F485841
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 923 | 346 | 923 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300053153|Ga0500616_0000926|Ga0500616_0000926_17832_18392 |
| Length | 186 |
| Sequence | LNTGITKFHERTMPITFTVNGKSATVDVPADMPLLWVLRDVLDLKGTKFGCGIAQCGACTVHVKGVPMRSCQIPASSAAGLAITTIEGLSPDGTHPLQVAWQDIDVPQCGYCQAGQIMSAAALLAKTPKPTDADIDEAMTGNICRCATYTRIKAAIHKAAGTTVTDSAPAGAGAKPVARRASKSGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 216 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 218 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 236 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 243 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 244 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 245 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 246 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 247 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 248 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 249 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 250 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 339 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 345 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.44 |
| Nodule | 0 |
| Rhizoplane | 1.08 |
| Rhizosphere | 94.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10004911 | 3300003203 | Bacteria | 6210 |
| 2 | Ga0058861_12020206 | 3300004800 | Bacteria | 2877 |
| 3 | Ga0058862_12814246 | 3300004803 | Bacteria | 2669 |
| 4 | Ga0065704_10096643 | 3300005289 | Bacteria | 2431 |
| 5 | Ga0065715_10155647 | 3300005293 | Bacteria | 1680 |
| 6 | Ga0065715_10297279 | 3300005293 | Bacteria | 1049 |
| 7 | Ga0065707_10093046 | 3300005295 | Bacteria | 3672 |
| 8 | Ga0065707_10238888 | 3300005295 | Bacteria | 1162 |
| 9 | Ga0065707_10334780 | 3300005295 | Bacteria | 943 |
| 10 | Ga0070658_10029087 | 3300005327 | Bacteria | 4438 |
| 11 | Ga0070658_10751912 | 3300005327 | Bacteria | 846 |
| 12 | Ga0070676_10004034 | 3300005328 | Bacteria | 7710 |
| 13 | Ga0070676_10212131 | 3300005328 | Bacteria | 1275 |
| 14 | Ga0070683_100006225 | 3300005329 | Bacteria | 10009 |
| 15 | Ga0070683_100175248 | 3300005329 | Bacteria | 2036 |
| 16 | Ga0070683_100198594 | 3300005329 | Bacteria | 1905 |
| 17 | Ga0070690_100045101 | 3300005330 | Bacteria | 2799 |
| 18 | Ga0070690_100050734 | 3300005330 | Bacteria | 2647 |
| 19 | Ga0070670_100017119 | 3300005331 | Bacteria | 6219 |
| 20 | Ga0070670_100038600 | 3300005331 | Bacteria | 4107 |
| 21 | Ga0070677_10153175 | 3300005333 | Bacteria | 1075 |
| 22 | Ga0068869_100003439 | 3300005334 | Bacteria | 9682 |
| 23 | Ga0068869_100223111 | 3300005334 | Bacteria | 1494 |
| 24 | Ga0068869_100775819 | 3300005334 | Bacteria | 822 |
| 25 | Ga0068869_100800793 | 3300005334 | Bacteria | 810 |
| 26 | Ga0070666_10132177 | 3300005335 | Bacteria | 1735 |
| 27 | Ga0070666_10228771 | 3300005335 | Bacteria | 1313 |
| 28 | Ga0070666_10454828 | 3300005335 | Bacteria | 925 |
| 29 | Ga0070680_100002196 | 3300005336 | Bacteria | 14389 |
| 30 | Ga0070680_100007201 | 3300005336 | Bacteria | 8479 |
| 31 | Ga0070680_100111613 | 3300005336 | Bacteria | 2276 |
| 32 | Ga0068868_100060025 | 3300005338 | Bacteria | 3009 |
| 33 | Ga0070660_100105928 | 3300005339 | Bacteria | 2232 |
| 34 | Ga0070689_100001466 | 3300005340 | Bacteria | 15055 |
| 35 | Ga0070689_100012437 | 3300005340 | Bacteria | 6132 |
| 36 | Ga0070689_100104338 | 3300005340 | Bacteria | 2247 |
| 37 | Ga0070689_100106941 | 3300005340 | Bacteria | 2220 |
| 38 | Ga0070689_100408684 | 3300005340 | Bacteria | 1149 |
| 39 | Ga0070687_100009121 | 3300005343 | Bacteria | 4237 |
| 40 | Ga0070687_100019645 | 3300005343 | Bacteria | 3147 |
| 41 | Ga0070687_100028627 | 3300005343 | Bacteria | 2704 |
| 42 | Ga0070687_100216610 | 3300005343 | Bacteria | 1170 |
| 43 | Ga0070661_100039948 | 3300005344 | Bacteria | 3420 |
| 44 | Ga0070661_100051556 | 3300005344 | Bacteria | 3012 |
| 45 | Ga0070661_100090988 | 3300005344 | Bacteria | 2259 |
| 46 | Ga0070692_10018279 | 3300005345 | Bacteria | 3368 |
| 47 | Ga0070692_10036286 | 3300005345 | Bacteria | 2501 |
| 48 | Ga0070692_10609117 | 3300005345 | Bacteria | 724 |
| 49 | Ga0070668_100000444 | 3300005347 | Bacteria | 27368 |
| 50 | Ga0070668_100038041 | 3300005347 | Bacteria | 3676 |
| 51 | Ga0070668_100195213 | 3300005347 | Bacteria | 1660 |
| 52 | Ga0070668_100394977 | 3300005347 | Bacteria | 1180 |
| 53 | Ga0070669_100016596 | 3300005353 | Bacteria | 5256 |
| 54 | Ga0070669_100031784 | 3300005353 | Bacteria | 3812 |
| 55 | Ga0070669_100053272 | 3300005353 | Bacteria | 2961 |
| 56 | Ga0070669_100876929 | 3300005353 | Bacteria | 766 |
| 57 | Ga0070669_101535655 | 3300005353 | Bacteria | 579 |
| 58 | Ga0070669_101597382 | 3300005353 | Bacteria | 568 |
| 59 | Ga0070669_101778821 | 3300005353 | Bacteria | 538 |
| 60 | Ga0070675_100001331 | 3300005354 | Bacteria | 18072 |
| 61 | Ga0070675_100014907 | 3300005354 | Bacteria | 6138 |
| 62 | Ga0070675_100016669 | 3300005354 | Bacteria | 5831 |
| 63 | Ga0070675_100042795 | 3300005354 | Bacteria | 3701 |
| 64 | Ga0070675_100435936 | 3300005354 | Bacteria | 1173 |
| 65 | Ga0070675_100538305 | 3300005354 | Bacteria | 1055 |
| 66 | Ga0070675_100613815 | 3300005354 | Bacteria | 987 |
| 67 | Ga0070671_100099076 | 3300005355 | Bacteria | 2444 |
| 68 | Ga0070674_100001579 | 3300005356 | Bacteria | 12185 |
| 69 | Ga0070674_100010963 | 3300005356 | Bacteria | 5498 |
| 70 | Ga0070674_100168716 | 3300005356 | Bacteria | 1667 |
| 71 | Ga0070674_100762128 | 3300005356 | Bacteria | 833 |
| 72 | Ga0070673_100029674 | 3300005364 | Bacteria | 4080 |
| 73 | Ga0070673_100172762 | 3300005364 | Bacteria | 1845 |
| 74 | Ga0070673_102077160 | 3300005364 | Bacteria | 539 |
| 75 | Ga0070688_100003074 | 3300005365 | Bacteria | 8525 |
| 76 | Ga0070688_100018960 | 3300005365 | Bacteria | 3979 |
| 77 | Ga0070688_100070024 | 3300005365 | Bacteria | 2242 |
| 78 | Ga0070688_100224466 | 3300005365 | Bacteria | 1325 |
| 79 | Ga0070688_100370056 | 3300005365 | Bacteria | 1054 |
| 80 | Ga0070688_100666559 | 3300005365 | Bacteria | 802 |
| 81 | Ga0070659_100091713 | 3300005366 | Bacteria | 2435 |
| 82 | Ga0070667_100013376 | 3300005367 | Bacteria | 6783 |
| 83 | Ga0070667_100119577 | 3300005367 | Bacteria | 2291 |
| 84 | Ga0070667_100260108 | 3300005367 | Bacteria | 1554 |
| 85 | Ga0070667_100631916 | 3300005367 | Bacteria | 988 |
| 86 | Ga0070667_100664685 | 3300005367 | Bacteria | 962 |
| 87 | Ga0070703_10140660 | 3300005406 | Bacteria | 896 |
| 88 | Ga0070709_10010190 | 3300005434 | Bacteria | 5194 |
| 89 | Ga0070714_100073766 | 3300005435 | Bacteria | 2957 |
| 90 | Ga0070701_10003233 | 3300005438 | Bacteria | 6421 |
| 91 | Ga0070701_10302011 | 3300005438 | Bacteria | 984 |
| 92 | Ga0070711_100091933 | 3300005439 | Bacteria | 2189 |
| 93 | Ga0070705_100000156 | 3300005440 | Bacteria | 40273 |
| 94 | Ga0070705_100019094 | 3300005440 | Bacteria | 3604 |
| 95 | Ga0070705_100194451 | 3300005440 | Bacteria | 1386 |
| 96 | Ga0070705_100419195 | 3300005440 | Bacteria | 996 |
| 97 | Ga0070705_100720726 | 3300005440 | Bacteria | 785 |
| 98 | Ga0070700_100005703 | 3300005441 | Bacteria | 6608 |
| 99 | Ga0070700_100111617 | 3300005441 | Bacteria | 1819 |
| 100 | Ga0070700_100118111 | 3300005441 | Bacteria | 1773 |
| 101 | Ga0070700_100567286 | 3300005441 | Bacteria | 884 |
| 102 | Ga0070700_100601525 | 3300005441 | Bacteria | 861 |
| 103 | Ga0070694_100003304 | 3300005444 | Bacteria | 9650 |
| 104 | Ga0070694_100005609 | 3300005444 | Bacteria | 7606 |
| 105 | Ga0070694_100043438 | 3300005444 | Bacteria | 3005 |
| 106 | Ga0070694_100062966 | 3300005444 | Bacteria | 2535 |
| 107 | Ga0070694_100385103 | 3300005444 | Bacteria | 1094 |
| 108 | Ga0070694_100794123 | 3300005444 | Bacteria | 776 |
| 109 | Ga0070694_100948023 | 3300005444 | Bacteria | 712 |
| 110 | Ga0070708_100004776 | 3300005445 | Bacteria | 10680 |
| 111 | Ga0070708_100012380 | 3300005445 | Bacteria | 6960 |
| 112 | Ga0070708_100045665 | 3300005445 | Bacteria | 3861 |
| 113 | Ga0070663_100062181 | 3300005455 | Bacteria | 2691 |
| 114 | Ga0070663_100065241 | 3300005455 | Bacteria | 2634 |
| 115 | Ga0070663_101332137 | 3300005455 | Bacteria | 634 |
| 116 | Ga0070663_101592817 | 3300005455 | Bacteria | 582 |
| 117 | Ga0070678_100008110 | 3300005456 | Bacteria | 6275 |
| 118 | Ga0070678_100180034 | 3300005456 | Bacteria | 1729 |
| 119 | Ga0070678_100570285 | 3300005456 | Bacteria | 1007 |
| 120 | Ga0070662_100041504 | 3300005457 | Bacteria | 3282 |
| 121 | Ga0070662_100124200 | 3300005457 | Bacteria | 1982 |
| 122 | Ga0070662_100462316 | 3300005457 | Bacteria | 1055 |
| 123 | Ga0070662_100635530 | 3300005457 | Bacteria | 900 |
| 124 | Ga0070681_10043237 | 3300005458 | Bacteria | 4514 |
| 125 | Ga0070681_10048676 | 3300005458 | Bacteria | 4236 |
| 126 | Ga0070681_10606477 | 3300005458 | Bacteria | 1009 |
| 127 | Ga0068867_100010217 | 3300005459 | Bacteria | 6621 |
| 128 | Ga0068867_100114913 | 3300005459 | Bacteria | 2072 |
| 129 | Ga0068867_100274630 | 3300005459 | Bacteria | 1380 |
| 130 | Ga0068867_101971268 | 3300005459 | Bacteria | 551 |
| 131 | Ga0070685_10011040 | 3300005466 | Bacteria | 4714 |
| 132 | Ga0070685_10087920 | 3300005466 | Bacteria | 1876 |
| 133 | Ga0070685_10115574 | 3300005466 | Bacteria | 1659 |
| 134 | Ga0070685_10436717 | 3300005466 | Bacteria | 914 |
| 135 | Ga0070685_10637608 | 3300005466 | Bacteria | 771 |
| 136 | Ga0070706_100009975 | 3300005467 | Bacteria | 8822 |
| 137 | Ga0070706_100091319 | 3300005467 | Bacteria | 2824 |
| 138 | Ga0070706_100529935 | 3300005467 | Bacteria | 1096 |
| 139 | Ga0070706_100597921 | 3300005467 | Bacteria | 1025 |
| 140 | Ga0070707_100302128 | 3300005468 | Bacteria | 1555 |
| 141 | Ga0070707_100657558 | 3300005468 | Bacteria | 1010 |
| 142 | Ga0070707_100692490 | 3300005468 | Bacteria | 982 |
| 143 | Ga0070707_101162494 | 3300005468 | Bacteria | 738 |
| 144 | Ga0070707_101624741 | 3300005468 | Bacteria | 613 |
| 145 | Ga0070698_100002282 | 3300005471 | Bacteria | 21228 |
| 146 | Ga0070698_100224520 | 3300005471 | Bacteria | 1811 |
| 147 | Ga0070698_100262333 | 3300005471 | Bacteria | 1660 |
| 148 | Ga0070698_100507100 | 3300005471 | Bacteria | 1145 |
| 149 | Ga0070698_100518363 | 3300005471 | Bacteria | 1130 |
| 150 | Ga0070699_100000763 | 3300005518 | Bacteria | 29746 |
| 151 | Ga0070699_100139811 | 3300005518 | Bacteria | 2137 |
| 152 | Ga0070699_100204867 | 3300005518 | Bacteria | 1755 |
| 153 | Ga0070699_100395356 | 3300005518 | Bacteria | 1249 |
| 154 | Ga0070679_100000595 | 3300005530 | Bacteria | 30724 |
| 155 | Ga0070679_100053079 | 3300005530 | Bacteria | 4035 |
| 156 | Ga0070684_100004296 | 3300005535 | Bacteria | 10813 |
| 157 | Ga0070684_100023616 | 3300005535 | Bacteria | 5147 |
| 158 | Ga0070684_100042162 | 3300005535 | Bacteria | 3939 |
| 159 | Ga0070684_100064604 | 3300005535 | Bacteria | 3211 |
| 160 | Ga0070684_100098615 | 3300005535 | Bacteria | 2607 |
| 161 | Ga0070684_100118791 | 3300005535 | Bacteria | 2377 |
| 162 | Ga0070684_100322287 | 3300005535 | Bacteria | 1419 |
| 163 | Ga0070684_101126476 | 3300005535 | Bacteria | 738 |
| 164 | Ga0070697_100374373 | 3300005536 | Bacteria | 1233 |
| 165 | Ga0070672_100013480 | 3300005543 | Bacteria | 5776 |
| 166 | Ga0070672_100014726 | 3300005543 | Bacteria | 5548 |
| 167 | Ga0070672_101162140 | 3300005543 | Bacteria | 687 |
| 168 | Ga0070672_101223994 | 3300005543 | Bacteria | 669 |
| 169 | Ga0070686_100059272 | 3300005544 | Bacteria | 2466 |
| 170 | Ga0070686_100115510 | 3300005544 | Bacteria | 1835 |
| 171 | Ga0070695_100000574 | 3300005545 | Bacteria | 19384 |
| 172 | Ga0070695_100134838 | 3300005545 | Bacteria | 1705 |
| 173 | Ga0070695_100344998 | 3300005545 | Bacteria | 1114 |
| 174 | Ga0070695_100347708 | 3300005545 | Bacteria | 1110 |
| 175 | Ga0070695_100424586 | 3300005545 | Bacteria | 1013 |
| 176 | Ga0070696_100002781 | 3300005546 | Bacteria | 11618 |
| 177 | Ga0070696_100035084 | 3300005546 | Bacteria | 3452 |
| 178 | Ga0070693_101404422 | 3300005547 | Bacteria | 543 |
| 179 | Ga0070693_101475564 | 3300005547 | Bacteria | 531 |
| 180 | Ga0070665_100223513 | 3300005548 | Bacteria | 1883 |
| 181 | Ga0070665_100336750 | 3300005548 | Bacteria | 1513 |
| 182 | Ga0070665_100377914 | 3300005548 | Bacteria | 1424 |
| 183 | Ga0070665_100538444 | 3300005548 | Bacteria | 1180 |
| 184 | Ga0070665_102073083 | 3300005548 | Bacteria | 573 |
| 185 | Ga0070665_102122933 | 3300005548 | Bacteria | 566 |
| 186 | Ga0070704_100003889 | 3300005549 | Bacteria | 8595 |
| 187 | Ga0070704_100067680 | 3300005549 | Bacteria | 2580 |
| 188 | Ga0070704_100540642 | 3300005549 | Bacteria | 1017 |
| 189 | Ga0070704_100695565 | 3300005549 | Bacteria | 901 |
| 190 | Ga0070704_101288635 | 3300005549 | Bacteria | 668 |
| 191 | Ga0070704_101497196 | 3300005549 | Bacteria | 621 |
| 192 | Ga0068855_100031356 | 3300005563 | Bacteria | 6347 |
| 193 | Ga0068855_100138491 | 3300005563 | Bacteria | 2775 |
| 194 | Ga0070664_100124839 | 3300005564 | Bacteria | 2257 |
| 195 | Ga0070664_100180040 | 3300005564 | Bacteria | 1878 |
| 196 | Ga0070664_100381944 | 3300005564 | Bacteria | 1286 |
| 197 | Ga0070664_100488519 | 3300005564 | Bacteria | 1134 |
| 198 | Ga0070664_100563886 | 3300005564 | Bacteria | 1054 |
| 199 | Ga0068857_100003390 | 3300005577 | Bacteria | 13271 |
| 200 | Ga0068857_100082803 | 3300005577 | Bacteria | 2866 |
| 201 | Ga0068857_100549781 | 3300005577 | Bacteria | 1088 |
| 202 | Ga0068857_100700948 | 3300005577 | Bacteria | 962 |
| 203 | Ga0068857_101863108 | 3300005577 | Bacteria | 589 |
| 204 | Ga0068854_100026113 | 3300005578 | Bacteria | 4012 |
| 205 | Ga0068856_100433112 | 3300005614 | Bacteria | 1335 |
| 206 | Ga0068856_100442317 | 3300005614 | Bacteria | 1320 |
| 207 | Ga0068856_101728796 | 3300005614 | Bacteria | 638 |
| 208 | Ga0070702_100065204 | 3300005615 | Bacteria | 2133 |
| 209 | Ga0070702_100668905 | 3300005615 | Bacteria | 787 |
| 210 | Ga0068852_100027475 | 3300005616 | Bacteria | 4638 |
| 211 | Ga0068852_100231606 | 3300005616 | Bacteria | 1761 |
| 212 | Ga0068852_100663846 | 3300005616 | Bacteria | 1051 |
| 213 | Ga0068852_100958469 | 3300005616 | Bacteria | 874 |
| 214 | Ga0068859_100007156 | 3300005617 | Bacteria | 11327 |
| 215 | Ga0068859_100008945 | 3300005617 | Bacteria | 10113 |
| 216 | Ga0068859_100137579 | 3300005617 | Bacteria | 2516 |
| 217 | Ga0068859_100408803 | 3300005617 | Bacteria | 1453 |
| 218 | Ga0068859_100436540 | 3300005617 | Bacteria | 1406 |
| 219 | Ga0068859_100776857 | 3300005617 | Bacteria | 1046 |
| 220 | Ga0068859_101014513 | 3300005617 | Bacteria | 911 |
| 221 | Ga0068859_101154645 | 3300005617 | Bacteria | 852 |
| 222 | Ga0068859_101237010 | 3300005617 | Bacteria | 822 |
| 223 | Ga0068859_102492342 | 3300005617 | Bacteria | 569 |
| 224 | Ga0068864_100064676 | 3300005618 | Bacteria | 3173 |
| 225 | Ga0068864_100077076 | 3300005618 | Bacteria | 2914 |
| 226 | Ga0068864_100126191 | 3300005618 | Bacteria | 2294 |
| 227 | Ga0068864_100135909 | 3300005618 | Bacteria | 2214 |
| 228 | Ga0068864_101185630 | 3300005618 | Bacteria | 762 |
| 229 | Ga0068866_10225786 | 3300005718 | Bacteria | 1133 |
| 230 | Ga0068861_100002466 | 3300005719 | Bacteria | 12064 |
| 231 | Ga0068861_100007890 | 3300005719 | Bacteria | 7324 |
| 232 | Ga0068861_100016097 | 3300005719 | Bacteria | 5282 |
| 233 | Ga0068861_100213147 | 3300005719 | Bacteria | 1628 |
| 234 | Ga0068861_100987446 | 3300005719 | Bacteria | 803 |
| 235 | Ga0068861_101530840 | 3300005719 | Bacteria | 655 |
| 236 | Ga0068861_101936590 | 3300005719 | Bacteria | 587 |
| 237 | Ga0068851_10119810 | 3300005834 | Bacteria | 1413 |
| 238 | Ga0068870_10003744 | 3300005840 | Bacteria | 6471 |
| 239 | Ga0068870_10022791 | 3300005840 | Bacteria | 3080 |
| 240 | Ga0068870_10043570 | 3300005840 | Bacteria | 2341 |
| 241 | Ga0068870_10288969 | 3300005840 | Bacteria | 1031 |
| 242 | Ga0068863_100031527 | 3300005841 | Bacteria | 5057 |
| 243 | Ga0068863_100038626 | 3300005841 | Bacteria | 4541 |
| 244 | Ga0068863_100040923 | 3300005841 | Bacteria | 4406 |
| 245 | Ga0068863_100181805 | 3300005841 | Bacteria | 2018 |
| 246 | Ga0068863_100603403 | 3300005841 | Bacteria | 1087 |
| 247 | Ga0068858_100008252 | 3300005842 | Bacteria | 10011 |
| 248 | Ga0068858_100070669 | 3300005842 | Bacteria | 3236 |
| 249 | Ga0068858_100137314 | 3300005842 | Bacteria | 2295 |
| 250 | Ga0068858_100147606 | 3300005842 | Bacteria | 2209 |
| 251 | Ga0068858_100180314 | 3300005842 | Bacteria | 1994 |
| 252 | Ga0068858_100671224 | 3300005842 | Bacteria | 1008 |
| 253 | Ga0068860_100001702 | 3300005843 | Bacteria | 23502 |
| 254 | Ga0068860_100006938 | 3300005843 | Bacteria | 11352 |
| 255 | Ga0068860_100074411 | 3300005843 | Bacteria | 3230 |
| 256 | Ga0068860_100584939 | 3300005843 | Bacteria | 1121 |
| 257 | Ga0068860_101136943 | 3300005843 | Bacteria | 801 |
| 258 | Ga0068862_100001703 | 3300005844 | Bacteria | 19941 |
| 259 | Ga0068862_100007216 | 3300005844 | Bacteria | 9231 |
| 260 | Ga0068862_100046426 | 3300005844 | Bacteria | 3706 |
| 261 | Ga0068862_100176479 | 3300005844 | Bacteria | 1915 |
| 262 | Ga0068862_100390674 | 3300005844 | Bacteria | 1300 |
| 263 | Ga0068862_100743451 | 3300005844 | Bacteria | 954 |
| 264 | Ga0068862_100813993 | 3300005844 | Bacteria | 913 |
| 265 | Ga0081455_10195831 | 3300005937 | Bacteria | 1518 |
| 266 | Ga0081539_10001447 | 3300005985 | Bacteria | 40627 |
| 267 | Ga0081539_10001460 | 3300005985 | Bacteria | 40240 |
| 268 | Ga0075365_10008317 | 3300006038 | Bacteria | 5880 |
| 269 | Ga0075365_10097114 | 3300006038 | Bacteria | 2013 |
| 270 | Ga0075365_10226393 | 3300006038 | Bacteria | 1312 |
| 271 | Ga0075368_10004085 | 3300006042 | Bacteria | 4911 |
| 272 | Ga0075368_10278475 | 3300006042 | Bacteria | 718 |
| 273 | Ga0075363_100080712 | 3300006048 | Bacteria | 1779 |
| 274 | Ga0075364_10053197 | 3300006051 | Bacteria | 2647 |
| 275 | Ga0075364_10164752 | 3300006051 | Bacteria | 1497 |
| 276 | Ga0070716_100740760 | 3300006173 | Bacteria | 755 |
| 277 | Ga0070712_100162596 | 3300006175 | Bacteria | 1725 |
| 278 | Ga0075362_10038042 | 3300006177 | Bacteria | 2112 |
| 279 | Ga0075362_10068299 | 3300006177 | Bacteria | 1619 |
| 280 | Ga0075362_10629209 | 3300006177 | Bacteria | 556 |
| 281 | Ga0075367_10021436 | 3300006178 | Bacteria | 3611 |
| 282 | Ga0075367_10030877 | 3300006178 | Bacteria | 3075 |
| 283 | Ga0075369_10346076 | 3300006186 | Bacteria | 697 |
| 284 | Ga0075369_10475424 | 3300006186 | Bacteria | 593 |
| 285 | Ga0075366_10000128 | 3300006195 | Bacteria | 31593 |
| 286 | Ga0097621_100082981 | 3300006237 | Bacteria | 2670 |
| 287 | Ga0075370_10096103 | 3300006353 | Bacteria | 1712 |
| 288 | Ga0075370_10720353 | 3300006353 | Bacteria | 607 |
| 289 | Ga0068871_100389406 | 3300006358 | Bacteria | 1239 |
| 290 | Ga0075428_100004279 | 3300006844 | Bacteria | 15712 |
| 291 | Ga0075428_100095286 | 3300006844 | Bacteria | 3244 |
| 292 | Ga0075428_100131771 | 3300006844 | Bacteria | 2719 |
| 293 | Ga0075428_100236400 | 3300006844 | Bacteria | 1971 |
| 294 | Ga0075428_100354165 | 3300006844 | Bacteria | 1575 |
| 295 | Ga0075428_100504633 | 3300006844 | Bacteria | 1294 |
| 296 | Ga0075430_100135241 | 3300006846 | Bacteria | 2054 |
| 297 | Ga0075430_100882018 | 3300006846 | Bacteria | 737 |
| 298 | Ga0075431_100009878 | 3300006847 | Bacteria | 9582 |
| 299 | Ga0075431_100181590 | 3300006847 | Bacteria | 2159 |
| 300 | Ga0075431_100600220 | 3300006847 | Bacteria | 1085 |
| 301 | Ga0075431_101221499 | 3300006847 | Bacteria | 714 |
| 302 | Ga0075433_10003192 | 3300006852 | Bacteria | 12636 |
| 303 | Ga0075433_10018953 | 3300006852 | Bacteria | 5727 |
| 304 | Ga0075433_10106453 | 3300006852 | Bacteria | 2486 |
| 305 | Ga0075433_10188470 | 3300006852 | Bacteria | 1835 |
| 306 | Ga0075433_10260145 | 3300006852 | Bacteria | 1539 |
| 307 | Ga0075433_10487469 | 3300006852 | Bacteria | 1086 |
| 308 | Ga0075434_100006350 | 3300006871 | Bacteria | 10836 |
| 309 | Ga0075434_100023121 | 3300006871 | Bacteria | 6054 |
| 310 | Ga0075434_100240855 | 3300006871 | Bacteria | 1829 |
| 311 | Ga0075434_100481010 | 3300006871 | Bacteria | 1263 |
| 312 | Ga0075434_101676521 | 3300006871 | Bacteria | 644 |
| 313 | Ga0075434_101836417 | 3300006871 | Bacteria | 613 |
| 314 | Ga0075429_100206839 | 3300006880 | Bacteria | 1720 |
| 315 | Ga0075429_100221408 | 3300006880 | Bacteria | 1658 |
| 316 | Ga0075429_100499549 | 3300006880 | Bacteria | 1066 |
| 317 | Ga0075429_100540894 | 3300006880 | Bacteria | 1021 |
| 318 | Ga0068865_100018249 | 3300006881 | Bacteria | 4526 |
| 319 | Ga0068865_100113907 | 3300006881 | Bacteria | 1999 |
| 320 | Ga0068865_100190724 | 3300006881 | Bacteria | 1585 |
| 321 | Ga0068865_100574336 | 3300006881 | Bacteria | 950 |
| 322 | Ga0068865_100728584 | 3300006881 | Bacteria | 850 |
| 323 | Ga0097620_100007155 | 3300006931 | Bacteria | 11327 |
| 324 | Ga0097620_100008945 | 3300006931 | Bacteria | 10113 |
| 325 | Ga0097620_100137586 | 3300006931 | Bacteria | 2516 |
| 326 | Ga0097620_100408773 | 3300006931 | Bacteria | 1453 |
| 327 | Ga0097620_100436498 | 3300006931 | Bacteria | 1406 |
| 328 | Ga0097620_100776833 | 3300006931 | Bacteria | 1046 |
| 329 | Ga0097620_101014531 | 3300006931 | Bacteria | 911 |
| 330 | Ga0097620_101154692 | 3300006931 | Bacteria | 852 |
| 331 | Ga0097620_101236971 | 3300006931 | Bacteria | 822 |
| 332 | Ga0097620_102492287 | 3300006931 | Bacteria | 569 |
| 333 | Ga0075435_100008302 | 3300007076 | Bacteria | 7443 |
| 334 | Ga0075435_100009995 | 3300007076 | Bacteria | 6917 |
| 335 | Ga0075435_100218556 | 3300007076 | Bacteria | 1618 |
| 336 | Ga0075435_100254982 | 3300007076 | Bacteria | 1494 |
| 337 | Ga0075435_100277843 | 3300007076 | Bacteria | 1429 |
| 338 | Ga0105240_10069451 | 3300009093 | Bacteria | 4360 |
| 339 | Ga0105240_10312363 | 3300009093 | Bacteria | 1794 |
| 340 | Ga0111539_10000305 | 3300009094 | Bacteria | 59778 |
| 341 | Ga0111539_10022206 | 3300009094 | Bacteria | 7802 |
| 342 | Ga0111539_10040437 | 3300009094 | Bacteria | 5614 |
| 343 | Ga0111539_10214093 | 3300009094 | Bacteria | 2245 |
| 344 | Ga0111539_10310608 | 3300009094 | Bacteria | 1835 |
| 345 | Ga0111539_10366694 | 3300009094 | Bacteria | 1676 |
| 346 | Ga0111539_10392898 | 3300009094 | Bacteria | 1615 |
| 347 | Ga0111539_10527595 | 3300009094 | Bacteria | 1376 |
| 348 | Ga0111539_10734437 | 3300009094 | Bacteria | 1149 |
| 349 | Ga0105245_10169305 | 3300009098 | Bacteria | 2079 |
| 350 | Ga0105245_10232054 | 3300009098 | Bacteria | 1785 |
| 351 | Ga0105245_10733529 | 3300009098 | Bacteria | 1023 |
| 352 | Ga0105245_10972118 | 3300009098 | Bacteria | 893 |
| 353 | Ga0105247_10287431 | 3300009101 | Bacteria | 1136 |
| 354 | Ga0114129_10001655 | 3300009147 | Bacteria | 30310 |
| 355 | Ga0114129_10086207 | 3300009147 | Bacteria | 4356 |
| 356 | Ga0114129_10111748 | 3300009147 | Bacteria | 3770 |
| 357 | Ga0114129_10136702 | 3300009147 | Bacteria | 3363 |
| 358 | Ga0114129_10178224 | 3300009147 | Bacteria | 2893 |
| 359 | Ga0114129_10322886 | 3300009147 | Bacteria | 2052 |
| 360 | Ga0114129_11554625 | 3300009147 | Bacteria | 811 |
| 361 | Ga0105243_10011189 | 3300009148 | Bacteria | 6787 |
| 362 | Ga0105243_10107591 | 3300009148 | Bacteria | 2326 |
| 363 | Ga0105243_10109765 | 3300009148 | Bacteria | 2305 |
| 364 | Ga0105243_10345087 | 3300009148 | Bacteria | 1365 |
| 365 | Ga0105243_10793465 | 3300009148 | Bacteria | 933 |
| 366 | Ga0105241_10131094 | 3300009174 | Bacteria | 2030 |
| 367 | Ga0105241_10554892 | 3300009174 | Bacteria | 1032 |
| 368 | Ga0105242_10031909 | 3300009176 | Bacteria | 4211 |
| 369 | Ga0105242_10091885 | 3300009176 | Bacteria | 2556 |
| 370 | Ga0105242_10256413 | 3300009176 | Bacteria | 1578 |
| 371 | Ga0105242_10446394 | 3300009176 | Bacteria | 1218 |
| 372 | Ga0105242_10518490 | 3300009176 | Bacteria | 1137 |
| 373 | Ga0105242_10963427 | 3300009176 | Bacteria | 858 |
| 374 | Ga0105242_11566740 | 3300009176 | Bacteria | 691 |
| 375 | Ga0105248_10008266 | 3300009177 | Bacteria | 11434 |
| 376 | Ga0105248_10034349 | 3300009177 | Bacteria | 5670 |
| 377 | Ga0105248_10350586 | 3300009177 | Bacteria | 1662 |
| 378 | Ga0105248_10427070 | 3300009177 | Bacteria | 1492 |
| 379 | Ga0105248_10557109 | 3300009177 | Bacteria | 1293 |
| 380 | Ga0105248_10588362 | 3300009177 | Bacteria | 1256 |
| 381 | Ga0105248_11041428 | 3300009177 | Bacteria | 924 |
| 382 | Ga0105237_10094706 | 3300009545 | Bacteria | 2975 |
| 383 | Ga0105237_10443189 | 3300009545 | Bacteria | 1304 |
| 384 | Ga0105237_10599141 | 3300009545 | Bacteria | 1109 |
| 385 | Ga0105238_10103316 | 3300009551 | Bacteria | 2831 |
| 386 | Ga0105238_11337255 | 3300009551 | Bacteria | 743 |
| 387 | Ga0105249_10002856 | 3300009553 | Bacteria | 14921 |
| 388 | Ga0105249_10003594 | 3300009553 | Bacteria | 13417 |
| 389 | Ga0105249_10023451 | 3300009553 | Bacteria | 5537 |
| 390 | Ga0105249_10243759 | 3300009553 | Bacteria | 1778 |
| 391 | Ga0105249_10326581 | 3300009553 | Bacteria | 1547 |
| 392 | Ga0105249_11140213 | 3300009553 | Bacteria | 850 |
| 393 | Ga0105249_12479767 | 3300009553 | Bacteria | 591 |
| 394 | Ga0105239_10055210 | 3300010375 | Bacteria | 4356 |
| 395 | Ga0157373_10109563 | 3300013100 | Bacteria | 1941 |
| 396 | Ga0157371_10020712 | 3300013102 | Bacteria | 4837 |
| 397 | Ga0157370_10127181 | 3300013104 | Bacteria | 2378 |
| 398 | Ga0157369_10326981 | 3300013105 | Bacteria | 1593 |
| 399 | Ga0157369_10641235 | 3300013105 | Bacteria | 1096 |
| 400 | Ga0157374_10209306 | 3300013296 | Bacteria | 1912 |
| 401 | Ga0157378_10000001 | 3300013297 | Bacteria | 352632 |
| 402 | Ga0157378_10099008 | 3300013297 | Bacteria | 2660 |
| 403 | Ga0163162_10000455 | 3300013306 | Bacteria | 37915 |
| 404 | Ga0163162_10095346 | 3300013306 | Bacteria | 3062 |
| 405 | Ga0163162_10102417 | 3300013306 | Bacteria | 2956 |
| 406 | Ga0163162_10547020 | 3300013306 | Bacteria | 1286 |
| 407 | Ga0157372_10037384 | 3300013307 | Bacteria | 5356 |
| 408 | Ga0157372_10313094 | 3300013307 | Bacteria | 1827 |
| 409 | Ga0157372_11631620 | 3300013307 | Bacteria | 742 |
| 410 | Ga0157375_10003909 | 3300013308 | Bacteria | 12925 |
| 411 | Ga0157375_10009133 | 3300013308 | Bacteria | 8686 |
| 412 | Ga0157375_10015147 | 3300013308 | Bacteria | 6897 |
| 413 | Ga0157375_10262716 | 3300013308 | Bacteria | 1888 |
| 414 | Ga0157375_10891583 | 3300013308 | Bacteria | 1034 |
| 415 | Ga0157375_12112007 | 3300013308 | Bacteria | 670 |
| 416 | Ga0163163_10006856 | 3300014325 | Bacteria | 10000 |
| 417 | Ga0163163_10935413 | 3300014325 | Bacteria | 930 |
| 418 | Ga0163163_11224431 | 3300014325 | Bacteria | 813 |
| 419 | Ga0157380_10006107 | 3300014326 | Bacteria | 8442 |
| 420 | Ga0157380_10008768 | 3300014326 | Bacteria | 7224 |
| 421 | Ga0157380_10061475 | 3300014326 | Bacteria | 3006 |
| 422 | Ga0157380_10253204 | 3300014326 | Bacteria | 1595 |
| 423 | Ga0157377_10020027 | 3300014745 | Bacteria | 3499 |
| 424 | Ga0157377_10028243 | 3300014745 | Bacteria | 3018 |
| 425 | Ga0157377_10037485 | 3300014745 | Bacteria | 2671 |
| 426 | Ga0157377_10091167 | 3300014745 | Bacteria | 1800 |
| 427 | Ga0157377_10341191 | 3300014745 | Bacteria | 1002 |
| 428 | Ga0157379_10511353 | 3300014968 | Bacteria | 1114 |
| 429 | Ga0157379_11129689 | 3300014968 | Bacteria | 751 |
| 430 | Ga0157379_11851970 | 3300014968 | Bacteria | 594 |
| 431 | Ga0157379_11961963 | 3300014968 | Bacteria | 578 |
| 432 | Ga0157376_10203145 | 3300014969 | Bacteria | 1825 |
| 433 | Ga0157376_10477277 | 3300014969 | Bacteria | 1221 |
| 434 | Ga0163161_10425001 | 3300017792 | Bacteria | 1070 |
| 435 | Ga0197907_10821123 | 3300020069 | Bacteria | 733 |
| 436 | Ga0206352_10799656 | 3300020078 | Bacteria | 2961 |
| 437 | Ga0206353_11065889 | 3300020082 | Bacteria | 803 |
| 438 | Ga0154015_1277831 | 3300020610 | Bacteria | 709 |
| 439 | Ga0213875_10556325 | 3300021388 | Bacteria | 553 |
| 440 | Ga0207697_10004603 | 3300025315 | Bacteria | 6554 |
| 441 | Ga0207697_10134691 | 3300025315 | Bacteria | 1069 |
| 442 | Ga0207653_10037061 | 3300025885 | Bacteria | 1590 |
| 443 | Ga0207682_10037279 | 3300025893 | Bacteria | 1969 |
| 444 | Ga0207682_10095712 | 3300025893 | Bacteria | 1293 |
| 445 | Ga0207682_10177049 | 3300025893 | Bacteria | 973 |
| 446 | Ga0207688_10023903 | 3300025901 | Bacteria | 3350 |
| 447 | Ga0207688_10062307 | 3300025901 | Bacteria | 2102 |
| 448 | Ga0207688_10098690 | 3300025901 | Bacteria | 1684 |
| 449 | Ga0207688_10981361 | 3300025901 | Bacteria | 534 |
| 450 | Ga0207680_10049308 | 3300025903 | Bacteria | 2506 |
| 451 | Ga0207680_10074727 | 3300025903 | Bacteria | 2111 |
| 452 | Ga0207680_10367720 | 3300025903 | Bacteria | 1012 |
| 453 | Ga0207680_11006824 | 3300025903 | Bacteria | 597 |
| 454 | Ga0207647_10030615 | 3300025904 | Bacteria | 3469 |
| 455 | Ga0207647_10132312 | 3300025904 | Bacteria | 1465 |
| 456 | Ga0207645_10000687 | 3300025907 | Bacteria | 28066 |
| 457 | Ga0207643_10009279 | 3300025908 | Bacteria | 5286 |
| 458 | Ga0207643_10012200 | 3300025908 | Bacteria | 4646 |
| 459 | Ga0207643_10015211 | 3300025908 | Bacteria | 4186 |
| 460 | Ga0207684_10504390 | 3300025910 | Bacteria | 1037 |
| 461 | Ga0207684_10971157 | 3300025910 | Bacteria | 712 |
| 462 | Ga0207707_10028110 | 3300025912 | Bacteria | 4916 |
| 463 | Ga0207707_10062568 | 3300025912 | Bacteria | 3239 |
| 464 | Ga0207707_10067530 | 3300025912 | Bacteria | 3115 |
| 465 | Ga0207707_10512288 | 3300025912 | Bacteria | 1022 |
| 466 | Ga0207707_10609738 | 3300025912 | Bacteria | 923 |
| 467 | Ga0207695_10031018 | 3300025913 | Bacteria | 5875 |
| 468 | Ga0207695_10068761 | 3300025913 | Bacteria | 3628 |
| 469 | Ga0207671_10095116 | 3300025914 | Bacteria | 2249 |
| 470 | Ga0207671_10301280 | 3300025914 | Bacteria | 1266 |
| 471 | Ga0207663_10131520 | 3300025916 | Bacteria | 1730 |
| 472 | Ga0207660_10000818 | 3300025917 | Bacteria | 20531 |
| 473 | Ga0207660_10075669 | 3300025917 | Bacteria | 2460 |
| 474 | Ga0207660_10091568 | 3300025917 | Bacteria | 2255 |
| 475 | Ga0207660_10853352 | 3300025917 | Bacteria | 743 |
| 476 | Ga0207662_10001597 | 3300025918 | Bacteria | 11096 |
| 477 | Ga0207662_10002499 | 3300025918 | Bacteria | 9244 |
| 478 | Ga0207662_10019830 | 3300025918 | Bacteria | 3832 |
| 479 | Ga0207662_10063717 | 3300025918 | Bacteria | 2217 |
| 480 | Ga0207657_10052336 | 3300025919 | Bacteria | 3544 |
| 481 | Ga0207649_10053694 | 3300025920 | Bacteria | 2505 |
| 482 | Ga0207649_10495927 | 3300025920 | Bacteria | 928 |
| 483 | Ga0207649_10838722 | 3300025920 | Bacteria | 719 |
| 484 | Ga0207649_11278462 | 3300025920 | Bacteria | 580 |
| 485 | Ga0207652_10080149 | 3300025921 | Bacteria | 2853 |
| 486 | Ga0207652_10164539 | 3300025921 | Bacteria | 1989 |
| 487 | Ga0207652_10306718 | 3300025921 | Bacteria | 1433 |
| 488 | Ga0207646_10131939 | 3300025922 | Bacteria | 2249 |
| 489 | Ga0207646_10262756 | 3300025922 | Bacteria | 1560 |
| 490 | Ga0207646_10540532 | 3300025922 | Bacteria | 1048 |
| 491 | Ga0207681_10001144 | 3300025923 | Bacteria | 17122 |
| 492 | Ga0207681_10010449 | 3300025923 | Bacteria | 5680 |
| 493 | Ga0207681_10116658 | 3300025923 | Bacteria | 1951 |
| 494 | Ga0207681_10342530 | 3300025923 | Bacteria | 1194 |
| 495 | Ga0207681_10355140 | 3300025923 | Bacteria | 1174 |
| 496 | Ga0207681_10386957 | 3300025923 | Bacteria | 1127 |
| 497 | Ga0207681_10854491 | 3300025923 | Bacteria | 761 |
| 498 | Ga0207681_11223622 | 3300025923 | Bacteria | 631 |
| 499 | Ga0207694_10010888 | 3300025924 | Bacteria | 6868 |
| 500 | Ga0207650_10043836 | 3300025925 | Bacteria | 3286 |
| 501 | Ga0207650_10078385 | 3300025925 | Bacteria | 2499 |
| 502 | Ga0207650_10246798 | 3300025925 | Bacteria | 1444 |
| 503 | Ga0207650_10752607 | 3300025925 | Bacteria | 825 |
| 504 | Ga0207659_10000485 | 3300025926 | Bacteria | 23902 |
| 505 | Ga0207659_10000662 | 3300025926 | Bacteria | 20344 |
| 506 | Ga0207659_10370100 | 3300025926 | Bacteria | 1193 |
| 507 | Ga0207659_10480251 | 3300025926 | Bacteria | 1050 |
| 508 | Ga0207659_10867036 | 3300025926 | Bacteria | 776 |
| 509 | Ga0207687_10094278 | 3300025927 | Bacteria | 2190 |
| 510 | Ga0207687_10142770 | 3300025927 | Bacteria | 1818 |
| 511 | Ga0207687_10334648 | 3300025927 | Bacteria | 1229 |
| 512 | Ga0207664_10145500 | 3300025929 | Bacteria | 2009 |
| 513 | Ga0207644_10123831 | 3300025931 | Bacteria | 1971 |
| 514 | Ga0207644_10938762 | 3300025931 | Bacteria | 725 |
| 515 | Ga0207644_11390862 | 3300025931 | Bacteria | 589 |
| 516 | Ga0207644_11494003 | 3300025931 | Bacteria | 567 |
| 517 | Ga0207706_10001099 | 3300025933 | Bacteria | 27517 |
| 518 | Ga0207706_10043260 | 3300025933 | Bacteria | 3992 |
| 519 | Ga0207706_10252137 | 3300025933 | Bacteria | 1541 |
| 520 | Ga0207706_10288738 | 3300025933 | Bacteria | 1430 |
| 521 | Ga0207706_10389281 | 3300025933 | Bacteria | 1209 |
| 522 | Ga0207706_10536726 | 3300025933 | Bacteria | 1008 |
| 523 | Ga0207686_10016982 | 3300025934 | Bacteria | 4092 |
| 524 | Ga0207686_10058992 | 3300025934 | Bacteria | 2422 |
| 525 | Ga0207686_10125458 | 3300025934 | Bacteria | 1754 |
| 526 | Ga0207686_10219212 | 3300025934 | Bacteria | 1373 |
| 527 | Ga0207686_10401457 | 3300025934 | Bacteria | 1044 |
| 528 | Ga0207709_10008410 | 3300025935 | Bacteria | 5707 |
| 529 | Ga0207709_10098536 | 3300025935 | Bacteria | 1928 |
| 530 | Ga0207709_10315314 | 3300025935 | Bacteria | 1168 |
| 531 | Ga0207709_10425524 | 3300025935 | Bacteria | 1021 |
| 532 | Ga0207670_10000771 | 3300025936 | Bacteria | 16844 |
| 533 | Ga0207670_10094530 | 3300025936 | Bacteria | 2121 |
| 534 | Ga0207670_10190862 | 3300025936 | Bacteria | 1550 |
| 535 | Ga0207670_10193190 | 3300025936 | Bacteria | 1541 |
| 536 | Ga0207670_10193802 | 3300025936 | Bacteria | 1539 |
| 537 | Ga0207670_11617094 | 3300025936 | Bacteria | 551 |
| 538 | Ga0207669_10012338 | 3300025937 | Bacteria | 4198 |
| 539 | Ga0207669_10026671 | 3300025937 | Bacteria | 3148 |
| 540 | Ga0207669_10388733 | 3300025937 | Bacteria | 1089 |
| 541 | Ga0207669_10631069 | 3300025937 | Bacteria | 874 |
| 542 | Ga0207704_10075915 | 3300025938 | Bacteria | 2151 |
| 543 | Ga0207704_10159611 | 3300025938 | Bacteria | 1603 |
| 544 | Ga0207704_10252233 | 3300025938 | Bacteria | 1325 |
| 545 | Ga0207704_10597652 | 3300025938 | Bacteria | 903 |
| 546 | Ga0207665_10457601 | 3300025939 | Bacteria | 980 |
| 547 | Ga0207691_10002827 | 3300025940 | Bacteria | 16911 |
| 548 | Ga0207691_10008916 | 3300025940 | Bacteria | 9630 |
| 549 | Ga0207691_10016017 | 3300025940 | Bacteria | 7120 |
| 550 | Ga0207691_10084819 | 3300025940 | Bacteria | 2843 |
| 551 | Ga0207691_10243366 | 3300025940 | Bacteria | 1555 |
| 552 | Ga0207711_10129164 | 3300025941 | Bacteria | 2264 |
| 553 | Ga0207711_10321484 | 3300025941 | Bacteria | 1430 |
| 554 | Ga0207711_10398418 | 3300025941 | Bacteria | 1279 |
| 555 | Ga0207711_10448695 | 3300025941 | Bacteria | 1201 |
| 556 | Ga0207711_10697684 | 3300025941 | Bacteria | 947 |
| 557 | Ga0207711_10795867 | 3300025941 | Bacteria | 881 |
| 558 | Ga0207689_10002768 | 3300025942 | Bacteria | 16209 |
| 559 | Ga0207689_10022249 | 3300025942 | Bacteria | 5330 |
| 560 | Ga0207689_10116195 | 3300025942 | Bacteria | 2199 |
| 561 | Ga0207661_10004508 | 3300025944 | Bacteria | 9765 |
| 562 | Ga0207661_10011169 | 3300025944 | Bacteria | 6496 |
| 563 | Ga0207661_10041846 | 3300025944 | Bacteria | 3609 |
| 564 | Ga0207661_10078151 | 3300025944 | Bacteria | 2723 |
| 565 | Ga0207661_10138409 | 3300025944 | Bacteria | 2093 |
| 566 | Ga0207661_10185135 | 3300025944 | Bacteria | 1822 |
| 567 | Ga0207661_10232981 | 3300025944 | Bacteria | 1631 |
| 568 | Ga0207661_10275459 | 3300025944 | Bacteria | 1502 |
| 569 | Ga0207679_10028174 | 3300025945 | Bacteria | 3894 |
| 570 | Ga0207679_10100832 | 3300025945 | Bacteria | 2257 |
| 571 | Ga0207679_10125372 | 3300025945 | Bacteria | 2051 |
| 572 | Ga0207679_10506425 | 3300025945 | Bacteria | 1078 |
| 573 | Ga0207679_10764722 | 3300025945 | Bacteria | 879 |
| 574 | Ga0207667_10080730 | 3300025949 | Bacteria | 3369 |
| 575 | Ga0207667_10153504 | 3300025949 | Bacteria | 2369 |
| 576 | Ga0207651_10129428 | 3300025960 | Bacteria | 1929 |
| 577 | Ga0207651_10964533 | 3300025960 | Bacteria | 761 |
| 578 | Ga0207712_10002158 | 3300025961 | Bacteria | 12853 |
| 579 | Ga0207712_10018433 | 3300025961 | Bacteria | 4547 |
| 580 | Ga0207712_10220360 | 3300025961 | Bacteria | 1516 |
| 581 | Ga0207712_10327827 | 3300025961 | Bacteria | 1265 |
| 582 | Ga0207712_10891877 | 3300025961 | Bacteria | 785 |
| 583 | Ga0207712_11132371 | 3300025961 | Bacteria | 697 |
| 584 | Ga0207712_11447448 | 3300025961 | Bacteria | 615 |
| 585 | Ga0207668_10015066 | 3300025972 | Bacteria | 4798 |
| 586 | Ga0207668_10015442 | 3300025972 | Bacteria | 4745 |
| 587 | Ga0207640_10060457 | 3300025981 | Bacteria | 2505 |
| 588 | Ga0207640_10571352 | 3300025981 | Bacteria | 953 |
| 589 | Ga0207658_10016778 | 3300025986 | Bacteria | 5040 |
| 590 | Ga0207658_10182075 | 3300025986 | Bacteria | 1740 |
| 591 | Ga0207658_10342942 | 3300025986 | Bacteria | 1299 |
| 592 | Ga0207658_10468921 | 3300025986 | Bacteria | 1117 |
| 593 | Ga0207658_10529611 | 3300025986 | Bacteria | 1052 |
| 594 | Ga0207658_10890798 | 3300025986 | Bacteria | 810 |
| 595 | Ga0207677_10013685 | 3300026023 | Bacteria | 4710 |
| 596 | Ga0207677_10260150 | 3300026023 | Bacteria | 1414 |
| 597 | Ga0207677_10773124 | 3300026023 | Bacteria | 858 |
| 598 | Ga0207703_10016307 | 3300026035 | Bacteria | 5791 |
| 599 | Ga0207703_10130334 | 3300026035 | Bacteria | 2171 |
| 600 | Ga0207639_10263637 | 3300026041 | Bacteria | 1508 |
| 601 | Ga0207639_11365997 | 3300026041 | Bacteria | 665 |
| 602 | Ga0207678_10136040 | 3300026067 | Bacteria | 2097 |
| 603 | Ga0207678_10229146 | 3300026067 | Bacteria | 1591 |
| 604 | Ga0207708_10009542 | 3300026075 | Bacteria | 7195 |
| 605 | Ga0207708_10014222 | 3300026075 | Bacteria | 5951 |
| 606 | Ga0207708_10098231 | 3300026075 | Bacteria | 2263 |
| 607 | Ga0207708_10282495 | 3300026075 | Bacteria | 1345 |
| 608 | Ga0207702_10087444 | 3300026078 | Bacteria | 2721 |
| 609 | Ga0207641_10034240 | 3300026088 | Bacteria | 4224 |
| 610 | Ga0207641_10448214 | 3300026088 | Bacteria | 1247 |
| 611 | Ga0207648_10000478 | 3300026089 | Bacteria | 44666 |
| 612 | Ga0207648_10001666 | 3300026089 | Bacteria | 24344 |
| 613 | Ga0207648_10017903 | 3300026089 | Bacteria | 6427 |
| 614 | Ga0207648_10183358 | 3300026089 | Bacteria | 1853 |
| 615 | Ga0207648_10614436 | 3300026089 | Bacteria | 1003 |
| 616 | Ga0207676_10050368 | 3300026095 | Bacteria | 3247 |
| 617 | Ga0207676_10072933 | 3300026095 | Bacteria | 2761 |
| 618 | Ga0207676_10096075 | 3300026095 | Bacteria | 2445 |
| 619 | Ga0207676_10181705 | 3300026095 | Bacteria | 1842 |
| 620 | Ga0207676_10508054 | 3300026095 | Bacteria | 1145 |
| 621 | Ga0207676_10543477 | 3300026095 | Bacteria | 1109 |
| 622 | Ga0207674_10005242 | 3300026116 | Bacteria | 15432 |
| 623 | Ga0207674_10030393 | 3300026116 | Bacteria | 5680 |
| 624 | Ga0207674_10113784 | 3300026116 | Bacteria | 2679 |
| 625 | Ga0207674_10691015 | 3300026116 | Bacteria | 985 |
| 626 | Ga0207675_100000141 | 3300026118 | Bacteria | 61869 |
| 627 | Ga0207675_100006526 | 3300026118 | Bacteria | 11044 |
| 628 | Ga0207675_100042169 | 3300026118 | Bacteria | 4259 |
| 629 | Ga0207675_100066641 | 3300026118 | Bacteria | 3366 |
| 630 | Ga0207675_100481829 | 3300026118 | Bacteria | 1233 |
| 631 | Ga0207675_100562902 | 3300026118 | Bacteria | 1140 |
| 632 | Ga0207675_101550534 | 3300026118 | Bacteria | 683 |
| 633 | Ga0207683_10037284 | 3300026121 | Bacteria | 4233 |
| 634 | Ga0207683_10401139 | 3300026121 | Bacteria | 1262 |
| 635 | Ga0207683_10412199 | 3300026121 | Bacteria | 1244 |
| 636 | Ga0207698_10021580 | 3300026142 | Bacteria | 4458 |
| 637 | Ga0207698_10927402 | 3300026142 | Bacteria | 879 |
| 638 | Ga0207698_11401396 | 3300026142 | Bacteria | 714 |
| 639 | Ga0209983_1044054 | 3300027665 | Bacteria | 969 |
| 640 | Ga0209813_10254780 | 3300027866 | Bacteria | 668 |
| 641 | Ga0207428_10000161 | 3300027907 | Bacteria | 92184 |
| 642 | Ga0207428_10002496 | 3300027907 | Bacteria | 18377 |
| 643 | Ga0207428_10274500 | 3300027907 | Bacteria | 1253 |
| 644 | Ga0268266_10010565 | 3300028379 | Bacteria | 8056 |
| 645 | Ga0268266_10062215 | 3300028379 | Bacteria | 3220 |
| 646 | Ga0268266_10129335 | 3300028379 | Bacteria | 2257 |
| 647 | Ga0268266_10327654 | 3300028379 | Bacteria | 1435 |
| 648 | Ga0268266_10650919 | 3300028379 | Bacteria | 1014 |
| 649 | Ga0268266_12185581 | 3300028379 | Bacteria | 525 |
| 650 | Ga0268265_10000663 | 3300028380 | Bacteria | 34113 |
| 651 | Ga0268265_10036005 | 3300028380 | Bacteria | 3621 |
| 652 | Ga0268265_10084962 | 3300028380 | Bacteria | 2510 |
| 653 | Ga0268265_10376002 | 3300028380 | Bacteria | 1305 |
| 654 | Ga0268265_10426551 | 3300028380 | Bacteria | 1232 |
| 655 | Ga0268264_10002304 | 3300028381 | Bacteria | 16905 |
| 656 | Ga0268264_10068440 | 3300028381 | Bacteria | 3000 |
| 657 | Ga0268264_11332091 | 3300028381 | Bacteria | 728 |
| 658 | Ga0265762_1046575 | 3300030760 | Bacteria | 861 |
| 659 | Ga0265775_109132 | 3300030762 | Bacteria | 611 |
| 660 | Ga0307408_100051677 | 3300031548 | Bacteria | 2961 |
| 661 | Ga0316576_10109211 | 3300031727 | Bacteria | 2073 |
| 662 | Ga0316578_10166595 | 3300031728 | Bacteria | 1328 |
| 663 | Ga0307405_10358657 | 3300031731 | Bacteria | 1127 |
| 664 | Ga0316577_10445168 | 3300031733 | Bacteria | 736 |
| 665 | Ga0307413_10393071 | 3300031824 | Bacteria | 1084 |
| 666 | Ga0307410_10071420 | 3300031852 | Bacteria | 2407 |
| 667 | Ga0307406_10002220 | 3300031901 | Bacteria | 10569 |
| 668 | Ga0307407_10036680 | 3300031903 | Bacteria | 2703 |
| 669 | Ga0307407_11324085 | 3300031903 | Bacteria | 566 |
| 670 | Ga0307412_10019704 | 3300031911 | Bacteria | 4092 |
| 671 | Ga0307412_10162085 | 3300031911 | Bacteria | 1663 |
| 672 | Ga0307409_100062443 | 3300031995 | Bacteria | 2916 |
| 673 | Ga0307416_100010521 | 3300032002 | Bacteria | 6115 |
| 674 | Ga0307416_100536726 | 3300032002 | Bacteria | 1241 |
| 675 | Ga0307414_10161300 | 3300032004 | Bacteria | 1781 |
| 676 | Ga0307411_10017454 | 3300032005 | Bacteria | 4090 |
| 677 | Ga0307415_100039760 | 3300032126 | Bacteria | 3112 |
| 678 | Ga0373930_0057583 | 3300034816 | Bacteria | 861 |
| 679 | Ga0373938_0023785 | 3300034957 | Bacteria | 1262 |
| 680 | Ga0373928_0246325 | 3300035084 | Bacteria | 531 |
| 681 | Ga0373929_0009852 | 3300035085 | Bacteria | 1777 |
| 682 | Ga0373929_0035750 | 3300035085 | Bacteria | 1083 |
| 683 | Ga0373934_0005354 | 3300035086 | Bacteria | 4753 |
| 684 | Ga0373934_0018545 | 3300035086 | Bacteria | 2664 |
| 685 | Ga0373940_0002992 | 3300035088 | Bacteria | 3381 |
| 686 | Ga0373940_0021054 | 3300035088 | Bacteria | 1663 |
| 687 | Ga0373949_0055552 | 3300035090 | Bacteria | 1007 |
| 688 | Ga0373951_0126760 | 3300035091 | Bacteria | 699 |
| 689 | Ga0373932_0115079 | 3300035112 | Bacteria | 891 |
| 690 | Ga0373939_0024150 | 3300035114 | Bacteria | 1691 |
| 691 | Ga0373941_0009680 | 3300035115 | Bacteria | 2433 |
| 692 | Ga0373941_0048891 | 3300035115 | Bacteria | 1337 |
| 693 | Ga0373953_0023333 | 3300035117 | Bacteria | 2341 |
| 694 | Ga0373954_0035006 | 3300035118 | Bacteria | 2328 |
| 695 | Ga0373954_0397563 | 3300035118 | Bacteria | 681 |
| 696 | Ga0373957_0008536 | 3300035120 | Bacteria | 3323 |
| 697 | Ga0373943_0555441 | 3300035170 | Bacteria | 674 |
| 698 | Ga0373946_0104632 | 3300035171 | Bacteria | 1273 |
| 699 | Ga0373955_0021652 | 3300035172 | Bacteria | 3249 |
| 700 | Ga0373942_0072128 | 3300035207 | Bacteria | 1010 |
| 701 | Ga0373942_0171991 | 3300035207 | Bacteria | 706 |
| 702 | Ga0373961_0014911 | 3300035241 | Bacteria | 1980 |
| 703 | Ga0373961_0020712 | 3300035241 | Bacteria | 1742 |
| 704 | Ga0373961_0023035 | 3300035241 | Bacteria | 1672 |
| 705 | Ga0373962_0055517 | 3300035242 | Bacteria | 1151 |
| 706 | Ga0373962_0129334 | 3300035242 | Bacteria | 812 |
| 707 | Ga0373931_0001831 | 3300035691 | Bacteria | 9242 |
| 708 | Ga0373931_0092161 | 3300035691 | Bacteria | 1690 |
| 709 | Ga0373927_0055350 | 3300035695 | Bacteria | 2565 |
| 710 | Ga0373933_0108617 | 3300035724 | Bacteria | 1728 |
| 711 | Ga0373933_0271923 | 3300035724 | Bacteria | 1094 |
| 712 | Ga0373947_0150909 | 3300035725 | Bacteria | 1497 |
| 713 | Ga0373937_0261403 | 3300036401 | Bacteria | 1632 |
| 714 | Ga0373937_0293758 | 3300036401 | Bacteria | 1535 |
| 715 | Ga0373925_0189173 | 3300037068 | Bacteria | 1633 |
| 716 | Ga0395905_0218578 | 3300037471 | Bacteria | 1784 |
| 717 | Ga0395905_0812010 | 3300037471 | Bacteria | 838 |
| 718 | Ga0436364_0530783 | 3300037853 | Bacteria | 632 |
| 719 | Ga0436364_1278837 | 3300037853 | Bacteria | 1463 |
| 720 | Ga0242420_000431 | 3300038996 | Bacteria | 4722 |
| 721 | Ga0242420_002167 | 3300038996 | Bacteria | 2769 |
| 722 | Ga0451837_0841720 | 3300041494 | Bacteria | 1854 |
| 723 | Ga0439437_012012 | 3300042000 | Bacteria | 996 |
| 724 | Ga0439455_0008140 | 3300042012 | Bacteria | 2241 |
| 725 | Ga0439455_0156884 | 3300042012 | Bacteria | 649 |
| 726 | Ga0450910_052467 | 3300042147 | Bacteria | 676 |
| 727 | Ga0439435_0014123 | 3300042436 | Bacteria | 1968 |
| 728 | Ga0439464_0024646 | 3300042439 | Bacteria | 1664 |
| 729 | Ga0439464_0124002 | 3300042439 | Bacteria | 797 |
| 730 | Ga0451577_0423678 | 3300042876 | Bacteria | 1209 |
| 731 | Ga0451577_0536882 | 3300042876 | Bacteria | 1062 |
| 732 | Ga0451577_0680249 | 3300042876 | Bacteria | 933 |
| 733 | Ga0453683_0029383 | 3300044673 | Bacteria | 3475 |
| 734 | Ga0453683_0355886 | 3300044673 | Bacteria | 941 |
| 735 | Ga0466966_0029559 | 3300044684 | Bacteria | 3564 |
| 736 | Ga0466966_0776308 | 3300044684 | Bacteria | 578 |
| 737 | Ga0466963_0360437 | 3300044694 | Unclassified | 1024 |
| 738 | Ga0466959_0214317 | 3300045049 | Bacteria | 1337 |
| 739 | Ga0451576_0170815 | 3300045051 | Bacteria | 2269 |
| 740 | Ga0451576_0184905 | 3300045051 | Bacteria | 2176 |
| 741 | Ga0451576_0189609 | 3300045051 | Bacteria | 2147 |
| 742 | Ga0451576_0202524 | 3300045051 | Bacteria | 2073 |
| 743 | Ga0451576_0388994 | 3300045051 | Bacteria | 1462 |
| 744 | Ga0451576_0460866 | 3300045051 | Bacteria | 1335 |
| 745 | Ga0451576_2040148 | 3300045051 | Bacteria | 590 |
| 746 | Ga0466958_0105273 | 3300045836 | Bacteria | 1758 |
| 747 | Ga0466967_0007283 | 3300045976 | Bacteria | 7964 |
| 748 | Ga0495629_0130700 | 3300046459 | Bacteria | 1749 |
| 749 | Ga0495629_0260972 | 3300046459 | Bacteria | 1191 |
| 750 | Ga0495580_0001855 | 3300046472 | Bacteria | 18582 |
| 751 | Ga0495580_0011369 | 3300046472 | Bacteria | 6888 |
| 752 | Ga0495580_0123404 | 3300046472 | Bacteria | 1798 |
| 753 | Ga0495582_0265669 | 3300046473 | Bacteria | 984 |
| 754 | Ga0495594_0023223 | 3300046499 | Bacteria | 3322 |
| 755 | Ga0495628_0050873 | 3300046516 | Bacteria | 3277 |
| 756 | Ga0495663_0053817 | 3300046525 | Bacteria | 1252 |
| 757 | Ga0495642_0165177 | 3300046528 | Bacteria | 961 |
| 758 | Ga0495652_0277204 | 3300046529 | Bacteria | 1229 |
| 759 | Ga0495665_0162088 | 3300046531 | Bacteria | 1165 |
| 760 | Ga0495665_0453408 | 3300046531 | Bacteria | 648 |
| 761 | Ga0495586_0013411 | 3300046535 | Bacteria | 4346 |
| 762 | Ga0495586_0157726 | 3300046535 | Bacteria | 1279 |
| 763 | Ga0495609_0280561 | 3300046538 | Bacteria | 681 |
| 764 | Ga0495621_0008177 | 3300046539 | Bacteria | 3126 |
| 765 | Ga0495621_0008551 | 3300046539 | Bacteria | 3075 |
| 766 | Ga0495621_0092616 | 3300046539 | Bacteria | 1141 |
| 767 | Ga0495621_0204949 | 3300046539 | Bacteria | 794 |
| 768 | Ga0495645_0000710 | 3300046543 | Bacteria | 22853 |
| 769 | Ga0495667_0056115 | 3300046559 | Bacteria | 2590 |
| 770 | Ga0495667_0122252 | 3300046559 | Bacteria | 1681 |
| 771 | Ga0495625_0000547 | 3300046660 | Bacteria | 55124 |
| 772 | Ga0495659_0028743 | 3300046664 | Bacteria | 1925 |
| 773 | Ga0495659_0056166 | 3300046664 | Bacteria | 1444 |
| 774 | Ga0495588_0008624 | 3300046674 | Bacteria | 4684 |
| 775 | Ga0495623_0006725 | 3300046679 | Bacteria | 7483 |
| 776 | Ga0495647_0104313 | 3300046681 | Bacteria | 1177 |
| 777 | Ga0495647_0157165 | 3300046681 | Bacteria | 978 |
| 778 | Ga0495658_0033080 | 3300046683 | Bacteria | 2829 |
| 779 | Ga0495658_0100149 | 3300046683 | Bacteria | 1729 |
| 780 | Ga0495658_0126225 | 3300046683 | Bacteria | 1553 |
| 781 | Ga0495658_0127865 | 3300046683 | Bacteria | 1544 |
| 782 | Ga0495669_0010491 | 3300046684 | Bacteria | 3917 |
| 783 | Ga0495670_0344805 | 3300046691 | Bacteria | 801 |
| 784 | Ga0495649_0024081 | 3300046694 | Bacteria | 3398 |
| 785 | Ga0495649_0070501 | 3300046694 | Unclassified | 1874 |
| 786 | Ga0495636_0019947 | 3300047318 | Bacteria | 2698 |
| 787 | Ga0495636_0157113 | 3300047318 | Bacteria | 1023 |
| 788 | Ga0495636_0343549 | 3300047318 | Bacteria | 704 |
| 789 | Ga0495674_0392667 | 3300047319 | Bacteria | 1121 |
| 790 | Ga0495672_0076098 | 3300047320 | Bacteria | 1886 |
| 791 | Ga0495676_0395344 | 3300047321 | Bacteria | 918 |
| 792 | Ga0495675_0005338 | 3300047444 | Bacteria | 7830 |
| 793 | Ga0495677_0073081 | 3300047445 | Bacteria | 1279 |
| 794 | Ga0495684_0206457 | 3300047471 | Bacteria | 1446 |
| 795 | Ga0495686_0112987 | 3300047472 | Bacteria | 1627 |
| 796 | Ga0495602_0504306 | 3300048088 | Bacteria | 845 |
| 797 | Ga0496100_0186544 | 3300048903 | Bacteria | 1503 |
| 798 | Ga0496102_0851790 | 3300048905 | Bacteria | 834 |
| 799 | Ga0496104_0000969 | 3300048907 | Bacteria | 24651 |
| 800 | Ga0496106_0003284 | 3300048909 | Bacteria | 12081 |
| 801 | Ga0496106_0493575 | 3300048909 | Bacteria | 984 |
| 802 | Ga0496108_0257660 | 3300048911 | Bacteria | 1518 |
| 803 | Ga0496108_0386664 | 3300048911 | Bacteria | 1222 |
| 804 | Ga0496109_0164921 | 3300048912 | Bacteria | 2077 |
| 805 | Ga0496109_0678429 | 3300048912 | Bacteria | 968 |
| 806 | Ga0496112_0285768 | 3300048915 | Bacteria | 1596 |
| 807 | Ga0501031_0091725 | 3300049568 | Bacteria | 1982 |
| 808 | Ga0501031_0308398 | 3300049568 | Bacteria | 1025 |
| 809 | Ga0501032_0005818 | 3300049569 | Bacteria | 9121 |
| 810 | Ga0501032_0008491 | 3300049569 | Bacteria | 7489 |
| 811 | Ga0501033_0033973 | 3300049570 | Bacteria | 3827 |
| 812 | Ga0501033_0198030 | 3300049570 | Bacteria | 1436 |
| 813 | Ga0501033_0918010 | 3300049570 | Bacteria | 588 |
| 814 | Ga0501034_0001243 | 3300049571 | Bacteria | 34628 |
| 815 | Ga0501034_0026502 | 3300049571 | Bacteria | 5903 |
| 816 | Ga0501034_0183834 | 3300049571 | Bacteria | 2054 |
| 817 | Ga0501034_0442924 | 3300049571 | Bacteria | 1217 |
| 818 | Ga0501036_0005033 | 3300049572 | Bacteria | 10695 |
| 819 | Ga0501036_0105328 | 3300049572 | Bacteria | 2385 |
| 820 | Ga0501036_0259153 | 3300049572 | Bacteria | 1457 |
| 821 | Ga0501037_0040085 | 3300049573 | Bacteria | 3447 |
| 822 | Ga0501038_0013231 | 3300049574 | Bacteria | 7526 |
| 823 | Ga0501038_0057399 | 3300049574 | Bacteria | 3342 |
| 824 | Ga0501038_0193655 | 3300049574 | Bacteria | 1635 |
| 825 | Ga0501039_0012793 | 3300049575 | Bacteria | 6414 |
| 826 | Ga0501039_0016198 | 3300049575 | Bacteria | 5711 |
| 827 | Ga0501042_0457112 | 3300049578 | Bacteria | 926 |
| 828 | Ga0501042_0625308 | 3300049578 | Bacteria | 783 |
| 829 | Ga0501043_0187706 | 3300049579 | Bacteria | 1608 |
| 830 | Ga0501043_0485531 | 3300049579 | Bacteria | 924 |
| 831 | Ga0501046_0001245 | 3300049580 | Bacteria | 24637 |
| 832 | Ga0501046_0028017 | 3300049580 | Bacteria | 4591 |
| 833 | Ga0501046_0062230 | 3300049580 | Bacteria | 2917 |
| 834 | Ga0501047_0018586 | 3300049581 | Bacteria | 6662 |
| 835 | Ga0501047_0065211 | 3300049581 | Bacteria | 3510 |
| 836 | Ga0501047_0239918 | 3300049581 | Bacteria | 1664 |
| 837 | Ga0501048_0089418 | 3300049582 | Bacteria | 2172 |
| 838 | Ga0501067_0046467 | 3300049583 | Bacteria | 2410 |
| 839 | Ga0501067_0081628 | 3300049583 | Bacteria | 1792 |
| 840 | Ga0501067_0201164 | 3300049583 | Bacteria | 1109 |
| 841 | Ga0501068_0109988 | 3300049584 | Bacteria | 1713 |
| 842 | Ga0501068_0149271 | 3300049584 | Bacteria | 1468 |
| 843 | Ga0501069_0029834 | 3300049585 | Bacteria | 2993 |
| 844 | Ga0501071_0773627 | 3300049587 | Bacteria | 740 |
| 845 | Ga0501073_0002552 | 3300049589 | Bacteria | 13613 |
| 846 | Ga0501073_0040918 | 3300049589 | Bacteria | 3276 |
| 847 | Ga0501073_0176897 | 3300049589 | Bacteria | 1477 |
| 848 | Ga0501077_0251029 | 3300049593 | Bacteria | 1125 |
| 849 | Ga0501229_032467 | 3300049706 | Bacteria | 721 |
| 850 | Ga0501080_0002574 | 3300049742 | Bacteria | 15883 |
| 851 | Ga0501080_0057869 | 3300049742 | Bacteria | 3608 |
| 852 | Ga0501080_0862968 | 3300049742 | Bacteria | 791 |
| 853 | Ga0501081_0755190 | 3300049743 | Bacteria | 731 |
| 854 | Ga0501283_058035 | 3300049779 | Bacteria | 695 |
| 855 | Ga0501035_0096190 | 3300049822 | Bacteria | 2602 |
| 856 | Ga0501044_0037786 | 3300049823 | Bacteria | 5045 |
| 857 | Ga0501044_1327420 | 3300049823 | Bacteria | 585 |
| 858 | nmdc:mga03683_16448_c1 | 3300050489 | Bacteria | 2779 |
| 859 | nmdc:mga03n38_131196_c1 | 3300050490 | Bacteria | 1242 |
| 860 | nmdc:mga00v17_48917_c1 | 3300050491 | Bacteria | 2563 |
| 861 | nmdc:mga00v17_6590_c1 | 3300050491 | Bacteria | 6165 |
| 862 | nmdc:mga0yw44_1187327_c1 | 3300050492 | Bacteria | 515 |
| 863 | nmdc:mga0yw44_53351_c1 | 3300050492 | Bacteria | 2455 |
| 864 | nmdc:mga0k408_120337_c1 | 3300050493 | Bacteria | 1554 |
| 865 | nmdc:mga0k408_316656_c1 | 3300050493 | Bacteria | 931 |
| 866 | nmdc:mga0k408_562_c1 | 3300050493 | Bacteria | 20449 |
| 867 | nmdc:mga0k408_79000_c1 | 3300050493 | Bacteria | 1925 |
| 868 | nmdc:mga06z11_21556_c1 | 3300050494 | Bacteria | 2996 |
| 869 | nmdc:mga06z11_322010_c1 | 3300050494 | Bacteria | 922 |
| 870 | nmdc:mga06z11_42985_c1 | 3300050494 | Bacteria | 2270 |
| 871 | nmdc:mga04h51_276360_c1 | 3300050495 | Bacteria | 679 |
| 872 | nmdc:mga07m45_91381_c1 | 3300050496 | Bacteria | 1744 |
| 873 | nmdc:mga05p37_100453_c1 | 3300050507 | Bacteria | 3563 |
| 874 | nmdc:mga05p37_14640_c1 | 3300050507 | Bacteria | 9423 |
| 875 | nmdc:mga05p37_228848_c1 | 3300050507 | Bacteria | 2241 |
| 876 | nmdc:mga05p37_89722_c1 | 3300050507 | Bacteria | 3788 |
| 877 | nmdc:mga09592_175559_c1 | 3300050508 | Bacteria | 1853 |
| 878 | nmdc:mga09592_239135_c1 | 3300050508 | Bacteria | 1573 |
| 879 | nmdc:mga09592_881781_c1 | 3300050508 | Bacteria | 753 |
| 880 | nmdc:mga06r32_160294_c1 | 3300050510 | Bacteria | 2232 |
| 881 | nmdc:mga06r32_26610_c1 | 3300050510 | Bacteria | 5396 |
| 882 | nmdc:mga06r32_707144_c1 | 3300050510 | Bacteria | 973 |
| 883 | nmdc:mga06r32_756692_c1 | 3300050510 | Bacteria | 934 |
| 884 | nmdc:mga08y16_1625_c1 | 3300050511 | Bacteria | 22760 |
| 885 | nmdc:mga08y16_232565_c1 | 3300050511 | Bacteria | 1906 |
| 886 | nmdc:mga08y16_265700_c1 | 3300050511 | Bacteria | 1771 |
| 887 | nmdc:mga08y16_273209_c1 | 3300050511 | Bacteria | 1744 |
| 888 | nmdc:mga08y16_34591_c1 | 3300050511 | Bacteria | 5308 |
| 889 | nmdc:mga08y16_350641_c1 | 3300050511 | Bacteria | 1516 |
| 890 | nmdc:mga08y16_508_c1 | 3300050511 | Bacteria | 35851 |
| 891 | nmdc:mga08y16_95576_c1 | 3300050511 | Bacteria | 3095 |
| 892 | nmdc:mga0n895_1016429_c1 | 3300050512 | Bacteria | 810 |
| 893 | nmdc:mga0n895_17167_c1 | 3300050512 | Bacteria | 6668 |
| 894 | nmdc:mga0n895_179851_c1 | 3300050512 | Bacteria | 2146 |
| 895 | nmdc:mga0n895_226659_c1 | 3300050512 | Bacteria | 1897 |
| 896 | nmdc:mga0n895_401194_c1 | 3300050512 | Bacteria | 1387 |
| 897 | nmdc:mga0n895_54242_c1 | 3300050512 | Bacteria | 3942 |
| 898 | nmdc:mga0n895_5969_c1 | 3300050512 | Bacteria | 10253 |
| 899 | nmdc:mga0rr50_238511_c1 | 3300050513 | Bacteria | 1507 |
| 900 | nmdc:mga0rr50_444054_c1 | 3300050513 | Bacteria | 1099 |
| 901 | nmdc:mga0a205_115024_c1 | 3300050515 | Bacteria | 2589 |
| 902 | nmdc:mga0a205_11699_c1 | 3300050515 | Bacteria | 8092 |
| 903 | nmdc:mga0a205_161993_c1 | 3300050515 | Bacteria | 2133 |
| 904 | nmdc:mga0a205_192722_c1 | 3300050515 | Bacteria | 1930 |
| 905 | nmdc:mga0a205_226729_c1 | 3300050515 | Bacteria | 1753 |
| 906 | nmdc:mga0a205_283278_c1 | 3300050515 | Bacteria | 1533 |
| 907 | nmdc:mga0a205_38247_c1 | 3300050515 | Bacteria | 4615 |
| 908 | nmdc:mga0a205_709217_c1 | 3300050515 | Bacteria | 856 |
| 909 | nmdc:mga0sz30_165393_c1 | 3300050516 | Bacteria | 980 |
| 910 | nmdc:mga0sz30_386683_c1 | 3300050516 | Bacteria | 626 |
| 911 | Ga0495619_0193312 | 3300053085 | Bacteria | 1408 |
| 912 | Ga0500651_0380457 | 3300053093 | Bacteria | 796 |
| 913 | Ga0500555_000149 | 3300053103 | Bacteria | 33331 |
| 914 | Ga0500616_0000926 | 3300053153 | Bacteria | 32073 |
| 915 | Ga0500645_000610 | 3300053730 | Bacteria | 22872 |
| 916 | Ga0500599_009884 | 3300053736 | Bacteria | 1255 |
| 917 | Ga0501084_0143910 | 3300054114 | Bacteria | 2008 |
| 918 | Ga0501084_0209291 | 3300054114 | Bacteria | 1646 |
| 919 | Ga0590075_055424 | 3300059424 | Bacteria | 1019 |
| 920 | Ga0590077_016929 | 3300059426 | Bacteria | 1531 |
| 921 | Ga0590077_060551 | 3300059426 | Bacteria | 858 |
| 922 | Ga0501082_0018151 | 3300060353 | Bacteria | 6057 |
| 923 | Ga0501082_0044691 | 3300060353 | Bacteria | 3820 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006048 | Ga0075363_100080712 | Ga0075363_1000807123 | 147 |
| 2 | 3300009094 | Ga0111539_10214093 | Ga0111539_102140933 | 147 |
| 3 | 3300050511 | nmdc:mga08y16_232565_c1 | nmdc:mga08y16_232565_c1_1392_1844 | 147 |
| 4 | 3300005441 | Ga0070700_100567286 | Ga0070700_1005672861 | 148 |
| 5 | 3300006177 | Ga0075362_10629209 | Ga0075362_106292091 | 148 |
| 6 | 3300009093 | Ga0105240_10069451 | Ga0105240_100694512 | 148 |
| 7 | 3300009545 | Ga0105237_10443189 | Ga0105237_104431892 | 148 |
| 8 | 3300014325 | Ga0163163_10935413 | Ga0163163_109354132 | 148 |
| 9 | 3300025913 | Ga0207695_10068761 | Ga0207695_100687612 | 148 |
| 10 | 3300025914 | Ga0207671_10301280 | Ga0207671_103012802 | 148 |
| 11 | 3300042000 | Ga0439437_012012 | Ga0439437_012012_324_776 | 148 |
| 12 | 3300005548 | Ga0070665_102073083 | Ga0070665_1020730831 | 149 |
| 13 | 3300026116 | Ga0207674_10113784 | Ga0207674_101137842 | 149 |
| 14 | 3300028379 | Ga0268266_10010565 | Ga0268266_100105656 | 149 |
| 15 | 3300028379 | Ga0268266_10062215 | Ga0268266_100622152 | 149 |
| 16 | 3300031903 | Ga0307407_11324085 | Ga0307407_113240851 | 149 |
| 17 | 3300044673 | Ga0453683_0029383 | Ga0453683_0029383_720_1175 | 149 |
| 18 | 3300046459 | Ga0495629_0130700 | Ga0495629_0130700_1021_1497 | 149 |
| 19 | 3300046531 | Ga0495665_0162088 | Ga0495665_0162088_327_803 | 149 |
| 20 | 3300046660 | Ga0495625_0000547 | Ga0495625_0000547_43045_43503 | 149 |
| 21 | 3300046681 | Ga0495647_0157165 | Ga0495647_0157165_53_532 | 149 |
| 22 | 3300046683 | Ga0495658_0126225 | Ga0495658_0126225_996_1472 | 149 |
| 23 | 3300046694 | Ga0495649_0024081 | Ga0495649_0024081_791_1249 | 149 |
| 24 | 3300046694 | Ga0495649_0070501 | Ga0495649_0070501_1139_1597 | 149 |
| 25 | 3300047472 | Ga0495686_0112987 | Ga0495686_0112987_258_716 | 149 |
| 26 | 3300048907 | Ga0496104_0000969 | Ga0496104_0000969_22797_23255 | 149 |
| 27 | 3300048911 | Ga0496108_0386664 | Ga0496108_0386664_639_1091 | 149 |
| 28 | 3300048912 | Ga0496109_0678429 | Ga0496109_0678429_230_682 | 149 |
| 29 | 3300050490 | nmdc:mga03n38_131196_c1 | nmdc:mga03n38_131196_c1_545_1024 | 149 |
| 30 | 3300005334 | Ga0068869_100223111 | Ga0068869_1002231112 | 150 |
| 31 | 3300005340 | Ga0070689_100012437 | Ga0070689_1000124372 | 150 |
| 32 | 3300005340 | Ga0070689_100408684 | Ga0070689_1004086842 | 150 |
| 33 | 3300005343 | Ga0070687_100028627 | Ga0070687_1000286271 | 150 |
| 34 | 3300005345 | Ga0070692_10609117 | Ga0070692_106091172 | 150 |
| 35 | 3300005347 | Ga0070668_100394977 | Ga0070668_1003949772 | 150 |
| 36 | 3300005353 | Ga0070669_101597382 | Ga0070669_1015973821 | 150 |
| 37 | 3300005354 | Ga0070675_100016669 | Ga0070675_1000166692 | 150 |
| 38 | 3300005356 | Ga0070674_100010963 | Ga0070674_1000109632 | 150 |
| 39 | 3300005365 | Ga0070688_100070024 | Ga0070688_1000700242 | 150 |
| 40 | 3300005367 | Ga0070667_100631916 | Ga0070667_1006319162 | 150 |
| 41 | 3300005441 | Ga0070700_100111617 | Ga0070700_1001116172 | 150 |
| 42 | 3300005445 | Ga0070708_100004776 | Ga0070708_1000047766 | 150 |
| 43 | 3300005455 | Ga0070663_100065241 | Ga0070663_1000652412 | 150 |
| 44 | 3300005456 | Ga0070678_100008110 | Ga0070678_1000081103 | 150 |
| 45 | 3300005457 | Ga0070662_100462316 | Ga0070662_1004623162 | 150 |
| 46 | 3300005459 | Ga0068867_100274630 | Ga0068867_1002746302 | 150 |
| 47 | 3300005466 | Ga0070685_10011040 | Ga0070685_100110405 | 150 |
| 48 | 3300005467 | Ga0070706_100091319 | Ga0070706_1000913191 | 150 |
| 49 | 3300005518 | Ga0070699_100395356 | Ga0070699_1003953562 | 150 |
| 50 | 3300005543 | Ga0070672_100014726 | Ga0070672_1000147263 | 150 |
| 51 | 3300005546 | Ga0070696_100035084 | Ga0070696_1000350843 | 150 |
| 52 | 3300005547 | Ga0070693_101404422 | Ga0070693_1014044221 | 150 |
| 53 | 3300005548 | Ga0070665_102122933 | Ga0070665_1021229331 | 150 |
| 54 | 3300005577 | Ga0068857_101863108 | Ga0068857_1018631081 | 150 |
| 55 | 3300005615 | Ga0070702_100065204 | Ga0070702_1000652042 | 150 |
| 56 | 3300005616 | Ga0068852_100663846 | Ga0068852_1006638461 | 150 |
| 57 | 3300005617 | Ga0068859_101237010 | Ga0068859_1012370102 | 150 |
| 58 | 3300005719 | Ga0068861_100007890 | Ga0068861_1000078902 | 150 |
| 59 | 3300005840 | Ga0068870_10022791 | Ga0068870_100227912 | 150 |
| 60 | 3300005841 | Ga0068863_100038626 | Ga0068863_1000386262 | 150 |
| 61 | 3300005842 | Ga0068858_100008252 | Ga0068858_1000082522 | 150 |
| 62 | 3300005843 | Ga0068860_100006938 | Ga0068860_1000069385 | 150 |
| 63 | 3300005844 | Ga0068862_100007216 | Ga0068862_1000072167 | 150 |
| 64 | 3300006038 | Ga0075365_10008317 | Ga0075365_100083172 | 150 |
| 65 | 3300006038 | Ga0075365_10226393 | Ga0075365_102263932 | 150 |
| 66 | 3300006051 | Ga0075364_10164752 | Ga0075364_101647522 | 150 |
| 67 | 3300006177 | Ga0075362_10038042 | Ga0075362_100380422 | 150 |
| 68 | 3300006177 | Ga0075362_10068299 | Ga0075362_100682992 | 150 |
| 69 | 3300006178 | Ga0075367_10021436 | Ga0075367_100214362 | 150 |
| 70 | 3300006186 | Ga0075369_10346076 | Ga0075369_103460761 | 150 |
| 71 | 3300006195 | Ga0075366_10000128 | Ga0075366_1000012819 | 150 |
| 72 | 3300006353 | Ga0075370_10096103 | Ga0075370_100961032 | 150 |
| 73 | 3300006844 | Ga0075428_100354165 | Ga0075428_1003541652 | 150 |
| 74 | 3300006847 | Ga0075431_100009878 | Ga0075431_1000098785 | 150 |
| 75 | 3300006847 | Ga0075431_100600220 | Ga0075431_1006002202 | 150 |
| 76 | 3300006852 | Ga0075433_10487469 | Ga0075433_104874692 | 150 |
| 77 | 3300006871 | Ga0075434_100481010 | Ga0075434_1004810102 | 150 |
| 78 | 3300006880 | Ga0075429_100499549 | Ga0075429_1004995492 | 150 |
| 79 | 3300006881 | Ga0068865_100018249 | Ga0068865_1000182495 | 150 |
| 80 | 3300006931 | Ga0097620_101236971 | Ga0097620_1012369712 | 150 |
| 81 | 3300007076 | Ga0075435_100008302 | Ga0075435_1000083025 | 150 |
| 82 | 3300009094 | Ga0111539_10000305 | Ga0111539_100003052 | 150 |
| 83 | 3300009098 | Ga0105245_10232054 | Ga0105245_102320542 | 150 |
| 84 | 3300009147 | Ga0114129_10136702 | Ga0114129_101367023 | 150 |
| 85 | 3300009147 | Ga0114129_11554625 | Ga0114129_115546252 | 150 |
| 86 | 3300009148 | Ga0105243_10107591 | Ga0105243_101075912 | 150 |
| 87 | 3300009176 | Ga0105242_10446394 | Ga0105242_104463942 | 150 |
| 88 | 3300009176 | Ga0105242_10518490 | Ga0105242_105184901 | 150 |
| 89 | 3300009176 | Ga0105242_11566740 | Ga0105242_115667401 | 150 |
| 90 | 3300009177 | Ga0105248_10008266 | Ga0105248_100082662 | 150 |
| 91 | 3300009553 | Ga0105249_10243759 | Ga0105249_102437592 | 150 |
| 92 | 3300013308 | Ga0157375_10009133 | Ga0157375_100091334 | 150 |
| 93 | 3300014326 | Ga0157380_10006107 | Ga0157380_100061077 | 150 |
| 94 | 3300014745 | Ga0157377_10028243 | Ga0157377_100282433 | 150 |
| 95 | 3300014968 | Ga0157379_10511353 | Ga0157379_105113532 | 150 |
| 96 | 3300025893 | Ga0207682_10095712 | Ga0207682_100957122 | 150 |
| 97 | 3300025901 | Ga0207688_10981361 | Ga0207688_109813611 | 150 |
| 98 | 3300025908 | Ga0207643_10015211 | Ga0207643_100152115 | 150 |
| 99 | 3300025918 | Ga0207662_10002499 | Ga0207662_100024997 | 150 |
| 100 | 3300025923 | Ga0207681_10386957 | Ga0207681_103869572 | 150 |
| 101 | 3300025926 | Ga0207659_10867036 | Ga0207659_108670362 | 150 |
| 102 | 3300025927 | Ga0207687_10334648 | Ga0207687_103346481 | 150 |
| 103 | 3300025933 | Ga0207706_10043260 | Ga0207706_100432605 | 150 |
| 104 | 3300025933 | Ga0207706_10536726 | Ga0207706_105367262 | 150 |
| 105 | 3300025934 | Ga0207686_10058992 | Ga0207686_100589922 | 150 |
| 106 | 3300025934 | Ga0207686_10125458 | Ga0207686_101254582 | 150 |
| 107 | 3300025935 | Ga0207709_10098536 | Ga0207709_100985362 | 150 |
| 108 | 3300025936 | Ga0207670_10193190 | Ga0207670_101931902 | 150 |
| 109 | 3300025937 | Ga0207669_10012338 | Ga0207669_100123382 | 150 |
| 110 | 3300025938 | Ga0207704_10075915 | Ga0207704_100759152 | 150 |
| 111 | 3300025940 | Ga0207691_10008916 | Ga0207691_100089161 | 150 |
| 112 | 3300025942 | Ga0207689_10116195 | Ga0207689_101161952 | 150 |
| 113 | 3300025960 | Ga0207651_10964533 | Ga0207651_109645331 | 150 |
| 114 | 3300025961 | Ga0207712_10220360 | Ga0207712_102203602 | 150 |
| 115 | 3300025981 | Ga0207640_10571352 | Ga0207640_105713522 | 150 |
| 116 | 3300025986 | Ga0207658_10342942 | Ga0207658_103429422 | 150 |
| 117 | 3300026023 | Ga0207677_10260150 | Ga0207677_102601502 | 150 |
| 118 | 3300026023 | Ga0207677_10773124 | Ga0207677_107731241 | 150 |
| 119 | 3300026067 | Ga0207678_10136040 | Ga0207678_101360402 | 150 |
| 120 | 3300026075 | Ga0207708_10009542 | Ga0207708_100095426 | 150 |
| 121 | 3300026089 | Ga0207648_10001666 | Ga0207648_1000166610 | 150 |
| 122 | 3300026095 | Ga0207676_10050368 | Ga0207676_100503683 | 150 |
| 123 | 3300026095 | Ga0207676_10508054 | Ga0207676_105080542 | 150 |
| 124 | 3300026118 | Ga0207675_100006526 | Ga0207675_1000065262 | 150 |
| 125 | 3300026118 | Ga0207675_100066641 | Ga0207675_1000666412 | 150 |
| 126 | 3300026118 | Ga0207675_100562902 | Ga0207675_1005629022 | 150 |
| 127 | 3300026121 | Ga0207683_10037284 | Ga0207683_100372841 | 150 |
| 128 | 3300027907 | Ga0207428_10000161 | Ga0207428_1000016160 | 150 |
| 129 | 3300028379 | Ga0268266_12185581 | Ga0268266_121855811 | 150 |
| 130 | 3300028380 | Ga0268265_10084962 | Ga0268265_100849622 | 150 |
| 131 | 3300028380 | Ga0268265_10426551 | Ga0268265_104265512 | 150 |
| 132 | 3300028381 | Ga0268264_10068440 | Ga0268264_100684402 | 150 |
| 133 | 3300031727 | Ga0316576_10109211 | Ga0316576_101092113 | 150 |
| 134 | 3300031728 | Ga0316578_10166595 | Ga0316578_101665952 | 150 |
| 135 | 3300031733 | Ga0316577_10445168 | Ga0316577_104451681 | 150 |
| 136 | 3300034816 | Ga0373930_0057583 | Ga0373930_0057583_297_755 | 150 |
| 137 | 3300034957 | Ga0373938_0023785 | Ga0373938_0023785_503_961 | 150 |
| 138 | 3300035084 | Ga0373928_0246325 | Ga0373928_0246325_39_497 | 150 |
| 139 | 3300035085 | Ga0373929_0035750 | Ga0373929_0035750_201_659 | 150 |
| 140 | 3300035091 | Ga0373951_0126760 | Ga0373951_0126760_10_468 | 150 |
| 141 | 3300035112 | Ga0373932_0115079 | Ga0373932_0115079_392_850 | 150 |
| 142 | 3300035207 | Ga0373942_0171991 | Ga0373942_0171991_185_643 | 150 |
| 143 | 3300035241 | Ga0373961_0014911 | Ga0373961_0014911_1462_1920 | 150 |
| 144 | 3300038996 | Ga0242420_000431 | Ga0242420_000431_1057_1515 | 150 |
| 145 | 3300042012 | Ga0439455_0156884 | Ga0439455_0156884_185_637 | 150 |
| 146 | 3300042876 | Ga0451577_0680249 | Ga0451577_0680249_152_610 | 150 |
| 147 | 3300046684 | Ga0495669_0010491 | Ga0495669_0010491_1472_1933 | 150 |
| 148 | 3300047318 | Ga0495636_0019947 | Ga0495636_0019947_2208_2663 | 150 |
| 149 | 3300049583 | Ga0501067_0046467 | Ga0501067_0046467_1618_2076 | 150 |
| 150 | 3300050489 | nmdc:mga03683_16448_c1 | nmdc:mga03683_16448_c1_1401_1862 | 150 |
| 151 | 3300050491 | nmdc:mga00v17_6590_c1 | nmdc:mga00v17_6590_c1_5462_5923 | 150 |
| 152 | 3300050492 | nmdc:mga0yw44_1187327_c1 | nmdc:mga0yw44_1187327_c1_22_483 | 150 |
| 153 | 3300050492 | nmdc:mga0yw44_53351_c1 | nmdc:mga0yw44_53351_c1_1008_1469 | 150 |
| 154 | 3300050493 | nmdc:mga0k408_562_c1 | nmdc:mga0k408_562_c1_2059_2520 | 150 |
| 155 | 3300050494 | nmdc:mga06z11_42985_c1 | nmdc:mga06z11_42985_c1_713_1174 | 150 |
| 156 | 3300050496 | nmdc:mga07m45_91381_c1 | nmdc:mga07m45_91381_c1_698_1159 | 150 |
| 157 | 3300050507 | nmdc:mga05p37_89722_c1 | nmdc:mga05p37_89722_c1_2308_2769 | 150 |
| 158 | 3300050508 | nmdc:mga09592_239135_c1 | nmdc:mga09592_239135_c1_736_1197 | 150 |
| 159 | 3300050510 | nmdc:mga06r32_26610_c1 | nmdc:mga06r32_26610_c1_2321_2782 | 150 |
| 160 | 3300050511 | nmdc:mga08y16_1625_c1 | nmdc:mga08y16_1625_c1_17828_18289 | 150 |
| 161 | 3300050512 | nmdc:mga0n895_54242_c1 | nmdc:mga0n895_54242_c1_902_1363 | 150 |
| 162 | 3300050515 | nmdc:mga0a205_192722_c1 | nmdc:mga0a205_192722_c1_549_1007 | 150 |
| 163 | 3300050515 | nmdc:mga0a205_709217_c1 | nmdc:mga0a205_709217_c1_358_816 | 150 |
| 164 | 3300050516 | nmdc:mga0sz30_386683_c1 | nmdc:mga0sz30_386683_c1_31_492 | 150 |
| 165 | 3300005336 | Ga0070680_100111613 | Ga0070680_1001116132 | 151 |
| 166 | 3300005353 | Ga0070669_100876929 | Ga0070669_1008769292 | 151 |
| 167 | 3300005354 | Ga0070675_100613815 | Ga0070675_1006138152 | 151 |
| 168 | 3300005455 | Ga0070663_101592817 | Ga0070663_1015928171 | 151 |
| 169 | 3300005456 | Ga0070678_100570285 | Ga0070678_1005702851 | 151 |
| 170 | 3300005458 | Ga0070681_10043237 | Ga0070681_100432373 | 151 |
| 171 | 3300005458 | Ga0070681_10606477 | Ga0070681_106064772 | 151 |
| 172 | 3300005471 | Ga0070698_100262333 | Ga0070698_1002623332 | 151 |
| 173 | 3300005530 | Ga0070679_100053079 | Ga0070679_1000530793 | 151 |
| 174 | 3300005543 | Ga0070672_101162140 | Ga0070672_1011621402 | 151 |
| 175 | 3300005544 | Ga0070686_100115510 | Ga0070686_1001155102 | 151 |
| 176 | 3300005547 | Ga0070693_101475564 | Ga0070693_1014755641 | 151 |
| 177 | 3300005616 | Ga0068852_100958469 | Ga0068852_1009584692 | 151 |
| 178 | 3300005617 | Ga0068859_100776857 | Ga0068859_1007768572 | 151 |
| 179 | 3300005618 | Ga0068864_101185630 | Ga0068864_1011856302 | 151 |
| 180 | 3300005719 | Ga0068861_101530840 | Ga0068861_1015308402 | 151 |
| 181 | 3300005844 | Ga0068862_100813993 | Ga0068862_1008139931 | 151 |
| 182 | 3300006846 | Ga0075430_100882018 | Ga0075430_1008820181 | 151 |
| 183 | 3300006881 | Ga0068865_100728584 | Ga0068865_1007285842 | 151 |
| 184 | 3300006931 | Ga0097620_100776833 | Ga0097620_1007768332 | 151 |
| 185 | 3300009174 | Ga0105241_10131094 | Ga0105241_101310942 | 151 |
| 186 | 3300009176 | Ga0105242_10091885 | Ga0105242_100918852 | 151 |
| 187 | 3300009176 | Ga0105242_10963427 | Ga0105242_109634272 | 151 |
| 188 | 3300009177 | Ga0105248_10427070 | Ga0105248_104270702 | 151 |
| 189 | 3300009177 | Ga0105248_11041428 | Ga0105248_110414281 | 151 |
| 190 | 3300009551 | Ga0105238_10103316 | Ga0105238_101033163 | 151 |
| 191 | 3300009553 | Ga0105249_11140213 | Ga0105249_111402132 | 151 |
| 192 | 3300013306 | Ga0163162_10102417 | Ga0163162_101024175 | 151 |
| 193 | 3300013308 | Ga0157375_10891583 | Ga0157375_108915831 | 151 |
| 194 | 3300025912 | Ga0207707_10028110 | Ga0207707_100281103 | 151 |
| 195 | 3300025912 | Ga0207707_10512288 | Ga0207707_105122882 | 151 |
| 196 | 3300025917 | Ga0207660_10075669 | Ga0207660_100756692 | 151 |
| 197 | 3300025921 | Ga0207652_10306718 | Ga0207652_103067182 | 151 |
| 198 | 3300025923 | Ga0207681_10854491 | Ga0207681_108544911 | 151 |
| 199 | 3300025924 | Ga0207694_10010888 | Ga0207694_100108884 | 151 |
| 200 | 3300025938 | Ga0207704_10597652 | Ga0207704_105976522 | 151 |
| 201 | 3300025941 | Ga0207711_10129164 | Ga0207711_101291641 | 151 |
| 202 | 3300025941 | Ga0207711_10448695 | Ga0207711_104486952 | 151 |
| 203 | 3300025961 | Ga0207712_11132371 | Ga0207712_111323711 | 151 |
| 204 | 3300026142 | Ga0207698_10927402 | Ga0207698_109274022 | 151 |
| 205 | 3300027665 | Ga0209983_1044054 | Ga0209983_10440542 | 151 |
| 206 | 3300035085 | Ga0373929_0009852 | Ga0373929_0009852_500_961 | 151 |
| 207 | 3300035088 | Ga0373940_0021054 | Ga0373940_0021054_399_860 | 151 |
| 208 | 3300035115 | Ga0373941_0009680 | Ga0373941_0009680_1637_2098 | 151 |
| 209 | 3300035242 | Ga0373962_0129334 | Ga0373962_0129334_22_483 | 151 |
| 210 | 3300035691 | Ga0373931_0001831 | Ga0373931_0001831_1735_2196 | 151 |
| 211 | 3300038996 | Ga0242420_002167 | Ga0242420_002167_1319_1780 | 151 |
| 212 | 3300046472 | Ga0495580_0001855 | Ga0495580_0001855_1525_2001 | 151 |
| 213 | 3300046472 | Ga0495580_0011369 | Ga0495580_0011369_5135_5617 | 151 |
| 214 | 3300048905 | Ga0496102_0851790 | Ga0496102_0851790_205_666 | 151 |
| 215 | 3300005353 | Ga0070669_101535655 | Ga0070669_1015356551 | 152 |
| 216 | 3300005617 | Ga0068859_100436540 | Ga0068859_1004365402 | 152 |
| 217 | 3300005719 | Ga0068861_101936590 | Ga0068861_1019365901 | 152 |
| 218 | 3300006871 | Ga0075434_100240855 | Ga0075434_1002408552 | 152 |
| 219 | 3300006931 | Ga0097620_100436498 | Ga0097620_1004364982 | 152 |
| 220 | 3300007076 | Ga0075435_100218556 | Ga0075435_1002185562 | 152 |
| 221 | 3300025923 | Ga0207681_11223622 | Ga0207681_112236221 | 152 |
| 222 | 3300042439 | Ga0439464_0124002 | Ga0439464_0124002_200_724 | 152 |
| 223 | 3300042876 | Ga0451577_0536882 | Ga0451577_0536882_360_836 | 152 |
| 224 | 3300044673 | Ga0453683_0355886 | Ga0453683_0355886_160_636 | 152 |
| 225 | 3300045051 | Ga0451576_0170815 | Ga0451576_0170815_260_736 | 152 |
| 226 | 3300050512 | nmdc:mga0n895_226659_c1 | nmdc:mga0n895_226659_c1_1072_1548 | 152 |
| 227 | 3300050513 | nmdc:mga0rr50_444054_c1 | nmdc:mga0rr50_444054_c1_258_734 | 152 |
| 228 | 3300005330 | Ga0070690_100045101 | Ga0070690_1000451012 | 153 |
| 229 | 3300005406 | Ga0070703_10140660 | Ga0070703_101406602 | 153 |
| 230 | 3300005617 | Ga0068859_100408803 | Ga0068859_1004088032 | 153 |
| 231 | 3300005842 | Ga0068858_100180314 | Ga0068858_1001803143 | 153 |
| 232 | 3300006931 | Ga0097620_100408773 | Ga0097620_1004087732 | 153 |
| 233 | 3300009148 | Ga0105243_10011189 | Ga0105243_100111895 | 153 |
| 234 | 3300009176 | Ga0105242_10031909 | Ga0105242_100319094 | 153 |
| 235 | 3300009177 | Ga0105248_10557109 | Ga0105248_105571092 | 153 |
| 236 | 3300013297 | Ga0157378_10000001 | Ga0157378_10000001208 | 153 |
| 237 | 3300013308 | Ga0157375_10015147 | Ga0157375_100151474 | 153 |
| 238 | 3300025934 | Ga0207686_10016982 | Ga0207686_100169824 | 153 |
| 239 | 3300025935 | Ga0207709_10008410 | Ga0207709_100084103 | 153 |
| 240 | 3300025941 | Ga0207711_10321484 | Ga0207711_103214842 | 153 |
| 241 | 3300048903 | Ga0496100_0186544 | Ga0496100_0186544_177_644 | 153 |
| 242 | 3300048909 | Ga0496106_0003284 | Ga0496106_0003284_4233_4700 | 153 |
| 243 | 3300049580 | Ga0501046_0028017 | Ga0501046_0028017_2628_3143 | 153 |
| 244 | 3300049743 | Ga0501081_0755190 | Ga0501081_0755190_206_691 | 153 |
| 245 | 3300004800 | Ga0058861_12020206 | Ga0058861_120202062 | 154 |
| 246 | 3300004803 | Ga0058862_12814246 | Ga0058862_128142462 | 154 |
| 247 | 3300005293 | Ga0065715_10297279 | Ga0065715_102972792 | 154 |
| 248 | 3300005295 | Ga0065707_10334780 | Ga0065707_103347802 | 154 |
| 249 | 3300005327 | Ga0070658_10751912 | Ga0070658_107519121 | 154 |
| 250 | 3300005329 | Ga0070683_100175248 | Ga0070683_1001752482 | 154 |
| 251 | 3300005329 | Ga0070683_100198594 | Ga0070683_1001985942 | 154 |
| 252 | 3300005333 | Ga0070677_10153175 | Ga0070677_101531751 | 154 |
| 253 | 3300005335 | Ga0070666_10228771 | Ga0070666_102287711 | 154 |
| 254 | 3300005336 | Ga0070680_100007201 | Ga0070680_1000072012 | 154 |
| 255 | 3300005340 | Ga0070689_100106941 | Ga0070689_1001069412 | 154 |
| 256 | 3300005343 | Ga0070687_100216610 | Ga0070687_1002166102 | 154 |
| 257 | 3300005347 | Ga0070668_100195213 | Ga0070668_1001952132 | 154 |
| 258 | 3300005353 | Ga0070669_101778821 | Ga0070669_1017788211 | 154 |
| 259 | 3300005354 | Ga0070675_100435936 | Ga0070675_1004359362 | 154 |
| 260 | 3300005354 | Ga0070675_100538305 | Ga0070675_1005383051 | 154 |
| 261 | 3300005356 | Ga0070674_100762128 | Ga0070674_1007621282 | 154 |
| 262 | 3300005364 | Ga0070673_102077160 | Ga0070673_1020771601 | 154 |
| 263 | 3300005365 | Ga0070688_100018960 | Ga0070688_1000189603 | 154 |
| 264 | 3300005367 | Ga0070667_100664685 | Ga0070667_1006646852 | 154 |
| 265 | 3300005434 | Ga0070709_10010190 | Ga0070709_100101902 | 154 |
| 266 | 3300005435 | Ga0070714_100073766 | Ga0070714_1000737663 | 154 |
| 267 | 3300005438 | Ga0070701_10302011 | Ga0070701_103020112 | 154 |
| 268 | 3300005440 | Ga0070705_100019094 | Ga0070705_1000190942 | 154 |
| 269 | 3300005444 | Ga0070694_100948023 | Ga0070694_1009480231 | 154 |
| 270 | 3300005445 | Ga0070708_100012380 | Ga0070708_1000123804 | 154 |
| 271 | 3300005445 | Ga0070708_100045665 | Ga0070708_1000456652 | 154 |
| 272 | 3300005455 | Ga0070663_101332137 | Ga0070663_1013321371 | 154 |
| 273 | 3300005457 | Ga0070662_100635530 | Ga0070662_1006355302 | 154 |
| 274 | 3300005458 | Ga0070681_10048676 | Ga0070681_100486762 | 154 |
| 275 | 3300005466 | Ga0070685_10637608 | Ga0070685_106376081 | 154 |
| 276 | 3300005467 | Ga0070706_100009975 | Ga0070706_1000099752 | 154 |
| 277 | 3300005467 | Ga0070706_100597921 | Ga0070706_1005979211 | 154 |
| 278 | 3300005468 | Ga0070707_100302128 | Ga0070707_1003021282 | 154 |
| 279 | 3300005468 | Ga0070707_100657558 | Ga0070707_1006575581 | 154 |
| 280 | 3300005471 | Ga0070698_100518363 | Ga0070698_1005183631 | 154 |
| 281 | 3300005530 | Ga0070679_100000595 | Ga0070679_1000005953 | 154 |
| 282 | 3300005535 | Ga0070684_100004296 | Ga0070684_1000042962 | 154 |
| 283 | 3300005535 | Ga0070684_100064604 | Ga0070684_1000646042 | 154 |
| 284 | 3300005535 | Ga0070684_100322287 | Ga0070684_1003222872 | 154 |
| 285 | 3300005535 | Ga0070684_101126476 | Ga0070684_1011264762 | 154 |
| 286 | 3300005544 | Ga0070686_100059272 | Ga0070686_1000592722 | 154 |
| 287 | 3300005548 | Ga0070665_100223513 | Ga0070665_1002235132 | 154 |
| 288 | 3300005549 | Ga0070704_100695565 | Ga0070704_1006955651 | 154 |
| 289 | 3300005549 | Ga0070704_101288635 | Ga0070704_1012886351 | 154 |
| 290 | 3300005563 | Ga0068855_100031356 | Ga0068855_1000313562 | 154 |
| 291 | 3300005577 | Ga0068857_100549781 | Ga0068857_1005497812 | 154 |
| 292 | 3300005614 | Ga0068856_100442317 | Ga0068856_1004423172 | 154 |
| 293 | 3300005617 | Ga0068859_100137579 | Ga0068859_1001375792 | 154 |
| 294 | 3300005617 | Ga0068859_101014513 | Ga0068859_1010145132 | 154 |
| 295 | 3300005617 | Ga0068859_101154645 | Ga0068859_1011546451 | 154 |
| 296 | 3300005617 | Ga0068859_102492342 | Ga0068859_1024923421 | 154 |
| 297 | 3300005840 | Ga0068870_10288969 | Ga0068870_102889692 | 154 |
| 298 | 3300005841 | Ga0068863_100181805 | Ga0068863_1001818052 | 154 |
| 299 | 3300005842 | Ga0068858_100671224 | Ga0068858_1006712242 | 154 |
| 300 | 3300005844 | Ga0068862_100176479 | Ga0068862_1001764792 | 154 |
| 301 | 3300005844 | Ga0068862_100743451 | Ga0068862_1007434511 | 154 |
| 302 | 3300006173 | Ga0070716_100740760 | Ga0070716_1007407602 | 154 |
| 303 | 3300006881 | Ga0068865_100113907 | Ga0068865_1001139072 | 154 |
| 304 | 3300006931 | Ga0097620_100137586 | Ga0097620_1001375862 | 154 |
| 305 | 3300006931 | Ga0097620_101014531 | Ga0097620_1010145312 | 154 |
| 306 | 3300006931 | Ga0097620_101154692 | Ga0097620_1011546922 | 154 |
| 307 | 3300006931 | Ga0097620_102492287 | Ga0097620_1024922871 | 154 |
| 308 | 3300009093 | Ga0105240_10312363 | Ga0105240_103123632 | 154 |
| 309 | 3300009094 | Ga0111539_10310608 | Ga0111539_103106082 | 154 |
| 310 | 3300009098 | Ga0105245_10169305 | Ga0105245_101693051 | 154 |
| 311 | 3300009098 | Ga0105245_10972118 | Ga0105245_109721182 | 154 |
| 312 | 3300009147 | Ga0114129_10086207 | Ga0114129_100862072 | 154 |
| 313 | 3300009147 | Ga0114129_10322886 | Ga0114129_103228862 | 154 |
| 314 | 3300009148 | Ga0105243_10793465 | Ga0105243_107934652 | 154 |
| 315 | 3300009553 | Ga0105249_10023451 | Ga0105249_100234512 | 154 |
| 316 | 3300009553 | Ga0105249_10326581 | Ga0105249_103265812 | 154 |
| 317 | 3300013100 | Ga0157373_10109563 | Ga0157373_101095632 | 154 |
| 318 | 3300013104 | Ga0157370_10127181 | Ga0157370_101271812 | 154 |
| 319 | 3300013105 | Ga0157369_10326981 | Ga0157369_103269812 | 154 |
| 320 | 3300013105 | Ga0157369_10641235 | Ga0157369_106412352 | 154 |
| 321 | 3300013296 | Ga0157374_10209306 | Ga0157374_102093062 | 154 |
| 322 | 3300013306 | Ga0163162_10547020 | Ga0163162_105470202 | 154 |
| 323 | 3300013307 | Ga0157372_10037384 | Ga0157372_100373844 | 154 |
| 324 | 3300013307 | Ga0157372_11631620 | Ga0157372_116316201 | 154 |
| 325 | 3300013308 | Ga0157375_12112007 | Ga0157375_121120072 | 154 |
| 326 | 3300014326 | Ga0157380_10253204 | Ga0157380_102532042 | 154 |
| 327 | 3300014745 | Ga0157377_10091167 | Ga0157377_100911672 | 154 |
| 328 | 3300014969 | Ga0157376_10477277 | Ga0157376_104772772 | 154 |
| 329 | 3300017792 | Ga0163161_10425001 | Ga0163161_104250011 | 154 |
| 330 | 3300020069 | Ga0197907_10821123 | Ga0197907_108211232 | 154 |
| 331 | 3300020078 | Ga0206352_10799656 | Ga0206352_107996562 | 154 |
| 332 | 3300020082 | Ga0206353_11065889 | Ga0206353_110658892 | 154 |
| 333 | 3300020610 | Ga0154015_1277831 | Ga0154015_12778311 | 154 |
| 334 | 3300025893 | Ga0207682_10037279 | Ga0207682_100372792 | 154 |
| 335 | 3300025893 | Ga0207682_10177049 | Ga0207682_101770492 | 154 |
| 336 | 3300025903 | Ga0207680_10049308 | Ga0207680_100493082 | 154 |
| 337 | 3300025910 | Ga0207684_10971157 | Ga0207684_109711571 | 154 |
| 338 | 3300025912 | Ga0207707_10062568 | Ga0207707_100625682 | 154 |
| 339 | 3300025912 | Ga0207707_10067530 | Ga0207707_100675302 | 154 |
| 340 | 3300025913 | Ga0207695_10031018 | Ga0207695_100310184 | 154 |
| 341 | 3300025917 | Ga0207660_10091568 | Ga0207660_100915682 | 154 |
| 342 | 3300025918 | Ga0207662_10063717 | Ga0207662_100637172 | 154 |
| 343 | 3300025920 | Ga0207649_10495927 | Ga0207649_104959272 | 154 |
| 344 | 3300025921 | Ga0207652_10080149 | Ga0207652_100801492 | 154 |
| 345 | 3300025922 | Ga0207646_10262756 | Ga0207646_102627562 | 154 |
| 346 | 3300025922 | Ga0207646_10540532 | Ga0207646_105405321 | 154 |
| 347 | 3300025923 | Ga0207681_10355140 | Ga0207681_103551402 | 154 |
| 348 | 3300025925 | Ga0207650_10246798 | Ga0207650_102467982 | 154 |
| 349 | 3300025926 | Ga0207659_10370100 | Ga0207659_103701002 | 154 |
| 350 | 3300025927 | Ga0207687_10094278 | Ga0207687_100942782 | 154 |
| 351 | 3300025929 | Ga0207664_10145500 | Ga0207664_101455002 | 154 |
| 352 | 3300025933 | Ga0207706_10252137 | Ga0207706_102521372 | 154 |
| 353 | 3300025934 | Ga0207686_10401457 | Ga0207686_104014571 | 154 |
| 354 | 3300025936 | Ga0207670_10190862 | Ga0207670_101908622 | 154 |
| 355 | 3300025939 | Ga0207665_10457601 | Ga0207665_104576012 | 154 |
| 356 | 3300025940 | Ga0207691_10243366 | Ga0207691_102433662 | 154 |
| 357 | 3300025941 | Ga0207711_10697684 | Ga0207711_106976841 | 154 |
| 358 | 3300025941 | Ga0207711_10795867 | Ga0207711_107958672 | 154 |
| 359 | 3300025942 | Ga0207689_10022249 | Ga0207689_100222493 | 154 |
| 360 | 3300025944 | Ga0207661_10011169 | Ga0207661_100111694 | 154 |
| 361 | 3300025944 | Ga0207661_10138409 | Ga0207661_101384092 | 154 |
| 362 | 3300025944 | Ga0207661_10275459 | Ga0207661_102754592 | 154 |
| 363 | 3300025949 | Ga0207667_10080730 | Ga0207667_100807303 | 154 |
| 364 | 3300025961 | Ga0207712_10327827 | Ga0207712_103278272 | 154 |
| 365 | 3300025961 | Ga0207712_10891877 | Ga0207712_108918772 | 154 |
| 366 | 3300025986 | Ga0207658_10468921 | Ga0207658_104689212 | 154 |
| 367 | 3300026075 | Ga0207708_10098231 | Ga0207708_100982312 | 154 |
| 368 | 3300026078 | Ga0207702_10087444 | Ga0207702_100874442 | 154 |
| 369 | 3300026088 | Ga0207641_10448214 | Ga0207641_104482142 | 154 |
| 370 | 3300026089 | Ga0207648_10614436 | Ga0207648_106144362 | 154 |
| 371 | 3300026095 | Ga0207676_10543477 | Ga0207676_105434772 | 154 |
| 372 | 3300026116 | Ga0207674_10691015 | Ga0207674_106910151 | 154 |
| 373 | 3300026118 | Ga0207675_100481829 | Ga0207675_1004818292 | 154 |
| 374 | 3300026121 | Ga0207683_10412199 | Ga0207683_104121991 | 154 |
| 375 | 3300028380 | Ga0268265_10376002 | Ga0268265_103760022 | 154 |
| 376 | 3300028381 | Ga0268264_11332091 | Ga0268264_113320912 | 154 |
| 377 | 3300035086 | Ga0373934_0005354 | Ga0373934_0005354_1417_1908 | 154 |
| 378 | 3300035117 | Ga0373953_0023333 | Ga0373953_0023333_1089_1580 | 154 |
| 379 | 3300035118 | Ga0373954_0397563 | Ga0373954_0397563_144_635 | 154 |
| 380 | 3300035120 | Ga0373957_0008536 | Ga0373957_0008536_1342_1833 | 154 |
| 381 | 3300035172 | Ga0373955_0021652 | Ga0373955_0021652_2478_2969 | 154 |
| 382 | 3300035724 | Ga0373933_0108617 | Ga0373933_0108617_499_990 | 154 |
| 383 | 3300035725 | Ga0373947_0150909 | Ga0373947_0150909_881_1372 | 154 |
| 384 | 3300036401 | Ga0373937_0261403 | Ga0373937_0261403_94_585 | 154 |
| 385 | 3300044684 | Ga0466966_0029559 | Ga0466966_0029559_1203_1706 | 154 |
| 386 | 3300045049 | Ga0466959_0214317 | Ga0466959_0214317_700_1203 | 154 |
| 387 | 3300045836 | Ga0466958_0105273 | Ga0466958_0105273_359_862 | 154 |
| 388 | 3300045976 | Ga0466967_0007283 | Ga0466967_0007283_300_803 | 154 |
| 389 | 3300046516 | Ga0495628_0050873 | Ga0495628_0050873_857_1348 | 154 |
| 390 | 3300046529 | Ga0495652_0277204 | Ga0495652_0277204_656_1147 | 154 |
| 391 | 3300046531 | Ga0495665_0453408 | Ga0495665_0453408_96_587 | 154 |
| 392 | 3300046535 | Ga0495586_0013411 | Ga0495586_0013411_3110_3601 | 154 |
| 393 | 3300046543 | Ga0495645_0000710 | Ga0495645_0000710_11467_11958 | 154 |
| 394 | 3300046559 | Ga0495667_0056115 | Ga0495667_0056115_1002_1493 | 154 |
| 395 | 3300046679 | Ga0495623_0006725 | Ga0495623_0006725_974_1465 | 154 |
| 396 | 3300047319 | Ga0495674_0392667 | Ga0495674_0392667_616_1107 | 154 |
| 397 | 3300047444 | Ga0495675_0005338 | Ga0495675_0005338_1199_1690 | 154 |
| 398 | 3300047471 | Ga0495684_0206457 | Ga0495684_0206457_864_1355 | 154 |
| 399 | 3300048088 | Ga0495602_0504306 | Ga0495602_0504306_209_700 | 154 |
| 400 | 3300049578 | Ga0501042_0625308 | Ga0501042_0625308_122_595 | 154 |
| 401 | 3300049587 | Ga0501071_0773627 | Ga0501071_0773627_176_649 | 154 |
| 402 | 3300049589 | Ga0501073_0176897 | Ga0501073_0176897_315_788 | 154 |
| 403 | 3300050507 | nmdc:mga05p37_100453_c1 | nmdc:mga05p37_100453_c1_957_1427 | 154 |
| 404 | 3300050510 | nmdc:mga06r32_707144_c1 | nmdc:mga06r32_707144_c1_122_610 | 154 |
| 405 | 3300050511 | nmdc:mga08y16_350641_c1 | nmdc:mga08y16_350641_c1_559_1047 | 154 |
| 406 | 3300053085 | Ga0495619_0193312 | Ga0495619_0193312_488_979 | 154 |
| 407 | 3300054114 | Ga0501084_0209291 | Ga0501084_0209291_901_1374 | 154 |
| 408 | 3300005329 | Ga0070683_100006225 | Ga0070683_1000062254 | 155 |
| 409 | 3300005336 | Ga0070680_100002196 | Ga0070680_1000021967 | 155 |
| 410 | 3300005440 | Ga0070705_100194451 | Ga0070705_1001944512 | 155 |
| 411 | 3300005444 | Ga0070694_100043438 | Ga0070694_1000434383 | 155 |
| 412 | 3300005467 | Ga0070706_100529935 | Ga0070706_1005299351 | 155 |
| 413 | 3300005468 | Ga0070707_100692490 | Ga0070707_1006924901 | 155 |
| 414 | 3300005471 | Ga0070698_100224520 | Ga0070698_1002245202 | 155 |
| 415 | 3300005535 | Ga0070684_100042162 | Ga0070684_1000421621 | 155 |
| 416 | 3300005535 | Ga0070684_100098615 | Ga0070684_1000986152 | 155 |
| 417 | 3300005549 | Ga0070704_100540642 | Ga0070704_1005406421 | 155 |
| 418 | 3300005549 | Ga0070704_101497196 | Ga0070704_1014971962 | 155 |
| 419 | 3300005564 | Ga0070664_100488519 | Ga0070664_1004885192 | 155 |
| 420 | 3300005564 | Ga0070664_100563886 | Ga0070664_1005638862 | 155 |
| 421 | 3300005616 | Ga0068852_100231606 | Ga0068852_1002316062 | 155 |
| 422 | 3300006852 | Ga0075433_10188470 | Ga0075433_101884703 | 155 |
| 423 | 3300013307 | Ga0157372_10313094 | Ga0157372_103130942 | 155 |
| 424 | 3300014968 | Ga0157379_11961963 | Ga0157379_119619631 | 155 |
| 425 | 3300025910 | Ga0207684_10504390 | Ga0207684_105043902 | 155 |
| 426 | 3300025917 | Ga0207660_10000818 | Ga0207660_1000081810 | 155 |
| 427 | 3300025944 | Ga0207661_10004508 | Ga0207661_100045085 | 155 |
| 428 | 3300025944 | Ga0207661_10041846 | Ga0207661_100418462 | 155 |
| 429 | 3300025944 | Ga0207661_10185135 | Ga0207661_101851352 | 155 |
| 430 | 3300025945 | Ga0207679_10100832 | Ga0207679_101008322 | 155 |
| 431 | 3300025945 | Ga0207679_10764722 | Ga0207679_107647221 | 155 |
| 432 | 3300026041 | Ga0207639_11365997 | Ga0207639_113659971 | 155 |
| 433 | 3300026121 | Ga0207683_10401139 | Ga0207683_104011392 | 155 |
| 434 | 3300026142 | Ga0207698_10021580 | Ga0207698_100215802 | 155 |
| 435 | 3300035086 | Ga0373934_0018545 | Ga0373934_0018545_1504_1983 | 155 |
| 436 | 3300044694 | Ga0466963_0360437 | Ga0466963_0360437_241_735 | 155 |
| 437 | 3300050515 | nmdc:mga0a205_161993_c1 | nmdc:mga0a205_161993_c1_762_1238 | 155 |
| 438 | 3300021388 | Ga0213875_10556325 | Ga0213875_105563251 | 156 |
| 439 | 3300037853 | Ga0436364_0530783 | Ga0436364_0530783_42_533 | 156 |
| 440 | 3300049570 | Ga0501033_0033973 | Ga0501033_0033973_516_992 | 156 |
| 441 | 3300049571 | Ga0501034_0183834 | Ga0501034_0183834_618_1094 | 156 |
| 442 | 3300049572 | Ga0501036_0259153 | Ga0501036_0259153_623_1099 | 156 |
| 443 | 3300049573 | Ga0501037_0040085 | Ga0501037_0040085_342_818 | 156 |
| 444 | 3300049574 | Ga0501038_0193655 | Ga0501038_0193655_837_1313 | 156 |
| 445 | 3300049580 | Ga0501046_0062230 | Ga0501046_0062230_1518_1994 | 156 |
| 446 | 3300049581 | Ga0501047_0239918 | Ga0501047_0239918_362_838 | 156 |
| 447 | 3300059424 | Ga0590075_055424 | Ga0590075_055424_426_941 | 156 |
| 448 | 3300059426 | Ga0590077_060551 | Ga0590077_060551_153_668 | 156 |
| 449 | 3300005295 | Ga0065707_10093046 | Ga0065707_100930462 | 157 |
| 450 | 3300005328 | Ga0070676_10004034 | Ga0070676_100040344 | 157 |
| 451 | 3300005331 | Ga0070670_100017119 | Ga0070670_1000171194 | 157 |
| 452 | 3300005334 | Ga0068869_100003439 | Ga0068869_1000034393 | 157 |
| 453 | 3300005334 | Ga0068869_100800793 | Ga0068869_1008007932 | 157 |
| 454 | 3300005335 | Ga0070666_10132177 | Ga0070666_101321772 | 157 |
| 455 | 3300005338 | Ga0068868_100060025 | Ga0068868_1000600252 | 157 |
| 456 | 3300005339 | Ga0070660_100105928 | Ga0070660_1001059282 | 157 |
| 457 | 3300005340 | Ga0070689_100104338 | Ga0070689_1001043382 | 157 |
| 458 | 3300005343 | Ga0070687_100009121 | Ga0070687_1000091212 | 157 |
| 459 | 3300005344 | Ga0070661_100039948 | Ga0070661_1000399482 | 157 |
| 460 | 3300005344 | Ga0070661_100090988 | Ga0070661_1000909882 | 157 |
| 461 | 3300005345 | Ga0070692_10018279 | Ga0070692_100182792 | 157 |
| 462 | 3300005347 | Ga0070668_100000444 | Ga0070668_10000044411 | 157 |
| 463 | 3300005353 | Ga0070669_100031784 | Ga0070669_1000317843 | 157 |
| 464 | 3300005354 | Ga0070675_100014907 | Ga0070675_1000149072 | 157 |
| 465 | 3300005355 | Ga0070671_100099076 | Ga0070671_1000990764 | 157 |
| 466 | 3300005356 | Ga0070674_100168716 | Ga0070674_1001687162 | 157 |
| 467 | 3300005364 | Ga0070673_100029674 | Ga0070673_1000296742 | 157 |
| 468 | 3300005365 | Ga0070688_100370056 | Ga0070688_1003700562 | 157 |
| 469 | 3300005365 | Ga0070688_100666559 | Ga0070688_1006665591 | 157 |
| 470 | 3300005366 | Ga0070659_100091713 | Ga0070659_1000917132 | 157 |
| 471 | 3300005367 | Ga0070667_100013376 | Ga0070667_1000133763 | 157 |
| 472 | 3300005439 | Ga0070711_100091933 | Ga0070711_1000919332 | 157 |
| 473 | 3300005441 | Ga0070700_100005703 | Ga0070700_1000057035 | 157 |
| 474 | 3300005444 | Ga0070694_100062966 | Ga0070694_1000629662 | 157 |
| 475 | 3300005455 | Ga0070663_100062181 | Ga0070663_1000621813 | 157 |
| 476 | 3300005457 | Ga0070662_100041504 | Ga0070662_1000415042 | 157 |
| 477 | 3300005459 | Ga0068867_100114913 | Ga0068867_1001149132 | 157 |
| 478 | 3300005466 | Ga0070685_10115574 | Ga0070685_101155742 | 157 |
| 479 | 3300005535 | Ga0070684_100023616 | Ga0070684_1000236163 | 157 |
| 480 | 3300005548 | Ga0070665_100336750 | Ga0070665_1003367501 | 157 |
| 481 | 3300005563 | Ga0068855_100138491 | Ga0068855_1001384912 | 157 |
| 482 | 3300005564 | Ga0070664_100124839 | Ga0070664_1001248392 | 157 |
| 483 | 3300005564 | Ga0070664_100180040 | Ga0070664_1001800402 | 157 |
| 484 | 3300005577 | Ga0068857_100082803 | Ga0068857_1000828032 | 157 |
| 485 | 3300005578 | Ga0068854_100026113 | Ga0068854_1000261133 | 157 |
| 486 | 3300005614 | Ga0068856_101728796 | Ga0068856_1017287961 | 157 |
| 487 | 3300005615 | Ga0070702_100668905 | Ga0070702_1006689051 | 157 |
| 488 | 3300005616 | Ga0068852_100027475 | Ga0068852_1000274753 | 157 |
| 489 | 3300005618 | Ga0068864_100135909 | Ga0068864_1001359092 | 157 |
| 490 | 3300005718 | Ga0068866_10225786 | Ga0068866_102257862 | 157 |
| 491 | 3300005719 | Ga0068861_100016097 | Ga0068861_1000160972 | 157 |
| 492 | 3300005834 | Ga0068851_10119810 | Ga0068851_101198102 | 157 |
| 493 | 3300005841 | Ga0068863_100031527 | Ga0068863_1000315272 | 157 |
| 494 | 3300005842 | Ga0068858_100147606 | Ga0068858_1001476062 | 157 |
| 495 | 3300005843 | Ga0068860_100074411 | Ga0068860_1000744112 | 157 |
| 496 | 3300005844 | Ga0068862_100046426 | Ga0068862_1000464262 | 157 |
| 497 | 3300006175 | Ga0070712_100162596 | Ga0070712_1001625962 | 157 |
| 498 | 3300006237 | Ga0097621_100082981 | Ga0097621_1000829812 | 157 |
| 499 | 3300006844 | Ga0075428_100095286 | Ga0075428_1000952863 | 157 |
| 500 | 3300006844 | Ga0075428_100131771 | Ga0075428_1001317712 | 157 |
| 501 | 3300006847 | Ga0075431_100181590 | Ga0075431_1001815903 | 157 |
| 502 | 3300006847 | Ga0075431_101221499 | Ga0075431_1012214991 | 157 |
| 503 | 3300006852 | Ga0075433_10003192 | Ga0075433_1000319211 | 157 |
| 504 | 3300006852 | Ga0075433_10018953 | Ga0075433_100189533 | 157 |
| 505 | 3300006871 | Ga0075434_100006350 | Ga0075434_1000063503 | 157 |
| 506 | 3300006871 | Ga0075434_100023121 | Ga0075434_1000231214 | 157 |
| 507 | 3300006880 | Ga0075429_100221408 | Ga0075429_1002214082 | 157 |
| 508 | 3300009147 | Ga0114129_10178224 | Ga0114129_101782243 | 157 |
| 509 | 3300009177 | Ga0105248_10034349 | Ga0105248_100343492 | 157 |
| 510 | 3300009177 | Ga0105248_10588362 | Ga0105248_105883622 | 157 |
| 511 | 3300009545 | Ga0105237_10094706 | Ga0105237_100947062 | 157 |
| 512 | 3300009551 | Ga0105238_11337255 | Ga0105238_113372552 | 157 |
| 513 | 3300009553 | Ga0105249_10003594 | Ga0105249_100035948 | 157 |
| 514 | 3300010375 | Ga0105239_10055210 | Ga0105239_100552103 | 157 |
| 515 | 3300013102 | Ga0157371_10020712 | Ga0157371_100207122 | 157 |
| 516 | 3300013306 | Ga0163162_10000455 | Ga0163162_100004552 | 157 |
| 517 | 3300013308 | Ga0157375_10262716 | Ga0157375_102627162 | 157 |
| 518 | 3300014325 | Ga0163163_10006856 | Ga0163163_100068564 | 157 |
| 519 | 3300014326 | Ga0157380_10008768 | Ga0157380_100087686 | 157 |
| 520 | 3300014745 | Ga0157377_10020027 | Ga0157377_100200272 | 157 |
| 521 | 3300025315 | Ga0207697_10004603 | Ga0207697_100046034 | 157 |
| 522 | 3300025901 | Ga0207688_10023903 | Ga0207688_100239032 | 157 |
| 523 | 3300025903 | Ga0207680_10074727 | Ga0207680_100747272 | 157 |
| 524 | 3300025904 | Ga0207647_10030615 | Ga0207647_100306153 | 157 |
| 525 | 3300025907 | Ga0207645_10000687 | Ga0207645_1000068711 | 157 |
| 526 | 3300025914 | Ga0207671_10095116 | Ga0207671_100951162 | 157 |
| 527 | 3300025916 | Ga0207663_10131520 | Ga0207663_101315202 | 157 |
| 528 | 3300025918 | Ga0207662_10001597 | Ga0207662_100015976 | 157 |
| 529 | 3300025919 | Ga0207657_10052336 | Ga0207657_100523362 | 157 |
| 530 | 3300025920 | Ga0207649_10053694 | Ga0207649_100536942 | 157 |
| 531 | 3300025920 | Ga0207649_10838722 | Ga0207649_108387221 | 157 |
| 532 | 3300025923 | Ga0207681_10010449 | Ga0207681_100104492 | 157 |
| 533 | 3300025925 | Ga0207650_10078385 | Ga0207650_100783852 | 157 |
| 534 | 3300025927 | Ga0207687_10142770 | Ga0207687_101427702 | 157 |
| 535 | 3300025931 | Ga0207644_10123831 | Ga0207644_101238314 | 157 |
| 536 | 3300025931 | Ga0207644_10938762 | Ga0207644_109387622 | 157 |
| 537 | 3300025933 | Ga0207706_10001099 | Ga0207706_1000109919 | 157 |
| 538 | 3300025933 | Ga0207706_10389281 | Ga0207706_103892812 | 157 |
| 539 | 3300025936 | Ga0207670_10193802 | Ga0207670_101938021 | 157 |
| 540 | 3300025937 | Ga0207669_10631069 | Ga0207669_106310692 | 157 |
| 541 | 3300025940 | Ga0207691_10002827 | Ga0207691_100028274 | 157 |
| 542 | 3300025941 | Ga0207711_10398418 | Ga0207711_103984182 | 157 |
| 543 | 3300025942 | Ga0207689_10002768 | Ga0207689_1000276810 | 157 |
| 544 | 3300025944 | Ga0207661_10078151 | Ga0207661_100781512 | 157 |
| 545 | 3300025944 | Ga0207661_10232981 | Ga0207661_102329812 | 157 |
| 546 | 3300025945 | Ga0207679_10028174 | Ga0207679_100281742 | 157 |
| 547 | 3300025945 | Ga0207679_10125372 | Ga0207679_101253721 | 157 |
| 548 | 3300025949 | Ga0207667_10153504 | Ga0207667_101535042 | 157 |
| 549 | 3300025961 | Ga0207712_10018433 | Ga0207712_100184333 | 157 |
| 550 | 3300025972 | Ga0207668_10015066 | Ga0207668_100150662 | 157 |
| 551 | 3300025981 | Ga0207640_10060457 | Ga0207640_100604572 | 157 |
| 552 | 3300025986 | Ga0207658_10016778 | Ga0207658_100167782 | 157 |
| 553 | 3300026023 | Ga0207677_10013685 | Ga0207677_100136852 | 157 |
| 554 | 3300026041 | Ga0207639_10263637 | Ga0207639_102636372 | 157 |
| 555 | 3300026075 | Ga0207708_10014222 | Ga0207708_100142223 | 157 |
| 556 | 3300026089 | Ga0207648_10017903 | Ga0207648_100179033 | 157 |
| 557 | 3300026095 | Ga0207676_10072933 | Ga0207676_100729332 | 157 |
| 558 | 3300026116 | Ga0207674_10005242 | Ga0207674_100052422 | 157 |
| 559 | 3300026118 | Ga0207675_100000141 | Ga0207675_10000014141 | 157 |
| 560 | 3300027866 | Ga0209813_10254780 | Ga0209813_102547801 | 157 |
| 561 | 3300028379 | Ga0268266_10129335 | Ga0268266_101293352 | 157 |
| 562 | 3300028380 | Ga0268265_10036005 | Ga0268265_100360053 | 157 |
| 563 | 3300031548 | Ga0307408_100051677 | Ga0307408_1000516772 | 157 |
| 564 | 3300031731 | Ga0307405_10358657 | Ga0307405_103586572 | 157 |
| 565 | 3300031824 | Ga0307413_10393071 | Ga0307413_103930712 | 157 |
| 566 | 3300031901 | Ga0307406_10002220 | Ga0307406_100022206 | 157 |
| 567 | 3300031911 | Ga0307412_10162085 | Ga0307412_101620852 | 157 |
| 568 | 3300035170 | Ga0373943_0555441 | Ga0373943_0555441_56_559 | 157 |
| 569 | 3300035171 | Ga0373946_0104632 | Ga0373946_0104632_53_556 | 157 |
| 570 | 3300035241 | Ga0373961_0023035 | Ga0373961_0023035_307_810 | 157 |
| 571 | 3300037471 | Ga0395905_0218578 | Ga0395905_0218578_1082_1585 | 157 |
| 572 | 3300037471 | Ga0395905_0812010 | Ga0395905_0812010_158_661 | 157 |
| 573 | 3300042012 | Ga0439455_0008140 | Ga0439455_0008140_562_1065 | 157 |
| 574 | 3300042439 | Ga0439464_0024646 | Ga0439464_0024646_238_741 | 157 |
| 575 | 3300042876 | Ga0451577_0423678 | Ga0451577_0423678_631_1134 | 157 |
| 576 | 3300044684 | Ga0466966_0776308 | Ga0466966_0776308_12_518 | 157 |
| 577 | 3300045051 | Ga0451576_0189609 | Ga0451576_0189609_210_713 | 157 |
| 578 | 3300046459 | Ga0495629_0260972 | Ga0495629_0260972_221_724 | 157 |
| 579 | 3300046525 | Ga0495663_0053817 | Ga0495663_0053817_323_826 | 157 |
| 580 | 3300046538 | Ga0495609_0280561 | Ga0495609_0280561_19_522 | 157 |
| 581 | 3300046681 | Ga0495647_0104313 | Ga0495647_0104313_255_758 | 157 |
| 582 | 3300046683 | Ga0495658_0127865 | Ga0495658_0127865_474_977 | 157 |
| 583 | 3300046691 | Ga0495670_0344805 | Ga0495670_0344805_257_760 | 157 |
| 584 | 3300047318 | Ga0495636_0343549 | Ga0495636_0343549_130_624 | 157 |
| 585 | 3300048909 | Ga0496106_0493575 | Ga0496106_0493575_101_604 | 157 |
| 586 | 3300048911 | Ga0496108_0257660 | Ga0496108_0257660_65_568 | 157 |
| 587 | 3300048912 | Ga0496109_0164921 | Ga0496109_0164921_601_1104 | 157 |
| 588 | 3300048915 | Ga0496112_0285768 | Ga0496112_0285768_1015_1518 | 157 |
| 589 | 3300049742 | Ga0501080_0862968 | Ga0501080_0862968_210_707 | 157 |
| 590 | 3300050494 | nmdc:mga06z11_322010_c1 | nmdc:mga06z11_322010_c1_186_677 | 157 |
| 591 | 3300050507 | nmdc:mga05p37_228848_c1 | nmdc:mga05p37_228848_c1_586_1089 | 157 |
| 592 | 3300050508 | nmdc:mga09592_175559_c1 | nmdc:mga09592_175559_c1_762_1265 | 157 |
| 593 | 3300050510 | nmdc:mga06r32_160294_c1 | nmdc:mga06r32_160294_c1_1696_2199 | 157 |
| 594 | 3300050512 | nmdc:mga0n895_17167_c1 | nmdc:mga0n895_17167_c1_5037_5540 | 157 |
| 595 | 3300050512 | nmdc:mga0n895_5969_c1 | nmdc:mga0n895_5969_c1_7659_8162 | 157 |
| 596 | 3300050515 | nmdc:mga0a205_11699_c1 | nmdc:mga0a205_11699_c1_3964_4467 | 157 |
| 597 | 3300050515 | nmdc:mga0a205_283278_c1 | nmdc:mga0a205_283278_c1_479_982 | 157 |
| 598 | 3300025903 | Ga0207680_11006824 | Ga0207680_110068241 | 158 |
| 599 | 3300025912 | Ga0207707_10609738 | Ga0207707_106097382 | 158 |
| 600 | 3300025986 | Ga0207658_10890798 | Ga0207658_108907981 | 158 |
| 601 | 3300030760 | Ga0265762_1046575 | Ga0265762_10465752 | 158 |
| 602 | 3300030762 | Ga0265775_109132 | Ga0265775_1091321 | 158 |
| 603 | 3300031852 | Ga0307410_10071420 | Ga0307410_100714202 | 158 |
| 604 | 3300031903 | Ga0307407_10036680 | Ga0307407_100366802 | 158 |
| 605 | 3300031911 | Ga0307412_10019704 | Ga0307412_100197042 | 158 |
| 606 | 3300031995 | Ga0307409_100062443 | Ga0307409_1000624432 | 158 |
| 607 | 3300032002 | Ga0307416_100010521 | Ga0307416_1000105215 | 158 |
| 608 | 3300032002 | Ga0307416_100536726 | Ga0307416_1005367262 | 158 |
| 609 | 3300032004 | Ga0307414_10161300 | Ga0307414_101613002 | 158 |
| 610 | 3300032005 | Ga0307411_10017454 | Ga0307411_100174546 | 158 |
| 611 | 3300041494 | Ga0451837_0841720 | Ga0451837_0841720_397_921 | 158 |
| 612 | 3300042147 | Ga0450910_052467 | Ga0450910_052467_41_553 | 158 |
| 613 | 3300049570 | Ga0501033_0198030 | Ga0501033_0198030_753_1253 | 158 |
| 614 | 3300049589 | Ga0501073_0002552 | Ga0501073_0002552_416_910 | 158 |
| 615 | 3300049593 | Ga0501077_0251029 | Ga0501077_0251029_141_629 | 158 |
| 616 | 3300049706 | Ga0501229_032467 | Ga0501229_032467_196_687 | 158 |
| 617 | 3300049779 | Ga0501283_058035 | Ga0501283_058035_77_568 | 158 |
| 618 | 3300050493 | nmdc:mga0k408_120337_c1 | nmdc:mga0k408_120337_c1_879_1391 | 158 |
| 619 | 3300050493 | nmdc:mga0k408_79000_c1 | nmdc:mga0k408_79000_c1_335_847 | 158 |
| 620 | 3300050510 | nmdc:mga06r32_756692_c1 | nmdc:mga06r32_756692_c1_312_809 | 158 |
| 621 | 3300059426 | Ga0590077_016929 | Ga0590077_016929_115_615 | 158 |
| 622 | 3300005327 | Ga0070658_10029087 | Ga0070658_100290872 | 159 |
| 623 | 3300005334 | Ga0068869_100775819 | Ga0068869_1007758191 | 159 |
| 624 | 3300005548 | Ga0070665_100377914 | Ga0070665_1003779142 | 159 |
| 625 | 3300005614 | Ga0068856_100433112 | Ga0068856_1004331122 | 159 |
| 626 | 3300006038 | Ga0075365_10097114 | Ga0075365_100971142 | 159 |
| 627 | 3300006042 | Ga0075368_10278475 | Ga0075368_102784751 | 159 |
| 628 | 3300006186 | Ga0075369_10475424 | Ga0075369_104754241 | 159 |
| 629 | 3300050493 | nmdc:mga0k408_316656_c1 | nmdc:mga0k408_316656_c1_169_681 | 159 |
| 630 | 3300050495 | nmdc:mga04h51_276360_c1 | nmdc:mga04h51_276360_c1_95_607 | 159 |
| 631 | 3300005353 | Ga0070669_100053272 | Ga0070669_1000532723 | 160 |
| 632 | 3300005364 | Ga0070673_100172762 | Ga0070673_1001727622 | 160 |
| 633 | 3300005365 | Ga0070688_100224466 | Ga0070688_1002244662 | 160 |
| 634 | 3300005367 | Ga0070667_100260108 | Ga0070667_1002601082 | 160 |
| 635 | 3300005440 | Ga0070705_100720726 | Ga0070705_1007207262 | 160 |
| 636 | 3300005441 | Ga0070700_100118111 | Ga0070700_1001181112 | 160 |
| 637 | 3300005444 | Ga0070694_100385103 | Ga0070694_1003851032 | 160 |
| 638 | 3300005456 | Ga0070678_100180034 | Ga0070678_1001800342 | 160 |
| 639 | 3300005459 | Ga0068867_101971268 | Ga0068867_1019712681 | 160 |
| 640 | 3300005468 | Ga0070707_101162494 | Ga0070707_1011624941 | 160 |
| 641 | 3300005545 | Ga0070695_100134838 | Ga0070695_1001348382 | 160 |
| 642 | 3300005545 | Ga0070695_100347708 | Ga0070695_1003477082 | 160 |
| 643 | 3300005548 | Ga0070665_100538444 | Ga0070665_1005384442 | 160 |
| 644 | 3300005577 | Ga0068857_100700948 | Ga0068857_1007009482 | 160 |
| 645 | 3300005840 | Ga0068870_10043570 | Ga0068870_100435702 | 160 |
| 646 | 3300005844 | Ga0068862_100390674 | Ga0068862_1003906742 | 160 |
| 647 | 3300006042 | Ga0075368_10004085 | Ga0075368_100040855 | 160 |
| 648 | 3300006051 | Ga0075364_10053197 | Ga0075364_100531972 | 160 |
| 649 | 3300006178 | Ga0075367_10030877 | Ga0075367_100308772 | 160 |
| 650 | 3300006353 | Ga0075370_10720353 | Ga0075370_107203531 | 160 |
| 651 | 3300006844 | Ga0075428_100504633 | Ga0075428_1005046332 | 160 |
| 652 | 3300009094 | Ga0111539_10022206 | Ga0111539_100222066 | 160 |
| 653 | 3300009094 | Ga0111539_10734437 | Ga0111539_107344372 | 160 |
| 654 | 3300009101 | Ga0105247_10287431 | Ga0105247_102874312 | 160 |
| 655 | 3300009174 | Ga0105241_10554892 | Ga0105241_105548922 | 160 |
| 656 | 3300009545 | Ga0105237_10599141 | Ga0105237_105991412 | 160 |
| 657 | 3300014968 | Ga0157379_11851970 | Ga0157379_118519701 | 160 |
| 658 | 3300025901 | Ga0207688_10098690 | Ga0207688_100986902 | 160 |
| 659 | 3300025923 | Ga0207681_10342530 | Ga0207681_103425302 | 160 |
| 660 | 3300025925 | Ga0207650_10752607 | Ga0207650_107526072 | 160 |
| 661 | 3300025926 | Ga0207659_10480251 | Ga0207659_104802511 | 160 |
| 662 | 3300025986 | Ga0207658_10182075 | Ga0207658_101820752 | 160 |
| 663 | 3300026067 | Ga0207678_10229146 | Ga0207678_102291462 | 160 |
| 664 | 3300026089 | Ga0207648_10183358 | Ga0207648_101833582 | 160 |
| 665 | 3300027907 | Ga0207428_10274500 | Ga0207428_102745001 | 160 |
| 666 | 3300028379 | Ga0268266_10327654 | Ga0268266_103276542 | 160 |
| 667 | 3300028379 | Ga0268266_10650919 | Ga0268266_106509191 | 160 |
| 668 | 3300032126 | Ga0307415_100039760 | Ga0307415_1000397602 | 160 |
| 669 | 3300035118 | Ga0373954_0035006 | Ga0373954_0035006_700_1197 | 160 |
| 670 | 3300035695 | Ga0373927_0055350 | Ga0373927_0055350_83_580 | 160 |
| 671 | 3300035724 | Ga0373933_0271923 | Ga0373933_0271923_396_893 | 160 |
| 672 | 3300036401 | Ga0373937_0293758 | Ga0373937_0293758_900_1397 | 160 |
| 673 | 3300037853 | Ga0436364_1278837 | Ga0436364_1278837_373_885 | 160 |
| 674 | 3300045051 | Ga0451576_0184905 | Ga0451576_0184905_274_795 | 160 |
| 675 | 3300046539 | Ga0495621_0204949 | Ga0495621_0204949_229_723 | 160 |
| 676 | 3300046559 | Ga0495667_0122252 | Ga0495667_0122252_719_1216 | 160 |
| 677 | 3300046664 | Ga0495659_0056166 | Ga0495659_0056166_662_1168 | 160 |
| 678 | 3300050491 | nmdc:mga00v17_48917_c1 | nmdc:mga00v17_48917_c1_975_1475 | 160 |
| 679 | 3300050494 | nmdc:mga06z11_21556_c1 | nmdc:mga06z11_21556_c1_2397_2915 | 160 |
| 680 | 3300050511 | nmdc:mga08y16_95576_c1 | nmdc:mga08y16_95576_c1_2084_2572 | 160 |
| 681 | 3300050516 | nmdc:mga0sz30_165393_c1 | nmdc:mga0sz30_165393_c1_422_922 | 160 |
| 682 | 3300005289 | Ga0065704_10096643 | Ga0065704_100966432 | 161 |
| 683 | 3300005293 | Ga0065715_10155647 | Ga0065715_101556472 | 161 |
| 684 | 3300005328 | Ga0070676_10212131 | Ga0070676_102121312 | 161 |
| 685 | 3300005330 | Ga0070690_100050734 | Ga0070690_1000507341 | 161 |
| 686 | 3300005331 | Ga0070670_100038600 | Ga0070670_1000386003 | 161 |
| 687 | 3300005335 | Ga0070666_10454828 | Ga0070666_104548281 | 161 |
| 688 | 3300005340 | Ga0070689_100001466 | Ga0070689_10000146614 | 161 |
| 689 | 3300005343 | Ga0070687_100019645 | Ga0070687_1000196452 | 161 |
| 690 | 3300005344 | Ga0070661_100051556 | Ga0070661_1000515561 | 161 |
| 691 | 3300005345 | Ga0070692_10036286 | Ga0070692_100362862 | 161 |
| 692 | 3300005347 | Ga0070668_100038041 | Ga0070668_1000380415 | 161 |
| 693 | 3300005353 | Ga0070669_100016596 | Ga0070669_1000165962 | 161 |
| 694 | 3300005354 | Ga0070675_100001331 | Ga0070675_10000133115 | 161 |
| 695 | 3300005354 | Ga0070675_100042795 | Ga0070675_1000427952 | 161 |
| 696 | 3300005356 | Ga0070674_100001579 | Ga0070674_10000157912 | 161 |
| 697 | 3300005365 | Ga0070688_100003074 | Ga0070688_1000030747 | 161 |
| 698 | 3300005367 | Ga0070667_100119577 | Ga0070667_1001195772 | 161 |
| 699 | 3300005438 | Ga0070701_10003233 | Ga0070701_100032334 | 161 |
| 700 | 3300005440 | Ga0070705_100000156 | Ga0070705_10000015631 | 161 |
| 701 | 3300005441 | Ga0070700_100601525 | Ga0070700_1006015252 | 161 |
| 702 | 3300005444 | Ga0070694_100003304 | Ga0070694_1000033042 | 161 |
| 703 | 3300005444 | Ga0070694_100005609 | Ga0070694_1000056097 | 161 |
| 704 | 3300005444 | Ga0070694_100794123 | Ga0070694_1007941231 | 161 |
| 705 | 3300005457 | Ga0070662_100124200 | Ga0070662_1001242003 | 161 |
| 706 | 3300005459 | Ga0068867_100010217 | Ga0068867_1000102177 | 161 |
| 707 | 3300005466 | Ga0070685_10087920 | Ga0070685_100879202 | 161 |
| 708 | 3300005466 | Ga0070685_10436717 | Ga0070685_104367171 | 161 |
| 709 | 3300005468 | Ga0070707_101624741 | Ga0070707_1016247411 | 161 |
| 710 | 3300005471 | Ga0070698_100002282 | Ga0070698_10000228210 | 161 |
| 711 | 3300005471 | Ga0070698_100507100 | Ga0070698_1005071002 | 161 |
| 712 | 3300005518 | Ga0070699_100000763 | Ga0070699_10000076314 | 161 |
| 713 | 3300005518 | Ga0070699_100139811 | Ga0070699_1001398112 | 161 |
| 714 | 3300005518 | Ga0070699_100204867 | Ga0070699_1002048672 | 161 |
| 715 | 3300005535 | Ga0070684_100118791 | Ga0070684_1001187912 | 161 |
| 716 | 3300005536 | Ga0070697_100374373 | Ga0070697_1003743732 | 161 |
| 717 | 3300005543 | Ga0070672_100013480 | Ga0070672_1000134803 | 161 |
| 718 | 3300005545 | Ga0070695_100000574 | Ga0070695_10000057419 | 161 |
| 719 | 3300005545 | Ga0070695_100344998 | Ga0070695_1003449981 | 161 |
| 720 | 3300005545 | Ga0070695_100424586 | Ga0070695_1004245862 | 161 |
| 721 | 3300005546 | Ga0070696_100002781 | Ga0070696_1000027816 | 161 |
| 722 | 3300005549 | Ga0070704_100003889 | Ga0070704_1000038895 | 161 |
| 723 | 3300005549 | Ga0070704_100067680 | Ga0070704_1000676802 | 161 |
| 724 | 3300005564 | Ga0070664_100381944 | Ga0070664_1003819442 | 161 |
| 725 | 3300005577 | Ga0068857_100003390 | Ga0068857_1000033904 | 161 |
| 726 | 3300005617 | Ga0068859_100007156 | Ga0068859_1000071562 | 161 |
| 727 | 3300005617 | Ga0068859_100008945 | Ga0068859_1000089457 | 161 |
| 728 | 3300005618 | Ga0068864_100064676 | Ga0068864_1000646762 | 161 |
| 729 | 3300005618 | Ga0068864_100077076 | Ga0068864_1000770764 | 161 |
| 730 | 3300005618 | Ga0068864_100126191 | Ga0068864_1001261912 | 161 |
| 731 | 3300005719 | Ga0068861_100002466 | Ga0068861_10000246611 | 161 |
| 732 | 3300005719 | Ga0068861_100213147 | Ga0068861_1002131472 | 161 |
| 733 | 3300005840 | Ga0068870_10003744 | Ga0068870_100037442 | 161 |
| 734 | 3300005841 | Ga0068863_100040923 | Ga0068863_1000409232 | 161 |
| 735 | 3300005841 | Ga0068863_100603403 | Ga0068863_1006034032 | 161 |
| 736 | 3300005842 | Ga0068858_100070669 | Ga0068858_1000706692 | 161 |
| 737 | 3300005842 | Ga0068858_100137314 | Ga0068858_1001373142 | 161 |
| 738 | 3300005843 | Ga0068860_100001702 | Ga0068860_10000170215 | 161 |
| 739 | 3300005843 | Ga0068860_100584939 | Ga0068860_1005849392 | 161 |
| 740 | 3300005844 | Ga0068862_100001703 | Ga0068862_1000017037 | 161 |
| 741 | 3300005937 | Ga0081455_10195831 | Ga0081455_101958312 | 161 |
| 742 | 3300006358 | Ga0068871_100389406 | Ga0068871_1003894062 | 161 |
| 743 | 3300006844 | Ga0075428_100004279 | Ga0075428_1000042793 | 161 |
| 744 | 3300006844 | Ga0075428_100236400 | Ga0075428_1002364004 | 161 |
| 745 | 3300006846 | Ga0075430_100135241 | Ga0075430_1001352412 | 161 |
| 746 | 3300006852 | Ga0075433_10106453 | Ga0075433_101064532 | 161 |
| 747 | 3300006852 | Ga0075433_10260145 | Ga0075433_102601453 | 161 |
| 748 | 3300006871 | Ga0075434_101676521 | Ga0075434_1016765211 | 161 |
| 749 | 3300006871 | Ga0075434_101836417 | Ga0075434_1018364171 | 161 |
| 750 | 3300006880 | Ga0075429_100206839 | Ga0075429_1002068393 | 161 |
| 751 | 3300006880 | Ga0075429_100540894 | Ga0075429_1005408941 | 161 |
| 752 | 3300006881 | Ga0068865_100190724 | Ga0068865_1001907243 | 161 |
| 753 | 3300006881 | Ga0068865_100574336 | Ga0068865_1005743361 | 161 |
| 754 | 3300006931 | Ga0097620_100007155 | Ga0097620_1000071552 | 161 |
| 755 | 3300006931 | Ga0097620_100008945 | Ga0097620_1000089457 | 161 |
| 756 | 3300007076 | Ga0075435_100009995 | Ga0075435_1000099952 | 161 |
| 757 | 3300007076 | Ga0075435_100254982 | Ga0075435_1002549822 | 161 |
| 758 | 3300007076 | Ga0075435_100277843 | Ga0075435_1002778432 | 161 |
| 759 | 3300009094 | Ga0111539_10366694 | Ga0111539_103666941 | 161 |
| 760 | 3300009094 | Ga0111539_10392898 | Ga0111539_103928982 | 161 |
| 761 | 3300009094 | Ga0111539_10527595 | Ga0111539_105275952 | 161 |
| 762 | 3300009098 | Ga0105245_10733529 | Ga0105245_107335291 | 161 |
| 763 | 3300009147 | Ga0114129_10001655 | Ga0114129_1000165513 | 161 |
| 764 | 3300009147 | Ga0114129_10111748 | Ga0114129_101117482 | 161 |
| 765 | 3300009148 | Ga0105243_10109765 | Ga0105243_101097652 | 161 |
| 766 | 3300009148 | Ga0105243_10345087 | Ga0105243_103450872 | 161 |
| 767 | 3300009176 | Ga0105242_10256413 | Ga0105242_102564132 | 161 |
| 768 | 3300009177 | Ga0105248_10350586 | Ga0105248_103505862 | 161 |
| 769 | 3300009553 | Ga0105249_10002856 | Ga0105249_100028569 | 161 |
| 770 | 3300009553 | Ga0105249_12479767 | Ga0105249_124797671 | 161 |
| 771 | 3300013297 | Ga0157378_10099008 | Ga0157378_100990084 | 161 |
| 772 | 3300013306 | Ga0163162_10095346 | Ga0163162_100953462 | 161 |
| 773 | 3300013308 | Ga0157375_10003909 | Ga0157375_100039095 | 161 |
| 774 | 3300014325 | Ga0163163_11224431 | Ga0163163_112244311 | 161 |
| 775 | 3300014326 | Ga0157380_10061475 | Ga0157380_100614754 | 161 |
| 776 | 3300014745 | Ga0157377_10037485 | Ga0157377_100374852 | 161 |
| 777 | 3300014745 | Ga0157377_10341191 | Ga0157377_103411912 | 161 |
| 778 | 3300014968 | Ga0157379_11129689 | Ga0157379_111296892 | 161 |
| 779 | 3300014969 | Ga0157376_10203145 | Ga0157376_102031452 | 161 |
| 780 | 3300025315 | Ga0207697_10134691 | Ga0207697_101346911 | 161 |
| 781 | 3300025885 | Ga0207653_10037061 | Ga0207653_100370612 | 161 |
| 782 | 3300025901 | Ga0207688_10062307 | Ga0207688_100623072 | 161 |
| 783 | 3300025903 | Ga0207680_10367720 | Ga0207680_103677202 | 161 |
| 784 | 3300025904 | Ga0207647_10132312 | Ga0207647_101323122 | 161 |
| 785 | 3300025908 | Ga0207643_10009279 | Ga0207643_100092796 | 161 |
| 786 | 3300025908 | Ga0207643_10012200 | Ga0207643_100122002 | 161 |
| 787 | 3300025917 | Ga0207660_10853352 | Ga0207660_108533522 | 161 |
| 788 | 3300025918 | Ga0207662_10019830 | Ga0207662_100198303 | 161 |
| 789 | 3300025920 | Ga0207649_11278462 | Ga0207649_112784621 | 161 |
| 790 | 3300025921 | Ga0207652_10164539 | Ga0207652_101645393 | 161 |
| 791 | 3300025922 | Ga0207646_10131939 | Ga0207646_101319392 | 161 |
| 792 | 3300025923 | Ga0207681_10001144 | Ga0207681_100011448 | 161 |
| 793 | 3300025923 | Ga0207681_10116658 | Ga0207681_101166581 | 161 |
| 794 | 3300025925 | Ga0207650_10043836 | Ga0207650_100438361 | 161 |
| 795 | 3300025926 | Ga0207659_10000485 | Ga0207659_1000048513 | 161 |
| 796 | 3300025926 | Ga0207659_10000662 | Ga0207659_1000066212 | 161 |
| 797 | 3300025931 | Ga0207644_11390862 | Ga0207644_113908621 | 161 |
| 798 | 3300025931 | Ga0207644_11494003 | Ga0207644_114940031 | 161 |
| 799 | 3300025933 | Ga0207706_10288738 | Ga0207706_102887383 | 161 |
| 800 | 3300025934 | Ga0207686_10219212 | Ga0207686_102192122 | 161 |
| 801 | 3300025935 | Ga0207709_10315314 | Ga0207709_103153142 | 161 |
| 802 | 3300025935 | Ga0207709_10425524 | Ga0207709_104255242 | 161 |
| 803 | 3300025936 | Ga0207670_10000771 | Ga0207670_1000077113 | 161 |
| 804 | 3300025936 | Ga0207670_10094530 | Ga0207670_100945303 | 161 |
| 805 | 3300025936 | Ga0207670_11617094 | Ga0207670_116170941 | 161 |
| 806 | 3300025937 | Ga0207669_10026671 | Ga0207669_100266712 | 161 |
| 807 | 3300025937 | Ga0207669_10388733 | Ga0207669_103887331 | 161 |
| 808 | 3300025938 | Ga0207704_10159611 | Ga0207704_101596112 | 161 |
| 809 | 3300025938 | Ga0207704_10252233 | Ga0207704_102522331 | 161 |
| 810 | 3300025940 | Ga0207691_10016017 | Ga0207691_100160173 | 161 |
| 811 | 3300025940 | Ga0207691_10084819 | Ga0207691_100848193 | 161 |
| 812 | 3300025945 | Ga0207679_10506425 | Ga0207679_105064251 | 161 |
| 813 | 3300025960 | Ga0207651_10129428 | Ga0207651_101294282 | 161 |
| 814 | 3300025961 | Ga0207712_10002158 | Ga0207712_100021587 | 161 |
| 815 | 3300025961 | Ga0207712_11447448 | Ga0207712_114474482 | 161 |
| 816 | 3300025972 | Ga0207668_10015442 | Ga0207668_100154425 | 161 |
| 817 | 3300025986 | Ga0207658_10529611 | Ga0207658_105296111 | 161 |
| 818 | 3300026035 | Ga0207703_10016307 | Ga0207703_100163072 | 161 |
| 819 | 3300026035 | Ga0207703_10130334 | Ga0207703_101303342 | 161 |
| 820 | 3300026075 | Ga0207708_10282495 | Ga0207708_102824952 | 161 |
| 821 | 3300026088 | Ga0207641_10034240 | Ga0207641_100342402 | 161 |
| 822 | 3300026089 | Ga0207648_10000478 | Ga0207648_1000047815 | 161 |
| 823 | 3300026095 | Ga0207676_10096075 | Ga0207676_100960752 | 161 |
| 824 | 3300026095 | Ga0207676_10181705 | Ga0207676_101817052 | 161 |
| 825 | 3300026116 | Ga0207674_10030393 | Ga0207674_100303937 | 161 |
| 826 | 3300026118 | Ga0207675_100042169 | Ga0207675_1000421694 | 161 |
| 827 | 3300026118 | Ga0207675_101550534 | Ga0207675_1015505341 | 161 |
| 828 | 3300026142 | Ga0207698_11401396 | Ga0207698_114013962 | 161 |
| 829 | 3300027907 | Ga0207428_10002496 | Ga0207428_100024964 | 161 |
| 830 | 3300028380 | Ga0268265_10000663 | Ga0268265_1000066314 | 161 |
| 831 | 3300028381 | Ga0268264_10002304 | Ga0268264_100023045 | 161 |
| 832 | 3300035088 | Ga0373940_0002992 | Ga0373940_0002992_1105_1614 | 161 |
| 833 | 3300035090 | Ga0373949_0055552 | Ga0373949_0055552_258_767 | 161 |
| 834 | 3300035114 | Ga0373939_0024150 | Ga0373939_0024150_950_1459 | 161 |
| 835 | 3300035115 | Ga0373941_0048891 | Ga0373941_0048891_804_1313 | 161 |
| 836 | 3300035207 | Ga0373942_0072128 | Ga0373942_0072128_89_598 | 161 |
| 837 | 3300035241 | Ga0373961_0020712 | Ga0373961_0020712_1000_1509 | 161 |
| 838 | 3300035242 | Ga0373962_0055517 | Ga0373962_0055517_379_888 | 161 |
| 839 | 3300035691 | Ga0373931_0092161 | Ga0373931_0092161_1123_1632 | 161 |
| 840 | 3300037068 | Ga0373925_0189173 | Ga0373925_0189173_479_988 | 161 |
| 841 | 3300042436 | Ga0439435_0014123 | Ga0439435_0014123_825_1319 | 161 |
| 842 | 3300045051 | Ga0451576_0202524 | Ga0451576_0202524_322_831 | 161 |
| 843 | 3300045051 | Ga0451576_0388994 | Ga0451576_0388994_602_1111 | 161 |
| 844 | 3300045051 | Ga0451576_0460866 | Ga0451576_0460866_594_1103 | 161 |
| 845 | 3300045051 | Ga0451576_2040148 | Ga0451576_2040148_30_539 | 161 |
| 846 | 3300046472 | Ga0495580_0123404 | Ga0495580_0123404_706_1215 | 161 |
| 847 | 3300046473 | Ga0495582_0265669 | Ga0495582_0265669_454_963 | 161 |
| 848 | 3300046499 | Ga0495594_0023223 | Ga0495594_0023223_2079_2588 | 161 |
| 849 | 3300046528 | Ga0495642_0165177 | Ga0495642_0165177_20_529 | 161 |
| 850 | 3300046535 | Ga0495586_0157726 | Ga0495586_0157726_38_547 | 161 |
| 851 | 3300046539 | Ga0495621_0008177 | Ga0495621_0008177_331_837 | 161 |
| 852 | 3300046539 | Ga0495621_0008551 | Ga0495621_0008551_2072_2581 | 161 |
| 853 | 3300046539 | Ga0495621_0092616 | Ga0495621_0092616_370_900 | 161 |
| 854 | 3300046664 | Ga0495659_0028743 | Ga0495659_0028743_1137_1658 | 161 |
| 855 | 3300046674 | Ga0495588_0008624 | Ga0495588_0008624_3309_3818 | 161 |
| 856 | 3300046683 | Ga0495658_0100149 | Ga0495658_0100149_1177_1686 | 161 |
| 857 | 3300047318 | Ga0495636_0157113 | Ga0495636_0157113_235_732 | 161 |
| 858 | 3300047320 | Ga0495672_0076098 | Ga0495672_0076098_1374_1871 | 161 |
| 859 | 3300047321 | Ga0495676_0395344 | Ga0495676_0395344_396_905 | 161 |
| 860 | 3300047445 | Ga0495677_0073081 | Ga0495677_0073081_729_1238 | 161 |
| 861 | 3300049568 | Ga0501031_0091725 | Ga0501031_0091725_308_823 | 161 |
| 862 | 3300049568 | Ga0501031_0308398 | Ga0501031_0308398_58_573 | 161 |
| 863 | 3300049569 | Ga0501032_0005818 | Ga0501032_0005818_7948_8463 | 161 |
| 864 | 3300049569 | Ga0501032_0008491 | Ga0501032_0008491_2062_2577 | 161 |
| 865 | 3300049570 | Ga0501033_0918010 | Ga0501033_0918010_42_557 | 161 |
| 866 | 3300049571 | Ga0501034_0001243 | Ga0501034_0001243_24858_25373 | 161 |
| 867 | 3300049571 | Ga0501034_0026502 | Ga0501034_0026502_105_620 | 161 |
| 868 | 3300049571 | Ga0501034_0442924 | Ga0501034_0442924_656_1171 | 161 |
| 869 | 3300049572 | Ga0501036_0005033 | Ga0501036_0005033_4409_4924 | 161 |
| 870 | 3300049572 | Ga0501036_0105328 | Ga0501036_0105328_693_1208 | 161 |
| 871 | 3300049574 | Ga0501038_0013231 | Ga0501038_0013231_4425_4940 | 161 |
| 872 | 3300049574 | Ga0501038_0057399 | Ga0501038_0057399_2066_2581 | 161 |
| 873 | 3300049575 | Ga0501039_0012793 | Ga0501039_0012793_2509_3024 | 161 |
| 874 | 3300049575 | Ga0501039_0016198 | Ga0501039_0016198_1308_1823 | 161 |
| 875 | 3300049578 | Ga0501042_0457112 | Ga0501042_0457112_162_656 | 161 |
| 876 | 3300049579 | Ga0501043_0187706 | Ga0501043_0187706_670_1185 | 161 |
| 877 | 3300049579 | Ga0501043_0485531 | Ga0501043_0485531_232_747 | 161 |
| 878 | 3300049580 | Ga0501046_0001245 | Ga0501046_0001245_23839_24354 | 161 |
| 879 | 3300049581 | Ga0501047_0018586 | Ga0501047_0018586_5377_5892 | 161 |
| 880 | 3300049581 | Ga0501047_0065211 | Ga0501047_0065211_799_1314 | 161 |
| 881 | 3300049582 | Ga0501048_0089418 | Ga0501048_0089418_20_535 | 161 |
| 882 | 3300049583 | Ga0501067_0081628 | Ga0501067_0081628_299_808 | 161 |
| 883 | 3300049583 | Ga0501067_0201164 | Ga0501067_0201164_10_525 | 161 |
| 884 | 3300049584 | Ga0501068_0109988 | Ga0501068_0109988_865_1374 | 161 |
| 885 | 3300049584 | Ga0501068_0149271 | Ga0501068_0149271_347_862 | 161 |
| 886 | 3300049585 | Ga0501069_0029834 | Ga0501069_0029834_2317_2832 | 161 |
| 887 | 3300049589 | Ga0501073_0040918 | Ga0501073_0040918_1787_2302 | 161 |
| 888 | 3300049742 | Ga0501080_0002574 | Ga0501080_0002574_7275_7790 | 161 |
| 889 | 3300049742 | Ga0501080_0057869 | Ga0501080_0057869_2510_3025 | 161 |
| 890 | 3300049822 | Ga0501035_0096190 | Ga0501035_0096190_554_1069 | 161 |
| 891 | 3300049823 | Ga0501044_0037786 | Ga0501044_0037786_840_1355 | 161 |
| 892 | 3300049823 | Ga0501044_1327420 | Ga0501044_1327420_13_528 | 161 |
| 893 | 3300050507 | nmdc:mga05p37_14640_c1 | nmdc:mga05p37_14640_c1_2316_2825 | 161 |
| 894 | 3300050508 | nmdc:mga09592_881781_c1 | nmdc:mga09592_881781_c1_215_724 | 161 |
| 895 | 3300050511 | nmdc:mga08y16_265700_c1 | nmdc:mga08y16_265700_c1_58_555 | 161 |
| 896 | 3300050511 | nmdc:mga08y16_273209_c1 | nmdc:mga08y16_273209_c1_414_923 | 161 |
| 897 | 3300050511 | nmdc:mga08y16_508_c1 | nmdc:mga08y16_508_c1_4502_5011 | 161 |
| 898 | 3300050512 | nmdc:mga0n895_1016429_c1 | nmdc:mga0n895_1016429_c1_216_722 | 161 |
| 899 | 3300050512 | nmdc:mga0n895_179851_c1 | nmdc:mga0n895_179851_c1_1587_2096 | 161 |
| 900 | 3300050512 | nmdc:mga0n895_401194_c1 | nmdc:mga0n895_401194_c1_842_1351 | 161 |
| 901 | 3300050513 | nmdc:mga0rr50_238511_c1 | nmdc:mga0rr50_238511_c1_406_915 | 161 |
| 902 | 3300050515 | nmdc:mga0a205_115024_c1 | nmdc:mga0a205_115024_c1_1342_1848 | 161 |
| 903 | 3300050515 | nmdc:mga0a205_226729_c1 | nmdc:mga0a205_226729_c1_481_990 | 161 |
| 904 | 3300050515 | nmdc:mga0a205_38247_c1 | nmdc:mga0a205_38247_c1_1515_2024 | 161 |
| 905 | 3300053093 | Ga0500651_0380457 | Ga0500651_0380457_74_598 | 161 |
| 906 | 3300053103 | Ga0500555_000149 | Ga0500555_000149_17285_17809 | 161 |
| 907 | 3300053153 | Ga0500616_0000926 | Ga0500616_0000926_17832_18392 | 161 |
| 908 | 3300053730 | Ga0500645_000610 | Ga0500645_000610_22334_22858 | 161 |
| 909 | 3300053736 | Ga0500599_009884 | Ga0500599_009884_626_1150 | 161 |
| 910 | 3300054114 | Ga0501084_0143910 | Ga0501084_0143910_333_848 | 161 |
| 911 | 3300060353 | Ga0501082_0018151 | Ga0501082_0018151_5055_5570 | 161 |
| 912 | 3300060353 | Ga0501082_0044691 | Ga0501082_0044691_3030_3545 | 161 |
| 913 | 3300003203 | JGI25406J46586_10004911 | JGI25406J46586_100049112 | 162 |
| 914 | 3300005295 | Ga0065707_10238888 | Ga0065707_102388882 | 162 |
| 915 | 3300005440 | Ga0070705_100419195 | Ga0070705_1004191952 | 162 |
| 916 | 3300005543 | Ga0070672_101223994 | Ga0070672_1012239941 | 162 |
| 917 | 3300005719 | Ga0068861_100987446 | Ga0068861_1009874462 | 162 |
| 918 | 3300005843 | Ga0068860_101136943 | Ga0068860_1011369432 | 162 |
| 919 | 3300005985 | Ga0081539_10001447 | Ga0081539_100014475 | 162 |
| 920 | 3300005985 | Ga0081539_10001460 | Ga0081539_1000146031 | 162 |
| 921 | 3300009094 | Ga0111539_10040437 | Ga0111539_100404375 | 162 |
| 922 | 3300046683 | Ga0495658_0033080 | Ga0495658_0033080_507_1007 | 162 |
| 923 | 3300050511 | nmdc:mga08y16_34591_c1 | nmdc:mga08y16_34591_c1_4779_5267 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.981 | 1 | 150 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9628 | 1 | 149 |
| 4c7y-assembly1.cif.gz_A | aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide | 0.9585 | 1 | 149 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9566 | 1 | 150 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9559 | 1 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9822 | 1 | 73 | 3.10.20.30 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9808 | 1 | 75 | 3.10.20.30 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9626 | 1 | 75 | 3.10.20.30 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9607 | 1 | 75 | 3.10.20.30 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9511 | 83 | 150 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5QJI1-F1-model_v4 | (2Fe-2S)-binding protein | 0.9949 | 1 | 149 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7X0JUW7-F1-model_v4 | Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) | 0.9947 | 1 | 149 |
GO:0046872
GO:0047121 GO:0051537 |
| AF-A0A349TGJ4-F1-model_v4 | (2Fe-2S)-binding protein | 0.9942 | 1 | 141 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7V9BKS3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9939 | 1 | 149 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-Q089K2-F1-model_v4 | (2Fe-2S)-binding domain protein | 0.9936 | 3 | 149 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar