2599185257 | 2599803410 | 371 |
| 574 | iso_pu_bacteria | 2600255318 | 2601799732 | 371 |
| 575 | iso_pu_bacteria | 2603880185 | 2606074083 | 371 |
| 576 | iso_pu_bacteria | 2603880199 | 2606126272 | 371 |
| 577 | iso_pu_bacteria | 2623620443 | 2624482628 | 371 |
| 578 | iso_pu_bacteria | 2623620446 | 2624490307 | 371 |
| 579 | iso_pu_bacteria | 2643221565 | 2643841980 | 371 |
| 580 | iso_pu_bacteria | 2643221589 | 2643955389 | 371 |
| 581 | iso_pu_bacteria | 2643221602 | 2644023741 | 371 |
| 582 | iso_pu_bacteria | 2643221633 | 2644188288 | 371 |
| 583 | iso_pu_bacteria | 2671180172 | 2671771022 | 371 |
| 584 | iso_pu_bacteria | 2713897148 | 2715752044 | 371 |
| 585 | iso_pu_bacteria | 2718217725 | 2718635839 | 371 |
| 586 | iso_pu_bacteria | 2738543004 | 2739196520 | 371 |
| 587 | iso_pu_bacteria | 2738543015 | 2739257496 | 371 |
| 588 | iso_pu_bacteria | 2738543025 | 2739314506 | 371 |
| 589 | iso_pu_bacteria | 2740892503 | 2743739581 | 371 |
| 590 | iso_pu_bacteria | 2773857670 | 2774122118 | 371 |
| 591 | iso_pu_bacteria | 2784132072 | 2784314363 | 371 |
| 592 | iso_pu_bacteria | 2808606377 | 2808933329 | 371 |
| 593 | iso_pu_bacteria | 2808606381 | 2808955489 | 371 |
| 594 | iso_pu_bacteria | 2808606382 | 2808959709 | 371 |
| 595 | iso_pu_bacteria | 2808606445 | 2809218534 | 371 |
| 596 | iso_pu_bacteria | 2818991456 | 2819654269 | 371 |
| 597 | iso_pu_bacteria | 2842832357 | 2842837483 | 371 |
| 598 | iso_pu_bacteria | 2842843487 | 2842845267 | 371 |
| 599 | iso_pu_bacteria | 2860339153 | 2860344497 | 371 |
| 600 | iso_pu_bacteria | 2878029506 | 2878034558 | 371 |
| 601 | iso_pu_bacteria | 2880230671 | 2880235205 | 371 |
| 602 | iso_pu_bacteria | 2904518522 | 2904521577 | 371 |
| 603 | iso_pu_bacteria | 2904550169 | 2904553013 | 371 |
| 604 | iso_pu_bacteria | 2919063839 | 2919069549 | 371 |
| 605 | iso_pu_bacteria | 2919385768 | 2919388626 | 371 |
| 606 | iso_pu_bacteria | 2919456309 | 2919459610 | 371 |
| 607 | iso_pu_bacteria | 2919487758 | 2919490053 | 371 |
| 608 | iso_pu_bacteria | 2919697872 | 2919703729 | 371 |
| 609 | iso_pu_bacteria | 2931396565 | 2931397267 | 371 |
| 610 | iso_pu_bacteria | 2939636861 | 2939636990 | 371 |
| 611 | iso_pu_bacteria | 2969304461 | 2969309354 | 371 |
| 612 | iso_pu_bacteria | 2974289157 | 2974289287 | 371 |
| 613 | iso_pu_bacteria | 2984286254 | 2984287503 | 371 |
| 614 | iso_pu_bacteria | 2998139840 | 2998144615 | 371 |
| 615 | iso_pu_bacteria | 3007395558 | 3007398297 | 371 |
| 616 | iso_pu_bacteria | 3007511990 | 3007516380 | 371 |
| 617 | iso_pu_bacteria | 3007619802 | 3007622739 | 371 |
| 618 | iso_pu_bacteria | 3007718800 | 3007723657 | 371 |
| 619 | iso_pu_bacteria | 3007855910 | 3007858402 | 371 |
| 620 | iso_pu_bacteria | 3007861166 | 3007866082 | 371 |
| 621 | iso_pu_bacteria | 8015687852 | 8015692753 | 371 |
| 622 | iso_pu_bacteria | 8019775933 | 8019782096 | 371 |
| 623 | iso_pu_bacteria | 8029995093 | 8029996264 | 371 |
| 624 | iso_pu_bacteria | 8055770955 | 8055775987 | 371 |
| 625 | iso_pu_bacteria | 8056125926 | 8056130858 | 371 |
| 626 | iso_pu_bacteria | 8056155041 | 8056155638 | 371 |
| 627 | iso_pu_bacteria | 8056166840 | 8056171941 | 371 |
| 628 | iso_pu_bacteria | 8056172158 | 8056172622 | 371 |
| 629 | iso_pu_bacteria | 8056177738 | 8056179748 | 371 |
| 630 | 3300005290 | Ga0065712_10088845 | Ga0065712_100888451 | 372 |
| 631 | 3300005331 | Ga0070670_100000460 | Ga0070670_1000004605 | 372 |
| 632 | 3300005548 | Ga0070665_100030810 | Ga0070665_1000308102 | 372 |
| 633 | 3300009011 | Ga0105251_10004637 | Ga0105251_100046372 | 372 |
| 634 | 3300025735 | Ga0207713_1000244 | Ga0207713_100024418 | 372 |
| 635 | 3300025925 | Ga0207650_10000183 | Ga0207650_100001836 | 372 |
| 636 | 3300031731 | Ga0307405_10000606 | Ga0307405_100006062 | 372 |
| 637 | 3300041407 | Ga0439447_012908 | Ga0439447_012908_264_1424 | 372 |
| 638 | 3300042010 | Ga0439452_000554 | Ga0439452_000554_9431_10591 | 372 |
| 639 | 3300042115 | Ga0450911_000500 | Ga0450911_000500_9199_10359 | 372 |
| 640 | 3300042145 | Ga0450906_001361 | Ga0450906_001361_152_1312 | 372 |
| 641 | 3300014497 | Ga0182008_10097362 | Ga0182008_100973621 | 373 |
| 642 | 3300003751 | Ga0055538_1000036 | Ga0055538_100003613 | 374 |
| 643 | 3300003752 | Ga0055539_1000047 | Ga0055539_100004713 | 374 |
| 644 | 3300003756 | Ga0055533_1000058 | Ga0055533_100005813 | 374 |
| 645 | 3300003758 | Ga0055532_1000234 | Ga0055532_100023423 | 374 |
| 646 | 3300003759 | Ga0055525_1000113 | Ga0055525_100011313 | 374 |
| 647 | 3300003761 | Ga0055535_1007641 | Ga0055535_10076411 | 374 |
| 648 | 3300003841 | Ga0055541_1000034 | Ga0055541_1000034164 | 374 |
| 649 | 3300005288 | Ga0065714_10065847 | Ga0065714_100658472 | 374 |
| 650 | 3300005289 | Ga0065704_10008374 | Ga0065704_100083742 | 374 |
| 651 | 3300005331 | Ga0070670_100002191 | Ga0070670_10000219118 | 374 |
| 652 | 3300005344 | Ga0070661_100001513 | Ga0070661_1000015137 | 374 |
| 653 | 3300005353 | Ga0070669_100000570 | Ga0070669_1000005708 | 374 |
| 654 | 3300005457 | Ga0070662_100000950 | Ga0070662_1000009508 | 374 |
| 655 | 3300005457 | Ga0070662_100086801 | Ga0070662_1000868012 | 374 |
| 656 | 3300005539 | Ga0068853_100001285 | Ga0068853_10000128517 | 374 |
| 657 | 3300005564 | Ga0070664_100002049 | Ga0070664_1000020497 | 374 |
| 658 | 3300005578 | Ga0068854_100042072 | Ga0068854_1000420723 | 374 |
| 659 | 3300005834 | Ga0068851_10000006 | Ga0068851_10000006211 | 374 |
| 660 | 3300009011 | Ga0105251_10000702 | Ga0105251_100007027 | 374 |
| 661 | 3300009011 | Ga0105251_10003989 | Ga0105251_100039898 | 374 |
| 662 | 3300009036 | Ga0105244_10001491 | Ga0105244_100014919 | 374 |
| 663 | 3300009036 | Ga0105244_10003141 | Ga0105244_100031415 | 374 |
| 664 | 3300009036 | Ga0105244_10011887 | Ga0105244_100118871 | 374 |
| 665 | 3300009092 | Ga0105250_10000216 | Ga0105250_100002167 | 374 |
| 666 | 3300009092 | Ga0105250_10003850 | Ga0105250_100038505 | 374 |
| 667 | 3300009092 | Ga0105250_10008147 | Ga0105250_100081474 | 374 |
| 668 | 3300009176 | Ga0105242_10003570 | Ga0105242_100035708 | 374 |
| 669 | 3300009545 | Ga0105237_10001380 | Ga0105237_100013804 | 374 |
| 670 | 3300011119 | Ga0105246_10000391 | Ga0105246_100003917 | 374 |
| 671 | 3300013100 | Ga0157373_10003948 | Ga0157373_100039483 | 374 |
| 672 | 3300013100 | Ga0157373_10009036 | Ga0157373_100090362 | 374 |
| 673 | 3300013100 | Ga0157373_10021586 | Ga0157373_100215863 | 374 |
| 674 | 3300013100 | Ga0157373_10022523 | Ga0157373_100225232 | 374 |
| 675 | 3300013100 | Ga0157373_10026009 | Ga0157373_100260092 | 374 |
| 676 | 3300013100 | Ga0157373_10130859 | Ga0157373_101308591 | 374 |
| 677 | 3300013105 | Ga0157369_10003869 | Ga0157369_1000386913 | 374 |
| 678 | 3300013105 | Ga0157369_10008334 | Ga0157369_100083348 | 374 |
| 679 | 3300013105 | Ga0157369_10010281 | Ga0157369_100102818 | 374 |
| 680 | 3300013307 | Ga0157372_10008635 | Ga0157372_100086358 | 374 |
| 681 | 3300013308 | Ga0157375_10001660 | Ga0157375_1000166010 | 374 |
| 682 | 3300013308 | Ga0157375_10015584 | Ga0157375_100155847 | 374 |
| 683 | 3300013308 | Ga0157375_10250014 | Ga0157375_102500142 | 374 |
| 684 | 3300014497 | Ga0182008_10004237 | Ga0182008_100042372 | 374 |
| 685 | 3300015261 | Ga0182006_1000460 | Ga0182006_10004609 | 374 |
| 686 | 3300015262 | Ga0182007_10006306 | Ga0182007_100063066 | 374 |
| 687 | 3300017792 | Ga0163161_10009143 | Ga0163161_100091432 | 374 |
| 688 | 3300017792 | Ga0163161_10024982 | Ga0163161_100249826 | 374 |
| 689 | 3300017792 | Ga0163161_10177202 | Ga0163161_101772022 | 374 |
| 690 | 3300025224 | Ga0209784_100050 | Ga0209784_10005014 | 374 |
| 691 | 3300025225 | Ga0209566_100063 | Ga0209566_10006314 | 374 |
| 692 | 3300025226 | Ga0209674_100084 | Ga0209674_10008414 | 374 |
| 693 | 3300025229 | Ga0209147_100083 | Ga0209147_10008314 | 374 |
| 694 | 3300025230 | Ga0209563_100084 | Ga0209563_10008414 | 374 |
| 695 | 3300025242 | Ga0209258_100113 | Ga0209258_10011314 | 374 |
| 696 | 3300025246 | Ga0209646_1000463 | Ga0209646_100046314 | 374 |
| 697 | 3300025253 | Ga0209677_100047 | Ga0209677_10004714 | 374 |
| 698 | 3300025256 | Ga0209759_1013387 | Ga0209759_10133873 | 374 |
| 699 | 3300025321 | Ga0207656_10000023 | Ga0207656_1000002313 | 374 |
| 700 | 3300025711 | Ga0207696_1000210 | Ga0207696_100021022 | 374 |
| 701 | 3300025711 | Ga0207696_1000314 | Ga0207696_10003148 | 374 |
| 702 | 3300025728 | Ga0207655_1000311 | Ga0207655_100031159 | 374 |
| 703 | 3300025728 | Ga0207655_1002514 | Ga0207655_10025145 | 374 |
| 704 | 3300025728 | Ga0207655_1007805 | Ga0207655_10078054 | 374 |
| 705 | 3300025735 | Ga0207713_1000728 | Ga0207713_100072822 | 374 |
| 706 | 3300025914 | Ga0207671_10001052 | Ga0207671_100010524 | 374 |
| 707 | 3300025920 | Ga0207649_10000004 | Ga0207649_10000004122 | 374 |
| 708 | 3300025923 | Ga0207681_10000474 | Ga0207681_1000047413 | 374 |
| 709 | 3300025925 | Ga0207650_10000393 | Ga0207650_1000039329 | 374 |
| 710 | 3300025933 | Ga0207706_10002563 | Ga0207706_100025638 | 374 |
| 711 | 3300025933 | Ga0207706_10044926 | Ga0207706_100449261 | 374 |
| 712 | 3300025934 | Ga0207686_10002963 | Ga0207686_100029637 | 374 |
| 713 | 3300025945 | Ga0207679_10000043 | Ga0207679_10000043115 | 374 |
| 714 | 3300026041 | Ga0207639_10001525 | Ga0207639_100015254 | 374 |
| 715 | 3300042006 | Ga0439432_000157 | Ga0439432_000157_13587_14753 | 374 |
| 716 | 3300046460 | Ga0495638_0004890 | Ga0495638_0004890_1583_2743 | 374 |
| 717 | 3300046501 | Ga0495607_0011228 | Ga0495607_0011228_4025_5191 | 374 |
| 718 | 3300046507 | Ga0495606_0005024 | Ga0495606_0005024_11613_12779 | 374 |
| 719 | 3300046519 | Ga0495632_0006735 | Ga0495632_0006735_6163_7329 | 374 |
| 720 | 3300046530 | Ga0495654_0011390 | Ga0495654_0011390_1300_2469 | 374 |
| 721 | 3300046665 | Ga0495661_0002477 | Ga0495661_0002477_81_1247 | 374 |
| 722 | 3300046665 | Ga0495661_0006019 | Ga0495661_0006019_4927_6093 | 374 |
| 723 | 3300047321 | Ga0495676_0123928 | Ga0495676_0123928_349_1506 | 374 |
| 724 | 3300048920 | Ga0496117_0001350 | Ga0496117_0001350_23088_24254 | 374 |
| 725 | 3300048922 | Ga0496119_0029321 | Ga0496119_0029321_197_1363 | 374 |
| 726 | 3300048922 | Ga0496119_0131159 | Ga0496119_0131159_64_1221 | 374 |
| 727 | 3300048923 | Ga0496120_0008617 | Ga0496120_0008617_126_1292 | 374 |
| 728 | 3300048926 | Ga0496123_0079060 | Ga0496123_0079060_677_1834 | 374 |
| 729 | 3300048927 | Ga0496124_0005300 | Ga0496124_0005300_12953_14119 | 374 |
| 730 | 3300048928 | Ga0496125_0006089 | Ga0496125_0006089_281_1447 | 374 |
| 731 | 3300048929 | Ga0496126_0155753 | Ga0496126_0155753_20_1186 | 374 |
| 732 | 3300053161 | Ga0500634_0004112 | Ga0500634_0004112_821_1987 | 374 |
| 733 | iso_pu_bacteria | 2599185179 | 2599449177 | 374 |
| 734 | iso_pu_bacteria | 8054285046 | 8054290129 | 374 |
| 735 | 2124908027 | MRS2a_Contig_63 | MRS2a_00493970 | 375 |
| 736 | 3300003781 | Ga0055536_1000920 | Ga0055536_10009209 | 375 |
| 737 | 3300003781 | Ga0055536_1001795 | Ga0055536_10017951 | 375 |
| 738 | 3300003791 | Ga0055530_10002576 | Ga0055530_100025768 | 375 |
| 739 | 3300003792 | Ga0055540_1000824 | Ga0055540_100082416 | 375 |
| 740 | 3300003794 | Ga0055531_10000348 | Ga0055531_1000034841 | 375 |
| 741 | 3300005288 | Ga0065714_10000844 | Ga0065714_100008441 | 375 |
| 742 | 3300005288 | Ga0065714_10012453 | Ga0065714_100124532 | 375 |
| 743 | 3300005288 | Ga0065714_10013075 | Ga0065714_100130752 | 375 |
| 744 | 3300005288 | Ga0065714_10022700 | Ga0065714_100227001 | 375 |
| 745 | 3300005288 | Ga0065714_10075530 | Ga0065714_100755301 | 375 |
| 746 | 3300005290 | Ga0065712_10000524 | Ga0065712_100005247 | 375 |
| 747 | 3300005293 | Ga0065715_10006155 | Ga0065715_100061551 | 375 |
| 748 | 3300006058 | Ga0075432_10050357 | Ga0075432_100503571 | 375 |
| 749 | 3300009036 | Ga0105244_10030982 | Ga0105244_100309822 | 375 |
| 750 | 3300009036 | Ga0105244_10078168 | Ga0105244_100781682 | 375 |
| 751 | 3300009092 | Ga0105250_10033451 | Ga0105250_100334512 | 375 |
| 752 | 3300009092 | Ga0105250_10070599 | Ga0105250_100705991 | 375 |
| 753 | 3300009092 | Ga0105250_10085461 | Ga0105250_100854611 | 375 |
| 754 | 3300009148 | Ga0105243_10001439 | Ga0105243_1000143916 | 375 |
| 755 | 3300009176 | Ga0105242_10176737 | Ga0105242_101767372 | 375 |
| 756 | 3300011119 | Ga0105246_10009116 | Ga0105246_100091167 | 375 |
| 757 | 3300011119 | Ga0105246_10074401 | Ga0105246_100744012 | 375 |
| 758 | 3300012498 | Ga0157345_1000168 | Ga0157345_10001682 | 375 |
| 759 | 3300013100 | Ga0157373_10029445 | Ga0157373_100294454 | 375 |
| 760 | 3300013102 | Ga0157371_10006382 | Ga0157371_100063822 | 375 |
| 761 | 3300013102 | Ga0157371_10156117 | Ga0157371_101561172 | 375 |
| 762 | 3300013104 | Ga0157370_10013518 | Ga0157370_100135182 | 375 |
| 763 | 3300013105 | Ga0157369_10009828 | Ga0157369_100098281 | 375 |
| 764 | 3300013105 | Ga0157369_10197670 | Ga0157369_101976701 | 375 |
| 765 | 3300013306 | Ga0163162_10017157 | Ga0163162_100171575 | 375 |
| 766 | 3300013306 | Ga0163162_10103441 | Ga0163162_101034412 | 375 |
| 767 | 3300015261 | Ga0182006_1001369 | Ga0182006_10013698 | 375 |
| 768 | 3300015261 | Ga0182006_1018001 | Ga0182006_10180012 | 375 |
| 769 | 3300017792 | Ga0163161_10007473 | Ga0163161_100074735 | 375 |
| 770 | 3300017792 | Ga0163161_10008880 | Ga0163161_100088801 | 375 |
| 771 | 3300017792 | Ga0163161_10183063 | Ga0163161_101830631 | 375 |
| 772 | 3300025230 | Ga0209563_100384 | Ga0209563_10038412 | 375 |
| 773 | 3300025291 | Ga0209675_1010730 | Ga0209675_10107301 | 375 |
| 774 | 3300025292 | Ga0209676_1000010 | Ga0209676_1000010774 | 375 |
| 775 | 3300025292 | Ga0209676_1000541 | Ga0209676_100054135 | 375 |
| 776 | 3300025298 | Ga0209050_1000019 | Ga0209050_100001989 | 375 |
| 777 | 3300025303 | Ga0209051_1000800 | Ga0209051_100080016 | 375 |
| 778 | 3300025304 | Ga0209257_1000119 | Ga0209257_1000119179 | 375 |
| 779 | 3300025711 | Ga0207696_1002258 | Ga0207696_100225810 | 375 |
| 780 | 3300025711 | Ga0207696_1017983 | Ga0207696_10179832 | 375 |
| 781 | 3300025728 | Ga0207655_1001102 | Ga0207655_100110213 | 375 |
| 782 | 3300025728 | Ga0207655_1002625 | Ga0207655_10026258 | 375 |
| 783 | 3300025728 | Ga0207655_1016339 | Ga0207655_10163394 | 375 |
| 784 | 3300025735 | Ga0207713_1002068 | Ga0207713_10020687 | 375 |
| 785 | 3300025735 | Ga0207713_1049118 | Ga0207713_10491182 | 375 |
| 786 | 3300025735 | Ga0207713_1049554 | Ga0207713_10495541 | 375 |
| 787 | 3300025923 | Ga0207681_10001097 | Ga0207681_100010978 | 375 |
| 788 | 3300025935 | Ga0207709_10000224 | Ga0207709_1000022445 | 375 |
| 789 | 3300027111 | Ga0209281_1004383 | Ga0209281_10043832 | 375 |
| 790 | 3300027111 | Ga0209281_1010894 | Ga0209281_10108942 | 375 |
| 791 | 3300027907 | Ga0207428_10123269 | Ga0207428_101232692 | 375 |
| 792 | 3300030734 | Ga0316179_1033450 | Ga0316179_10334501 | 375 |
| 793 | 3300030735 | Ga0316178_1159376 | Ga0316178_11593764 | 375 |
| 794 | 3300031911 | Ga0307412_10146500 | Ga0307412_101465001 | 375 |
| 795 | 3300032002 | Ga0307416_100076510 | Ga0307416_1000765103 | 375 |
| 796 | 3300032005 | Ga0307411_10159191 | Ga0307411_101591911 | 375 |
| 797 | 3300033180 | Ga0307510_10007242 | Ga0307510_100072428 | 375 |
| 798 | 3300038705 | Ga0237819_00235 | Ga0237819_00235_11431_12591 | 375 |
| 799 | 3300041405 | Ga0439438_000458 | Ga0439438_000458_11817_12977 | 375 |
| 800 | 3300041405 | Ga0439438_001721 | Ga0439438_001721_816_1976 | 375 |
| 801 | 3300041405 | Ga0439438_002770 | Ga0439438_002770_4156_5316 | 375 |
| 802 | 3300041405 | Ga0439438_017844 | Ga0439438_017844_39_1199 | 375 |
| 803 | 3300041407 | Ga0439447_002188 | Ga0439447_002188_5196_6356 | 375 |
| 804 | 3300041407 | Ga0439447_004618 | Ga0439447_004618_751_1911 | 375 |
| 805 | 3300042006 | Ga0439432_025391 | Ga0439432_025391_269_1429 | 375 |
| 806 | 3300042009 | Ga0439451_003860 | Ga0439451_003860_1795_2955 | 375 |
| 807 | 3300042009 | Ga0439451_006249 | Ga0439451_006249_306_1466 | 375 |
| 808 | 3300042010 | Ga0439452_000450 | Ga0439452_000450_14255_15415 | 375 |
| 809 | 3300042013 | Ga0439456_009072 | Ga0439456_009072_210_1370 | 375 |
| 810 | 3300042122 | Ga0450920_000365 | Ga0450920_000365_3481_4641 | 375 |
| 811 | 3300042124 | Ga0450922_001018 | Ga0450922_001018_1336_2496 | 375 |
| 812 | 3300042136 | Ga0450900_000110 | Ga0450900_000110_783_1943 | 375 |
| 813 | 3300042137 | Ga0450902_002840 | Ga0450902_002840_1276_2436 | 375 |
| 814 | 3300042139 | Ga0450904_000764 | Ga0450904_000764_4254_5414 | 375 |
| 815 | 3300042145 | Ga0450906_003145 | Ga0450906_003145_1114_2274 | 375 |
| 816 | 3300042146 | Ga0450907_000153 | Ga0450907_000153_17343_18503 | 375 |
| 817 | 3300042146 | Ga0450907_005901 | Ga0450907_005901_69_1229 | 375 |
| 818 | 3300042184 | Ga0450908_007144 | Ga0450908_007144_833_1993 | 375 |
| 819 | 3300042435 | Ga0439434_0001096 | Ga0439434_0001096_2059_3219 | 375 |
| 820 | 3300046453 | Ga0495627_024437 | Ga0495627_024437_218_1378 | 375 |
| 821 | 3300046453 | Ga0495627_024787 | Ga0495627_024787_265_1425 | 375 |
| 822 | 3300046455 | Ga0495603_0023331 | Ga0495603_0023331_2486_3646 | 375 |
| 823 | 3300046458 | Ga0495591_004507 | Ga0495591_004507_1422_2582 | 375 |
| 824 | 3300046460 | Ga0495638_0003108 | Ga0495638_0003108_2384_3544 | 375 |
| 825 | 3300046463 | Ga0495653_0006511 | Ga0495653_0006511_2711_3871 | 375 |
| 826 | 3300046471 | Ga0495650_0040248 | Ga0495650_0040248_745_1905 | 375 |
| 827 | 3300046471 | Ga0495650_0043657 | Ga0495650_0043657_442_1602 | 375 |
| 828 | 3300046473 | Ga0495582_0017973 | Ga0495582_0017973_2691_3851 | 375 |
| 829 | 3300046474 | Ga0495605_0022897 | Ga0495605_0022897_1889_3049 | 375 |
| 830 | 3300046491 | Ga0495584_0053357 | Ga0495584_0053357_391_1551 | 375 |
| 831 | 3300046492 | Ga0495585_0004196 | Ga0495585_0004196_7773_8933 | 375 |
| 832 | 3300046492 | Ga0495585_0017751 | Ga0495585_0017751_2009_3169 | 375 |
| 833 | 3300046492 | Ga0495585_0044256 | Ga0495585_0044256_302_1462 | 375 |
| 834 | 3300046501 | Ga0495607_0002741 | Ga0495607_0002741_3167_4327 | 375 |
| 835 | 3300046501 | Ga0495607_0078543 | Ga0495607_0078543_98_1258 | 375 |
| 836 | 3300046507 | Ga0495606_0015552 | Ga0495606_0015552_2371_3531 | 375 |
| 837 | 3300046507 | Ga0495606_0019081 | Ga0495606_0019081_2288_3448 | 375 |
| 838 | 3300046507 | Ga0495606_0019825 | Ga0495606_0019825_1237_2397 | 375 |
| 839 | 3300046507 | Ga0495606_0082622 | Ga0495606_0082622_265_1425 | 375 |
| 840 | 3300046512 | Ga0495610_0018448 | Ga0495610_0018448_2394_3554 | 375 |
| 841 | 3300046512 | Ga0495610_0029274 | Ga0495610_0029274_106_1266 | 375 |
| 842 | 3300046512 | Ga0495610_0050563 | Ga0495610_0050563_750_1910 | 375 |
| 843 | 3300046513 | Ga0495616_0005088 | Ga0495616_0005088_862_2022 | 375 |
| 844 | 3300046513 | Ga0495616_0032435 | Ga0495616_0032435_1287_2447 | 375 |
| 845 | 3300046513 | Ga0495616_0052375 | Ga0495616_0052375_599_1759 | 375 |
| 846 | 3300046515 | Ga0495620_0013908 | Ga0495620_0013908_2024_3184 | 375 |
| 847 | 3300046518 | Ga0495631_0001079 | Ga0495631_0001079_7701_8861 | 375 |
| 848 | 3300046518 | Ga0495631_0043545 | Ga0495631_0043545_302_1462 | 375 |
| 849 | 3300046518 | Ga0495631_0044133 | Ga0495631_0044133_569_1729 | 375 |
| 850 | 3300046519 | Ga0495632_0011832 | Ga0495632_0011832_3613_4773 | 375 |
| 851 | 3300046519 | Ga0495632_0013263 | Ga0495632_0013263_3330_4490 | 375 |
| 852 | 3300046519 | Ga0495632_0015231 | Ga0495632_0015231_2352_3512 | 375 |
| 853 | 3300046520 | Ga0495637_0004137 | Ga0495637_0004137_3209_4369 | 375 |
| 854 | 3300046520 | Ga0495637_0010811 | Ga0495637_0010811_2629_3789 | 375 |
| 855 | 3300046520 | Ga0495637_0043908 | Ga0495637_0043908_428_1588 | 375 |
| 856 | 3300046520 | Ga0495637_0045890 | Ga0495637_0045890_389_1549 | 375 |
| 857 | 3300046522 | Ga0495643_0013408 | Ga0495643_0013408_2181_3341 | 375 |
| 858 | 3300046523 | Ga0495644_0022305 | Ga0495644_0022305_48_1208 | 375 |
| 859 | 3300046524 | Ga0495648_0013764 | Ga0495648_0013764_483_1643 | 375 |
| 860 | 3300046524 | Ga0495648_0061183 | Ga0495648_0061183_698_1858 | 375 |
| 861 | 3300046524 | Ga0495648_0091032 | Ga0495648_0091032_27_1187 | 375 |
| 862 | 3300046524 | Ga0495648_0118945 | Ga0495648_0118945_225_1385 | 375 |
| 863 | 3300046526 | Ga0495666_0002545 | Ga0495666_0002545_2692_3852 | 375 |
| 864 | 3300046528 | Ga0495642_0002058 | Ga0495642_0002058_2213_3373 | 375 |
| 865 | 3300046530 | Ga0495654_0010961 | Ga0495654_0010961_3065_4225 | 375 |
| 866 | 3300046530 | Ga0495654_0083936 | Ga0495654_0083936_127_1287 | 375 |
| 867 | 3300046530 | Ga0495654_0085016 | Ga0495654_0085016_79_1239 | 375 |
| 868 | 3300046536 | Ga0495587_0018365 | Ga0495587_0018365_461_1621 | 375 |
| 869 | 3300046538 | Ga0495609_0048549 | Ga0495609_0048549_411_1571 | 375 |
| 870 | 3300046542 | Ga0495597_0034665 | Ga0495597_0034665_445_1605 | 375 |
| 871 | 3300046557 | Ga0495622_0000881 | Ga0495622_0000881_9091_10251 | 375 |
| 872 | 3300046557 | Ga0495622_0037999 | Ga0495622_0037999_539_1699 | 375 |
| 873 | 3300046558 | Ga0495633_0013001 | Ga0495633_0013001_2844_4004 | 375 |
| 874 | 3300046558 | Ga0495633_0050371 | Ga0495633_0050371_577_1737 | 375 |
| 875 | 3300046615 | Ga0495656_0002588 | Ga0495656_0002588_207_1367 | 375 |
| 876 | 3300046616 | Ga0495668_0006319 | Ga0495668_0006319_6197_7357 | 375 |
| 877 | 3300046648 | Ga0495611_0000552 | Ga0495611_0000552_11439_12599 | 375 |
| 878 | 3300046660 | Ga0495625_0005658 | Ga0495625_0005658_2093_3253 | 375 |
| 879 | 3300046660 | Ga0495625_0056209 | Ga0495625_0056209_318_1478 | 375 |
| 880 | 3300046660 | Ga0495625_0091661 | Ga0495625_0091661_196_1356 | 375 |
| 881 | 3300046664 | Ga0495659_0007381 | Ga0495659_0007381_2245_3405 | 375 |
| 882 | 3300046665 | Ga0495661_0008982 | Ga0495661_0008982_1216_2376 | 375 |
| 883 | 3300046674 | Ga0495588_0006165 | Ga0495588_0006165_2449_3609 | 375 |
| 884 | 3300046684 | Ga0495669_0001163 | Ga0495669_0001163_302_1462 | 375 |
| 885 | 3300046690 | Ga0495624_0039210 | Ga0495624_0039210_564_1724 | 375 |
| 886 | 3300046691 | Ga0495670_0004255 | Ga0495670_0004255_185_1345 | 375 |
| 887 | 3300046692 | Ga0495671_0012398 | Ga0495671_0012398_3008_4168 | 375 |
| 888 | 3300046694 | Ga0495649_0068790 | Ga0495649_0068790_475_1635 | 375 |
| 889 | 3300046794 | Ga0495589_0010374 | Ga0495589_0010374_1708_2868 | 375 |
| 890 | 3300046794 | Ga0495589_0057734 | Ga0495589_0057734_302_1462 | 375 |
| 891 | 3300046810 | Ga0495660_0029684 | Ga0495660_0029684_228_1388 | 375 |
| 892 | 3300046810 | Ga0495660_0063174 | Ga0495660_0063174_621_1781 | 375 |
| 893 | 3300046810 | Ga0495660_0068778 | Ga0495660_0068778_445_1605 | 375 |
| 894 | 3300047320 | Ga0495672_0022225 | Ga0495672_0022225_1180_2340 | 375 |
| 895 | 3300047320 | Ga0495672_0049027 | Ga0495672_0049027_64_1224 | 375 |
| 896 | 3300047322 | Ga0495680_0006252 | Ga0495680_0006252_7172_8332 | 375 |
| 897 | 3300047323 | Ga0495683_0001305 | Ga0495683_0001305_8070_9230 | 375 |
| 898 | 3300047323 | Ga0495683_0003033 | Ga0495683_0003033_7476_8636 | 375 |
| 899 | 3300047444 | Ga0495675_0005561 | Ga0495675_0005561_603_1763 | 375 |
| 900 | 3300047445 | Ga0495677_0031595 | Ga0495677_0031595_339_1499 | 375 |
| 901 | 3300047469 | Ga0495673_0002216 | Ga0495673_0002216_7540_8700 | 375 |
| 902 | 3300047469 | Ga0495673_0004159 | Ga0495673_0004159_6049_7209 | 375 |
| 903 | 3300047469 | Ga0495673_0013304 | Ga0495673_0013304_2970_4130 | 375 |
| 904 | 3300047469 | Ga0495673_0026465 | Ga0495673_0026465_44_1204 | 375 |
| 905 | 3300047469 | Ga0495673_0071113 | Ga0495673_0071113_39_1199 | 375 |
| 906 | 3300047470 | Ga0495681_0000894 | Ga0495681_0000894_12350_13510 | 375 |
| 907 | 3300047470 | Ga0495681_0003240 | Ga0495681_0003240_9762_10922 | 375 |
| 908 | 3300047470 | Ga0495681_0008887 | Ga0495681_0008887_119_1279 | 375 |
| 909 | 3300047470 | Ga0495681_0015723 | Ga0495681_0015723_2288_3448 | 375 |
| 910 | 3300047470 | Ga0495681_0081583 | Ga0495681_0081583_39_1199 | 375 |
| 911 | 3300047472 | Ga0495686_0110101 | Ga0495686_0110101_369_1529 | 375 |
| 912 | 3300048091 | Ga0495626_0013501 | Ga0495626_0013501_2397_3557 | 375 |
| 913 | 3300048091 | Ga0495626_0047244 | Ga0495626_0047244_237_1397 | 375 |
| 914 | 3300048913 | Ga0496110_0154226 | Ga0496110_0154226_299_1459 | 375 |
| 915 | 3300048914 | Ga0496111_0057676 | Ga0496111_0057676_383_1543 | 375 |
| 916 | 3300048919 | Ga0496116_0025164 | Ga0496116_0025164_2720_3880 | 375 |
| 917 | 3300048924 | Ga0496121_0035510 | Ga0496121_0035510_216_1376 | 375 |
| 918 | 3300048927 | Ga0496124_0150998 | Ga0496124_0150998_322_1482 | 375 |
| 919 | 3300048928 | Ga0496125_0080128 | Ga0496125_0080128_1275_2435 | 375 |
| 920 | 3300049459 | Ga0495678_028893 | Ga0495678_028893_369_1529 | 375 |
| 921 | 3300049459 | Ga0495678_048774 | Ga0495678_048774_326_1486 | 375 |
| 922 | 3300049460 | Ga0495682_0024110 | Ga0495682_0024110_345_1505 | 375 |
| 923 | 3300049460 | Ga0495682_0027673 | Ga0495682_0027673_570_1730 | 375 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qsh-assembly1.cif.gz_B | crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp | 0.8673 | 68 | 198 |
| 4qsh-assembly1.cif.gz_D | crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp | 0.8671 | 68 | 198 |
| 5gua-assembly1.cif.gz_A | structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant | 0.8501 | 65 | 196 |
| 2d5d-assembly1.cif.gz_A | structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii | 0.8463 | 68 | 196 |
| 5u0p-assembly1.cif.gz_V | cryo-em structure of the transcriptional mediator | 0.8325 | 100 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vf7H02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.936 | 65 | 198 | 2.40.50.100 |
| 1vf7H02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9236 | 65 | 198 | 2.40.50.100 |
| 4l8jA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9232 | 65 | 198 | 2.40.50.100 |
| 4kkuA01 | Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; | 0.9057 | 295 | 362 | 2.40.420.20 |
| 4tkoB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8909 | 65 | 196 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6F8NVC2-F1-model_v4 | deleted | 0.9267 | 294 | 363 |
|
| AF-A0A1G0M0X9-F1-model_v4 | Efflux transporter periplasmic adaptor subunit | 0.8404 | 30 | 365 |
GO:0015562
GO:0030313 GO:1990281 |
| AF-A0A1G1MZR1-F1-model_v4 | RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein | 0.832 | 247 | 364 |
GO:0015562
GO:1990281 |
| AF-A0A6J5A5W7-F1-model_v4 | Multidrug resistance protein MdtA | 0.8265 | 39 | 363 |
GO:0015562
GO:1990281 |
| AF-A0A533IIS9-F1-model_v4 | deleted | 0.819 | 200 | 367 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar