F485841

General Info

Members Datasets Scaffolds Average Seq Length
923 346 923 163

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000926|Ga0500616_0000926_17832_18392
Length 186
Sequence LNTGITKFHERTMPITFTVNGKSATVDVPADMPLLWVLRDVLDLKGTKFGCGIAQCGACTVHVKGVPMRSCQIPASSAAGLAITTIEGLSPDGTHPLQVAWQDIDVPQCGYCQAGQIMSAAALLAKTPKPTDADIDEAMTGNICRCATYTRIKAAIHKAAGTTVTDSAPAGAGAKPVARRASKSGQ

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
215 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
216 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
217 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
220 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
221 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
243 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
244 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
245 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
246 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
247 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
248 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
342 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0
Rhizoplane 1.08
Rhizosphere 94.04
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10004911 3300003203 Bacteria 6210
2 Ga0058861_12020206 3300004800 Bacteria 2877
3 Ga0058862_12814246 3300004803 Bacteria 2669
4 Ga0065704_10096643 3300005289 Bacteria 2431
5 Ga0065715_10155647 3300005293 Bacteria 1680
6 Ga0065715_10297279 3300005293 Bacteria 1049
7 Ga0065707_10093046 3300005295 Bacteria 3672
8 Ga0065707_10238888 3300005295 Bacteria 1162
9 Ga0065707_10334780 3300005295 Bacteria 943
10 Ga0070658_10029087 3300005327 Bacteria 4438
11 Ga0070658_10751912 3300005327 Bacteria 846
12 Ga0070676_10004034 3300005328 Bacteria 7710
13 Ga0070676_10212131 3300005328 Bacteria 1275
14 Ga0070683_100006225 3300005329 Bacteria 10009
15 Ga0070683_100175248 3300005329 Bacteria 2036
16 Ga0070683_100198594 3300005329 Bacteria 1905
17 Ga0070690_100045101 3300005330 Bacteria 2799
18 Ga0070690_100050734 3300005330 Bacteria 2647
19 Ga0070670_100017119 3300005331 Bacteria 6219
20 Ga0070670_100038600 3300005331 Bacteria 4107
21 Ga0070677_10153175 3300005333 Bacteria 1075
22 Ga0068869_100003439 3300005334 Bacteria 9682
23 Ga0068869_100223111 3300005334 Bacteria 1494
24 Ga0068869_100775819 3300005334 Bacteria 822
25 Ga0068869_100800793 3300005334 Bacteria 810
26 Ga0070666_10132177 3300005335 Bacteria 1735
27 Ga0070666_10228771 3300005335 Bacteria 1313
28 Ga0070666_10454828 3300005335 Bacteria 925
29 Ga0070680_100002196 3300005336 Bacteria 14389
30 Ga0070680_100007201 3300005336 Bacteria 8479
31 Ga0070680_100111613 3300005336 Bacteria 2276
32 Ga0068868_100060025 3300005338 Bacteria 3009
33 Ga0070660_100105928 3300005339 Bacteria 2232
34 Ga0070689_100001466 3300005340 Bacteria 15055
35 Ga0070689_100012437 3300005340 Bacteria 6132
36 Ga0070689_100104338 3300005340 Bacteria 2247
37 Ga0070689_100106941 3300005340 Bacteria 2220
38 Ga0070689_100408684 3300005340 Bacteria 1149
39 Ga0070687_100009121 3300005343 Bacteria 4237
40 Ga0070687_100019645 3300005343 Bacteria 3147
41 Ga0070687_100028627 3300005343 Bacteria 2704
42 Ga0070687_100216610 3300005343 Bacteria 1170
43 Ga0070661_100039948 3300005344 Bacteria 3420
44 Ga0070661_100051556 3300005344 Bacteria 3012
45 Ga0070661_100090988 3300005344 Bacteria 2259
46 Ga0070692_10018279 3300005345 Bacteria 3368
47 Ga0070692_10036286 3300005345 Bacteria 2501
48 Ga0070692_10609117 3300005345 Bacteria 724
49 Ga0070668_100000444 3300005347 Bacteria 27368
50 Ga0070668_100038041 3300005347 Bacteria 3676
51 Ga0070668_100195213 3300005347 Bacteria 1660
52 Ga0070668_100394977 3300005347 Bacteria 1180
53 Ga0070669_100016596 3300005353 Bacteria 5256
54 Ga0070669_100031784 3300005353 Bacteria 3812
55 Ga0070669_100053272 3300005353 Bacteria 2961
56 Ga0070669_100876929 3300005353 Bacteria 766
57 Ga0070669_101535655 3300005353 Bacteria 579
58 Ga0070669_101597382 3300005353 Bacteria 568
59 Ga0070669_101778821 3300005353 Bacteria 538
60 Ga0070675_100001331 3300005354 Bacteria 18072
61 Ga0070675_100014907 3300005354 Bacteria 6138
62 Ga0070675_100016669 3300005354 Bacteria 5831
63 Ga0070675_100042795 3300005354 Bacteria 3701
64 Ga0070675_100435936 3300005354 Bacteria 1173
65 Ga0070675_100538305 3300005354 Bacteria 1055
66 Ga0070675_100613815 3300005354 Bacteria 987
67 Ga0070671_100099076 3300005355 Bacteria 2444
68 Ga0070674_100001579 3300005356 Bacteria 12185
69 Ga0070674_100010963 3300005356 Bacteria 5498
70 Ga0070674_100168716 3300005356 Bacteria 1667
71 Ga0070674_100762128 3300005356 Bacteria 833
72 Ga0070673_100029674 3300005364 Bacteria 4080
73 Ga0070673_100172762 3300005364 Bacteria 1845
74 Ga0070673_102077160 3300005364 Bacteria 539
75 Ga0070688_100003074 3300005365 Bacteria 8525
76 Ga0070688_100018960 3300005365 Bacteria 3979
77 Ga0070688_100070024 3300005365 Bacteria 2242
78 Ga0070688_100224466 3300005365 Bacteria 1325
79 Ga0070688_100370056 3300005365 Bacteria 1054
80 Ga0070688_100666559 3300005365 Bacteria 802
81 Ga0070659_100091713 3300005366 Bacteria 2435
82 Ga0070667_100013376 3300005367 Bacteria 6783
83 Ga0070667_100119577 3300005367 Bacteria 2291
84 Ga0070667_100260108 3300005367 Bacteria 1554
85 Ga0070667_100631916 3300005367 Bacteria 988
86 Ga0070667_100664685 3300005367 Bacteria 962
87 Ga0070703_10140660 3300005406 Bacteria 896
88 Ga0070709_10010190 3300005434 Bacteria 5194
89 Ga0070714_100073766 3300005435 Bacteria 2957
90 Ga0070701_10003233 3300005438 Bacteria 6421
91 Ga0070701_10302011 3300005438 Bacteria 984
92 Ga0070711_100091933 3300005439 Bacteria 2189
93 Ga0070705_100000156 3300005440 Bacteria 40273
94 Ga0070705_100019094 3300005440 Bacteria 3604
95 Ga0070705_100194451 3300005440 Bacteria 1386
96 Ga0070705_100419195 3300005440 Bacteria 996
97 Ga0070705_100720726 3300005440 Bacteria 785
98 Ga0070700_100005703 3300005441 Bacteria 6608
99 Ga0070700_100111617 3300005441 Bacteria 1819
100 Ga0070700_100118111 3300005441 Bacteria 1773
101 Ga0070700_100567286 3300005441 Bacteria 884
102 Ga0070700_100601525 3300005441 Bacteria 861
103 Ga0070694_100003304 3300005444 Bacteria 9650
104 Ga0070694_100005609 3300005444 Bacteria 7606
105 Ga0070694_100043438 3300005444 Bacteria 3005
106 Ga0070694_100062966 3300005444 Bacteria 2535
107 Ga0070694_100385103 3300005444 Bacteria 1094
108 Ga0070694_100794123 3300005444 Bacteria 776
109 Ga0070694_100948023 3300005444 Bacteria 712
110 Ga0070708_100004776 3300005445 Bacteria 10680
111 Ga0070708_100012380 3300005445 Bacteria 6960
112 Ga0070708_100045665 3300005445 Bacteria 3861
113 Ga0070663_100062181 3300005455 Bacteria 2691
114 Ga0070663_100065241 3300005455 Bacteria 2634
115 Ga0070663_101332137 3300005455 Bacteria 634
116 Ga0070663_101592817 3300005455 Bacteria 582
117 Ga0070678_100008110 3300005456 Bacteria 6275
118 Ga0070678_100180034 3300005456 Bacteria 1729
119 Ga0070678_100570285 3300005456 Bacteria 1007
120 Ga0070662_100041504 3300005457 Bacteria 3282
121 Ga0070662_100124200 3300005457 Bacteria 1982
122 Ga0070662_100462316 3300005457 Bacteria 1055
123 Ga0070662_100635530 3300005457 Bacteria 900
124 Ga0070681_10043237 3300005458 Bacteria 4514
125 Ga0070681_10048676 3300005458 Bacteria 4236
126 Ga0070681_10606477 3300005458 Bacteria 1009
127 Ga0068867_100010217 3300005459 Bacteria 6621
128 Ga0068867_100114913 3300005459 Bacteria 2072
129 Ga0068867_100274630 3300005459 Bacteria 1380
130 Ga0068867_101971268 3300005459 Bacteria 551
131 Ga0070685_10011040 3300005466 Bacteria 4714
132 Ga0070685_10087920 3300005466 Bacteria 1876
133 Ga0070685_10115574 3300005466 Bacteria 1659
134 Ga0070685_10436717 3300005466 Bacteria 914
135 Ga0070685_10637608 3300005466 Bacteria 771
136 Ga0070706_100009975 3300005467 Bacteria 8822
137 Ga0070706_100091319 3300005467 Bacteria 2824
138 Ga0070706_100529935 3300005467 Bacteria 1096
139 Ga0070706_100597921 3300005467 Bacteria 1025
140 Ga0070707_100302128 3300005468 Bacteria 1555
141 Ga0070707_100657558 3300005468 Bacteria 1010
142 Ga0070707_100692490 3300005468 Bacteria 982
143 Ga0070707_101162494 3300005468 Bacteria 738
144 Ga0070707_101624741 3300005468 Bacteria 613
145 Ga0070698_100002282 3300005471 Bacteria 21228
146 Ga0070698_100224520 3300005471 Bacteria 1811
147 Ga0070698_100262333 3300005471 Bacteria 1660
148 Ga0070698_100507100 3300005471 Bacteria 1145
149 Ga0070698_100518363 3300005471 Bacteria 1130
150 Ga0070699_100000763 3300005518 Bacteria 29746
151 Ga0070699_100139811 3300005518 Bacteria 2137
152 Ga0070699_100204867 3300005518 Bacteria 1755
153 Ga0070699_100395356 3300005518 Bacteria 1249
154 Ga0070679_100000595 3300005530 Bacteria 30724
155 Ga0070679_100053079 3300005530 Bacteria 4035
156 Ga0070684_100004296 3300005535 Bacteria 10813
157 Ga0070684_100023616 3300005535 Bacteria 5147
158 Ga0070684_100042162 3300005535 Bacteria 3939
159 Ga0070684_100064604 3300005535 Bacteria 3211
160 Ga0070684_100098615 3300005535 Bacteria 2607
161 Ga0070684_100118791 3300005535 Bacteria 2377
162 Ga0070684_100322287 3300005535 Bacteria 1419
163 Ga0070684_101126476 3300005535 Bacteria 738
164 Ga0070697_100374373 3300005536 Bacteria 1233
165 Ga0070672_100013480 3300005543 Bacteria 5776
166 Ga0070672_100014726 3300005543 Bacteria 5548
167 Ga0070672_101162140 3300005543 Bacteria 687
168 Ga0070672_101223994 3300005543 Bacteria 669
169 Ga0070686_100059272 3300005544 Bacteria 2466
170 Ga0070686_100115510 3300005544 Bacteria 1835
171 Ga0070695_100000574 3300005545 Bacteria 19384
172 Ga0070695_100134838 3300005545 Bacteria 1705
173 Ga0070695_100344998 3300005545 Bacteria 1114
174 Ga0070695_100347708 3300005545 Bacteria 1110
175 Ga0070695_100424586 3300005545 Bacteria 1013
176 Ga0070696_100002781 3300005546 Bacteria 11618
177 Ga0070696_100035084 3300005546 Bacteria 3452
178 Ga0070693_101404422 3300005547 Bacteria 543
179 Ga0070693_101475564 3300005547 Bacteria 531
180 Ga0070665_100223513 3300005548 Bacteria 1883
181 Ga0070665_100336750 3300005548 Bacteria 1513
182 Ga0070665_100377914 3300005548 Bacteria 1424
183 Ga0070665_100538444 3300005548 Bacteria 1180
184 Ga0070665_102073083 3300005548 Bacteria 573
185 Ga0070665_102122933 3300005548 Bacteria 566
186 Ga0070704_100003889 3300005549 Bacteria 8595
187 Ga0070704_100067680 3300005549 Bacteria 2580
188 Ga0070704_100540642 3300005549 Bacteria 1017
189 Ga0070704_100695565 3300005549 Bacteria 901
190 Ga0070704_101288635 3300005549 Bacteria 668
191 Ga0070704_101497196 3300005549 Bacteria 621
192 Ga0068855_100031356 3300005563 Bacteria 6347
193 Ga0068855_100138491 3300005563 Bacteria 2775
194 Ga0070664_100124839 3300005564 Bacteria 2257
195 Ga0070664_100180040 3300005564 Bacteria 1878
196 Ga0070664_100381944 3300005564 Bacteria 1286
197 Ga0070664_100488519 3300005564 Bacteria 1134
198 Ga0070664_100563886 3300005564 Bacteria 1054
199 Ga0068857_100003390 3300005577 Bacteria 13271
200 Ga0068857_100082803 3300005577 Bacteria 2866
201 Ga0068857_100549781 3300005577 Bacteria 1088
202 Ga0068857_100700948 3300005577 Bacteria 962
203 Ga0068857_101863108 3300005577 Bacteria 589
204 Ga0068854_100026113 3300005578 Bacteria 4012
205 Ga0068856_100433112 3300005614 Bacteria 1335
206 Ga0068856_100442317 3300005614 Bacteria 1320
207 Ga0068856_101728796 3300005614 Bacteria 638
208 Ga0070702_100065204 3300005615 Bacteria 2133
209 Ga0070702_100668905 3300005615 Bacteria 787
210 Ga0068852_100027475 3300005616 Bacteria 4638
211 Ga0068852_100231606 3300005616 Bacteria 1761
212 Ga0068852_100663846 3300005616 Bacteria 1051
213 Ga0068852_100958469 3300005616 Bacteria 874
214 Ga0068859_100007156 3300005617 Bacteria 11327
215 Ga0068859_100008945 3300005617 Bacteria 10113
216 Ga0068859_100137579 3300005617 Bacteria 2516
217 Ga0068859_100408803 3300005617 Bacteria 1453
218 Ga0068859_100436540 3300005617 Bacteria 1406
219 Ga0068859_100776857 3300005617 Bacteria 1046
220 Ga0068859_101014513 3300005617 Bacteria 911
221 Ga0068859_101154645 3300005617 Bacteria 852
222 Ga0068859_101237010 3300005617 Bacteria 822
223 Ga0068859_102492342 3300005617 Bacteria 569
224 Ga0068864_100064676 3300005618 Bacteria 3173
225 Ga0068864_100077076 3300005618 Bacteria 2914
226 Ga0068864_100126191 3300005618 Bacteria 2294
227 Ga0068864_100135909 3300005618 Bacteria 2214
228 Ga0068864_101185630 3300005618 Bacteria 762
229 Ga0068866_10225786 3300005718 Bacteria 1133
230 Ga0068861_100002466 3300005719 Bacteria 12064
231 Ga0068861_100007890 3300005719 Bacteria 7324
232 Ga0068861_100016097 3300005719 Bacteria 5282
233 Ga0068861_100213147 3300005719 Bacteria 1628
234 Ga0068861_100987446 3300005719 Bacteria 803
235 Ga0068861_101530840 3300005719 Bacteria 655
236 Ga0068861_101936590 3300005719 Bacteria 587
237 Ga0068851_10119810 3300005834 Bacteria 1413
238 Ga0068870_10003744 3300005840 Bacteria 6471
239 Ga0068870_10022791 3300005840 Bacteria 3080
240 Ga0068870_10043570 3300005840 Bacteria 2341
241 Ga0068870_10288969 3300005840 Bacteria 1031
242 Ga0068863_100031527 3300005841 Bacteria 5057
243 Ga0068863_100038626 3300005841 Bacteria 4541
244 Ga0068863_100040923 3300005841 Bacteria 4406
245 Ga0068863_100181805 3300005841 Bacteria 2018
246 Ga0068863_100603403 3300005841 Bacteria 1087
247 Ga0068858_100008252 3300005842 Bacteria 10011
248 Ga0068858_100070669 3300005842 Bacteria 3236
249 Ga0068858_100137314 3300005842 Bacteria 2295
250 Ga0068858_100147606 3300005842 Bacteria 2209
251 Ga0068858_100180314 3300005842 Bacteria 1994
252 Ga0068858_100671224 3300005842 Bacteria 1008
253 Ga0068860_100001702 3300005843 Bacteria 23502
254 Ga0068860_100006938 3300005843 Bacteria 11352
255 Ga0068860_100074411 3300005843 Bacteria 3230
256 Ga0068860_100584939 3300005843 Bacteria 1121
257 Ga0068860_101136943 3300005843 Bacteria 801
258 Ga0068862_100001703 3300005844 Bacteria 19941
259 Ga0068862_100007216 3300005844 Bacteria 9231
260 Ga0068862_100046426 3300005844 Bacteria 3706
261 Ga0068862_100176479 3300005844 Bacteria 1915
262 Ga0068862_100390674 3300005844 Bacteria 1300
263 Ga0068862_100743451 3300005844 Bacteria 954
264 Ga0068862_100813993 3300005844 Bacteria 913
265 Ga0081455_10195831 3300005937 Bacteria 1518
266 Ga0081539_10001447 3300005985 Bacteria 40627
267 Ga0081539_10001460 3300005985 Bacteria 40240
268 Ga0075365_10008317 3300006038 Bacteria 5880
269 Ga0075365_10097114 3300006038 Bacteria 2013
270 Ga0075365_10226393 3300006038 Bacteria 1312
271 Ga0075368_10004085 3300006042 Bacteria 4911
272 Ga0075368_10278475 3300006042 Bacteria 718
273 Ga0075363_100080712 3300006048 Bacteria 1779
274 Ga0075364_10053197 3300006051 Bacteria 2647
275 Ga0075364_10164752 3300006051 Bacteria 1497
276 Ga0070716_100740760 3300006173 Bacteria 755
277 Ga0070712_100162596 3300006175 Bacteria 1725
278 Ga0075362_10038042 3300006177 Bacteria 2112
279 Ga0075362_10068299 3300006177 Bacteria 1619
280 Ga0075362_10629209 3300006177 Bacteria 556
281 Ga0075367_10021436 3300006178 Bacteria 3611
282 Ga0075367_10030877 3300006178 Bacteria 3075
283 Ga0075369_10346076 3300006186 Bacteria 697
284 Ga0075369_10475424 3300006186 Bacteria 593
285 Ga0075366_10000128 3300006195 Bacteria 31593
286 Ga0097621_100082981 3300006237 Bacteria 2670
287 Ga0075370_10096103 3300006353 Bacteria 1712
288 Ga0075370_10720353 3300006353 Bacteria 607
289 Ga0068871_100389406 3300006358 Bacteria 1239
290 Ga0075428_100004279 3300006844 Bacteria 15712
291 Ga0075428_100095286 3300006844 Bacteria 3244
292 Ga0075428_100131771 3300006844 Bacteria 2719
293 Ga0075428_100236400 3300006844 Bacteria 1971
294 Ga0075428_100354165 3300006844 Bacteria 1575
295 Ga0075428_100504633 3300006844 Bacteria 1294
296 Ga0075430_100135241 3300006846 Bacteria 2054
297 Ga0075430_100882018 3300006846 Bacteria 737
298 Ga0075431_100009878 3300006847 Bacteria 9582
299 Ga0075431_100181590 3300006847 Bacteria 2159
300 Ga0075431_100600220 3300006847 Bacteria 1085
301 Ga0075431_101221499 3300006847 Bacteria 714
302 Ga0075433_10003192 3300006852 Bacteria 12636
303 Ga0075433_10018953 3300006852 Bacteria 5727
304 Ga0075433_10106453 3300006852 Bacteria 2486
305 Ga0075433_10188470 3300006852 Bacteria 1835
306 Ga0075433_10260145 3300006852 Bacteria 1539
307 Ga0075433_10487469 3300006852 Bacteria 1086
308 Ga0075434_100006350 3300006871 Bacteria 10836
309 Ga0075434_100023121 3300006871 Bacteria 6054
310 Ga0075434_100240855 3300006871 Bacteria 1829
311 Ga0075434_100481010 3300006871 Bacteria 1263
312 Ga0075434_101676521 3300006871 Bacteria 644
313 Ga0075434_101836417 3300006871 Bacteria 613
314 Ga0075429_100206839 3300006880 Bacteria 1720
315 Ga0075429_100221408 3300006880 Bacteria 1658
316 Ga0075429_100499549 3300006880 Bacteria 1066
317 Ga0075429_100540894 3300006880 Bacteria 1021
318 Ga0068865_100018249 3300006881 Bacteria 4526
319 Ga0068865_100113907 3300006881 Bacteria 1999
320 Ga0068865_100190724 3300006881 Bacteria 1585
321 Ga0068865_100574336 3300006881 Bacteria 950
322 Ga0068865_100728584 3300006881 Bacteria 850
323 Ga0097620_100007155 3300006931 Bacteria 11327
324 Ga0097620_100008945 3300006931 Bacteria 10113
325 Ga0097620_100137586 3300006931 Bacteria 2516
326 Ga0097620_100408773 3300006931 Bacteria 1453
327 Ga0097620_100436498 3300006931 Bacteria 1406
328 Ga0097620_100776833 3300006931 Bacteria 1046
329 Ga0097620_101014531 3300006931 Bacteria 911
330 Ga0097620_101154692 3300006931 Bacteria 852
331 Ga0097620_101236971 3300006931 Bacteria 822
332 Ga0097620_102492287 3300006931 Bacteria 569
333 Ga0075435_100008302 3300007076 Bacteria 7443
334 Ga0075435_100009995 3300007076 Bacteria 6917
335 Ga0075435_100218556 3300007076 Bacteria 1618
336 Ga0075435_100254982 3300007076 Bacteria 1494
337 Ga0075435_100277843 3300007076 Bacteria 1429
338 Ga0105240_10069451 3300009093 Bacteria 4360
339 Ga0105240_10312363 3300009093 Bacteria 1794
340 Ga0111539_10000305 3300009094 Bacteria 59778
341 Ga0111539_10022206 3300009094 Bacteria 7802
342 Ga0111539_10040437 3300009094 Bacteria 5614
343 Ga0111539_10214093 3300009094 Bacteria 2245
344 Ga0111539_10310608 3300009094 Bacteria 1835
345 Ga0111539_10366694 3300009094 Bacteria 1676
346 Ga0111539_10392898 3300009094 Bacteria 1615
347 Ga0111539_10527595 3300009094 Bacteria 1376
348 Ga0111539_10734437 3300009094 Bacteria 1149
349 Ga0105245_10169305 3300009098 Bacteria 2079
350 Ga0105245_10232054 3300009098 Bacteria 1785
351 Ga0105245_10733529 3300009098 Bacteria 1023
352 Ga0105245_10972118 3300009098 Bacteria 893
353 Ga0105247_10287431 3300009101 Bacteria 1136
354 Ga0114129_10001655 3300009147 Bacteria 30310
355 Ga0114129_10086207 3300009147 Bacteria 4356
356 Ga0114129_10111748 3300009147 Bacteria 3770
357 Ga0114129_10136702 3300009147 Bacteria 3363
358 Ga0114129_10178224 3300009147 Bacteria 2893
359 Ga0114129_10322886 3300009147 Bacteria 2052
360 Ga0114129_11554625 3300009147 Bacteria 811
361 Ga0105243_10011189 3300009148 Bacteria 6787
362 Ga0105243_10107591 3300009148 Bacteria 2326
363 Ga0105243_10109765 3300009148 Bacteria 2305
364 Ga0105243_10345087 3300009148 Bacteria 1365
365 Ga0105243_10793465 3300009148 Bacteria 933
366 Ga0105241_10131094 3300009174 Bacteria 2030
367 Ga0105241_10554892 3300009174 Bacteria 1032
368 Ga0105242_10031909 3300009176 Bacteria 4211
369 Ga0105242_10091885 3300009176 Bacteria 2556
370 Ga0105242_10256413 3300009176 Bacteria 1578
371 Ga0105242_10446394 3300009176 Bacteria 1218
372 Ga0105242_10518490 3300009176 Bacteria 1137
373 Ga0105242_10963427 3300009176 Bacteria 858
374 Ga0105242_11566740 3300009176 Bacteria 691
375 Ga0105248_10008266 3300009177 Bacteria 11434
376 Ga0105248_10034349 3300009177 Bacteria 5670
377 Ga0105248_10350586 3300009177 Bacteria 1662
378 Ga0105248_10427070 3300009177 Bacteria 1492
379 Ga0105248_10557109 3300009177 Bacteria 1293
380 Ga0105248_10588362 3300009177 Bacteria 1256
381 Ga0105248_11041428 3300009177 Bacteria 924
382 Ga0105237_10094706 3300009545 Bacteria 2975
383 Ga0105237_10443189 3300009545 Bacteria 1304
384 Ga0105237_10599141 3300009545 Bacteria 1109
385 Ga0105238_10103316 3300009551 Bacteria 2831
386 Ga0105238_11337255 3300009551 Bacteria 743
387 Ga0105249_10002856 3300009553 Bacteria 14921
388 Ga0105249_10003594 3300009553 Bacteria 13417
389 Ga0105249_10023451 3300009553 Bacteria 5537
390 Ga0105249_10243759 3300009553 Bacteria 1778
391 Ga0105249_10326581 3300009553 Bacteria 1547
392 Ga0105249_11140213 3300009553 Bacteria 850
393 Ga0105249_12479767 3300009553 Bacteria 591
394 Ga0105239_10055210 3300010375 Bacteria 4356
395 Ga0157373_10109563 3300013100 Bacteria 1941
396 Ga0157371_10020712 3300013102 Bacteria 4837
397 Ga0157370_10127181 3300013104 Bacteria 2378
398 Ga0157369_10326981 3300013105 Bacteria 1593
399 Ga0157369_10641235 3300013105 Bacteria 1096
400 Ga0157374_10209306 3300013296 Bacteria 1912
401 Ga0157378_10000001 3300013297 Bacteria 352632
402 Ga0157378_10099008 3300013297 Bacteria 2660
403 Ga0163162_10000455 3300013306 Bacteria 37915
404 Ga0163162_10095346 3300013306 Bacteria 3062
405 Ga0163162_10102417 3300013306 Bacteria 2956
406 Ga0163162_10547020 3300013306 Bacteria 1286
407 Ga0157372_10037384 3300013307 Bacteria 5356
408 Ga0157372_10313094 3300013307 Bacteria 1827
409 Ga0157372_11631620 3300013307 Bacteria 742
410 Ga0157375_10003909 3300013308 Bacteria 12925
411 Ga0157375_10009133 3300013308 Bacteria 8686
412 Ga0157375_10015147 3300013308 Bacteria 6897
413 Ga0157375_10262716 3300013308 Bacteria 1888
414 Ga0157375_10891583 3300013308 Bacteria 1034
415 Ga0157375_12112007 3300013308 Bacteria 670
416 Ga0163163_10006856 3300014325 Bacteria 10000
417 Ga0163163_10935413 3300014325 Bacteria 930
418 Ga0163163_11224431 3300014325 Bacteria 813
419 Ga0157380_10006107 3300014326 Bacteria 8442
420 Ga0157380_10008768 3300014326 Bacteria 7224
421 Ga0157380_10061475 3300014326 Bacteria 3006
422 Ga0157380_10253204 3300014326 Bacteria 1595
423 Ga0157377_10020027 3300014745 Bacteria 3499
424 Ga0157377_10028243 3300014745 Bacteria 3018
425 Ga0157377_10037485 3300014745 Bacteria 2671
426 Ga0157377_10091167 3300014745 Bacteria 1800
427 Ga0157377_10341191 3300014745 Bacteria 1002
428 Ga0157379_10511353 3300014968 Bacteria 1114
429 Ga0157379_11129689 3300014968 Bacteria 751
430 Ga0157379_11851970 3300014968 Bacteria 594
431 Ga0157379_11961963 3300014968 Bacteria 578
432 Ga0157376_10203145 3300014969 Bacteria 1825
433 Ga0157376_10477277 3300014969 Bacteria 1221
434 Ga0163161_10425001 3300017792 Bacteria 1070
435 Ga0197907_10821123 3300020069 Bacteria 733
436 Ga0206352_10799656 3300020078 Bacteria 2961
437 Ga0206353_11065889 3300020082 Bacteria 803
438 Ga0154015_1277831 3300020610 Bacteria 709
439 Ga0213875_10556325 3300021388 Bacteria 553
440 Ga0207697_10004603 3300025315 Bacteria 6554
441 Ga0207697_10134691 3300025315 Bacteria 1069
442 Ga0207653_10037061 3300025885 Bacteria 1590
443 Ga0207682_10037279 3300025893 Bacteria 1969
444 Ga0207682_10095712 3300025893 Bacteria 1293
445 Ga0207682_10177049 3300025893 Bacteria 973
446 Ga0207688_10023903 3300025901 Bacteria 3350
447 Ga0207688_10062307 3300025901 Bacteria 2102
448 Ga0207688_10098690 3300025901 Bacteria 1684
449 Ga0207688_10981361 3300025901 Bacteria 534
450 Ga0207680_10049308 3300025903 Bacteria 2506
451 Ga0207680_10074727 3300025903 Bacteria 2111
452 Ga0207680_10367720 3300025903 Bacteria 1012
453 Ga0207680_11006824 3300025903 Bacteria 597
454 Ga0207647_10030615 3300025904 Bacteria 3469
455 Ga0207647_10132312 3300025904 Bacteria 1465
456 Ga0207645_10000687 3300025907 Bacteria 28066
457 Ga0207643_10009279 3300025908 Bacteria 5286
458 Ga0207643_10012200 3300025908 Bacteria 4646
459 Ga0207643_10015211 3300025908 Bacteria 4186
460 Ga0207684_10504390 3300025910 Bacteria 1037
461 Ga0207684_10971157 3300025910 Bacteria 712
462 Ga0207707_10028110 3300025912 Bacteria 4916
463 Ga0207707_10062568 3300025912 Bacteria 3239
464 Ga0207707_10067530 3300025912 Bacteria 3115
465 Ga0207707_10512288 3300025912 Bacteria 1022
466 Ga0207707_10609738 3300025912 Bacteria 923
467 Ga0207695_10031018 3300025913 Bacteria 5875
468 Ga0207695_10068761 3300025913 Bacteria 3628
469 Ga0207671_10095116 3300025914 Bacteria 2249
470 Ga0207671_10301280 3300025914 Bacteria 1266
471 Ga0207663_10131520 3300025916 Bacteria 1730
472 Ga0207660_10000818 3300025917 Bacteria 20531
473 Ga0207660_10075669 3300025917 Bacteria 2460
474 Ga0207660_10091568 3300025917 Bacteria 2255
475 Ga0207660_10853352 3300025917 Bacteria 743
476 Ga0207662_10001597 3300025918 Bacteria 11096
477 Ga0207662_10002499 3300025918 Bacteria 9244
478 Ga0207662_10019830 3300025918 Bacteria 3832
479 Ga0207662_10063717 3300025918 Bacteria 2217
480 Ga0207657_10052336 3300025919 Bacteria 3544
481 Ga0207649_10053694 3300025920 Bacteria 2505
482 Ga0207649_10495927 3300025920 Bacteria 928
483 Ga0207649_10838722 3300025920 Bacteria 719
484 Ga0207649_11278462 3300025920 Bacteria 580
485 Ga0207652_10080149 3300025921 Bacteria 2853
486 Ga0207652_10164539 3300025921 Bacteria 1989
487 Ga0207652_10306718 3300025921 Bacteria 1433
488 Ga0207646_10131939 3300025922 Bacteria 2249
489 Ga0207646_10262756 3300025922 Bacteria 1560
490 Ga0207646_10540532 3300025922 Bacteria 1048
491 Ga0207681_10001144 3300025923 Bacteria 17122
492 Ga0207681_10010449 3300025923 Bacteria 5680
493 Ga0207681_10116658 3300025923 Bacteria 1951
494 Ga0207681_10342530 3300025923 Bacteria 1194
495 Ga0207681_10355140 3300025923 Bacteria 1174
496 Ga0207681_10386957 3300025923 Bacteria 1127
497 Ga0207681_10854491 3300025923 Bacteria 761
498 Ga0207681_11223622 3300025923 Bacteria 631
499 Ga0207694_10010888 3300025924 Bacteria 6868
500 Ga0207650_10043836 3300025925 Bacteria 3286
501 Ga0207650_10078385 3300025925 Bacteria 2499
502 Ga0207650_10246798 3300025925 Bacteria 1444
503 Ga0207650_10752607 3300025925 Bacteria 825
504 Ga0207659_10000485 3300025926 Bacteria 23902
505 Ga0207659_10000662 3300025926 Bacteria 20344
506 Ga0207659_10370100 3300025926 Bacteria 1193
507 Ga0207659_10480251 3300025926 Bacteria 1050
508 Ga0207659_10867036 3300025926 Bacteria 776
509 Ga0207687_10094278 3300025927 Bacteria 2190
510 Ga0207687_10142770 3300025927 Bacteria 1818
511 Ga0207687_10334648 3300025927 Bacteria 1229
512 Ga0207664_10145500 3300025929 Bacteria 2009
513 Ga0207644_10123831 3300025931 Bacteria 1971
514 Ga0207644_10938762 3300025931 Bacteria 725
515 Ga0207644_11390862 3300025931 Bacteria 589
516 Ga0207644_11494003 3300025931 Bacteria 567
517 Ga0207706_10001099 3300025933 Bacteria 27517
518 Ga0207706_10043260 3300025933 Bacteria 3992
519 Ga0207706_10252137 3300025933 Bacteria 1541
520 Ga0207706_10288738 3300025933 Bacteria 1430
521 Ga0207706_10389281 3300025933 Bacteria 1209
522 Ga0207706_10536726 3300025933 Bacteria 1008
523 Ga0207686_10016982 3300025934 Bacteria 4092
524 Ga0207686_10058992 3300025934 Bacteria 2422
525 Ga0207686_10125458 3300025934 Bacteria 1754
526 Ga0207686_10219212 3300025934 Bacteria 1373
527 Ga0207686_10401457 3300025934 Bacteria 1044
528 Ga0207709_10008410 3300025935 Bacteria 5707
529 Ga0207709_10098536 3300025935 Bacteria 1928
530 Ga0207709_10315314 3300025935 Bacteria 1168
531 Ga0207709_10425524 3300025935 Bacteria 1021
532 Ga0207670_10000771 3300025936 Bacteria 16844
533 Ga0207670_10094530 3300025936 Bacteria 2121
534 Ga0207670_10190862 3300025936 Bacteria 1550
535 Ga0207670_10193190 3300025936 Bacteria 1541
536 Ga0207670_10193802 3300025936 Bacteria 1539
537 Ga0207670_11617094 3300025936 Bacteria 551
538 Ga0207669_10012338 3300025937 Bacteria 4198
539 Ga0207669_10026671 3300025937 Bacteria 3148
540 Ga0207669_10388733 3300025937 Bacteria 1089
541 Ga0207669_10631069 3300025937 Bacteria 874
542 Ga0207704_10075915 3300025938 Bacteria 2151
543 Ga0207704_10159611 3300025938 Bacteria 1603
544 Ga0207704_10252233 3300025938 Bacteria 1325
545 Ga0207704_10597652 3300025938 Bacteria 903
546 Ga0207665_10457601 3300025939 Bacteria 980
547 Ga0207691_10002827 3300025940 Bacteria 16911
548 Ga0207691_10008916 3300025940 Bacteria 9630
549 Ga0207691_10016017 3300025940 Bacteria 7120
550 Ga0207691_10084819 3300025940 Bacteria 2843
551 Ga0207691_10243366 3300025940 Bacteria 1555
552 Ga0207711_10129164 3300025941 Bacteria 2264
553 Ga0207711_10321484 3300025941 Bacteria 1430
554 Ga0207711_10398418 3300025941 Bacteria 1279
555 Ga0207711_10448695 3300025941 Bacteria 1201
556 Ga0207711_10697684 3300025941 Bacteria 947
557 Ga0207711_10795867 3300025941 Bacteria 881
558 Ga0207689_10002768 3300025942 Bacteria 16209
559 Ga0207689_10022249 3300025942 Bacteria 5330
560 Ga0207689_10116195 3300025942 Bacteria 2199
561 Ga0207661_10004508 3300025944 Bacteria 9765
562 Ga0207661_10011169 3300025944 Bacteria 6496
563 Ga0207661_10041846 3300025944 Bacteria 3609
564 Ga0207661_10078151 3300025944 Bacteria 2723
565 Ga0207661_10138409 3300025944 Bacteria 2093
566 Ga0207661_10185135 3300025944 Bacteria 1822
567 Ga0207661_10232981 3300025944 Bacteria 1631
568 Ga0207661_10275459 3300025944 Bacteria 1502
569 Ga0207679_10028174 3300025945 Bacteria 3894
570 Ga0207679_10100832 3300025945 Bacteria 2257
571 Ga0207679_10125372 3300025945 Bacteria 2051
572 Ga0207679_10506425 3300025945 Bacteria 1078
573 Ga0207679_10764722 3300025945 Bacteria 879
574 Ga0207667_10080730 3300025949 Bacteria 3369
575 Ga0207667_10153504 3300025949 Bacteria 2369
576 Ga0207651_10129428 3300025960 Bacteria 1929
577 Ga0207651_10964533 3300025960 Bacteria 761
578 Ga0207712_10002158 3300025961 Bacteria 12853
579 Ga0207712_10018433 3300025961 Bacteria 4547
580 Ga0207712_10220360 3300025961 Bacteria 1516
581 Ga0207712_10327827 3300025961 Bacteria 1265
582 Ga0207712_10891877 3300025961 Bacteria 785
583 Ga0207712_11132371 3300025961 Bacteria 697
584 Ga0207712_11447448 3300025961 Bacteria 615
585 Ga0207668_10015066 3300025972 Bacteria 4798
586 Ga0207668_10015442 3300025972 Bacteria 4745
587 Ga0207640_10060457 3300025981 Bacteria 2505
588 Ga0207640_10571352 3300025981 Bacteria 953
589 Ga0207658_10016778 3300025986 Bacteria 5040
590 Ga0207658_10182075 3300025986 Bacteria 1740
591 Ga0207658_10342942 3300025986 Bacteria 1299
592 Ga0207658_10468921 3300025986 Bacteria 1117
593 Ga0207658_10529611 3300025986 Bacteria 1052
594 Ga0207658_10890798 3300025986 Bacteria 810
595 Ga0207677_10013685 3300026023 Bacteria 4710
596 Ga0207677_10260150 3300026023 Bacteria 1414
597 Ga0207677_10773124 3300026023 Bacteria 858
598 Ga0207703_10016307 3300026035 Bacteria 5791
599 Ga0207703_10130334 3300026035 Bacteria 2171
600 Ga0207639_10263637 3300026041 Bacteria 1508
601 Ga0207639_11365997 3300026041 Bacteria 665
602 Ga0207678_10136040 3300026067 Bacteria 2097
603 Ga0207678_10229146 3300026067 Bacteria 1591
604 Ga0207708_10009542 3300026075 Bacteria 7195
605 Ga0207708_10014222 3300026075 Bacteria 5951
606 Ga0207708_10098231 3300026075 Bacteria 2263
607 Ga0207708_10282495 3300026075 Bacteria 1345
608 Ga0207702_10087444 3300026078 Bacteria 2721
609 Ga0207641_10034240 3300026088 Bacteria 4224
610 Ga0207641_10448214 3300026088 Bacteria 1247
611 Ga0207648_10000478 3300026089 Bacteria 44666
612 Ga0207648_10001666 3300026089 Bacteria 24344
613 Ga0207648_10017903 3300026089 Bacteria 6427
614 Ga0207648_10183358 3300026089 Bacteria 1853
615 Ga0207648_10614436 3300026089 Bacteria 1003
616 Ga0207676_10050368 3300026095 Bacteria 3247
617 Ga0207676_10072933 3300026095 Bacteria 2761
618 Ga0207676_10096075 3300026095 Bacteria 2445
619 Ga0207676_10181705 3300026095 Bacteria 1842
620 Ga0207676_10508054 3300026095 Bacteria 1145
621 Ga0207676_10543477 3300026095 Bacteria 1109
622 Ga0207674_10005242 3300026116 Bacteria 15432
623 Ga0207674_10030393 3300026116 Bacteria 5680
624 Ga0207674_10113784 3300026116 Bacteria 2679
625 Ga0207674_10691015 3300026116 Bacteria 985
626 Ga0207675_100000141 3300026118 Bacteria 61869
627 Ga0207675_100006526 3300026118 Bacteria 11044
628 Ga0207675_100042169 3300026118 Bacteria 4259
629 Ga0207675_100066641 3300026118 Bacteria 3366
630 Ga0207675_100481829 3300026118 Bacteria 1233
631 Ga0207675_100562902 3300026118 Bacteria 1140
632 Ga0207675_101550534 3300026118 Bacteria 683
633 Ga0207683_10037284 3300026121 Bacteria 4233
634 Ga0207683_10401139 3300026121 Bacteria 1262
635 Ga0207683_10412199 3300026121 Bacteria 1244
636 Ga0207698_10021580 3300026142 Bacteria 4458
637 Ga0207698_10927402 3300026142 Bacteria 879
638 Ga0207698_11401396 3300026142 Bacteria 714
639 Ga0209983_1044054 3300027665 Bacteria 969
640 Ga0209813_10254780 3300027866 Bacteria 668
641 Ga0207428_10000161 3300027907 Bacteria 92184
642 Ga0207428_10002496 3300027907 Bacteria 18377
643 Ga0207428_10274500 3300027907 Bacteria 1253
644 Ga0268266_10010565 3300028379 Bacteria 8056
645 Ga0268266_10062215 3300028379 Bacteria 3220
646 Ga0268266_10129335 3300028379 Bacteria 2257
647 Ga0268266_10327654 3300028379 Bacteria 1435
648 Ga0268266_10650919 3300028379 Bacteria 1014
649 Ga0268266_12185581 3300028379 Bacteria 525
650 Ga0268265_10000663 3300028380 Bacteria 34113
651 Ga0268265_10036005 3300028380 Bacteria 3621
652 Ga0268265_10084962 3300028380 Bacteria 2510
653 Ga0268265_10376002 3300028380 Bacteria 1305
654 Ga0268265_10426551 3300028380 Bacteria 1232
655 Ga0268264_10002304 3300028381 Bacteria 16905
656 Ga0268264_10068440 3300028381 Bacteria 3000
657 Ga0268264_11332091 3300028381 Bacteria 728
658 Ga0265762_1046575 3300030760 Bacteria 861
659 Ga0265775_109132 3300030762 Bacteria 611
660 Ga0307408_100051677 3300031548 Bacteria 2961
661 Ga0316576_10109211 3300031727 Bacteria 2073
662 Ga0316578_10166595 3300031728 Bacteria 1328
663 Ga0307405_10358657 3300031731 Bacteria 1127
664 Ga0316577_10445168 3300031733 Bacteria 736
665 Ga0307413_10393071 3300031824 Bacteria 1084
666 Ga0307410_10071420 3300031852 Bacteria 2407
667 Ga0307406_10002220 3300031901 Bacteria 10569
668 Ga0307407_10036680 3300031903 Bacteria 2703
669 Ga0307407_11324085 3300031903 Bacteria 566
670 Ga0307412_10019704 3300031911 Bacteria 4092
671 Ga0307412_10162085 3300031911 Bacteria 1663
672 Ga0307409_100062443 3300031995 Bacteria 2916
673 Ga0307416_100010521 3300032002 Bacteria 6115
674 Ga0307416_100536726 3300032002 Bacteria 1241
675 Ga0307414_10161300 3300032004 Bacteria 1781
676 Ga0307411_10017454 3300032005 Bacteria 4090
677 Ga0307415_100039760 3300032126 Bacteria 3112
678 Ga0373930_0057583 3300034816 Bacteria 861
679 Ga0373938_0023785 3300034957 Bacteria 1262
680 Ga0373928_0246325 3300035084 Bacteria 531
681 Ga0373929_0009852 3300035085 Bacteria 1777
682 Ga0373929_0035750 3300035085 Bacteria 1083
683 Ga0373934_0005354 3300035086 Bacteria 4753
684 Ga0373934_0018545 3300035086 Bacteria 2664
685 Ga0373940_0002992 3300035088 Bacteria 3381
686 Ga0373940_0021054 3300035088 Bacteria 1663
687 Ga0373949_0055552 3300035090 Bacteria 1007
688 Ga0373951_0126760 3300035091 Bacteria 699
689 Ga0373932_0115079 3300035112 Bacteria 891
690 Ga0373939_0024150 3300035114 Bacteria 1691
691 Ga0373941_0009680 3300035115 Bacteria 2433
692 Ga0373941_0048891 3300035115 Bacteria 1337
693 Ga0373953_0023333 3300035117 Bacteria 2341
694 Ga0373954_0035006 3300035118 Bacteria 2328
695 Ga0373954_0397563 3300035118 Bacteria 681
696 Ga0373957_0008536 3300035120 Bacteria 3323
697 Ga0373943_0555441 3300035170 Bacteria 674
698 Ga0373946_0104632 3300035171 Bacteria 1273
699 Ga0373955_0021652 3300035172 Bacteria 3249
700 Ga0373942_0072128 3300035207 Bacteria 1010
701 Ga0373942_0171991 3300035207 Bacteria 706
702 Ga0373961_0014911 3300035241 Bacteria 1980
703 Ga0373961_0020712 3300035241 Bacteria 1742
704 Ga0373961_0023035 3300035241 Bacteria 1672
705 Ga0373962_0055517 3300035242 Bacteria 1151
706 Ga0373962_0129334 3300035242 Bacteria 812
707 Ga0373931_0001831 3300035691 Bacteria 9242
708 Ga0373931_0092161 3300035691 Bacteria 1690
709 Ga0373927_0055350 3300035695 Bacteria 2565
710 Ga0373933_0108617 3300035724 Bacteria 1728
711 Ga0373933_0271923 3300035724 Bacteria 1094
712 Ga0373947_0150909 3300035725 Bacteria 1497
713 Ga0373937_0261403 3300036401 Bacteria 1632
714 Ga0373937_0293758 3300036401 Bacteria 1535
715 Ga0373925_0189173 3300037068 Bacteria 1633
716 Ga0395905_0218578 3300037471 Bacteria 1784
717 Ga0395905_0812010 3300037471 Bacteria 838
718 Ga0436364_0530783 3300037853 Bacteria 632
719 Ga0436364_1278837 3300037853 Bacteria 1463
720 Ga0242420_000431 3300038996 Bacteria 4722
721 Ga0242420_002167 3300038996 Bacteria 2769
722 Ga0451837_0841720 3300041494 Bacteria 1854
723 Ga0439437_012012 3300042000 Bacteria 996
724 Ga0439455_0008140 3300042012 Bacteria 2241
725 Ga0439455_0156884 3300042012 Bacteria 649
726 Ga0450910_052467 3300042147 Bacteria 676
727 Ga0439435_0014123 3300042436 Bacteria 1968
728 Ga0439464_0024646 3300042439 Bacteria 1664
729 Ga0439464_0124002 3300042439 Bacteria 797
730 Ga0451577_0423678 3300042876 Bacteria 1209
731 Ga0451577_0536882 3300042876 Bacteria 1062
732 Ga0451577_0680249 3300042876 Bacteria 933
733 Ga0453683_0029383 3300044673 Bacteria 3475
734 Ga0453683_0355886 3300044673 Bacteria 941
735 Ga0466966_0029559 3300044684 Bacteria 3564
736 Ga0466966_0776308 3300044684 Bacteria 578
737 Ga0466963_0360437 3300044694 Unclassified 1024
738 Ga0466959_0214317 3300045049 Bacteria 1337
739 Ga0451576_0170815 3300045051 Bacteria 2269
740 Ga0451576_0184905 3300045051 Bacteria 2176
741 Ga0451576_0189609 3300045051 Bacteria 2147
742 Ga0451576_0202524 3300045051 Bacteria 2073
743 Ga0451576_0388994 3300045051 Bacteria 1462
744 Ga0451576_0460866 3300045051 Bacteria 1335
745 Ga0451576_2040148 3300045051 Bacteria 590
746 Ga0466958_0105273 3300045836 Bacteria 1758
747 Ga0466967_0007283 3300045976 Bacteria 7964
748 Ga0495629_0130700 3300046459 Bacteria 1749
749 Ga0495629_0260972 3300046459 Bacteria 1191
750 Ga0495580_0001855 3300046472 Bacteria 18582
751 Ga0495580_0011369 3300046472 Bacteria 6888
752 Ga0495580_0123404 3300046472 Bacteria 1798
753 Ga0495582_0265669 3300046473 Bacteria 984
754 Ga0495594_0023223 3300046499 Bacteria 3322
755 Ga0495628_0050873 3300046516 Bacteria 3277
756 Ga0495663_0053817 3300046525 Bacteria 1252
757 Ga0495642_0165177 3300046528 Bacteria 961
758 Ga0495652_0277204 3300046529 Bacteria 1229
759 Ga0495665_0162088 3300046531 Bacteria 1165
760 Ga0495665_0453408 3300046531 Bacteria 648
761 Ga0495586_0013411 3300046535 Bacteria 4346
762 Ga0495586_0157726 3300046535 Bacteria 1279
763 Ga0495609_0280561 3300046538 Bacteria 681
764 Ga0495621_0008177 3300046539 Bacteria 3126
765 Ga0495621_0008551 3300046539 Bacteria 3075
766 Ga0495621_0092616 3300046539 Bacteria 1141
767 Ga0495621_0204949 3300046539 Bacteria 794
768 Ga0495645_0000710 3300046543 Bacteria 22853
769 Ga0495667_0056115 3300046559 Bacteria 2590
770 Ga0495667_0122252 3300046559 Bacteria 1681
771 Ga0495625_0000547 3300046660 Bacteria 55124
772 Ga0495659_0028743 3300046664 Bacteria 1925
773 Ga0495659_0056166 3300046664 Bacteria 1444
774 Ga0495588_0008624 3300046674 Bacteria 4684
775 Ga0495623_0006725 3300046679 Bacteria 7483
776 Ga0495647_0104313 3300046681 Bacteria 1177
777 Ga0495647_0157165 3300046681 Bacteria 978
778 Ga0495658_0033080 3300046683 Bacteria 2829
779 Ga0495658_0100149 3300046683 Bacteria 1729
780 Ga0495658_0126225 3300046683 Bacteria 1553
781 Ga0495658_0127865 3300046683 Bacteria 1544
782 Ga0495669_0010491 3300046684 Bacteria 3917
783 Ga0495670_0344805 3300046691 Bacteria 801
784 Ga0495649_0024081 3300046694 Bacteria 3398
785 Ga0495649_0070501 3300046694 Unclassified 1874
786 Ga0495636_0019947 3300047318 Bacteria 2698
787 Ga0495636_0157113 3300047318 Bacteria 1023
788 Ga0495636_0343549 3300047318 Bacteria 704
789 Ga0495674_0392667 3300047319 Bacteria 1121
790 Ga0495672_0076098 3300047320 Bacteria 1886
791 Ga0495676_0395344 3300047321 Bacteria 918
792 Ga0495675_0005338 3300047444 Bacteria 7830
793 Ga0495677_0073081 3300047445 Bacteria 1279
794 Ga0495684_0206457 3300047471 Bacteria 1446
795 Ga0495686_0112987 3300047472 Bacteria 1627
796 Ga0495602_0504306 3300048088 Bacteria 845
797 Ga0496100_0186544 3300048903 Bacteria 1503
798 Ga0496102_0851790 3300048905 Bacteria 834
799 Ga0496104_0000969 3300048907 Bacteria 24651
800 Ga0496106_0003284 3300048909 Bacteria 12081
801 Ga0496106_0493575 3300048909 Bacteria 984
802 Ga0496108_0257660 3300048911 Bacteria 1518
803 Ga0496108_0386664 3300048911 Bacteria 1222
804 Ga0496109_0164921 3300048912 Bacteria 2077
805 Ga0496109_0678429 3300048912 Bacteria 968
806 Ga0496112_0285768 3300048915 Bacteria 1596
807 Ga0501031_0091725 3300049568 Bacteria 1982
808 Ga0501031_0308398 3300049568 Bacteria 1025
809 Ga0501032_0005818 3300049569 Bacteria 9121
810 Ga0501032_0008491 3300049569 Bacteria 7489
811 Ga0501033_0033973 3300049570 Bacteria 3827
812 Ga0501033_0198030 3300049570 Bacteria 1436
813 Ga0501033_0918010 3300049570 Bacteria 588
814 Ga0501034_0001243 3300049571 Bacteria 34628
815 Ga0501034_0026502 3300049571 Bacteria 5903
816 Ga0501034_0183834 3300049571 Bacteria 2054
817 Ga0501034_0442924 3300049571 Bacteria 1217
818 Ga0501036_0005033 3300049572 Bacteria 10695
819 Ga0501036_0105328 3300049572 Bacteria 2385
820 Ga0501036_0259153 3300049572 Bacteria 1457
821 Ga0501037_0040085 3300049573 Bacteria 3447
822 Ga0501038_0013231 3300049574 Bacteria 7526
823 Ga0501038_0057399 3300049574 Bacteria 3342
824 Ga0501038_0193655 3300049574 Bacteria 1635
825 Ga0501039_0012793 3300049575 Bacteria 6414
826 Ga0501039_0016198 3300049575 Bacteria 5711
827 Ga0501042_0457112 3300049578 Bacteria 926
828 Ga0501042_0625308 3300049578 Bacteria 783
829 Ga0501043_0187706 3300049579 Bacteria 1608
830 Ga0501043_0485531 3300049579 Bacteria 924
831 Ga0501046_0001245 3300049580 Bacteria 24637
832 Ga0501046_0028017 3300049580 Bacteria 4591
833 Ga0501046_0062230 3300049580 Bacteria 2917
834 Ga0501047_0018586 3300049581 Bacteria 6662
835 Ga0501047_0065211 3300049581 Bacteria 3510
836 Ga0501047_0239918 3300049581 Bacteria 1664
837 Ga0501048_0089418 3300049582 Bacteria 2172
838 Ga0501067_0046467 3300049583 Bacteria 2410
839 Ga0501067_0081628 3300049583 Bacteria 1792
840 Ga0501067_0201164 3300049583 Bacteria 1109
841 Ga0501068_0109988 3300049584 Bacteria 1713
842 Ga0501068_0149271 3300049584 Bacteria 1468
843 Ga0501069_0029834 3300049585 Bacteria 2993
844 Ga0501071_0773627 3300049587 Bacteria 740
845 Ga0501073_0002552 3300049589 Bacteria 13613
846 Ga0501073_0040918 3300049589 Bacteria 3276
847 Ga0501073_0176897 3300049589 Bacteria 1477
848 Ga0501077_0251029 3300049593 Bacteria 1125
849 Ga0501229_032467 3300049706 Bacteria 721
850 Ga0501080_0002574 3300049742 Bacteria 15883
851 Ga0501080_0057869 3300049742 Bacteria 3608
852 Ga0501080_0862968 3300049742 Bacteria 791
853 Ga0501081_0755190 3300049743 Bacteria 731
854 Ga0501283_058035 3300049779 Bacteria 695
855 Ga0501035_0096190 3300049822 Bacteria 2602
856 Ga0501044_0037786 3300049823 Bacteria 5045
857 Ga0501044_1327420 3300049823 Bacteria 585
858 nmdc:mga03683_16448_c1 3300050489 Bacteria 2779
859 nmdc:mga03n38_131196_c1 3300050490 Bacteria 1242
860 nmdc:mga00v17_48917_c1 3300050491 Bacteria 2563
861 nmdc:mga00v17_6590_c1 3300050491 Bacteria 6165
862 nmdc:mga0yw44_1187327_c1 3300050492 Bacteria 515
863 nmdc:mga0yw44_53351_c1 3300050492 Bacteria 2455
864 nmdc:mga0k408_120337_c1 3300050493 Bacteria 1554
865 nmdc:mga0k408_316656_c1 3300050493 Bacteria 931
866 nmdc:mga0k408_562_c1 3300050493 Bacteria 20449
867 nmdc:mga0k408_79000_c1 3300050493 Bacteria 1925
868 nmdc:mga06z11_21556_c1 3300050494 Bacteria 2996
869 nmdc:mga06z11_322010_c1 3300050494 Bacteria 922
870 nmdc:mga06z11_42985_c1 3300050494 Bacteria 2270
871 nmdc:mga04h51_276360_c1 3300050495 Bacteria 679
872 nmdc:mga07m45_91381_c1 3300050496 Bacteria 1744
873 nmdc:mga05p37_100453_c1 3300050507 Bacteria 3563
874 nmdc:mga05p37_14640_c1 3300050507 Bacteria 9423
875 nmdc:mga05p37_228848_c1 3300050507 Bacteria 2241
876 nmdc:mga05p37_89722_c1 3300050507 Bacteria 3788
877 nmdc:mga09592_175559_c1 3300050508 Bacteria 1853
878 nmdc:mga09592_239135_c1 3300050508 Bacteria 1573
879 nmdc:mga09592_881781_c1 3300050508 Bacteria 753
880 nmdc:mga06r32_160294_c1 3300050510 Bacteria 2232
881 nmdc:mga06r32_26610_c1 3300050510 Bacteria 5396
882 nmdc:mga06r32_707144_c1 3300050510 Bacteria 973
883 nmdc:mga06r32_756692_c1 3300050510 Bacteria 934
884 nmdc:mga08y16_1625_c1 3300050511 Bacteria 22760
885 nmdc:mga08y16_232565_c1 3300050511 Bacteria 1906
886 nmdc:mga08y16_265700_c1 3300050511 Bacteria 1771
887 nmdc:mga08y16_273209_c1 3300050511 Bacteria 1744
888 nmdc:mga08y16_34591_c1 3300050511 Bacteria 5308
889 nmdc:mga08y16_350641_c1 3300050511 Bacteria 1516
890 nmdc:mga08y16_508_c1 3300050511 Bacteria 35851
891 nmdc:mga08y16_95576_c1 3300050511 Bacteria 3095
892 nmdc:mga0n895_1016429_c1 3300050512 Bacteria 810
893 nmdc:mga0n895_17167_c1 3300050512 Bacteria 6668
894 nmdc:mga0n895_179851_c1 3300050512 Bacteria 2146
895 nmdc:mga0n895_226659_c1 3300050512 Bacteria 1897
896 nmdc:mga0n895_401194_c1 3300050512 Bacteria 1387
897 nmdc:mga0n895_54242_c1 3300050512 Bacteria 3942
898 nmdc:mga0n895_5969_c1 3300050512 Bacteria 10253
899 nmdc:mga0rr50_238511_c1 3300050513 Bacteria 1507
900 nmdc:mga0rr50_444054_c1 3300050513 Bacteria 1099
901 nmdc:mga0a205_115024_c1 3300050515 Bacteria 2589
902 nmdc:mga0a205_11699_c1 3300050515 Bacteria 8092
903 nmdc:mga0a205_161993_c1 3300050515 Bacteria 2133
904 nmdc:mga0a205_192722_c1 3300050515 Bacteria 1930
905 nmdc:mga0a205_226729_c1 3300050515 Bacteria 1753
906 nmdc:mga0a205_283278_c1 3300050515 Bacteria 1533
907 nmdc:mga0a205_38247_c1 3300050515 Bacteria 4615
908 nmdc:mga0a205_709217_c1 3300050515 Bacteria 856
909 nmdc:mga0sz30_165393_c1 3300050516 Bacteria 980
910 nmdc:mga0sz30_386683_c1 3300050516 Bacteria 626
911 Ga0495619_0193312 3300053085 Bacteria 1408
912 Ga0500651_0380457 3300053093 Bacteria 796
913 Ga0500555_000149 3300053103 Bacteria 33331
914 Ga0500616_0000926 3300053153 Bacteria 32073
915 Ga0500645_000610 3300053730 Bacteria 22872
916 Ga0500599_009884 3300053736 Bacteria 1255
917 Ga0501084_0143910 3300054114 Bacteria 2008
918 Ga0501084_0209291 3300054114 Bacteria 1646
919 Ga0590075_055424 3300059424 Bacteria 1019
920 Ga0590077_016929 3300059426 Bacteria 1531
921 Ga0590077_060551 3300059426 Bacteria 858
922 Ga0501082_0018151 3300060353 Bacteria 6057
923 Ga0501082_0044691 3300060353 Bacteria 3820

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100080712 Ga0075363_1000807123 147
2 3300009094 Ga0111539_10214093 Ga0111539_102140933 147
3 3300050511 nmdc:mga08y16_232565_c1 nmdc:mga08y16_232565_c1_1392_1844 147
4 3300005441 Ga0070700_100567286 Ga0070700_1005672861 148
5 3300006177 Ga0075362_10629209 Ga0075362_106292091 148
6 3300009093 Ga0105240_10069451 Ga0105240_100694512 148
7 3300009545 Ga0105237_10443189 Ga0105237_104431892 148
8 3300014325 Ga0163163_10935413 Ga0163163_109354132 148
9 3300025913 Ga0207695_10068761 Ga0207695_100687612 148
10 3300025914 Ga0207671_10301280 Ga0207671_103012802 148
11 3300042000 Ga0439437_012012 Ga0439437_012012_324_776 148
12 3300005548 Ga0070665_102073083 Ga0070665_1020730831 149
13 3300026116 Ga0207674_10113784 Ga0207674_101137842 149
14 3300028379 Ga0268266_10010565 Ga0268266_100105656 149
15 3300028379 Ga0268266_10062215 Ga0268266_100622152 149
16 3300031903 Ga0307407_11324085 Ga0307407_113240851 149
17 3300044673 Ga0453683_0029383 Ga0453683_0029383_720_1175 149
18 3300046459 Ga0495629_0130700 Ga0495629_0130700_1021_1497 149
19 3300046531 Ga0495665_0162088 Ga0495665_0162088_327_803 149
20 3300046660 Ga0495625_0000547 Ga0495625_0000547_43045_43503 149
21 3300046681 Ga0495647_0157165 Ga0495647_0157165_53_532 149
22 3300046683 Ga0495658_0126225 Ga0495658_0126225_996_1472 149
23 3300046694 Ga0495649_0024081 Ga0495649_0024081_791_1249 149
24 3300046694 Ga0495649_0070501 Ga0495649_0070501_1139_1597 149
25 3300047472 Ga0495686_0112987 Ga0495686_0112987_258_716 149
26 3300048907 Ga0496104_0000969 Ga0496104_0000969_22797_23255 149
27 3300048911 Ga0496108_0386664 Ga0496108_0386664_639_1091 149
28 3300048912 Ga0496109_0678429 Ga0496109_0678429_230_682 149
29 3300050490 nmdc:mga03n38_131196_c1 nmdc:mga03n38_131196_c1_545_1024 149
30 3300005334 Ga0068869_100223111 Ga0068869_1002231112 150
31 3300005340 Ga0070689_100012437 Ga0070689_1000124372 150
32 3300005340 Ga0070689_100408684 Ga0070689_1004086842 150
33 3300005343 Ga0070687_100028627 Ga0070687_1000286271 150
34 3300005345 Ga0070692_10609117 Ga0070692_106091172 150
35 3300005347 Ga0070668_100394977 Ga0070668_1003949772 150
36 3300005353 Ga0070669_101597382 Ga0070669_1015973821 150
37 3300005354 Ga0070675_100016669 Ga0070675_1000166692 150
38 3300005356 Ga0070674_100010963 Ga0070674_1000109632 150
39 3300005365 Ga0070688_100070024 Ga0070688_1000700242 150
40 3300005367 Ga0070667_100631916 Ga0070667_1006319162 150
41 3300005441 Ga0070700_100111617 Ga0070700_1001116172 150
42 3300005445 Ga0070708_100004776 Ga0070708_1000047766 150
43 3300005455 Ga0070663_100065241 Ga0070663_1000652412 150
44 3300005456 Ga0070678_100008110 Ga0070678_1000081103 150
45 3300005457 Ga0070662_100462316 Ga0070662_1004623162 150
46 3300005459 Ga0068867_100274630 Ga0068867_1002746302 150
47 3300005466 Ga0070685_10011040 Ga0070685_100110405 150
48 3300005467 Ga0070706_100091319 Ga0070706_1000913191 150
49 3300005518 Ga0070699_100395356 Ga0070699_1003953562 150
50 3300005543 Ga0070672_100014726 Ga0070672_1000147263 150
51 3300005546 Ga0070696_100035084 Ga0070696_1000350843 150
52 3300005547 Ga0070693_101404422 Ga0070693_1014044221 150
53 3300005548 Ga0070665_102122933 Ga0070665_1021229331 150
54 3300005577 Ga0068857_101863108 Ga0068857_1018631081 150
55 3300005615 Ga0070702_100065204 Ga0070702_1000652042 150
56 3300005616 Ga0068852_100663846 Ga0068852_1006638461 150
57 3300005617 Ga0068859_101237010 Ga0068859_1012370102 150
58 3300005719 Ga0068861_100007890 Ga0068861_1000078902 150
59 3300005840 Ga0068870_10022791 Ga0068870_100227912 150
60 3300005841 Ga0068863_100038626 Ga0068863_1000386262 150
61 3300005842 Ga0068858_100008252 Ga0068858_1000082522 150
62 3300005843 Ga0068860_100006938 Ga0068860_1000069385 150
63 3300005844 Ga0068862_100007216 Ga0068862_1000072167 150
64 3300006038 Ga0075365_10008317 Ga0075365_100083172 150
65 3300006038 Ga0075365_10226393 Ga0075365_102263932 150
66 3300006051 Ga0075364_10164752 Ga0075364_101647522 150
67 3300006177 Ga0075362_10038042 Ga0075362_100380422 150
68 3300006177 Ga0075362_10068299 Ga0075362_100682992 150
69 3300006178 Ga0075367_10021436 Ga0075367_100214362 150
70 3300006186 Ga0075369_10346076 Ga0075369_103460761 150
71 3300006195 Ga0075366_10000128 Ga0075366_1000012819 150
72 3300006353 Ga0075370_10096103 Ga0075370_100961032 150
73 3300006844 Ga0075428_100354165 Ga0075428_1003541652 150
74 3300006847 Ga0075431_100009878 Ga0075431_1000098785 150
75 3300006847 Ga0075431_100600220 Ga0075431_1006002202 150
76 3300006852 Ga0075433_10487469 Ga0075433_104874692 150
77 3300006871 Ga0075434_100481010 Ga0075434_1004810102 150
78 3300006880 Ga0075429_100499549 Ga0075429_1004995492 150
79 3300006881 Ga0068865_100018249 Ga0068865_1000182495 150
80 3300006931 Ga0097620_101236971 Ga0097620_1012369712 150
81 3300007076 Ga0075435_100008302 Ga0075435_1000083025 150
82 3300009094 Ga0111539_10000305 Ga0111539_100003052 150
83 3300009098 Ga0105245_10232054 Ga0105245_102320542 150
84 3300009147 Ga0114129_10136702 Ga0114129_101367023 150
85 3300009147 Ga0114129_11554625 Ga0114129_115546252 150
86 3300009148 Ga0105243_10107591 Ga0105243_101075912 150
87 3300009176 Ga0105242_10446394 Ga0105242_104463942 150
88 3300009176 Ga0105242_10518490 Ga0105242_105184901 150
89 3300009176 Ga0105242_11566740 Ga0105242_115667401 150
90 3300009177 Ga0105248_10008266 Ga0105248_100082662 150
91 3300009553 Ga0105249_10243759 Ga0105249_102437592 150
92 3300013308 Ga0157375_10009133 Ga0157375_100091334 150
93 3300014326 Ga0157380_10006107 Ga0157380_100061077 150
94 3300014745 Ga0157377_10028243 Ga0157377_100282433 150
95 3300014968 Ga0157379_10511353 Ga0157379_105113532 150
96 3300025893 Ga0207682_10095712 Ga0207682_100957122 150
97 3300025901 Ga0207688_10981361 Ga0207688_109813611 150
98 3300025908 Ga0207643_10015211 Ga0207643_100152115 150
99 3300025918 Ga0207662_10002499 Ga0207662_100024997 150
100 3300025923 Ga0207681_10386957 Ga0207681_103869572 150
101 3300025926 Ga0207659_10867036 Ga0207659_108670362 150
102 3300025927 Ga0207687_10334648 Ga0207687_103346481 150
103 3300025933 Ga0207706_10043260 Ga0207706_100432605 150
104 3300025933 Ga0207706_10536726 Ga0207706_105367262 150
105 3300025934 Ga0207686_10058992 Ga0207686_100589922 150
106 3300025934 Ga0207686_10125458 Ga0207686_101254582 150
107 3300025935 Ga0207709_10098536 Ga0207709_100985362 150
108 3300025936 Ga0207670_10193190 Ga0207670_101931902 150
109 3300025937 Ga0207669_10012338 Ga0207669_100123382 150
110 3300025938 Ga0207704_10075915 Ga0207704_100759152 150
111 3300025940 Ga0207691_10008916 Ga0207691_100089161 150
112 3300025942 Ga0207689_10116195 Ga0207689_101161952 150
113 3300025960 Ga0207651_10964533 Ga0207651_109645331 150
114 3300025961 Ga0207712_10220360 Ga0207712_102203602 150
115 3300025981 Ga0207640_10571352 Ga0207640_105713522 150
116 3300025986 Ga0207658_10342942 Ga0207658_103429422 150
117 3300026023 Ga0207677_10260150 Ga0207677_102601502 150
118 3300026023 Ga0207677_10773124 Ga0207677_107731241 150
119 3300026067 Ga0207678_10136040 Ga0207678_101360402 150
120 3300026075 Ga0207708_10009542 Ga0207708_100095426 150
121 3300026089 Ga0207648_10001666 Ga0207648_1000166610 150
122 3300026095 Ga0207676_10050368 Ga0207676_100503683 150
123 3300026095 Ga0207676_10508054 Ga0207676_105080542 150
124 3300026118 Ga0207675_100006526 Ga0207675_1000065262 150
125 3300026118 Ga0207675_100066641 Ga0207675_1000666412 150
126 3300026118 Ga0207675_100562902 Ga0207675_1005629022 150
127 3300026121 Ga0207683_10037284 Ga0207683_100372841 150
128 3300027907 Ga0207428_10000161 Ga0207428_1000016160 150
129 3300028379 Ga0268266_12185581 Ga0268266_121855811 150
130 3300028380 Ga0268265_10084962 Ga0268265_100849622 150
131 3300028380 Ga0268265_10426551 Ga0268265_104265512 150
132 3300028381 Ga0268264_10068440 Ga0268264_100684402 150
133 3300031727 Ga0316576_10109211 Ga0316576_101092113 150
134 3300031728 Ga0316578_10166595 Ga0316578_101665952 150
135 3300031733 Ga0316577_10445168 Ga0316577_104451681 150
136 3300034816 Ga0373930_0057583 Ga0373930_0057583_297_755 150
137 3300034957 Ga0373938_0023785 Ga0373938_0023785_503_961 150
138 3300035084 Ga0373928_0246325 Ga0373928_0246325_39_497 150
139 3300035085 Ga0373929_0035750 Ga0373929_0035750_201_659 150
140 3300035091 Ga0373951_0126760 Ga0373951_0126760_10_468 150
141 3300035112 Ga0373932_0115079 Ga0373932_0115079_392_850 150
142 3300035207 Ga0373942_0171991 Ga0373942_0171991_185_643 150
143 3300035241 Ga0373961_0014911 Ga0373961_0014911_1462_1920 150
144 3300038996 Ga0242420_000431 Ga0242420_000431_1057_1515 150
145 3300042012 Ga0439455_0156884 Ga0439455_0156884_185_637 150
146 3300042876 Ga0451577_0680249 Ga0451577_0680249_152_610 150
147 3300046684 Ga0495669_0010491 Ga0495669_0010491_1472_1933 150
148 3300047318 Ga0495636_0019947 Ga0495636_0019947_2208_2663 150
149 3300049583 Ga0501067_0046467 Ga0501067_0046467_1618_2076 150
150 3300050489 nmdc:mga03683_16448_c1 nmdc:mga03683_16448_c1_1401_1862 150
151 3300050491 nmdc:mga00v17_6590_c1 nmdc:mga00v17_6590_c1_5462_5923 150
152 3300050492 nmdc:mga0yw44_1187327_c1 nmdc:mga0yw44_1187327_c1_22_483 150
153 3300050492 nmdc:mga0yw44_53351_c1 nmdc:mga0yw44_53351_c1_1008_1469 150
154 3300050493 nmdc:mga0k408_562_c1 nmdc:mga0k408_562_c1_2059_2520 150
155 3300050494 nmdc:mga06z11_42985_c1 nmdc:mga06z11_42985_c1_713_1174 150
156 3300050496 nmdc:mga07m45_91381_c1 nmdc:mga07m45_91381_c1_698_1159 150
157 3300050507 nmdc:mga05p37_89722_c1 nmdc:mga05p37_89722_c1_2308_2769 150
158 3300050508 nmdc:mga09592_239135_c1 nmdc:mga09592_239135_c1_736_1197 150
159 3300050510 nmdc:mga06r32_26610_c1 nmdc:mga06r32_26610_c1_2321_2782 150
160 3300050511 nmdc:mga08y16_1625_c1 nmdc:mga08y16_1625_c1_17828_18289 150
161 3300050512 nmdc:mga0n895_54242_c1 nmdc:mga0n895_54242_c1_902_1363 150
162 3300050515 nmdc:mga0a205_192722_c1 nmdc:mga0a205_192722_c1_549_1007 150
163 3300050515 nmdc:mga0a205_709217_c1 nmdc:mga0a205_709217_c1_358_816 150
164 3300050516 nmdc:mga0sz30_386683_c1 nmdc:mga0sz30_386683_c1_31_492 150
165 3300005336 Ga0070680_100111613 Ga0070680_1001116132 151
166 3300005353 Ga0070669_100876929 Ga0070669_1008769292 151
167 3300005354 Ga0070675_100613815 Ga0070675_1006138152 151
168 3300005455 Ga0070663_101592817 Ga0070663_1015928171 151
169 3300005456 Ga0070678_100570285 Ga0070678_1005702851 151
170 3300005458 Ga0070681_10043237 Ga0070681_100432373 151
171 3300005458 Ga0070681_10606477 Ga0070681_106064772 151
172 3300005471 Ga0070698_100262333 Ga0070698_1002623332 151
173 3300005530 Ga0070679_100053079 Ga0070679_1000530793 151
174 3300005543 Ga0070672_101162140 Ga0070672_1011621402 151
175 3300005544 Ga0070686_100115510 Ga0070686_1001155102 151
176 3300005547 Ga0070693_101475564 Ga0070693_1014755641 151
177 3300005616 Ga0068852_100958469 Ga0068852_1009584692 151
178 3300005617 Ga0068859_100776857 Ga0068859_1007768572 151
179 3300005618 Ga0068864_101185630 Ga0068864_1011856302 151
180 3300005719 Ga0068861_101530840 Ga0068861_1015308402 151
181 3300005844 Ga0068862_100813993 Ga0068862_1008139931 151
182 3300006846 Ga0075430_100882018 Ga0075430_1008820181 151
183 3300006881 Ga0068865_100728584 Ga0068865_1007285842 151
184 3300006931 Ga0097620_100776833 Ga0097620_1007768332 151
185 3300009174 Ga0105241_10131094 Ga0105241_101310942 151
186 3300009176 Ga0105242_10091885 Ga0105242_100918852 151
187 3300009176 Ga0105242_10963427 Ga0105242_109634272 151
188 3300009177 Ga0105248_10427070 Ga0105248_104270702 151
189 3300009177 Ga0105248_11041428 Ga0105248_110414281 151
190 3300009551 Ga0105238_10103316 Ga0105238_101033163 151
191 3300009553 Ga0105249_11140213 Ga0105249_111402132 151
192 3300013306 Ga0163162_10102417 Ga0163162_101024175 151
193 3300013308 Ga0157375_10891583 Ga0157375_108915831 151
194 3300025912 Ga0207707_10028110 Ga0207707_100281103 151
195 3300025912 Ga0207707_10512288 Ga0207707_105122882 151
196 3300025917 Ga0207660_10075669 Ga0207660_100756692 151
197 3300025921 Ga0207652_10306718 Ga0207652_103067182 151
198 3300025923 Ga0207681_10854491 Ga0207681_108544911 151
199 3300025924 Ga0207694_10010888 Ga0207694_100108884 151
200 3300025938 Ga0207704_10597652 Ga0207704_105976522 151
201 3300025941 Ga0207711_10129164 Ga0207711_101291641 151
202 3300025941 Ga0207711_10448695 Ga0207711_104486952 151
203 3300025961 Ga0207712_11132371 Ga0207712_111323711 151
204 3300026142 Ga0207698_10927402 Ga0207698_109274022 151
205 3300027665 Ga0209983_1044054 Ga0209983_10440542 151
206 3300035085 Ga0373929_0009852 Ga0373929_0009852_500_961 151
207 3300035088 Ga0373940_0021054 Ga0373940_0021054_399_860 151
208 3300035115 Ga0373941_0009680 Ga0373941_0009680_1637_2098 151
209 3300035242 Ga0373962_0129334 Ga0373962_0129334_22_483 151
210 3300035691 Ga0373931_0001831 Ga0373931_0001831_1735_2196 151
211 3300038996 Ga0242420_002167 Ga0242420_002167_1319_1780 151
212 3300046472 Ga0495580_0001855 Ga0495580_0001855_1525_2001 151
213 3300046472 Ga0495580_0011369 Ga0495580_0011369_5135_5617 151
214 3300048905 Ga0496102_0851790 Ga0496102_0851790_205_666 151
215 3300005353 Ga0070669_101535655 Ga0070669_1015356551 152
216 3300005617 Ga0068859_100436540 Ga0068859_1004365402 152
217 3300005719 Ga0068861_101936590 Ga0068861_1019365901 152
218 3300006871 Ga0075434_100240855 Ga0075434_1002408552 152
219 3300006931 Ga0097620_100436498 Ga0097620_1004364982 152
220 3300007076 Ga0075435_100218556 Ga0075435_1002185562 152
221 3300025923 Ga0207681_11223622 Ga0207681_112236221 152
222 3300042439 Ga0439464_0124002 Ga0439464_0124002_200_724 152
223 3300042876 Ga0451577_0536882 Ga0451577_0536882_360_836 152
224 3300044673 Ga0453683_0355886 Ga0453683_0355886_160_636 152
225 3300045051 Ga0451576_0170815 Ga0451576_0170815_260_736 152
226 3300050512 nmdc:mga0n895_226659_c1 nmdc:mga0n895_226659_c1_1072_1548 152
227 3300050513 nmdc:mga0rr50_444054_c1 nmdc:mga0rr50_444054_c1_258_734 152
228 3300005330 Ga0070690_100045101 Ga0070690_1000451012 153
229 3300005406 Ga0070703_10140660 Ga0070703_101406602 153
230 3300005617 Ga0068859_100408803 Ga0068859_1004088032 153
231 3300005842 Ga0068858_100180314 Ga0068858_1001803143 153
232 3300006931 Ga0097620_100408773 Ga0097620_1004087732 153
233 3300009148 Ga0105243_10011189 Ga0105243_100111895 153
234 3300009176 Ga0105242_10031909 Ga0105242_100319094 153
235 3300009177 Ga0105248_10557109 Ga0105248_105571092 153
236 3300013297 Ga0157378_10000001 Ga0157378_10000001208 153
237 3300013308 Ga0157375_10015147 Ga0157375_100151474 153
238 3300025934 Ga0207686_10016982 Ga0207686_100169824 153
239 3300025935 Ga0207709_10008410 Ga0207709_100084103 153
240 3300025941 Ga0207711_10321484 Ga0207711_103214842 153
241 3300048903 Ga0496100_0186544 Ga0496100_0186544_177_644 153
242 3300048909 Ga0496106_0003284 Ga0496106_0003284_4233_4700 153
243 3300049580 Ga0501046_0028017 Ga0501046_0028017_2628_3143 153
244 3300049743 Ga0501081_0755190 Ga0501081_0755190_206_691 153
245 3300004800 Ga0058861_12020206 Ga0058861_120202062 154
246 3300004803 Ga0058862_12814246 Ga0058862_128142462 154
247 3300005293 Ga0065715_10297279 Ga0065715_102972792 154
248 3300005295 Ga0065707_10334780 Ga0065707_103347802 154
249 3300005327 Ga0070658_10751912 Ga0070658_107519121 154
250 3300005329 Ga0070683_100175248 Ga0070683_1001752482 154
251 3300005329 Ga0070683_100198594 Ga0070683_1001985942 154
252 3300005333 Ga0070677_10153175 Ga0070677_101531751 154
253 3300005335 Ga0070666_10228771 Ga0070666_102287711 154
254 3300005336 Ga0070680_100007201 Ga0070680_1000072012 154
255 3300005340 Ga0070689_100106941 Ga0070689_1001069412 154
256 3300005343 Ga0070687_100216610 Ga0070687_1002166102 154
257 3300005347 Ga0070668_100195213 Ga0070668_1001952132 154
258 3300005353 Ga0070669_101778821 Ga0070669_1017788211 154
259 3300005354 Ga0070675_100435936 Ga0070675_1004359362 154
260 3300005354 Ga0070675_100538305 Ga0070675_1005383051 154
261 3300005356 Ga0070674_100762128 Ga0070674_1007621282 154
262 3300005364 Ga0070673_102077160 Ga0070673_1020771601 154
263 3300005365 Ga0070688_100018960 Ga0070688_1000189603 154
264 3300005367 Ga0070667_100664685 Ga0070667_1006646852 154
265 3300005434 Ga0070709_10010190 Ga0070709_100101902 154
266 3300005435 Ga0070714_100073766 Ga0070714_1000737663 154
267 3300005438 Ga0070701_10302011 Ga0070701_103020112 154
268 3300005440 Ga0070705_100019094 Ga0070705_1000190942 154
269 3300005444 Ga0070694_100948023 Ga0070694_1009480231 154
270 3300005445 Ga0070708_100012380 Ga0070708_1000123804 154
271 3300005445 Ga0070708_100045665 Ga0070708_1000456652 154
272 3300005455 Ga0070663_101332137 Ga0070663_1013321371 154
273 3300005457 Ga0070662_100635530 Ga0070662_1006355302 154
274 3300005458 Ga0070681_10048676 Ga0070681_100486762 154
275 3300005466 Ga0070685_10637608 Ga0070685_106376081 154
276 3300005467 Ga0070706_100009975 Ga0070706_1000099752 154
277 3300005467 Ga0070706_100597921 Ga0070706_1005979211 154
278 3300005468 Ga0070707_100302128 Ga0070707_1003021282 154
279 3300005468 Ga0070707_100657558 Ga0070707_1006575581 154
280 3300005471 Ga0070698_100518363 Ga0070698_1005183631 154
281 3300005530 Ga0070679_100000595 Ga0070679_1000005953 154
282 3300005535 Ga0070684_100004296 Ga0070684_1000042962 154
283 3300005535 Ga0070684_100064604 Ga0070684_1000646042 154
284 3300005535 Ga0070684_100322287 Ga0070684_1003222872 154
285 3300005535 Ga0070684_101126476 Ga0070684_1011264762 154
286 3300005544 Ga0070686_100059272 Ga0070686_1000592722 154
287 3300005548 Ga0070665_100223513 Ga0070665_1002235132 154
288 3300005549 Ga0070704_100695565 Ga0070704_1006955651 154
289 3300005549 Ga0070704_101288635 Ga0070704_1012886351 154
290 3300005563 Ga0068855_100031356 Ga0068855_1000313562 154
291 3300005577 Ga0068857_100549781 Ga0068857_1005497812 154
292 3300005614 Ga0068856_100442317 Ga0068856_1004423172 154
293 3300005617 Ga0068859_100137579 Ga0068859_1001375792 154
294 3300005617 Ga0068859_101014513 Ga0068859_1010145132 154
295 3300005617 Ga0068859_101154645 Ga0068859_1011546451 154
296 3300005617 Ga0068859_102492342 Ga0068859_1024923421 154
297 3300005840 Ga0068870_10288969 Ga0068870_102889692 154
298 3300005841 Ga0068863_100181805 Ga0068863_1001818052 154
299 3300005842 Ga0068858_100671224 Ga0068858_1006712242 154
300 3300005844 Ga0068862_100176479 Ga0068862_1001764792 154
301 3300005844 Ga0068862_100743451 Ga0068862_1007434511 154
302 3300006173 Ga0070716_100740760 Ga0070716_1007407602 154
303 3300006881 Ga0068865_100113907 Ga0068865_1001139072 154
304 3300006931 Ga0097620_100137586 Ga0097620_1001375862 154
305 3300006931 Ga0097620_101014531 Ga0097620_1010145312 154
306 3300006931 Ga0097620_101154692 Ga0097620_1011546922 154
307 3300006931 Ga0097620_102492287 Ga0097620_1024922871 154
308 3300009093 Ga0105240_10312363 Ga0105240_103123632 154
309 3300009094 Ga0111539_10310608 Ga0111539_103106082 154
310 3300009098 Ga0105245_10169305 Ga0105245_101693051 154
311 3300009098 Ga0105245_10972118 Ga0105245_109721182 154
312 3300009147 Ga0114129_10086207 Ga0114129_100862072 154
313 3300009147 Ga0114129_10322886 Ga0114129_103228862 154
314 3300009148 Ga0105243_10793465 Ga0105243_107934652 154
315 3300009553 Ga0105249_10023451 Ga0105249_100234512 154
316 3300009553 Ga0105249_10326581 Ga0105249_103265812 154
317 3300013100 Ga0157373_10109563 Ga0157373_101095632 154
318 3300013104 Ga0157370_10127181 Ga0157370_101271812 154
319 3300013105 Ga0157369_10326981 Ga0157369_103269812 154
320 3300013105 Ga0157369_10641235 Ga0157369_106412352 154
321 3300013296 Ga0157374_10209306 Ga0157374_102093062 154
322 3300013306 Ga0163162_10547020 Ga0163162_105470202 154
323 3300013307 Ga0157372_10037384 Ga0157372_100373844 154
324 3300013307 Ga0157372_11631620 Ga0157372_116316201 154
325 3300013308 Ga0157375_12112007 Ga0157375_121120072 154
326 3300014326 Ga0157380_10253204 Ga0157380_102532042 154
327 3300014745 Ga0157377_10091167 Ga0157377_100911672 154
328 3300014969 Ga0157376_10477277 Ga0157376_104772772 154
329 3300017792 Ga0163161_10425001 Ga0163161_104250011 154
330 3300020069 Ga0197907_10821123 Ga0197907_108211232 154
331 3300020078 Ga0206352_10799656 Ga0206352_107996562 154
332 3300020082 Ga0206353_11065889 Ga0206353_110658892 154
333 3300020610 Ga0154015_1277831 Ga0154015_12778311 154
334 3300025893 Ga0207682_10037279 Ga0207682_100372792 154
335 3300025893 Ga0207682_10177049 Ga0207682_101770492 154
336 3300025903 Ga0207680_10049308 Ga0207680_100493082 154
337 3300025910 Ga0207684_10971157 Ga0207684_109711571 154
338 3300025912 Ga0207707_10062568 Ga0207707_100625682 154
339 3300025912 Ga0207707_10067530 Ga0207707_100675302 154
340 3300025913 Ga0207695_10031018 Ga0207695_100310184 154
341 3300025917 Ga0207660_10091568 Ga0207660_100915682 154
342 3300025918 Ga0207662_10063717 Ga0207662_100637172 154
343 3300025920 Ga0207649_10495927 Ga0207649_104959272 154
344 3300025921 Ga0207652_10080149 Ga0207652_100801492 154
345 3300025922 Ga0207646_10262756 Ga0207646_102627562 154
346 3300025922 Ga0207646_10540532 Ga0207646_105405321 154
347 3300025923 Ga0207681_10355140 Ga0207681_103551402 154
348 3300025925 Ga0207650_10246798 Ga0207650_102467982 154
349 3300025926 Ga0207659_10370100 Ga0207659_103701002 154
350 3300025927 Ga0207687_10094278 Ga0207687_100942782 154
351 3300025929 Ga0207664_10145500 Ga0207664_101455002 154
352 3300025933 Ga0207706_10252137 Ga0207706_102521372 154
353 3300025934 Ga0207686_10401457 Ga0207686_104014571 154
354 3300025936 Ga0207670_10190862 Ga0207670_101908622 154
355 3300025939 Ga0207665_10457601 Ga0207665_104576012 154
356 3300025940 Ga0207691_10243366 Ga0207691_102433662 154
357 3300025941 Ga0207711_10697684 Ga0207711_106976841 154
358 3300025941 Ga0207711_10795867 Ga0207711_107958672 154
359 3300025942 Ga0207689_10022249 Ga0207689_100222493 154
360 3300025944 Ga0207661_10011169 Ga0207661_100111694 154
361 3300025944 Ga0207661_10138409 Ga0207661_101384092 154
362 3300025944 Ga0207661_10275459 Ga0207661_102754592 154
363 3300025949 Ga0207667_10080730 Ga0207667_100807303 154
364 3300025961 Ga0207712_10327827 Ga0207712_103278272 154
365 3300025961 Ga0207712_10891877 Ga0207712_108918772 154
366 3300025986 Ga0207658_10468921 Ga0207658_104689212 154
367 3300026075 Ga0207708_10098231 Ga0207708_100982312 154
368 3300026078 Ga0207702_10087444 Ga0207702_100874442 154
369 3300026088 Ga0207641_10448214 Ga0207641_104482142 154
370 3300026089 Ga0207648_10614436 Ga0207648_106144362 154
371 3300026095 Ga0207676_10543477 Ga0207676_105434772 154
372 3300026116 Ga0207674_10691015 Ga0207674_106910151 154
373 3300026118 Ga0207675_100481829 Ga0207675_1004818292 154
374 3300026121 Ga0207683_10412199 Ga0207683_104121991 154
375 3300028380 Ga0268265_10376002 Ga0268265_103760022 154
376 3300028381 Ga0268264_11332091 Ga0268264_113320912 154
377 3300035086 Ga0373934_0005354 Ga0373934_0005354_1417_1908 154
378 3300035117 Ga0373953_0023333 Ga0373953_0023333_1089_1580 154
379 3300035118 Ga0373954_0397563 Ga0373954_0397563_144_635 154
380 3300035120 Ga0373957_0008536 Ga0373957_0008536_1342_1833 154
381 3300035172 Ga0373955_0021652 Ga0373955_0021652_2478_2969 154
382 3300035724 Ga0373933_0108617 Ga0373933_0108617_499_990 154
383 3300035725 Ga0373947_0150909 Ga0373947_0150909_881_1372 154
384 3300036401 Ga0373937_0261403 Ga0373937_0261403_94_585 154
385 3300044684 Ga0466966_0029559 Ga0466966_0029559_1203_1706 154
386 3300045049 Ga0466959_0214317 Ga0466959_0214317_700_1203 154
387 3300045836 Ga0466958_0105273 Ga0466958_0105273_359_862 154
388 3300045976 Ga0466967_0007283 Ga0466967_0007283_300_803 154
389 3300046516 Ga0495628_0050873 Ga0495628_0050873_857_1348 154
390 3300046529 Ga0495652_0277204 Ga0495652_0277204_656_1147 154
391 3300046531 Ga0495665_0453408 Ga0495665_0453408_96_587 154
392 3300046535 Ga0495586_0013411 Ga0495586_0013411_3110_3601 154
393 3300046543 Ga0495645_0000710 Ga0495645_0000710_11467_11958 154
394 3300046559 Ga0495667_0056115 Ga0495667_0056115_1002_1493 154
395 3300046679 Ga0495623_0006725 Ga0495623_0006725_974_1465 154
396 3300047319 Ga0495674_0392667 Ga0495674_0392667_616_1107 154
397 3300047444 Ga0495675_0005338 Ga0495675_0005338_1199_1690 154
398 3300047471 Ga0495684_0206457 Ga0495684_0206457_864_1355 154
399 3300048088 Ga0495602_0504306 Ga0495602_0504306_209_700 154
400 3300049578 Ga0501042_0625308 Ga0501042_0625308_122_595 154
401 3300049587 Ga0501071_0773627 Ga0501071_0773627_176_649 154
402 3300049589 Ga0501073_0176897 Ga0501073_0176897_315_788 154
403 3300050507 nmdc:mga05p37_100453_c1 nmdc:mga05p37_100453_c1_957_1427 154
404 3300050510 nmdc:mga06r32_707144_c1 nmdc:mga06r32_707144_c1_122_610 154
405 3300050511 nmdc:mga08y16_350641_c1 nmdc:mga08y16_350641_c1_559_1047 154
406 3300053085 Ga0495619_0193312 Ga0495619_0193312_488_979 154
407 3300054114 Ga0501084_0209291 Ga0501084_0209291_901_1374 154
408 3300005329 Ga0070683_100006225 Ga0070683_1000062254 155
409 3300005336 Ga0070680_100002196 Ga0070680_1000021967 155
410 3300005440 Ga0070705_100194451 Ga0070705_1001944512 155
411 3300005444 Ga0070694_100043438 Ga0070694_1000434383 155
412 3300005467 Ga0070706_100529935 Ga0070706_1005299351 155
413 3300005468 Ga0070707_100692490 Ga0070707_1006924901 155
414 3300005471 Ga0070698_100224520 Ga0070698_1002245202 155
415 3300005535 Ga0070684_100042162 Ga0070684_1000421621 155
416 3300005535 Ga0070684_100098615 Ga0070684_1000986152 155
417 3300005549 Ga0070704_100540642 Ga0070704_1005406421 155
418 3300005549 Ga0070704_101497196 Ga0070704_1014971962 155
419 3300005564 Ga0070664_100488519 Ga0070664_1004885192 155
420 3300005564 Ga0070664_100563886 Ga0070664_1005638862 155
421 3300005616 Ga0068852_100231606 Ga0068852_1002316062 155
422 3300006852 Ga0075433_10188470 Ga0075433_101884703 155
423 3300013307 Ga0157372_10313094 Ga0157372_103130942 155
424 3300014968 Ga0157379_11961963 Ga0157379_119619631 155
425 3300025910 Ga0207684_10504390 Ga0207684_105043902 155
426 3300025917 Ga0207660_10000818 Ga0207660_1000081810 155
427 3300025944 Ga0207661_10004508 Ga0207661_100045085 155
428 3300025944 Ga0207661_10041846 Ga0207661_100418462 155
429 3300025944 Ga0207661_10185135 Ga0207661_101851352 155
430 3300025945 Ga0207679_10100832 Ga0207679_101008322 155
431 3300025945 Ga0207679_10764722 Ga0207679_107647221 155
432 3300026041 Ga0207639_11365997 Ga0207639_113659971 155
433 3300026121 Ga0207683_10401139 Ga0207683_104011392 155
434 3300026142 Ga0207698_10021580 Ga0207698_100215802 155
435 3300035086 Ga0373934_0018545 Ga0373934_0018545_1504_1983 155
436 3300044694 Ga0466963_0360437 Ga0466963_0360437_241_735 155
437 3300050515 nmdc:mga0a205_161993_c1 nmdc:mga0a205_161993_c1_762_1238 155
438 3300021388 Ga0213875_10556325 Ga0213875_105563251 156
439 3300037853 Ga0436364_0530783 Ga0436364_0530783_42_533 156
440 3300049570 Ga0501033_0033973 Ga0501033_0033973_516_992 156
441 3300049571 Ga0501034_0183834 Ga0501034_0183834_618_1094 156
442 3300049572 Ga0501036_0259153 Ga0501036_0259153_623_1099 156
443 3300049573 Ga0501037_0040085 Ga0501037_0040085_342_818 156
444 3300049574 Ga0501038_0193655 Ga0501038_0193655_837_1313 156
445 3300049580 Ga0501046_0062230 Ga0501046_0062230_1518_1994 156
446 3300049581 Ga0501047_0239918 Ga0501047_0239918_362_838 156
447 3300059424 Ga0590075_055424 Ga0590075_055424_426_941 156
448 3300059426 Ga0590077_060551 Ga0590077_060551_153_668 156
449 3300005295 Ga0065707_10093046 Ga0065707_100930462 157
450 3300005328 Ga0070676_10004034 Ga0070676_100040344 157
451 3300005331 Ga0070670_100017119 Ga0070670_1000171194 157
452 3300005334 Ga0068869_100003439 Ga0068869_1000034393 157
453 3300005334 Ga0068869_100800793 Ga0068869_1008007932 157
454 3300005335 Ga0070666_10132177 Ga0070666_101321772 157
455 3300005338 Ga0068868_100060025 Ga0068868_1000600252 157
456 3300005339 Ga0070660_100105928 Ga0070660_1001059282 157
457 3300005340 Ga0070689_100104338 Ga0070689_1001043382 157
458 3300005343 Ga0070687_100009121 Ga0070687_1000091212 157
459 3300005344 Ga0070661_100039948 Ga0070661_1000399482 157
460 3300005344 Ga0070661_100090988 Ga0070661_1000909882 157
461 3300005345 Ga0070692_10018279 Ga0070692_100182792 157
462 3300005347 Ga0070668_100000444 Ga0070668_10000044411 157
463 3300005353 Ga0070669_100031784 Ga0070669_1000317843 157
464 3300005354 Ga0070675_100014907 Ga0070675_1000149072 157
465 3300005355 Ga0070671_100099076 Ga0070671_1000990764 157
466 3300005356 Ga0070674_100168716 Ga0070674_1001687162 157
467 3300005364 Ga0070673_100029674 Ga0070673_1000296742 157
468 3300005365 Ga0070688_100370056 Ga0070688_1003700562 157
469 3300005365 Ga0070688_100666559 Ga0070688_1006665591 157
470 3300005366 Ga0070659_100091713 Ga0070659_1000917132 157
471 3300005367 Ga0070667_100013376 Ga0070667_1000133763 157
472 3300005439 Ga0070711_100091933 Ga0070711_1000919332 157
473 3300005441 Ga0070700_100005703 Ga0070700_1000057035 157
474 3300005444 Ga0070694_100062966 Ga0070694_1000629662 157
475 3300005455 Ga0070663_100062181 Ga0070663_1000621813 157
476 3300005457 Ga0070662_100041504 Ga0070662_1000415042 157
477 3300005459 Ga0068867_100114913 Ga0068867_1001149132 157
478 3300005466 Ga0070685_10115574 Ga0070685_101155742 157
479 3300005535 Ga0070684_100023616 Ga0070684_1000236163 157
480 3300005548 Ga0070665_100336750 Ga0070665_1003367501 157
481 3300005563 Ga0068855_100138491 Ga0068855_1001384912 157
482 3300005564 Ga0070664_100124839 Ga0070664_1001248392 157
483 3300005564 Ga0070664_100180040 Ga0070664_1001800402 157
484 3300005577 Ga0068857_100082803 Ga0068857_1000828032 157
485 3300005578 Ga0068854_100026113 Ga0068854_1000261133 157
486 3300005614 Ga0068856_101728796 Ga0068856_1017287961 157
487 3300005615 Ga0070702_100668905 Ga0070702_1006689051 157
488 3300005616 Ga0068852_100027475 Ga0068852_1000274753 157
489 3300005618 Ga0068864_100135909 Ga0068864_1001359092 157
490 3300005718 Ga0068866_10225786 Ga0068866_102257862 157
491 3300005719 Ga0068861_100016097 Ga0068861_1000160972 157
492 3300005834 Ga0068851_10119810 Ga0068851_101198102 157
493 3300005841 Ga0068863_100031527 Ga0068863_1000315272 157
494 3300005842 Ga0068858_100147606 Ga0068858_1001476062 157
495 3300005843 Ga0068860_100074411 Ga0068860_1000744112 157
496 3300005844 Ga0068862_100046426 Ga0068862_1000464262 157
497 3300006175 Ga0070712_100162596 Ga0070712_1001625962 157
498 3300006237 Ga0097621_100082981 Ga0097621_1000829812 157
499 3300006844 Ga0075428_100095286 Ga0075428_1000952863 157
500 3300006844 Ga0075428_100131771 Ga0075428_1001317712 157
501 3300006847 Ga0075431_100181590 Ga0075431_1001815903 157
502 3300006847 Ga0075431_101221499 Ga0075431_1012214991 157
503 3300006852 Ga0075433_10003192 Ga0075433_1000319211 157
504 3300006852 Ga0075433_10018953 Ga0075433_100189533 157
505 3300006871 Ga0075434_100006350 Ga0075434_1000063503 157
506 3300006871 Ga0075434_100023121 Ga0075434_1000231214 157
507 3300006880 Ga0075429_100221408 Ga0075429_1002214082 157
508 3300009147 Ga0114129_10178224 Ga0114129_101782243 157
509 3300009177 Ga0105248_10034349 Ga0105248_100343492 157
510 3300009177 Ga0105248_10588362 Ga0105248_105883622 157
511 3300009545 Ga0105237_10094706 Ga0105237_100947062 157
512 3300009551 Ga0105238_11337255 Ga0105238_113372552 157
513 3300009553 Ga0105249_10003594 Ga0105249_100035948 157
514 3300010375 Ga0105239_10055210 Ga0105239_100552103 157
515 3300013102 Ga0157371_10020712 Ga0157371_100207122 157
516 3300013306 Ga0163162_10000455 Ga0163162_100004552 157
517 3300013308 Ga0157375_10262716 Ga0157375_102627162 157
518 3300014325 Ga0163163_10006856 Ga0163163_100068564 157
519 3300014326 Ga0157380_10008768 Ga0157380_100087686 157
520 3300014745 Ga0157377_10020027 Ga0157377_100200272 157
521 3300025315 Ga0207697_10004603 Ga0207697_100046034 157
522 3300025901 Ga0207688_10023903 Ga0207688_100239032 157
523 3300025903 Ga0207680_10074727 Ga0207680_100747272 157
524 3300025904 Ga0207647_10030615 Ga0207647_100306153 157
525 3300025907 Ga0207645_10000687 Ga0207645_1000068711 157
526 3300025914 Ga0207671_10095116 Ga0207671_100951162 157
527 3300025916 Ga0207663_10131520 Ga0207663_101315202 157
528 3300025918 Ga0207662_10001597 Ga0207662_100015976 157
529 3300025919 Ga0207657_10052336 Ga0207657_100523362 157
530 3300025920 Ga0207649_10053694 Ga0207649_100536942 157
531 3300025920 Ga0207649_10838722 Ga0207649_108387221 157
532 3300025923 Ga0207681_10010449 Ga0207681_100104492 157
533 3300025925 Ga0207650_10078385 Ga0207650_100783852 157
534 3300025927 Ga0207687_10142770 Ga0207687_101427702 157
535 3300025931 Ga0207644_10123831 Ga0207644_101238314 157
536 3300025931 Ga0207644_10938762 Ga0207644_109387622 157
537 3300025933 Ga0207706_10001099 Ga0207706_1000109919 157
538 3300025933 Ga0207706_10389281 Ga0207706_103892812 157
539 3300025936 Ga0207670_10193802 Ga0207670_101938021 157
540 3300025937 Ga0207669_10631069 Ga0207669_106310692 157
541 3300025940 Ga0207691_10002827 Ga0207691_100028274 157
542 3300025941 Ga0207711_10398418 Ga0207711_103984182 157
543 3300025942 Ga0207689_10002768 Ga0207689_1000276810 157
544 3300025944 Ga0207661_10078151 Ga0207661_100781512 157
545 3300025944 Ga0207661_10232981 Ga0207661_102329812 157
546 3300025945 Ga0207679_10028174 Ga0207679_100281742 157
547 3300025945 Ga0207679_10125372 Ga0207679_101253721 157
548 3300025949 Ga0207667_10153504 Ga0207667_101535042 157
549 3300025961 Ga0207712_10018433 Ga0207712_100184333 157
550 3300025972 Ga0207668_10015066 Ga0207668_100150662 157
551 3300025981 Ga0207640_10060457 Ga0207640_100604572 157
552 3300025986 Ga0207658_10016778 Ga0207658_100167782 157
553 3300026023 Ga0207677_10013685 Ga0207677_100136852 157
554 3300026041 Ga0207639_10263637 Ga0207639_102636372 157
555 3300026075 Ga0207708_10014222 Ga0207708_100142223 157
556 3300026089 Ga0207648_10017903 Ga0207648_100179033 157
557 3300026095 Ga0207676_10072933 Ga0207676_100729332 157
558 3300026116 Ga0207674_10005242 Ga0207674_100052422 157
559 3300026118 Ga0207675_100000141 Ga0207675_10000014141 157
560 3300027866 Ga0209813_10254780 Ga0209813_102547801 157
561 3300028379 Ga0268266_10129335 Ga0268266_101293352 157
562 3300028380 Ga0268265_10036005 Ga0268265_100360053 157
563 3300031548 Ga0307408_100051677 Ga0307408_1000516772 157
564 3300031731 Ga0307405_10358657 Ga0307405_103586572 157
565 3300031824 Ga0307413_10393071 Ga0307413_103930712 157
566 3300031901 Ga0307406_10002220 Ga0307406_100022206 157
567 3300031911 Ga0307412_10162085 Ga0307412_101620852 157
568 3300035170 Ga0373943_0555441 Ga0373943_0555441_56_559 157
569 3300035171 Ga0373946_0104632 Ga0373946_0104632_53_556 157
570 3300035241 Ga0373961_0023035 Ga0373961_0023035_307_810 157
571 3300037471 Ga0395905_0218578 Ga0395905_0218578_1082_1585 157
572 3300037471 Ga0395905_0812010 Ga0395905_0812010_158_661 157
573 3300042012 Ga0439455_0008140 Ga0439455_0008140_562_1065 157
574 3300042439 Ga0439464_0024646 Ga0439464_0024646_238_741 157
575 3300042876 Ga0451577_0423678 Ga0451577_0423678_631_1134 157
576 3300044684 Ga0466966_0776308 Ga0466966_0776308_12_518 157
577 3300045051 Ga0451576_0189609 Ga0451576_0189609_210_713 157
578 3300046459 Ga0495629_0260972 Ga0495629_0260972_221_724 157
579 3300046525 Ga0495663_0053817 Ga0495663_0053817_323_826 157
580 3300046538 Ga0495609_0280561 Ga0495609_0280561_19_522 157
581 3300046681 Ga0495647_0104313 Ga0495647_0104313_255_758 157
582 3300046683 Ga0495658_0127865 Ga0495658_0127865_474_977 157
583 3300046691 Ga0495670_0344805 Ga0495670_0344805_257_760 157
584 3300047318 Ga0495636_0343549 Ga0495636_0343549_130_624 157
585 3300048909 Ga0496106_0493575 Ga0496106_0493575_101_604 157
586 3300048911 Ga0496108_0257660 Ga0496108_0257660_65_568 157
587 3300048912 Ga0496109_0164921 Ga0496109_0164921_601_1104 157
588 3300048915 Ga0496112_0285768 Ga0496112_0285768_1015_1518 157
589 3300049742 Ga0501080_0862968 Ga0501080_0862968_210_707 157
590 3300050494 nmdc:mga06z11_322010_c1 nmdc:mga06z11_322010_c1_186_677 157
591 3300050507 nmdc:mga05p37_228848_c1 nmdc:mga05p37_228848_c1_586_1089 157
592 3300050508 nmdc:mga09592_175559_c1 nmdc:mga09592_175559_c1_762_1265 157
593 3300050510 nmdc:mga06r32_160294_c1 nmdc:mga06r32_160294_c1_1696_2199 157
594 3300050512 nmdc:mga0n895_17167_c1 nmdc:mga0n895_17167_c1_5037_5540 157
595 3300050512 nmdc:mga0n895_5969_c1 nmdc:mga0n895_5969_c1_7659_8162 157
596 3300050515 nmdc:mga0a205_11699_c1 nmdc:mga0a205_11699_c1_3964_4467 157
597 3300050515 nmdc:mga0a205_283278_c1 nmdc:mga0a205_283278_c1_479_982 157
598 3300025903 Ga0207680_11006824 Ga0207680_110068241 158
599 3300025912 Ga0207707_10609738 Ga0207707_106097382 158
600 3300025986 Ga0207658_10890798 Ga0207658_108907981 158
601 3300030760 Ga0265762_1046575 Ga0265762_10465752 158
602 3300030762 Ga0265775_109132 Ga0265775_1091321 158
603 3300031852 Ga0307410_10071420 Ga0307410_100714202 158
604 3300031903 Ga0307407_10036680 Ga0307407_100366802 158
605 3300031911 Ga0307412_10019704 Ga0307412_100197042 158
606 3300031995 Ga0307409_100062443 Ga0307409_1000624432 158
607 3300032002 Ga0307416_100010521 Ga0307416_1000105215 158
608 3300032002 Ga0307416_100536726 Ga0307416_1005367262 158
609 3300032004 Ga0307414_10161300 Ga0307414_101613002 158
610 3300032005 Ga0307411_10017454 Ga0307411_100174546 158
611 3300041494 Ga0451837_0841720 Ga0451837_0841720_397_921 158
612 3300042147 Ga0450910_052467 Ga0450910_052467_41_553 158
613 3300049570 Ga0501033_0198030 Ga0501033_0198030_753_1253 158
614 3300049589 Ga0501073_0002552 Ga0501073_0002552_416_910 158
615 3300049593 Ga0501077_0251029 Ga0501077_0251029_141_629 158
616 3300049706 Ga0501229_032467 Ga0501229_032467_196_687 158
617 3300049779 Ga0501283_058035 Ga0501283_058035_77_568 158
618 3300050493 nmdc:mga0k408_120337_c1 nmdc:mga0k408_120337_c1_879_1391 158
619 3300050493 nmdc:mga0k408_79000_c1 nmdc:mga0k408_79000_c1_335_847 158
620 3300050510 nmdc:mga06r32_756692_c1 nmdc:mga06r32_756692_c1_312_809 158
621 3300059426 Ga0590077_016929 Ga0590077_016929_115_615 158
622 3300005327 Ga0070658_10029087 Ga0070658_100290872 159
623 3300005334 Ga0068869_100775819 Ga0068869_1007758191 159
624 3300005548 Ga0070665_100377914 Ga0070665_1003779142 159
625 3300005614 Ga0068856_100433112 Ga0068856_1004331122 159
626 3300006038 Ga0075365_10097114 Ga0075365_100971142 159
627 3300006042 Ga0075368_10278475 Ga0075368_102784751 159
628 3300006186 Ga0075369_10475424 Ga0075369_104754241 159
629 3300050493 nmdc:mga0k408_316656_c1 nmdc:mga0k408_316656_c1_169_681 159
630 3300050495 nmdc:mga04h51_276360_c1 nmdc:mga04h51_276360_c1_95_607 159
631 3300005353 Ga0070669_100053272 Ga0070669_1000532723 160
632 3300005364 Ga0070673_100172762 Ga0070673_1001727622 160
633 3300005365 Ga0070688_100224466 Ga0070688_1002244662 160
634 3300005367 Ga0070667_100260108 Ga0070667_1002601082 160
635 3300005440 Ga0070705_100720726 Ga0070705_1007207262 160
636 3300005441 Ga0070700_100118111 Ga0070700_1001181112 160
637 3300005444 Ga0070694_100385103 Ga0070694_1003851032 160
638 3300005456 Ga0070678_100180034 Ga0070678_1001800342 160
639 3300005459 Ga0068867_101971268 Ga0068867_1019712681 160
640 3300005468 Ga0070707_101162494 Ga0070707_1011624941 160
641 3300005545 Ga0070695_100134838 Ga0070695_1001348382 160
642 3300005545 Ga0070695_100347708 Ga0070695_1003477082 160
643 3300005548 Ga0070665_100538444 Ga0070665_1005384442 160
644 3300005577 Ga0068857_100700948 Ga0068857_1007009482 160
645 3300005840 Ga0068870_10043570 Ga0068870_100435702 160
646 3300005844 Ga0068862_100390674 Ga0068862_1003906742 160
647 3300006042 Ga0075368_10004085 Ga0075368_100040855 160
648 3300006051 Ga0075364_10053197 Ga0075364_100531972 160
649 3300006178 Ga0075367_10030877 Ga0075367_100308772 160
650 3300006353 Ga0075370_10720353 Ga0075370_107203531 160
651 3300006844 Ga0075428_100504633 Ga0075428_1005046332 160
652 3300009094 Ga0111539_10022206 Ga0111539_100222066 160
653 3300009094 Ga0111539_10734437 Ga0111539_107344372 160
654 3300009101 Ga0105247_10287431 Ga0105247_102874312 160
655 3300009174 Ga0105241_10554892 Ga0105241_105548922 160
656 3300009545 Ga0105237_10599141 Ga0105237_105991412 160
657 3300014968 Ga0157379_11851970 Ga0157379_118519701 160
658 3300025901 Ga0207688_10098690 Ga0207688_100986902 160
659 3300025923 Ga0207681_10342530 Ga0207681_103425302 160
660 3300025925 Ga0207650_10752607 Ga0207650_107526072 160
661 3300025926 Ga0207659_10480251 Ga0207659_104802511 160
662 3300025986 Ga0207658_10182075 Ga0207658_101820752 160
663 3300026067 Ga0207678_10229146 Ga0207678_102291462 160
664 3300026089 Ga0207648_10183358 Ga0207648_101833582 160
665 3300027907 Ga0207428_10274500 Ga0207428_102745001 160
666 3300028379 Ga0268266_10327654 Ga0268266_103276542 160
667 3300028379 Ga0268266_10650919 Ga0268266_106509191 160
668 3300032126 Ga0307415_100039760 Ga0307415_1000397602 160
669 3300035118 Ga0373954_0035006 Ga0373954_0035006_700_1197 160
670 3300035695 Ga0373927_0055350 Ga0373927_0055350_83_580 160
671 3300035724 Ga0373933_0271923 Ga0373933_0271923_396_893 160
672 3300036401 Ga0373937_0293758 Ga0373937_0293758_900_1397 160
673 3300037853 Ga0436364_1278837 Ga0436364_1278837_373_885 160
674 3300045051 Ga0451576_0184905 Ga0451576_0184905_274_795 160
675 3300046539 Ga0495621_0204949 Ga0495621_0204949_229_723 160
676 3300046559 Ga0495667_0122252 Ga0495667_0122252_719_1216 160
677 3300046664 Ga0495659_0056166 Ga0495659_0056166_662_1168 160
678 3300050491 nmdc:mga00v17_48917_c1 nmdc:mga00v17_48917_c1_975_1475 160
679 3300050494 nmdc:mga06z11_21556_c1 nmdc:mga06z11_21556_c1_2397_2915 160
680 3300050511 nmdc:mga08y16_95576_c1 nmdc:mga08y16_95576_c1_2084_2572 160
681 3300050516 nmdc:mga0sz30_165393_c1 nmdc:mga0sz30_165393_c1_422_922 160
682 3300005289 Ga0065704_10096643 Ga0065704_100966432 161
683 3300005293 Ga0065715_10155647 Ga0065715_101556472 161
684 3300005328 Ga0070676_10212131 Ga0070676_102121312 161
685 3300005330 Ga0070690_100050734 Ga0070690_1000507341 161
686 3300005331 Ga0070670_100038600 Ga0070670_1000386003 161
687 3300005335 Ga0070666_10454828 Ga0070666_104548281 161
688 3300005340 Ga0070689_100001466 Ga0070689_10000146614 161
689 3300005343 Ga0070687_100019645 Ga0070687_1000196452 161
690 3300005344 Ga0070661_100051556 Ga0070661_1000515561 161
691 3300005345 Ga0070692_10036286 Ga0070692_100362862 161
692 3300005347 Ga0070668_100038041 Ga0070668_1000380415 161
693 3300005353 Ga0070669_100016596 Ga0070669_1000165962 161
694 3300005354 Ga0070675_100001331 Ga0070675_10000133115 161
695 3300005354 Ga0070675_100042795 Ga0070675_1000427952 161
696 3300005356 Ga0070674_100001579 Ga0070674_10000157912 161
697 3300005365 Ga0070688_100003074 Ga0070688_1000030747 161
698 3300005367 Ga0070667_100119577 Ga0070667_1001195772 161
699 3300005438 Ga0070701_10003233 Ga0070701_100032334 161
700 3300005440 Ga0070705_100000156 Ga0070705_10000015631 161
701 3300005441 Ga0070700_100601525 Ga0070700_1006015252 161
702 3300005444 Ga0070694_100003304 Ga0070694_1000033042 161
703 3300005444 Ga0070694_100005609 Ga0070694_1000056097 161
704 3300005444 Ga0070694_100794123 Ga0070694_1007941231 161
705 3300005457 Ga0070662_100124200 Ga0070662_1001242003 161
706 3300005459 Ga0068867_100010217 Ga0068867_1000102177 161
707 3300005466 Ga0070685_10087920 Ga0070685_100879202 161
708 3300005466 Ga0070685_10436717 Ga0070685_104367171 161
709 3300005468 Ga0070707_101624741 Ga0070707_1016247411 161
710 3300005471 Ga0070698_100002282 Ga0070698_10000228210 161
711 3300005471 Ga0070698_100507100 Ga0070698_1005071002 161
712 3300005518 Ga0070699_100000763 Ga0070699_10000076314 161
713 3300005518 Ga0070699_100139811 Ga0070699_1001398112 161
714 3300005518 Ga0070699_100204867 Ga0070699_1002048672 161
715 3300005535 Ga0070684_100118791 Ga0070684_1001187912 161
716 3300005536 Ga0070697_100374373 Ga0070697_1003743732 161
717 3300005543 Ga0070672_100013480 Ga0070672_1000134803 161
718 3300005545 Ga0070695_100000574 Ga0070695_10000057419 161
719 3300005545 Ga0070695_100344998 Ga0070695_1003449981 161
720 3300005545 Ga0070695_100424586 Ga0070695_1004245862 161
721 3300005546 Ga0070696_100002781 Ga0070696_1000027816 161
722 3300005549 Ga0070704_100003889 Ga0070704_1000038895 161
723 3300005549 Ga0070704_100067680 Ga0070704_1000676802 161
724 3300005564 Ga0070664_100381944 Ga0070664_1003819442 161
725 3300005577 Ga0068857_100003390 Ga0068857_1000033904 161
726 3300005617 Ga0068859_100007156 Ga0068859_1000071562 161
727 3300005617 Ga0068859_100008945 Ga0068859_1000089457 161
728 3300005618 Ga0068864_100064676 Ga0068864_1000646762 161
729 3300005618 Ga0068864_100077076 Ga0068864_1000770764 161
730 3300005618 Ga0068864_100126191 Ga0068864_1001261912 161
731 3300005719 Ga0068861_100002466 Ga0068861_10000246611 161
732 3300005719 Ga0068861_100213147 Ga0068861_1002131472 161
733 3300005840 Ga0068870_10003744 Ga0068870_100037442 161
734 3300005841 Ga0068863_100040923 Ga0068863_1000409232 161
735 3300005841 Ga0068863_100603403 Ga0068863_1006034032 161
736 3300005842 Ga0068858_100070669 Ga0068858_1000706692 161
737 3300005842 Ga0068858_100137314 Ga0068858_1001373142 161
738 3300005843 Ga0068860_100001702 Ga0068860_10000170215 161
739 3300005843 Ga0068860_100584939 Ga0068860_1005849392 161
740 3300005844 Ga0068862_100001703 Ga0068862_1000017037 161
741 3300005937 Ga0081455_10195831 Ga0081455_101958312 161
742 3300006358 Ga0068871_100389406 Ga0068871_1003894062 161
743 3300006844 Ga0075428_100004279 Ga0075428_1000042793 161
744 3300006844 Ga0075428_100236400 Ga0075428_1002364004 161
745 3300006846 Ga0075430_100135241 Ga0075430_1001352412 161
746 3300006852 Ga0075433_10106453 Ga0075433_101064532 161
747 3300006852 Ga0075433_10260145 Ga0075433_102601453 161
748 3300006871 Ga0075434_101676521 Ga0075434_1016765211 161
749 3300006871 Ga0075434_101836417 Ga0075434_1018364171 161
750 3300006880 Ga0075429_100206839 Ga0075429_1002068393 161
751 3300006880 Ga0075429_100540894 Ga0075429_1005408941 161
752 3300006881 Ga0068865_100190724 Ga0068865_1001907243 161
753 3300006881 Ga0068865_100574336 Ga0068865_1005743361 161
754 3300006931 Ga0097620_100007155 Ga0097620_1000071552 161
755 3300006931 Ga0097620_100008945 Ga0097620_1000089457 161
756 3300007076 Ga0075435_100009995 Ga0075435_1000099952 161
757 3300007076 Ga0075435_100254982 Ga0075435_1002549822 161
758 3300007076 Ga0075435_100277843 Ga0075435_1002778432 161
759 3300009094 Ga0111539_10366694 Ga0111539_103666941 161
760 3300009094 Ga0111539_10392898 Ga0111539_103928982 161
761 3300009094 Ga0111539_10527595 Ga0111539_105275952 161
762 3300009098 Ga0105245_10733529 Ga0105245_107335291 161
763 3300009147 Ga0114129_10001655 Ga0114129_1000165513 161
764 3300009147 Ga0114129_10111748 Ga0114129_101117482 161
765 3300009148 Ga0105243_10109765 Ga0105243_101097652 161
766 3300009148 Ga0105243_10345087 Ga0105243_103450872 161
767 3300009176 Ga0105242_10256413 Ga0105242_102564132 161
768 3300009177 Ga0105248_10350586 Ga0105248_103505862 161
769 3300009553 Ga0105249_10002856 Ga0105249_100028569 161
770 3300009553 Ga0105249_12479767 Ga0105249_124797671 161
771 3300013297 Ga0157378_10099008 Ga0157378_100990084 161
772 3300013306 Ga0163162_10095346 Ga0163162_100953462 161
773 3300013308 Ga0157375_10003909 Ga0157375_100039095 161
774 3300014325 Ga0163163_11224431 Ga0163163_112244311 161
775 3300014326 Ga0157380_10061475 Ga0157380_100614754 161
776 3300014745 Ga0157377_10037485 Ga0157377_100374852 161
777 3300014745 Ga0157377_10341191 Ga0157377_103411912 161
778 3300014968 Ga0157379_11129689 Ga0157379_111296892 161
779 3300014969 Ga0157376_10203145 Ga0157376_102031452 161
780 3300025315 Ga0207697_10134691 Ga0207697_101346911 161
781 3300025885 Ga0207653_10037061 Ga0207653_100370612 161
782 3300025901 Ga0207688_10062307 Ga0207688_100623072 161
783 3300025903 Ga0207680_10367720 Ga0207680_103677202 161
784 3300025904 Ga0207647_10132312 Ga0207647_101323122 161
785 3300025908 Ga0207643_10009279 Ga0207643_100092796 161
786 3300025908 Ga0207643_10012200 Ga0207643_100122002 161
787 3300025917 Ga0207660_10853352 Ga0207660_108533522 161
788 3300025918 Ga0207662_10019830 Ga0207662_100198303 161
789 3300025920 Ga0207649_11278462 Ga0207649_112784621 161
790 3300025921 Ga0207652_10164539 Ga0207652_101645393 161
791 3300025922 Ga0207646_10131939 Ga0207646_101319392 161
792 3300025923 Ga0207681_10001144 Ga0207681_100011448 161
793 3300025923 Ga0207681_10116658 Ga0207681_101166581 161
794 3300025925 Ga0207650_10043836 Ga0207650_100438361 161
795 3300025926 Ga0207659_10000485 Ga0207659_1000048513 161
796 3300025926 Ga0207659_10000662 Ga0207659_1000066212 161
797 3300025931 Ga0207644_11390862 Ga0207644_113908621 161
798 3300025931 Ga0207644_11494003 Ga0207644_114940031 161
799 3300025933 Ga0207706_10288738 Ga0207706_102887383 161
800 3300025934 Ga0207686_10219212 Ga0207686_102192122 161
801 3300025935 Ga0207709_10315314 Ga0207709_103153142 161
802 3300025935 Ga0207709_10425524 Ga0207709_104255242 161
803 3300025936 Ga0207670_10000771 Ga0207670_1000077113 161
804 3300025936 Ga0207670_10094530 Ga0207670_100945303 161
805 3300025936 Ga0207670_11617094 Ga0207670_116170941 161
806 3300025937 Ga0207669_10026671 Ga0207669_100266712 161
807 3300025937 Ga0207669_10388733 Ga0207669_103887331 161
808 3300025938 Ga0207704_10159611 Ga0207704_101596112 161
809 3300025938 Ga0207704_10252233 Ga0207704_102522331 161
810 3300025940 Ga0207691_10016017 Ga0207691_100160173 161
811 3300025940 Ga0207691_10084819 Ga0207691_100848193 161
812 3300025945 Ga0207679_10506425 Ga0207679_105064251 161
813 3300025960 Ga0207651_10129428 Ga0207651_101294282 161
814 3300025961 Ga0207712_10002158 Ga0207712_100021587 161
815 3300025961 Ga0207712_11447448 Ga0207712_114474482 161
816 3300025972 Ga0207668_10015442 Ga0207668_100154425 161
817 3300025986 Ga0207658_10529611 Ga0207658_105296111 161
818 3300026035 Ga0207703_10016307 Ga0207703_100163072 161
819 3300026035 Ga0207703_10130334 Ga0207703_101303342 161
820 3300026075 Ga0207708_10282495 Ga0207708_102824952 161
821 3300026088 Ga0207641_10034240 Ga0207641_100342402 161
822 3300026089 Ga0207648_10000478 Ga0207648_1000047815 161
823 3300026095 Ga0207676_10096075 Ga0207676_100960752 161
824 3300026095 Ga0207676_10181705 Ga0207676_101817052 161
825 3300026116 Ga0207674_10030393 Ga0207674_100303937 161
826 3300026118 Ga0207675_100042169 Ga0207675_1000421694 161
827 3300026118 Ga0207675_101550534 Ga0207675_1015505341 161
828 3300026142 Ga0207698_11401396 Ga0207698_114013962 161
829 3300027907 Ga0207428_10002496 Ga0207428_100024964 161
830 3300028380 Ga0268265_10000663 Ga0268265_1000066314 161
831 3300028381 Ga0268264_10002304 Ga0268264_100023045 161
832 3300035088 Ga0373940_0002992 Ga0373940_0002992_1105_1614 161
833 3300035090 Ga0373949_0055552 Ga0373949_0055552_258_767 161
834 3300035114 Ga0373939_0024150 Ga0373939_0024150_950_1459 161
835 3300035115 Ga0373941_0048891 Ga0373941_0048891_804_1313 161
836 3300035207 Ga0373942_0072128 Ga0373942_0072128_89_598 161
837 3300035241 Ga0373961_0020712 Ga0373961_0020712_1000_1509 161
838 3300035242 Ga0373962_0055517 Ga0373962_0055517_379_888 161
839 3300035691 Ga0373931_0092161 Ga0373931_0092161_1123_1632 161
840 3300037068 Ga0373925_0189173 Ga0373925_0189173_479_988 161
841 3300042436 Ga0439435_0014123 Ga0439435_0014123_825_1319 161
842 3300045051 Ga0451576_0202524 Ga0451576_0202524_322_831 161
843 3300045051 Ga0451576_0388994 Ga0451576_0388994_602_1111 161
844 3300045051 Ga0451576_0460866 Ga0451576_0460866_594_1103 161
845 3300045051 Ga0451576_2040148 Ga0451576_2040148_30_539 161
846 3300046472 Ga0495580_0123404 Ga0495580_0123404_706_1215 161
847 3300046473 Ga0495582_0265669 Ga0495582_0265669_454_963 161
848 3300046499 Ga0495594_0023223 Ga0495594_0023223_2079_2588 161
849 3300046528 Ga0495642_0165177 Ga0495642_0165177_20_529 161
850 3300046535 Ga0495586_0157726 Ga0495586_0157726_38_547 161
851 3300046539 Ga0495621_0008177 Ga0495621_0008177_331_837 161
852 3300046539 Ga0495621_0008551 Ga0495621_0008551_2072_2581 161
853 3300046539 Ga0495621_0092616 Ga0495621_0092616_370_900 161
854 3300046664 Ga0495659_0028743 Ga0495659_0028743_1137_1658 161
855 3300046674 Ga0495588_0008624 Ga0495588_0008624_3309_3818 161
856 3300046683 Ga0495658_0100149 Ga0495658_0100149_1177_1686 161
857 3300047318 Ga0495636_0157113 Ga0495636_0157113_235_732 161
858 3300047320 Ga0495672_0076098 Ga0495672_0076098_1374_1871 161
859 3300047321 Ga0495676_0395344 Ga0495676_0395344_396_905 161
860 3300047445 Ga0495677_0073081 Ga0495677_0073081_729_1238 161
861 3300049568 Ga0501031_0091725 Ga0501031_0091725_308_823 161
862 3300049568 Ga0501031_0308398 Ga0501031_0308398_58_573 161
863 3300049569 Ga0501032_0005818 Ga0501032_0005818_7948_8463 161
864 3300049569 Ga0501032_0008491 Ga0501032_0008491_2062_2577 161
865 3300049570 Ga0501033_0918010 Ga0501033_0918010_42_557 161
866 3300049571 Ga0501034_0001243 Ga0501034_0001243_24858_25373 161
867 3300049571 Ga0501034_0026502 Ga0501034_0026502_105_620 161
868 3300049571 Ga0501034_0442924 Ga0501034_0442924_656_1171 161
869 3300049572 Ga0501036_0005033 Ga0501036_0005033_4409_4924 161
870 3300049572 Ga0501036_0105328 Ga0501036_0105328_693_1208 161
871 3300049574 Ga0501038_0013231 Ga0501038_0013231_4425_4940 161
872 3300049574 Ga0501038_0057399 Ga0501038_0057399_2066_2581 161
873 3300049575 Ga0501039_0012793 Ga0501039_0012793_2509_3024 161
874 3300049575 Ga0501039_0016198 Ga0501039_0016198_1308_1823 161
875 3300049578 Ga0501042_0457112 Ga0501042_0457112_162_656 161
876 3300049579 Ga0501043_0187706 Ga0501043_0187706_670_1185 161
877 3300049579 Ga0501043_0485531 Ga0501043_0485531_232_747 161
878 3300049580 Ga0501046_0001245 Ga0501046_0001245_23839_24354 161
879 3300049581 Ga0501047_0018586 Ga0501047_0018586_5377_5892 161
880 3300049581 Ga0501047_0065211 Ga0501047_0065211_799_1314 161
881 3300049582 Ga0501048_0089418 Ga0501048_0089418_20_535 161
882 3300049583 Ga0501067_0081628 Ga0501067_0081628_299_808 161
883 3300049583 Ga0501067_0201164 Ga0501067_0201164_10_525 161
884 3300049584 Ga0501068_0109988 Ga0501068_0109988_865_1374 161
885 3300049584 Ga0501068_0149271 Ga0501068_0149271_347_862 161
886 3300049585 Ga0501069_0029834 Ga0501069_0029834_2317_2832 161
887 3300049589 Ga0501073_0040918 Ga0501073_0040918_1787_2302 161
888 3300049742 Ga0501080_0002574 Ga0501080_0002574_7275_7790 161
889 3300049742 Ga0501080_0057869 Ga0501080_0057869_2510_3025 161
890 3300049822 Ga0501035_0096190 Ga0501035_0096190_554_1069 161
891 3300049823 Ga0501044_0037786 Ga0501044_0037786_840_1355 161
892 3300049823 Ga0501044_1327420 Ga0501044_1327420_13_528 161
893 3300050507 nmdc:mga05p37_14640_c1 nmdc:mga05p37_14640_c1_2316_2825 161
894 3300050508 nmdc:mga09592_881781_c1 nmdc:mga09592_881781_c1_215_724 161
895 3300050511 nmdc:mga08y16_265700_c1 nmdc:mga08y16_265700_c1_58_555 161
896 3300050511 nmdc:mga08y16_273209_c1 nmdc:mga08y16_273209_c1_414_923 161
897 3300050511 nmdc:mga08y16_508_c1 nmdc:mga08y16_508_c1_4502_5011 161
898 3300050512 nmdc:mga0n895_1016429_c1 nmdc:mga0n895_1016429_c1_216_722 161
899 3300050512 nmdc:mga0n895_179851_c1 nmdc:mga0n895_179851_c1_1587_2096 161
900 3300050512 nmdc:mga0n895_401194_c1 nmdc:mga0n895_401194_c1_842_1351 161
901 3300050513 nmdc:mga0rr50_238511_c1 nmdc:mga0rr50_238511_c1_406_915 161
902 3300050515 nmdc:mga0a205_115024_c1 nmdc:mga0a205_115024_c1_1342_1848 161
903 3300050515 nmdc:mga0a205_226729_c1 nmdc:mga0a205_226729_c1_481_990 161
904 3300050515 nmdc:mga0a205_38247_c1 nmdc:mga0a205_38247_c1_1515_2024 161
905 3300053093 Ga0500651_0380457 Ga0500651_0380457_74_598 161
906 3300053103 Ga0500555_000149 Ga0500555_000149_17285_17809 161
907 3300053153 Ga0500616_0000926 Ga0500616_0000926_17832_18392 161
908 3300053730 Ga0500645_000610 Ga0500645_000610_22334_22858 161
909 3300053736 Ga0500599_009884 Ga0500599_009884_626_1150 161
910 3300054114 Ga0501084_0143910 Ga0501084_0143910_333_848 161
911 3300060353 Ga0501082_0018151 Ga0501082_0018151_5055_5570 161
912 3300060353 Ga0501082_0044691 Ga0501082_0044691_3030_3545 161
913 3300003203 JGI25406J46586_10004911 JGI25406J46586_100049112 162
914 3300005295 Ga0065707_10238888 Ga0065707_102388882 162
915 3300005440 Ga0070705_100419195 Ga0070705_1004191952 162
916 3300005543 Ga0070672_101223994 Ga0070672_1012239941 162
917 3300005719 Ga0068861_100987446 Ga0068861_1009874462 162
918 3300005843 Ga0068860_101136943 Ga0068860_1011369432 162
919 3300005985 Ga0081539_10001447 Ga0081539_100014475 162
920 3300005985 Ga0081539_10001460 Ga0081539_1000146031 162
921 3300009094 Ga0111539_10040437 Ga0111539_100404375 162
922 3300046683 Ga0495658_0033080 Ga0495658_0033080_507_1007 162
923 3300050511 nmdc:mga08y16_34591_c1 nmdc:mga08y16_34591_c1_4779_5267 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

85

157

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

17

79

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.981 1 150
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9628 1 149
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9585 1 149
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9566 1 150
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9559 1 150
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9822 1 73 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9808 1 75 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9626 1 75 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9607 1 75 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9511 83 150 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A7Y5QJI1-F1-model_v4 (2Fe-2S)-binding protein 0.9949 1 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A7X0JUW7-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.9947 1 149 GO:0046872
GO:0047121
GO:0051537
AF-A0A349TGJ4-F1-model_v4 (2Fe-2S)-binding protein 0.9942 1 141 GO:0016491
GO:0046872
GO:0051537
AF-A0A7V9BKS3-F1-model_v4 (2Fe-2S)-binding protein 0.9939 1 149 GO:0016491
GO:0046872
GO:0051537
AF-Q089K2-F1-model_v4 (2Fe-2S)-binding domain protein 0.9936 3 149 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
89.49 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map