F485869
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 924 | 733 | 408 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0042498|Ga0501035_0042498_2541_3419 |
| Length | 292 |
| Sequence | MSKDEKSGGSDRDKHYATLRRAHRDQKRERGEIPTPSPKDRRKTRAEDWKAPQLAPEQVFLYGLHTVRAALDNKQRQLIRLSATLNALQRLEIDEANPPCPLVIVTPQEIEKFVGPEAIHQGVMLETRPLPVRRLEALKDSPLVLVLDQVTDPHNVGAIMRSAVAFGAGAVITTQRHSPTESGVLAKSASGALELIPYIQITNLADALAELRKLGFFSIGLDSEGPAELEKTFSGDKIALVMGNEGKGLRQKTRETVSALARLDMPGKIKSLNVSNAAAIALYASRQFLARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 5 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 6 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 7 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 8 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 9 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 10 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 11 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 12 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 13 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 14 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 15 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 16 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 17 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 18 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 19 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 20 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 21 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 22 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 23 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 24 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 25 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 26 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 27 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 28 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 29 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 30 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 31 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 32 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 33 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 34 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 35 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 36 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 37 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 38 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 39 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 40 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 41 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 42 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 43 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 44 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 45 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 46 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 47 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 48 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 49 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 50 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 51 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 52 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 53 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 54 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 55 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 56 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 57 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 58 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 59 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 60 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 61 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 62 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 63 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 64 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 65 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 66 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 67 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 68 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 69 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 70 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 71 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 72 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 73 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 74 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 75 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 76 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 77 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 78 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 79 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 80 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 81 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 82 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 83 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 84 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 85 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 86 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 87 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 88 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 89 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 90 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 91 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 92 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 93 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 94 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 95 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 96 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 97 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 98 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 99 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 100 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 101 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 102 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 103 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 104 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 105 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 106 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 107 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 108 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 109 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 110 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 111 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 112 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 113 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 114 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 115 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 116 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 117 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 118 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 119 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 120 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 121 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 122 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 123 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 124 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 125 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 126 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 127 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 128 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 129 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 130 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 131 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 132 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 133 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 134 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 135 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 136 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 137 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 138 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 139 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 140 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 141 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 142 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 143 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 144 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 145 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 146 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 147 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 148 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 149 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 150 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 151 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 152 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 153 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 154 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 155 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 156 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 157 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 158 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 159 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 160 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 161 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 162 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 163 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 164 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 165 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 166 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 167 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 168 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 169 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 170 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 171 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 172 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 173 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 174 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 175 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 176 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 177 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 178 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 179 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 180 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 181 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 182 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 183 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 184 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 185 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 186 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 187 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 188 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 189 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 190 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 191 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 192 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 193 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 194 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 195 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 196 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 197 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 198 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 199 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 200 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 201 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 202 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 203 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 204 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 205 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 206 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 207 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 208 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 209 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 210 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 211 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 212 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 213 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 214 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 215 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 216 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 217 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 218 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 219 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 220 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 221 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 222 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 223 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 224 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 225 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 226 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 227 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 228 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 229 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 230 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 231 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 232 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 233 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 234 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 235 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 236 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 237 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 238 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 239 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 240 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 241 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 242 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 243 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 244 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 245 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 246 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 247 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 248 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 249 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 250 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 251 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 252 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 253 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 254 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 255 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 256 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 257 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 258 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 259 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 260 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 261 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 262 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 263 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 264 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 265 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 266 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 267 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 268 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 269 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 270 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 271 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 272 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 273 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 274 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 275 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 276 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 277 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 278 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 279 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 280 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 281 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 282 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 283 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 284 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 285 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 286 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 287 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 288 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 289 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 290 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 291 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 292 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 293 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 294 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 295 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 296 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 297 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 298 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 299 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 300 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 301 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 302 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 303 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 304 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 305 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 306 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 307 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 308 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 309 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 310 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 311 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 312 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 313 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 314 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 315 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 316 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 317 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 318 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 319 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 320 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 321 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 322 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 323 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 324 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 325 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 326 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 327 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 328 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 329 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 330 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 331 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 332 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 333 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 334 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 335 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 336 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 337 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 338 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 339 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 340 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 341 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 342 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 343 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 344 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 345 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 346 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 347 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 348 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 349 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 350 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 351 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 352 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 353 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 354 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 355 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 356 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 357 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 358 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 359 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 360 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 361 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 362 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 363 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 364 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 365 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 366 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 367 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 368 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 369 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 370 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 371 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 372 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 373 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 374 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 375 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 376 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 377 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 378 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 379 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 380 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 381 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 382 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 383 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 384 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 385 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 386 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 387 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 388 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 389 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 390 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 391 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 392 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 393 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 394 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 395 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 396 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 397 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 398 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 399 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 400 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 401 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 402 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 403 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 404 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 405 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 406 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 407 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 408 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 409 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 410 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 411 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 412 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 413 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 414 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 415 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 416 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 417 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 418 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 419 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 420 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 421 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 422 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 423 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 424 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 425 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 426 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 427 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 428 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 429 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 430 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 431 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 432 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 433 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 434 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 435 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 436 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 437 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 438 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 439 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 440 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 441 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 442 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 443 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 444 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 445 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 446 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 447 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 448 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 449 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 450 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 451 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 452 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 453 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 454 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 455 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 456 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 457 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 458 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 459 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 460 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 461 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 462 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 463 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 464 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 465 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 466 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 467 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 468 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 469 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 470 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 471 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 472 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 473 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 474 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 475 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 476 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 477 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 478 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 479 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 480 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 481 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 482 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 483 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 484 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 485 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 486 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 487 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 488 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 489 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 490 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 491 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 492 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 493 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 494 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 495 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 496 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 497 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 498 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 499 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 500 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 501 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 502 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 503 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 504 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 505 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 506 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 507 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 508 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 509 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 510 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 511 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 512 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 513 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 514 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 515 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 516 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 517 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 518 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 519 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 520 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 521 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 522 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 523 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 524 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 525 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 526 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 527 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 528 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 529 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 530 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 531 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 532 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 533 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 534 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 535 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 536 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 537 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 538 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 539 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 540 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 541 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 542 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 543 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 544 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 545 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 546 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 547 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 548 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 549 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 550 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 551 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 552 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 553 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 554 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 555 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 566 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 568 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 569 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 571 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 572 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 573 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 574 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 575 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 576 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 577 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 578 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 579 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 580 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 581 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 582 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 583 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 584 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 585 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 586 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 587 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 588 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 589 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 590 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 591 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 592 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 593 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 594 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 595 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 596 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 631 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 632 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 633 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 634 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 635 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 636 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 637 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 638 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 639 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 640 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 641 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 642 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 643 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 644 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 645 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 646 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 647 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 648 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 649 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 651 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 652 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 653 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 654 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 656 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 657 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 658 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 659 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 660 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 661 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 662 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 663 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 664 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 665 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 666 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 667 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 668 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 669 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 670 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 671 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 672 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 673 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 674 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 675 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 676 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 677 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 678 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 679 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 680 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 681 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 682 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 683 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 684 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 685 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 686 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 687 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 688 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 689 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 690 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 691 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 692 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 693 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 694 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 695 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 696 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 697 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 698 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 699 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 700 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 701 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 702 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 703 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 704 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 705 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 706 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 707 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 708 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 709 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 710 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 711 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 712 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 713 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 714 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 715 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 716 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 717 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 718 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 719 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 720 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 721 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 722 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 723 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 724 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 725 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 726 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 727 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 728 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 729 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 730 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 731 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 732 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 733 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 44.16 |
| Metatranscriptomes | 0 |
| Isolates | 55.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.54 |
| Bulb | 0 |
| Endosphere | 19.48 |
| Nodule | 45.35 |
| Rhizoplane | 1.41 |
| Rhizosphere | 16.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000019 | 3300002704 | Bacteria | 155636 |
| 2 | JGI25156J39149_1000020 | 3300002705 | Bacteria | 156628 |
| 3 | JGI25162J39368_1001894 | 3300002737 | Bacteria | 9602 |
| 4 | JGI25162J39368_1002010 | 3300002737 | Bacteria | 9034 |
| 5 | JGI25154J39366_1000355 | 3300002738 | Bacteria | 26026 |
| 6 | JGI25157J39369_1000129 | 3300002741 | Bacteria | 63620 |
| 7 | JGI25152J39213_1002523 | 3300002773 | Bacteria | 6907 |
| 8 | JGI25152J39213_1003647 | 3300002773 | Bacteria | 5186 |
| 9 | JGI25152J39213_1008753 | 3300002773 | Bacteria | 2477 |
| 10 | JGI25152J39213_1012472 | 3300002773 | Bacteria | 1822 |
| 11 | JGI25150J39212_1000153 | 3300002774 | Bacteria | 39087 |
| 12 | JGI25150J39212_1002615 | 3300002774 | Bacteria | 4427 |
| 13 | JGI25159J45721_1000002 | 3300002987 | Bacteria | 289163 |
| 14 | JGI25159J45721_1003547 | 3300002987 | Bacteria | 5480 |
| 15 | JGI25159J45721_1005935 | 3300002987 | Bacteria | 3746 |
| 16 | JGI25151J46595_10000108 | 3300003187 | Bacteria | 112874 |
| 17 | JGI25151J46595_10004679 | 3300003187 | Bacteria | 7197 |
| 18 | JGI25151J46595_10005084 | 3300003187 | Bacteria | 6838 |
| 19 | JGI25151J46595_10008103 | 3300003187 | Bacteria | 5089 |
| 20 | JGI25151J46595_10033779 | 3300003187 | Bacteria | 1964 |
| 21 | JGI25165J46597_1001808 | 3300003214 | Bacteria | 9034 |
| 22 | JGI25165J46597_1002226 | 3300003214 | Bacteria | 6784 |
| 23 | JGI25165J46597_1006328 | 3300003214 | Bacteria | 2111 |
| 24 | JGI25153J46596_10003463 | 3300003215 | Bacteria | 8838 |
| 25 | JGI25153J46596_10006470 | 3300003215 | Bacteria | 5913 |
| 26 | JGI25153J46596_10007593 | 3300003215 | Bacteria | 5304 |
| 27 | JGI25153J46596_10016965 | 3300003215 | Bacteria | 2889 |
| 28 | rootH2_10064249 | 3300003320 | Bacteria | 2074 |
| 29 | rootL2_10015680 | 3300003322 | Bacteria | 5379 |
| 30 | rootH1_10129292 | 3300003323 | Bacteria | 4106 |
| 31 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 32 | JGI25160J50197_1003935 | 3300003354 | Bacteria | 6499 |
| 33 | JGI25161J50226_1000014 | 3300003374 | Bacteria | 191109 |
| 34 | JGI25161J50226_1000839 | 3300003374 | Bacteria | 11452 |
| 35 | JGI25161J50226_1000986 | 3300003374 | Bacteria | 10033 |
| 36 | JGI25161J50226_1006713 | 3300003374 | Bacteria | 2041 |
| 37 | Ga0055526_1002661 | 3300003771 | Bacteria | 11927 |
| 38 | Ga0055524_1001683 | 3300003775 | Bacteria | 12306 |
| 39 | Ga0055524_1007422 | 3300003775 | Bacteria | 4656 |
| 40 | Ga0055524_1016863 | 3300003775 | Bacteria | 2597 |
| 41 | Ga0055536_1001156 | 3300003781 | Bacteria | 16517 |
| 42 | Ga0055528_1004080 | 3300003790 | Bacteria | 7130 |
| 43 | Ga0055528_1004197 | 3300003790 | Bacteria | 6999 |
| 44 | Ga0055528_1006267 | 3300003790 | Bacteria | 5410 |
| 45 | Ga0055528_1016805 | 3300003790 | Bacteria | 2566 |
| 46 | Ga0055528_1017972 | 3300003790 | Bacteria | 2421 |
| 47 | Ga0055530_10012989 | 3300003791 | Bacteria | 2868 |
| 48 | Ga0055540_1003094 | 3300003792 | Bacteria | 8269 |
| 49 | Ga0055540_1003655 | 3300003792 | Bacteria | 7324 |
| 50 | Ga0055540_1038030 | 3300003792 | Bacteria | 1057 |
| 51 | Ga0058692_1002661 | 3300003856 | Bacteria | 5880 |
| 52 | Ga0058692_1004925 | 3300003856 | Bacteria | 3879 |
| 53 | Ga0055543_1000027 | 3300004625 | Bacteria | 136033 |
| 54 | Ga0055543_1000109 | 3300004625 | Bacteria | 71370 |
| 55 | Ga0055543_1000193 | 3300004625 | Bacteria | 50071 |
| 56 | Ga0055543_1004741 | 3300004625 | Bacteria | 3630 |
| 57 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 58 | Ga0065165_1000915 | 3300005262 | Bacteria | 38053 |
| 59 | Ga0065165_1004124 | 3300005262 | Bacteria | 9338 |
| 60 | Ga0065165_1019249 | 3300005262 | Bacteria | 2445 |
| 61 | Ga0065165_1021974 | 3300005262 | Bacteria | 2201 |
| 62 | Ga0070670_100012947 | 3300005331 | Bacteria | 7141 |
| 63 | Ga0070668_100181647 | 3300005347 | Bacteria | 1719 |
| 64 | Ga0070668_100202824 | 3300005347 | Bacteria | 1629 |
| 65 | Ga0070671_100038063 | 3300005355 | Bacteria | 3992 |
| 66 | Ga0070667_100234492 | 3300005367 | Bacteria | 1637 |
| 67 | Ga0070662_100086648 | 3300005457 | Bacteria | 2343 |
| 68 | Ga0070685_10147333 | 3300005466 | Bacteria | 1489 |
| 69 | Ga0070665_100032328 | 3300005548 | Bacteria | 5267 |
| 70 | Ga0068855_100180241 | 3300005563 | Bacteria | 2389 |
| 71 | Ga0068851_10018396 | 3300005834 | Bacteria | 3365 |
| 72 | Ga0075365_10028260 | 3300006038 | Bacteria | 3576 |
| 73 | Ga0075365_10094626 | 3300006038 | Bacteria | 2039 |
| 74 | Ga0075368_10002087 | 3300006042 | Bacteria | 6452 |
| 75 | Ga0075363_100114733 | 3300006048 | Bacteria | 1500 |
| 76 | Ga0075363_100145860 | 3300006048 | Bacteria | 1334 |
| 77 | Ga0075362_10004901 | 3300006177 | Bacteria | 4843 |
| 78 | Ga0075367_10005429 | 3300006178 | Bacteria | 6329 |
| 79 | Ga0075367_10061958 | 3300006178 | Bacteria | 2233 |
| 80 | Ga0075367_10108192 | 3300006178 | Bacteria | 1704 |
| 81 | Ga0075367_10221576 | 3300006178 | Bacteria | 1184 |
| 82 | Ga0075369_10018710 | 3300006186 | Bacteria | 2822 |
| 83 | Ga0075369_10082166 | 3300006186 | Bacteria | 1430 |
| 84 | Ga0075366_10091007 | 3300006195 | Bacteria | 1827 |
| 85 | Ga0075370_10012045 | 3300006353 | Bacteria | 4560 |
| 86 | Ga0079104_1001945 | 3300006946 | Bacteria | 12272 |
| 87 | Ga0079104_1024882 | 3300006946 | Bacteria | 1571 |
| 88 | Ga0099826_10000098 | 3300006948 | Bacteria | 41270 |
| 89 | Ga0105244_10041955 | 3300009036 | Bacteria | 2369 |
| 90 | Ga0105240_10004701 | 3300009093 | Bacteria | 20645 |
| 91 | Ga0105243_10052642 | 3300009148 | Bacteria | 3225 |
| 92 | Ga0105248_10322768 | 3300009177 | Bacteria | 1739 |
| 93 | Ga0105237_10002935 | 3300009545 | Bacteria | 20647 |
| 94 | Ga0105249_10084573 | 3300009553 | Bacteria | 2955 |
| 95 | Ga0123342_1041008 | 3300009766 | Bacteria | 1692 |
| 96 | Ga0157322_1000552 | 3300012490 | Bacteria | 1461 |
| 97 | Ga0157371_10001437 | 3300013102 | Bacteria | 24739 |
| 98 | Ga0157370_10000351 | 3300013104 | Bacteria | 58496 |
| 99 | Ga0157370_10007253 | 3300013104 | Bacteria | 12095 |
| 100 | Ga0171463_1011 | 3300013249 | Bacteria | 230603 |
| 101 | Ga0157372_10655200 | 3300013307 | Bacteria | 1223 |
| 102 | Ga0182005_1008917 | 3300015265 | Bacteria | 2941 |
| 103 | Ga0183363_1362 | 3300015690 | Bacteria | 4965 |
| 104 | Ga0214544_1022053 | 3300021320 | Bacteria | 3963 |
| 105 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 106 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 107 | Ga0214543_1022635 | 3300021327 | Bacteria | 4398 |
| 108 | Ga0228711_1000015 | 3300022739 | Bacteria | 126974 |
| 109 | Ga0228710_1000015 | 3300022740 | Bacteria | 133640 |
| 110 | Ga0209435_100024 | 3300025206 | Bacteria | 199665 |
| 111 | Ga0209436_100075 | 3300025208 | Bacteria | 50427 |
| 112 | Ga0209436_109891 | 3300025208 | Bacteria | 1780 |
| 113 | Ga0209436_111918 | 3300025208 | Bacteria | 1501 |
| 114 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 115 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 116 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 117 | Ga0207425_1019089 | 3300025245 | Bacteria | 1481 |
| 118 | Ga0209646_1000064 | 3300025246 | Bacteria | 246524 |
| 119 | Ga0209026_1000053 | 3300025250 | Bacteria | 246524 |
| 120 | Ga0209677_101074 | 3300025253 | Bacteria | 12915 |
| 121 | Ga0209759_1000042 | 3300025256 | Bacteria | 246524 |
| 122 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 123 | Ga0209129_1000285 | 3300025258 | Bacteria | 48259 |
| 124 | Ga0209129_1003123 | 3300025258 | Bacteria | 7436 |
| 125 | Ga0209129_1004233 | 3300025258 | Bacteria | 5747 |
| 126 | Ga0209129_1007223 | 3300025258 | Bacteria | 3360 |
| 127 | Ga0209233_1000262 | 3300025261 | Bacteria | 79485 |
| 128 | Ga0209233_1000277 | 3300025261 | Bacteria | 72470 |
| 129 | Ga0209233_1001047 | 3300025261 | Bacteria | 11598 |
| 130 | Ga0209455_1014930 | 3300025272 | Bacteria | 1732 |
| 131 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 132 | Ga0209673_1001438 | 3300025273 | Bacteria | 22641 |
| 133 | Ga0209673_1001549 | 3300025273 | Bacteria | 20760 |
| 134 | Ga0209673_1003714 | 3300025273 | Bacteria | 8743 |
| 135 | Ga0209673_1004785 | 3300025273 | Bacteria | 7110 |
| 136 | Ga0209673_1039255 | 3300025273 | Bacteria | 1369 |
| 137 | Ga0209673_1043499 | 3300025273 | Bacteria | 1253 |
| 138 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 139 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 140 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 141 | Ga0209676_1001917 | 3300025292 | Bacteria | 16836 |
| 142 | Ga0209676_1044033 | 3300025292 | Bacteria | 1227 |
| 143 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 144 | Ga0209025_1000303 | 3300025294 | Bacteria | 110086 |
| 145 | Ga0209025_1000361 | 3300025294 | Bacteria | 97060 |
| 146 | Ga0209025_1000405 | 3300025294 | Bacteria | 87670 |
| 147 | Ga0209025_1000440 | 3300025294 | Bacteria | 81964 |
| 148 | Ga0209025_1004972 | 3300025294 | Bacteria | 11123 |
| 149 | Ga0209025_1015852 | 3300025294 | Bacteria | 4501 |
| 150 | Ga0209025_1049232 | 3300025294 | Bacteria | 1698 |
| 151 | Ga0209025_1063087 | 3300025294 | Bacteria | 1370 |
| 152 | Ga0209564_1000296 | 3300025295 | Bacteria | 100151 |
| 153 | Ga0209564_1000640 | 3300025295 | Bacteria | 53056 |
| 154 | Ga0209564_1000652 | 3300025295 | Bacteria | 51925 |
| 155 | Ga0209564_1001439 | 3300025295 | Bacteria | 24403 |
| 156 | Ga0209564_1005795 | 3300025295 | Bacteria | 6895 |
| 157 | Ga0209564_1016735 | 3300025295 | Bacteria | 2898 |
| 158 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 159 | Ga0209758_1000717 | 3300025297 | Bacteria | 48915 |
| 160 | Ga0209758_1002836 | 3300025297 | Bacteria | 16844 |
| 161 | Ga0209758_1004957 | 3300025297 | Bacteria | 10663 |
| 162 | Ga0209758_1006242 | 3300025297 | Bacteria | 8684 |
| 163 | Ga0209758_1019478 | 3300025297 | Bacteria | 3269 |
| 164 | Ga0209758_1029025 | 3300025297 | Bacteria | 2325 |
| 165 | Ga0209050_1017392 | 3300025298 | Bacteria | 2870 |
| 166 | Ga0209256_1003048 | 3300025299 | Bacteria | 12347 |
| 167 | Ga0209256_1004700 | 3300025299 | Bacteria | 8370 |
| 168 | Ga0209256_1005851 | 3300025299 | Bacteria | 6829 |
| 169 | Ga0209256_1011473 | 3300025299 | Bacteria | 3536 |
| 170 | Ga0209256_1014956 | 3300025299 | Bacteria | 2747 |
| 171 | Ga0209256_1018331 | 3300025299 | Bacteria | 2280 |
| 172 | Ga0209256_1023508 | 3300025299 | Bacteria | 1836 |
| 173 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 174 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 175 | Ga0207426_1000119 | 3300025302 | Bacteria | 221800 |
| 176 | Ga0207426_1000231 | 3300025302 | Bacteria | 128171 |
| 177 | Ga0207426_1011540 | 3300025302 | Bacteria | 3359 |
| 178 | Ga0209051_1002625 | 3300025303 | Bacteria | 12623 |
| 179 | Ga0209051_1003932 | 3300025303 | Bacteria | 9468 |
| 180 | Ga0209051_1021865 | 3300025303 | Bacteria | 2707 |
| 181 | Ga0209051_1021924 | 3300025303 | Bacteria | 2702 |
| 182 | Ga0209051_1032838 | 3300025303 | Bacteria | 1973 |
| 183 | Ga0209051_1039419 | 3300025303 | Bacteria | 1706 |
| 184 | Ga0209051_1062919 | 3300025303 | Bacteria | 1158 |
| 185 | Ga0209257_1000817 | 3300025304 | Bacteria | 45150 |
| 186 | Ga0209257_1005720 | 3300025304 | Bacteria | 8530 |
| 187 | Ga0207647_10240430 | 3300025904 | Bacteria | 1040 |
| 188 | Ga0207695_10003914 | 3300025913 | Bacteria | 20605 |
| 189 | Ga0207671_10012250 | 3300025914 | Bacteria | 6909 |
| 190 | Ga0207650_10060240 | 3300025925 | Bacteria | 2833 |
| 191 | Ga0207644_10048176 | 3300025931 | Bacteria | 3045 |
| 192 | Ga0207706_10131423 | 3300025933 | Bacteria | 2202 |
| 193 | Ga0207709_10008294 | 3300025935 | Bacteria | 5755 |
| 194 | Ga0207711_10206609 | 3300025941 | Bacteria | 1793 |
| 195 | Ga0207667_10553377 | 3300025949 | Bacteria | 1163 |
| 196 | Ga0207712_10457396 | 3300025961 | Bacteria | 1084 |
| 197 | Ga0209281_1000339 | 3300027111 | Bacteria | 79862 |
| 198 | Ga0209281_1001295 | 3300027111 | Bacteria | 16021 |
| 199 | Ga0209371_1000328 | 3300027312 | Bacteria | 51735 |
| 200 | Ga0209371_1001894 | 3300027312 | Bacteria | 12827 |
| 201 | Ga0209282_1000054 | 3300027666 | Bacteria | 101427 |
| 202 | Ga0209282_1000147 | 3300027666 | Bacteria | 41275 |
| 203 | Ga0209813_10004171 | 3300027866 | Bacteria | 3434 |
| 204 | Ga0268266_10083415 | 3300028379 | Bacteria | 2790 |
| 205 | Ga0307515_10001636 | 3300028794 | Bacteria | 49786 |
| 206 | Ga0307515_10001758 | 3300028794 | Bacteria | 48278 |
| 207 | Ga0307515_10061088 | 3300028794 | Bacteria | 5356 |
| 208 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 209 | Ga0268256_1004165 | 3300030500 | Bacteria | 6129 |
| 210 | Ga0316181_1156578 | 3300030744 | Bacteria | 3273 |
| 211 | Ga0307513_10006680 | 3300031456 | Bacteria | 15048 |
| 212 | Ga0307513_10124295 | 3300031456 | Bacteria | 2540 |
| 213 | Ga0307408_100072916 | 3300031548 | Bacteria | 2543 |
| 214 | Ga0307516_10129215 | 3300031730 | Bacteria | 2308 |
| 215 | Ga0307405_10050597 | 3300031731 | Bacteria | 2574 |
| 216 | Ga0307410_10261927 | 3300031852 | Bacteria | 1349 |
| 217 | Ga0307412_10008803 | 3300031911 | Bacteria | 5780 |
| 218 | Ga0315914_1000013 | 3300031967 | Bacteria | 133640 |
| 219 | Ga0315913_1000097 | 3300033430 | Bacteria | 51051 |
| 220 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 221 | Ga0373935_0238748 | 3300035692 | Bacteria | 1268 |
| 222 | Ga0373927_0000055 | 3300035695 | Bacteria | 81098 |
| 223 | Ga0373925_0055752 | 3300037068 | Bacteria | 2959 |
| 224 | Ga0395905_0000325 | 3300037471 | Bacteria | 68813 |
| 225 | Ga0395905_0010488 | 3300037471 | Bacteria | 9011 |
| 226 | Ga0395905_0013381 | 3300037471 | Bacteria | 7861 |
| 227 | Ga0439436_0049072 | 3300041404 | Bacteria | 1196 |
| 228 | Ga0439466_0065366 | 3300041411 | Bacteria | 1166 |
| 229 | Ga0439465_0036015 | 3300041413 | Bacteria | 1588 |
| 230 | Ga0439465_0047441 | 3300041413 | Bacteria | 1400 |
| 231 | Ga0451837_0324802 | 3300041494 | Bacteria | 2894 |
| 232 | Ga0451839_0811851 | 3300041496 | Bacteria | 4352 |
| 233 | Ga0451841_0621192 | 3300041498 | Bacteria | 1659 |
| 234 | Ga0451841_1210148 | 3300041498 | Bacteria | 1797 |
| 235 | Ga0451851_0025954 | 3300041507 | Bacteria | 3955 |
| 236 | Ga0451851_0839726 | 3300041507 | Bacteria | 1328 |
| 237 | Ga0451853_2406349 | 3300041512 | Bacteria | 2143 |
| 238 | Ga0439449_0009113 | 3300042007 | Bacteria | 3762 |
| 239 | Ga0439449_0017670 | 3300042007 | Bacteria | 2678 |
| 240 | Ga0466970_0006167 | 3300044765 | Bacteria | 5973 |
| 241 | Ga0495627_044109 | 3300046453 | Bacteria | 1362 |
| 242 | Ga0495629_0062690 | 3300046459 | Bacteria | 2596 |
| 243 | Ga0495638_0001063 | 3300046460 | Bacteria | 26811 |
| 244 | Ga0495638_0082458 | 3300046460 | Bacteria | 1950 |
| 245 | Ga0495638_0089858 | 3300046460 | Bacteria | 1852 |
| 246 | Ga0495650_0018078 | 3300046471 | Bacteria | 3515 |
| 247 | Ga0495605_0043145 | 3300046474 | Bacteria | 2237 |
| 248 | Ga0495662_0004497 | 3300046476 | Bacteria | 6995 |
| 249 | Ga0495585_0021779 | 3300046492 | Bacteria | 3680 |
| 250 | Ga0495585_0091614 | 3300046492 | Bacteria | 1636 |
| 251 | Ga0495607_0131150 | 3300046501 | Bacteria | 1304 |
| 252 | Ga0495607_0139652 | 3300046501 | Bacteria | 1251 |
| 253 | Ga0495583_0005892 | 3300046506 | Bacteria | 8160 |
| 254 | Ga0495583_0026515 | 3300046506 | Bacteria | 2871 |
| 255 | Ga0495583_0097686 | 3300046506 | Bacteria | 1257 |
| 256 | Ga0495606_0014273 | 3300046507 | Bacteria | 6212 |
| 257 | Ga0495606_0020058 | 3300046507 | Bacteria | 4943 |
| 258 | Ga0495606_0049109 | 3300046507 | Bacteria | 2770 |
| 259 | Ga0495610_0006312 | 3300046512 | Bacteria | 8202 |
| 260 | Ga0495610_0031663 | 3300046512 | Bacteria | 2756 |
| 261 | Ga0495610_0046380 | 3300046512 | Bacteria | 2144 |
| 262 | Ga0495616_0069025 | 3300046513 | Bacteria | 1715 |
| 263 | Ga0495616_0104691 | 3300046513 | Bacteria | 1322 |
| 264 | Ga0495620_0074437 | 3300046515 | Bacteria | 1383 |
| 265 | Ga0495631_0009977 | 3300046518 | Bacteria | 4721 |
| 266 | Ga0495632_0007495 | 3300046519 | Bacteria | 6842 |
| 267 | Ga0495643_0031311 | 3300046522 | Bacteria | 2961 |
| 268 | Ga0495643_0036191 | 3300046522 | Bacteria | 2713 |
| 269 | Ga0495643_0057513 | 3300046522 | Bacteria | 2072 |
| 270 | Ga0495648_0047141 | 3300046524 | Bacteria | 2666 |
| 271 | Ga0495609_0028041 | 3300046538 | Bacteria | 2571 |
| 272 | Ga0495597_0010356 | 3300046542 | Bacteria | 4560 |
| 273 | Ga0495622_0017513 | 3300046557 | Bacteria | 3336 |
| 274 | Ga0495633_0020432 | 3300046558 | Bacteria | 3330 |
| 275 | Ga0495668_0085723 | 3300046616 | Bacteria | 1727 |
| 276 | Ga0495625_0010082 | 3300046660 | Bacteria | 7852 |
| 277 | Ga0495625_0064647 | 3300046660 | Bacteria | 2580 |
| 278 | Ga0495588_0002878 | 3300046674 | Bacteria | 7414 |
| 279 | Ga0495657_0084509 | 3300046675 | Bacteria | 2047 |
| 280 | Ga0495647_0056346 | 3300046681 | Bacteria | 1541 |
| 281 | Ga0495671_0145312 | 3300046692 | Bacteria | 1155 |
| 282 | Ga0495649_0058104 | 3300046694 | Bacteria | 2085 |
| 283 | Ga0495660_0053967 | 3300046810 | Bacteria | 2179 |
| 284 | Ga0495604_0046794 | 3300047317 | Bacteria | 3372 |
| 285 | Ga0495672_0012037 | 3300047320 | Bacteria | 6059 |
| 286 | Ga0495681_0081455 | 3300047470 | Bacteria | 1444 |
| 287 | Ga0495686_0021587 | 3300047472 | Bacteria | 4271 |
| 288 | Ga0495686_0039822 | 3300047472 | Bacteria | 2999 |
| 289 | Ga0495686_0040924 | 3300047472 | Bacteria | 2952 |
| 290 | Ga0495686_0081255 | 3300047472 | Bacteria | 1980 |
| 291 | Ga0495686_0092438 | 3300047472 | Bacteria | 1835 |
| 292 | Ga0495615_0001752 | 3300048090 | Bacteria | 3311 |
| 293 | Ga0496101_0277464 | 3300048904 | Bacteria | 1309 |
| 294 | Ga0496102_0050644 | 3300048905 | Bacteria | 3782 |
| 295 | Ga0496104_0119719 | 3300048907 | Bacteria | 2527 |
| 296 | Ga0496105_0117115 | 3300048908 | Bacteria | 2197 |
| 297 | Ga0496106_0007845 | 3300048909 | Bacteria | 7899 |
| 298 | Ga0496111_0269516 | 3300048914 | Bacteria | 1263 |
| 299 | Ga0496113_0256652 | 3300048916 | Bacteria | 1396 |
| 300 | Ga0496114_0076506 | 3300048917 | Bacteria | 2820 |
| 301 | Ga0496116_0000322 | 3300048919 | Bacteria | 78643 |
| 302 | Ga0496116_0008412 | 3300048919 | Bacteria | 8956 |
| 303 | Ga0496116_0011264 | 3300048919 | Bacteria | 7422 |
| 304 | Ga0496116_0117374 | 3300048919 | Bacteria | 1548 |
| 305 | Ga0496116_0128141 | 3300048919 | Bacteria | 1452 |
| 306 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 307 | Ga0496117_0006432 | 3300048920 | Bacteria | 11891 |
| 308 | Ga0496117_0036996 | 3300048920 | Bacteria | 3642 |
| 309 | Ga0496117_0089470 | 3300048920 | Bacteria | 1988 |
| 310 | Ga0496118_0001028 | 3300048921 | Bacteria | 43423 |
| 311 | Ga0496118_0007239 | 3300048921 | Bacteria | 11840 |
| 312 | Ga0496118_0039631 | 3300048921 | Bacteria | 3756 |
| 313 | Ga0496118_0151282 | 3300048921 | Bacteria | 1452 |
| 314 | Ga0496119_0025832 | 3300048922 | Bacteria | 4091 |
| 315 | Ga0496119_0034739 | 3300048922 | Bacteria | 3313 |
| 316 | Ga0496119_0036640 | 3300048922 | Bacteria | 3199 |
| 317 | Ga0496119_0049630 | 3300048922 | Bacteria | 2593 |
| 318 | Ga0496119_0139703 | 3300048922 | Bacteria | 1309 |
| 319 | Ga0496120_0000180 | 3300048923 | Bacteria | 107518 |
| 320 | Ga0496120_0038438 | 3300048923 | Bacteria | 2830 |
| 321 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 322 | Ga0496121_0003794 | 3300048924 | Bacteria | 21073 |
| 323 | Ga0496121_0009418 | 3300048924 | Bacteria | 11229 |
| 324 | Ga0496121_0038542 | 3300048924 | Bacteria | 4228 |
| 325 | Ga0496121_0121718 | 3300048924 | Bacteria | 1970 |
| 326 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 327 | Ga0496122_0012241 | 3300048925 | Bacteria | 8577 |
| 328 | Ga0496122_0022833 | 3300048925 | Bacteria | 5542 |
| 329 | Ga0496122_0023868 | 3300048925 | Bacteria | 5371 |
| 330 | Ga0496122_0037418 | 3300048925 | Bacteria | 3906 |
| 331 | Ga0496122_0046922 | 3300048925 | Bacteria | 3340 |
| 332 | Ga0496122_0056646 | 3300048925 | Bacteria | 2920 |
| 333 | Ga0496122_0081101 | 3300048925 | Bacteria | 2259 |
| 334 | Ga0496122_0114081 | 3300048925 | Bacteria | 1763 |
| 335 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 336 | Ga0496123_0007644 | 3300048926 | Bacteria | 10116 |
| 337 | Ga0496123_0012453 | 3300048926 | Bacteria | 7251 |
| 338 | Ga0496123_0040255 | 3300048926 | Bacteria | 3258 |
| 339 | Ga0496123_0109144 | 3300048926 | Bacteria | 1586 |
| 340 | Ga0496123_0112812 | 3300048926 | Bacteria | 1549 |
| 341 | Ga0496123_0163342 | 3300048926 | Bacteria | 1184 |
| 342 | Ga0496124_0011204 | 3300048927 | Bacteria | 8987 |
| 343 | Ga0496124_0014415 | 3300048927 | Bacteria | 7643 |
| 344 | Ga0496124_0026193 | 3300048927 | Bacteria | 5263 |
| 345 | Ga0496124_0044913 | 3300048927 | Bacteria | 3789 |
| 346 | Ga0496124_0055128 | 3300048927 | Bacteria | 3361 |
| 347 | Ga0496124_0066083 | 3300048927 | Bacteria | 3013 |
| 348 | Ga0496124_0163634 | 3300048927 | Bacteria | 1731 |
| 349 | Ga0496124_0198997 | 3300048927 | Bacteria | 1525 |
| 350 | Ga0496125_0016573 | 3300048928 | Bacteria | 7068 |
| 351 | Ga0496125_0049711 | 3300048928 | Bacteria | 3480 |
| 352 | Ga0496125_0118953 | 3300048928 | Bacteria | 1890 |
| 353 | Ga0496126_0001008 | 3300048929 | Bacteria | 47974 |
| 354 | Ga0496126_0039838 | 3300048929 | Bacteria | 4356 |
| 355 | Ga0496126_0044472 | 3300048929 | Bacteria | 4089 |
| 356 | Ga0496126_0306511 | 3300048929 | Bacteria | 1308 |
| 357 | Ga0496126_0390676 | 3300048929 | Bacteria | 1130 |
| 358 | Ga0496126_0390680 | 3300048929 | Bacteria | 1130 |
| 359 | Ga0495678_051710 | 3300049459 | Bacteria | 1586 |
| 360 | Ga0501033_0022920 | 3300049570 | Bacteria | 4707 |
| 361 | Ga0501037_0141844 | 3300049573 | Bacteria | 1719 |
| 362 | Ga0501038_0404777 | 3300049574 | Bacteria | 1055 |
| 363 | Ga0501046_0256338 | 3300049580 | Bacteria | 1286 |
| 364 | Ga0501047_0129310 | 3300049581 | Bacteria | 2406 |
| 365 | Ga0501068_0096479 | 3300049584 | Bacteria | 1829 |
| 366 | Ga0501073_0032587 | 3300049589 | Bacteria | 3715 |
| 367 | Ga0501035_0042498 | 3300049822 | Bacteria | 4099 |
| 368 | nmdc:mga03683_12158_c1 | 3300050489 | Bacteria | 3137 |
| 369 | nmdc:mga00v17_371652_c1 | 3300050491 | Bacteria | 930 |
| 370 | nmdc:mga00v17_43489_c1 | 3300050491 | Bacteria | 2705 |
| 371 | nmdc:mga0yw44_2589_c1 | 3300050492 | Bacteria | 7776 |
| 372 | nmdc:mga0yw44_5539_c1 | 3300050492 | Bacteria | 5986 |
| 373 | nmdc:mga0k408_5841_c1 | 3300050493 | Bacteria | 6558 |
| 374 | nmdc:mga06z11_5276_c1 | 3300050494 | Bacteria | 5172 |
| 375 | nmdc:mga04h51_6320_c1 | 3300050495 | Bacteria | 3067 |
| 376 | nmdc:mga07m45_36026_c1 | 3300050496 | Bacteria | 2754 |
| 377 | nmdc:mga07m45_44172_c1 | 3300050496 | Bacteria | 2500 |
| 378 | nmdc:mga0sz30_1247_c1 | 3300050516 | Bacteria | 9108 |
| 379 | nmdc:mga0sz30_6040_c1 | 3300050516 | Bacteria | 4476 |
| 380 | Ga0500578_0037008 | 3300053086 | Bacteria | 3133 |
| 381 | Ga0500651_0159814 | 3300053093 | Bacteria | 1348 |
| 382 | Ga0500569_013278 | 3300053109 | Bacteria | 2013 |
| 383 | Ga0500572_023543 | 3300053111 | Bacteria | 1654 |
| 384 | Ga0500594_0000757 | 3300053118 | Bacteria | 6886 |
| 385 | Ga0500608_132390 | 3300053122 | Bacteria | 1116 |
| 386 | Ga0500618_006831 | 3300053125 | Bacteria | 3311 |
| 387 | Ga0500652_137235 | 3300053131 | Bacteria | 1019 |
| 388 | Ga0500658_0000879 | 3300053134 | Bacteria | 12329 |
| 389 | Ga0500658_0077727 | 3300053134 | Bacteria | 1413 |
| 390 | Ga0500658_0165042 | 3300053134 | Bacteria | 1004 |
| 391 | Ga0500559_0005071 | 3300053136 | Bacteria | 6104 |
| 392 | Ga0500561_0000181 | 3300053137 | Bacteria | 11504 |
| 393 | Ga0500568_0001996 | 3300053139 | Bacteria | 12442 |
| 394 | Ga0500568_0009947 | 3300053139 | Bacteria | 4487 |
| 395 | Ga0500568_0028794 | 3300053139 | Bacteria | 2313 |
| 396 | Ga0500573_0047899 | 3300053140 | Bacteria | 2460 |
| 397 | Ga0500590_004391 | 3300053148 | Bacteria | 6656 |
| 398 | Ga0500616_0017794 | 3300053153 | Bacteria | 4026 |
| 399 | Ga0500616_0025961 | 3300053153 | Bacteria | 3247 |
| 400 | Ga0500622_0000956 | 3300053156 | Bacteria | 24552 |
| 401 | Ga0500622_0002236 | 3300053156 | Bacteria | 14231 |
| 402 | Ga0500624_004970 | 3300053157 | Bacteria | 1759 |
| 403 | Ga0500627_0020746 | 3300053158 | Bacteria | 2640 |
| 404 | Ga0500627_0110330 | 3300053158 | Bacteria | 1238 |
| 405 | Ga0500634_0130207 | 3300053161 | Bacteria | 1209 |
| 406 | Ga0500636_0001051 | 3300053177 | Bacteria | 14819 |
| 407 | Ga0500636_0016209 | 3300053177 | Bacteria | 4394 |
| 408 | Ga0466962_0110495 | 3300061719 | Bacteria | 1323 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025904 | Ga0207647_10240430 | Ga0207647_102404301 | 262 |
| 2 | 3300050491 | nmdc:mga00v17_371652_c1 | nmdc:mga00v17_371652_c1_95_916 | 270 |
| 3 | 3300048925 | Ga0496122_0046922 | Ga0496122_0046922_33_851 | 272 |
| 4 | iso_pu_bacteria | 2977544691 | 2977551458 | 276 |
| 5 | 3300031456 | Ga0307513_10124295 | Ga0307513_101242953 | 282 |
| 6 | 3300035692 | Ga0373935_0238748 | Ga0373935_0238748_84_938 | 282 |
| 7 | 3300035695 | Ga0373927_0000055 | Ga0373927_0000055_35969_36823 | 282 |
| 8 | 3300037068 | Ga0373925_0055752 | Ga0373925_0055752_743_1597 | 282 |
| 9 | 3300025297 | Ga0209758_1019478 | Ga0209758_10194787 | 284 |
| 10 | 3300048926 | Ga0496123_0109144 | Ga0496123_0109144_287_1177 | 284 |
| 11 | 3300048928 | Ga0496125_0049711 | Ga0496125_0049711_1034_1924 | 284 |
| 12 | 3300049573 | Ga0501037_0141844 | Ga0501037_0141844_309_1199 | 284 |
| 13 | 3300049574 | Ga0501038_0404777 | Ga0501038_0404777_25_915 | 284 |
| 14 | 3300049581 | Ga0501047_0129310 | Ga0501047_0129310_955_1845 | 284 |
| 15 | 3300049584 | Ga0501068_0096479 | Ga0501068_0096479_777_1667 | 284 |
| 16 | 3300049589 | Ga0501073_0032587 | Ga0501073_0032587_1003_1893 | 284 |
| 17 | 3300053136 | Ga0500559_0005071 | Ga0500559_0005071_671_1570 | 284 |
| 18 | 3300037471 | Ga0395905_0000325 | Ga0395905_0000325_66566_67432 | 285 |
| 19 | 3300046460 | Ga0495638_0089858 | Ga0495638_0089858_705_1568 | 285 |
| 20 | 3300053122 | Ga0500608_132390 | Ga0500608_132390_79_942 | 285 |
| 21 | 3300053131 | Ga0500652_137235 | Ga0500652_137235_108_971 | 285 |
| 22 | 3300053156 | Ga0500622_0000956 | Ga0500622_0000956_20362_21225 | 285 |
| 23 | 3300053158 | Ga0500627_0020746 | Ga0500627_0020746_293_1156 | 285 |
| 24 | iso_pu_bacteria | 2818991461 | 2819683853 | 285 |
| 25 | iso_pu_bacteria | 8018150411 | 8018154011 | 285 |
| 26 | iso_pu_bacteria | 8056875544 | 8056879542 | 285 |
| 27 | iso_pu_bacteria | 2508501122 | 2509108782 | 286 |
| 28 | iso_pu_bacteria | 2643221653 | 2644296514 | 286 |
| 29 | iso_pu_bacteria | 2643221719 | 2644654768 | 286 |
| 30 | iso_pu_bacteria | 2738541317 | 2738948981 | 286 |
| 31 | iso_pu_bacteria | 2913308742 | 2913309907 | 286 |
| 32 | iso_pu_bacteria | 2989776772 | 2989778422 | 286 |
| 33 | iso_pu_bacteria | 8005246636 | 8005251055 | 286 |
| 34 | 3300003215 | JGI25153J46596_10003463 | JGI25153J46596_100034633 | 287 |
| 35 | 3300003790 | Ga0055528_1017972 | Ga0055528_10179725 | 287 |
| 36 | 3300025273 | Ga0209673_1004785 | Ga0209673_100478510 | 287 |
| 37 | 3300025297 | Ga0209758_1004957 | Ga0209758_100495711 | 287 |
| 38 | 3300025299 | Ga0209256_1023508 | Ga0209256_10235083 | 287 |
| 39 | 3300025303 | Ga0209051_1039419 | Ga0209051_10394192 | 287 |
| 40 | 3300028794 | Ga0307515_10001758 | Ga0307515_1000175851 | 287 |
| 41 | 3300031730 | Ga0307516_10129215 | Ga0307516_101292155 | 287 |
| 42 | 3300041494 | Ga0451837_0324802 | Ga0451837_0324802_872_1762 | 287 |
| 43 | 3300041496 | Ga0451839_0811851 | Ga0451839_0811851_1124_2014 | 287 |
| 44 | 3300041498 | Ga0451841_0621192 | Ga0451841_0621192_598_1488 | 287 |
| 45 | 3300041498 | Ga0451841_1210148 | Ga0451841_1210148_114_1004 | 287 |
| 46 | 3300041507 | Ga0451851_0025954 | Ga0451851_0025954_53_943 | 287 |
| 47 | 3300041507 | Ga0451851_0839726 | Ga0451851_0839726_53_943 | 287 |
| 48 | 3300041512 | Ga0451853_2406349 | Ga0451853_2406349_381_1271 | 287 |
| 49 | 3300046460 | Ga0495638_0082458 | Ga0495638_0082458_1068_1940 | 287 |
| 50 | 3300046474 | Ga0495605_0043145 | Ga0495605_0043145_924_1814 | 287 |
| 51 | 3300046492 | Ga0495585_0091614 | Ga0495585_0091614_305_1195 | 287 |
| 52 | 3300046501 | Ga0495607_0139652 | Ga0495607_0139652_342_1232 | 287 |
| 53 | 3300046506 | Ga0495583_0097686 | Ga0495583_0097686_315_1205 | 287 |
| 54 | 3300046507 | Ga0495606_0014273 | Ga0495606_0014273_112_1002 | 287 |
| 55 | 3300046512 | Ga0495610_0031663 | Ga0495610_0031663_456_1346 | 287 |
| 56 | 3300046522 | Ga0495643_0036191 | Ga0495643_0036191_27_917 | 287 |
| 57 | 3300046524 | Ga0495648_0047141 | Ga0495648_0047141_533_1423 | 287 |
| 58 | 3300046542 | Ga0495597_0010356 | Ga0495597_0010356_2264_3154 | 287 |
| 59 | 3300046558 | Ga0495633_0020432 | Ga0495633_0020432_2251_3141 | 287 |
| 60 | 3300046616 | Ga0495668_0085723 | Ga0495668_0085723_423_1313 | 287 |
| 61 | 3300046660 | Ga0495625_0064647 | Ga0495625_0064647_1330_2220 | 287 |
| 62 | 3300046692 | Ga0495671_0145312 | Ga0495671_0145312_220_1110 | 287 |
| 63 | 3300047470 | Ga0495681_0081455 | Ga0495681_0081455_278_1168 | 287 |
| 64 | 3300047472 | Ga0495686_0040924 | Ga0495686_0040924_266_1156 | 287 |
| 65 | 3300048090 | Ga0495615_0001752 | Ga0495615_0001752_2158_3048 | 287 |
| 66 | 3300053086 | Ga0500578_0037008 | Ga0500578_0037008_1030_1920 | 287 |
| 67 | 3300053109 | Ga0500569_013278 | Ga0500569_013278_274_1164 | 287 |
| 68 | 3300053134 | Ga0500658_0000879 | Ga0500658_0000879_1909_2799 | 287 |
| 69 | 3300053153 | Ga0500616_0017794 | Ga0500616_0017794_931_1821 | 287 |
| 70 | 3300053158 | Ga0500627_0110330 | Ga0500627_0110330_49_939 | 287 |
| 71 | iso_pu_bacteria | 2509276019 | 2509374238 | 287 |
| 72 | iso_pu_bacteria | 2510065057 | 2510307359 | 287 |
| 73 | iso_pu_bacteria | 2511231052 | 2511501234 | 287 |
| 74 | iso_pu_bacteria | 2512047086 | 2512532661 | 287 |
| 75 | iso_pu_bacteria | 2512875026 | 2512972010 | 287 |
| 76 | iso_pu_bacteria | 2513237086 | 2513587114 | 287 |
| 77 | iso_pu_bacteria | 2513237089 | 2513604679 | 287 |
| 78 | iso_pu_bacteria | 2513237091 | 2513616388 | 287 |
| 79 | iso_pu_bacteria | 2513237140 | 2513880890 | 287 |
| 80 | iso_pu_bacteria | 2513237143 | 2513907429 | 287 |
| 81 | iso_pu_bacteria | 2513237156 | 2513987316 | 287 |
| 82 | iso_pu_bacteria | 2513237160 | 2514007333 | 287 |
| 83 | iso_pu_bacteria | 2515154107 | 2515608408 | 287 |
| 84 | iso_pu_bacteria | 2516143018 | 2516209115 | 287 |
| 85 | iso_pu_bacteria | 2516653046 | 2516892517 | 287 |
| 86 | iso_pu_bacteria | 2517487022 | 2517569330 | 287 |
| 87 | iso_pu_bacteria | 2524023207 | 2524450930 | 287 |
| 88 | iso_pu_bacteria | 2537561587 | 2537875688 | 287 |
| 89 | iso_pu_bacteria | 2551306084 | 2551675551 | 287 |
| 90 | iso_pu_bacteria | 2551306085 | 2551689260 | 287 |
| 91 | iso_pu_bacteria | 2551306086 | 2551694320 | 287 |
| 92 | iso_pu_bacteria | 2551306087 | 2551699723 | 287 |
| 93 | iso_pu_bacteria | 2551306089 | 2551712783 | 287 |
| 94 | iso_pu_bacteria | 2551306090 | 2551722348 | 287 |
| 95 | iso_pu_bacteria | 2551306091 | 2551728632 | 287 |
| 96 | iso_pu_bacteria | 2551306092 | 2551734565 | 287 |
| 97 | iso_pu_bacteria | 2551306093 | 2551742236 | 287 |
| 98 | iso_pu_bacteria | 2554235003 | 2554248121 | 287 |
| 99 | iso_pu_bacteria | 2558860100 | 2558863263 | 287 |
| 100 | iso_pu_bacteria | 2558860242 | 2559295237 | 287 |
| 101 | iso_pu_bacteria | 2599185210 | 2599601550 | 287 |
| 102 | iso_pu_bacteria | 2599185352 | 2600192196 | 287 |
| 103 | iso_pu_bacteria | 2600255279 | 2601610186 | 287 |
| 104 | iso_pu_bacteria | 2600255308 | 2601746960 | 287 |
| 105 | iso_pu_bacteria | 2643221557 | 2643806959 | 287 |
| 106 | iso_pu_bacteria | 2643221568 | 2643856885 | 287 |
| 107 | iso_pu_bacteria | 2643221582 | 2643920457 | 287 |
| 108 | iso_pu_bacteria | 2643221610 | 2644067284 | 287 |
| 109 | iso_pu_bacteria | 2643221618 | 2644108769 | 287 |
| 110 | iso_pu_bacteria | 2643221626 | 2644151290 | 287 |
| 111 | iso_pu_bacteria | 2643221655 | 2644311425 | 287 |
| 112 | iso_pu_bacteria | 2643221659 | 2644329683 | 287 |
| 113 | iso_pu_bacteria | 2643221668 | 2644378327 | 287 |
| 114 | iso_pu_bacteria | 2643221675 | 2644420914 | 287 |
| 115 | iso_pu_bacteria | 2643221680 | 2644454438 | 287 |
| 116 | iso_pu_bacteria | 2643221693 | 2644522069 | 287 |
| 117 | iso_pu_bacteria | 2643221698 | 2644546357 | 287 |
| 118 | iso_pu_bacteria | 2643221712 | 2644617224 | 287 |
| 119 | iso_pu_bacteria | 2643221723 | 2644675338 | 287 |
| 120 | iso_pu_bacteria | 2643221726 | 2644689776 | 287 |
| 121 | iso_pu_bacteria | 2690316117 | 2692316568 | 287 |
| 122 | iso_pu_bacteria | 2791355091 | 2792622461 | 287 |
| 123 | iso_pu_bacteria | 2791355094 | 2792642792 | 287 |
| 124 | iso_pu_bacteria | 2802428858 | 2802719342 | 287 |
| 125 | iso_pu_bacteria | 2802428859 | 2802723097 | 287 |
| 126 | iso_pu_bacteria | 2802428860 | 2802732542 | 287 |
| 127 | iso_pu_bacteria | 2802428861 | 2802738459 | 287 |
| 128 | iso_pu_bacteria | 2802428862 | 2802745083 | 287 |
| 129 | iso_pu_bacteria | 2802428863 | 2802751518 | 287 |
| 130 | iso_pu_bacteria | 2808606387 | 2808988029 | 287 |
| 131 | iso_pu_bacteria | 2818991439 | 2819558937 | 287 |
| 132 | iso_pu_bacteria | 2838074704 | 2838076661 | 287 |
| 133 | iso_pu_bacteria | 2838675328 | 2838675886 | 287 |
| 134 | iso_pu_bacteria | 2838714209 | 2838714768 | 287 |
| 135 | iso_pu_bacteria | 2838719591 | 2838721431 | 287 |
| 136 | iso_pu_bacteria | 2838724970 | 2838725528 | 287 |
| 137 | iso_pu_bacteria | 2841846520 | 2841848380 | 287 |
| 138 | iso_pu_bacteria | 2841859092 | 2841862013 | 287 |
| 139 | iso_pu_bacteria | 2842124991 | 2842125589 | 287 |
| 140 | iso_pu_bacteria | 2842130223 | 2842130781 | 287 |
| 141 | iso_pu_bacteria | 2842152218 | 2842154049 | 287 |
| 142 | iso_pu_bacteria | 2842170452 | 2842171012 | 287 |
| 143 | iso_pu_bacteria | 2842175837 | 2842177669 | 287 |
| 144 | iso_pu_bacteria | 2842187318 | 2842187877 | 287 |
| 145 | iso_pu_bacteria | 2842211629 | 2842212188 | 287 |
| 146 | iso_pu_bacteria | 2842224351 | 2842226193 | 287 |
| 147 | iso_pu_bacteria | 2842515876 | 2842518797 | 287 |
| 148 | iso_pu_bacteria | 2844163670 | 2844168279 | 287 |
| 149 | iso_pu_bacteria | 2847417321 | 2847418364 | 287 |
| 150 | iso_pu_bacteria | 2848992105 | 2848993345 | 287 |
| 151 | iso_pu_bacteria | 2850079185 | 2850080703 | 287 |
| 152 | iso_pu_bacteria | 2855825444 | 2855831587 | 287 |
| 153 | iso_pu_bacteria | 2855839649 | 2855840705 | 287 |
| 154 | iso_pu_bacteria | 2855872281 | 2855878620 | 287 |
| 155 | iso_pu_bacteria | 2858800743 | 2858801233 | 287 |
| 156 | iso_pu_bacteria | 2896384573 | 2896386854 | 287 |
| 157 | iso_pu_bacteria | 2899792073 | 2899796167 | 287 |
| 158 | iso_pu_bacteria | 2899845264 | 2899850767 | 287 |
| 159 | iso_pu_bacteria | 2913295892 | 2913301813 | 287 |
| 160 | iso_pu_bacteria | 2915980308 | 2915985704 | 287 |
| 161 | iso_pu_bacteria | 2915986958 | 2915991765 | 287 |
| 162 | iso_pu_bacteria | 2915993759 | 2915995794 | 287 |
| 163 | iso_pu_bacteria | 2916000859 | 2916002664 | 287 |
| 164 | iso_pu_bacteria | 2916007675 | 2916009850 | 287 |
| 165 | iso_pu_bacteria | 2916014648 | 2916018812 | 287 |
| 166 | iso_pu_bacteria | 2916021584 | 2916022441 | 287 |
| 167 | iso_pu_bacteria | 2916028427 | 2916031835 | 287 |
| 168 | iso_pu_bacteria | 2916035215 | 2916040611 | 287 |
| 169 | iso_pu_bacteria | 2916041962 | 2916046643 | 287 |
| 170 | iso_pu_bacteria | 2916048683 | 2916052703 | 287 |
| 171 | iso_pu_bacteria | 2916055098 | 2916055101 | 287 |
| 172 | iso_pu_bacteria | 2916061851 | 2916065854 | 287 |
| 173 | iso_pu_bacteria | 2916068649 | 2916070037 | 287 |
| 174 | iso_pu_bacteria | 2916076590 | 2916078705 | 287 |
| 175 | iso_pu_bacteria | 2919114240 | 2919114859 | 287 |
| 176 | iso_pu_bacteria | 2920760137 | 2920765441 | 287 |
| 177 | iso_pu_bacteria | 2920822456 | 2920824072 | 287 |
| 178 | iso_pu_bacteria | 2921201388 | 2921205126 | 287 |
| 179 | iso_pu_bacteria | 2921208531 | 2921210042 | 287 |
| 180 | iso_pu_bacteria | 2921237296 | 2921242287 | 287 |
| 181 | iso_pu_bacteria | 2921244191 | 2921248035 | 287 |
| 182 | iso_pu_bacteria | 2921250672 | 2921251624 | 287 |
| 183 | iso_pu_bacteria | 2921257292 | 2921260819 | 287 |
| 184 | iso_pu_bacteria | 2921263974 | 2921263977 | 287 |
| 185 | iso_pu_bacteria | 2921282425 | 2921285946 | 287 |
| 186 | iso_pu_bacteria | 2921289301 | 2921292120 | 287 |
| 187 | iso_pu_bacteria | 2921296804 | 2921299866 | 287 |
| 188 | iso_pu_bacteria | 2924144063 | 2924147629 | 287 |
| 189 | iso_pu_bacteria | 2924150972 | 2924155037 | 287 |
| 190 | iso_pu_bacteria | 2924158325 | 2924165012 | 287 |
| 191 | iso_pu_bacteria | 2924165586 | 2924168028 | 287 |
| 192 | iso_pu_bacteria | 2924172951 | 2924177085 | 287 |
| 193 | iso_pu_bacteria | 2924179722 | 2924184775 | 287 |
| 194 | iso_pu_bacteria | 2924186466 | 2924188258 | 287 |
| 195 | iso_pu_bacteria | 2924193448 | 2924200322 | 287 |
| 196 | iso_pu_bacteria | 2924200457 | 2924206852 | 287 |
| 197 | iso_pu_bacteria | 2924207177 | 2924213775 | 287 |
| 198 | iso_pu_bacteria | 2924214083 | 2924220240 | 287 |
| 199 | iso_pu_bacteria | 2924221636 | 2924224365 | 287 |
| 200 | iso_pu_bacteria | 2924228884 | 2924233715 | 287 |
| 201 | iso_pu_bacteria | 2926754445 | 2926755823 | 287 |
| 202 | iso_pu_bacteria | 2926760298 | 2926762941 | 287 |
| 203 | iso_pu_bacteria | 2933006813 | 2933008694 | 287 |
| 204 | iso_pu_bacteria | 2933011516 | 2933015029 | 287 |
| 205 | iso_pu_bacteria | 2933594066 | 2933596705 | 287 |
| 206 | iso_pu_bacteria | 2936996657 | 2937000842 | 287 |
| 207 | iso_pu_bacteria | 2937002841 | 2937009656 | 287 |
| 208 | iso_pu_bacteria | 2937009748 | 2937016319 | 287 |
| 209 | iso_pu_bacteria | 2937016420 | 2937019562 | 287 |
| 210 | iso_pu_bacteria | 2937023124 | 2937028659 | 287 |
| 211 | iso_pu_bacteria | 2937029754 | 2937030347 | 287 |
| 212 | iso_pu_bacteria | 2937036028 | 2937040754 | 287 |
| 213 | iso_pu_bacteria | 2937042894 | 2937045912 | 287 |
| 214 | iso_pu_bacteria | 2937049772 | 2937056369 | 287 |
| 215 | iso_pu_bacteria | 2937056579 | 2937060831 | 287 |
| 216 | iso_pu_bacteria | 2937063883 | 2937069325 | 287 |
| 217 | iso_pu_bacteria | 2937071275 | 2937072484 | 287 |
| 218 | iso_pu_bacteria | 2937078374 | 2937079381 | 287 |
| 219 | iso_pu_bacteria | 2937084907 | 2937088890 | 287 |
| 220 | iso_pu_bacteria | 2937091812 | 2937095279 | 287 |
| 221 | iso_pu_bacteria | 2937098957 | 2937104518 | 287 |
| 222 | iso_pu_bacteria | 2937106411 | 2937109204 | 287 |
| 223 | iso_pu_bacteria | 2937113482 | 2937114124 | 287 |
| 224 | iso_pu_bacteria | 2937119839 | 2937125786 | 287 |
| 225 | iso_pu_bacteria | 2937126314 | 2937129931 | 287 |
| 226 | iso_pu_bacteria | 2941499720 | 2941499980 | 287 |
| 227 | iso_pu_bacteria | 2957375807 | 2957377168 | 287 |
| 228 | iso_pu_bacteria | 2957382221 | 2957385749 | 287 |
| 229 | iso_pu_bacteria | 2957388812 | 2957388872 | 287 |
| 230 | iso_pu_bacteria | 2957395598 | 2957397293 | 287 |
| 231 | iso_pu_bacteria | 2957402308 | 2957406478 | 287 |
| 232 | iso_pu_bacteria | 2957408893 | 2957413669 | 287 |
| 233 | iso_pu_bacteria | 2957415311 | 2957418205 | 287 |
| 234 | iso_pu_bacteria | 2957422303 | 2957426014 | 287 |
| 235 | iso_pu_bacteria | 2957430029 | 2957431815 | 287 |
| 236 | iso_pu_bacteria | 2957437181 | 2957441233 | 287 |
| 237 | iso_pu_bacteria | 2957443900 | 2957444737 | 287 |
| 238 | iso_pu_bacteria | 2957450854 | 2957453235 | 287 |
| 239 | iso_pu_bacteria | 2957457609 | 2957458989 | 287 |
| 240 | iso_pu_bacteria | 2957464669 | 2957468153 | 287 |
| 241 | iso_pu_bacteria | 2957471148 | 2957475172 | 287 |
| 242 | iso_pu_bacteria | 2957478035 | 2957481866 | 287 |
| 243 | iso_pu_bacteria | 2957484790 | 2957489217 | 287 |
| 244 | iso_pu_bacteria | 2957491536 | 2957491942 | 287 |
| 245 | iso_pu_bacteria | 2957498199 | 2957504692 | 287 |
| 246 | iso_pu_bacteria | 2957505466 | 2957509092 | 287 |
| 247 | iso_pu_bacteria | 2960584000 | 2960587034 | 287 |
| 248 | iso_pu_bacteria | 2960591022 | 2960593487 | 287 |
| 249 | iso_pu_bacteria | 2960597568 | 2960603590 | 287 |
| 250 | iso_pu_bacteria | 2960603979 | 2960604605 | 287 |
| 251 | iso_pu_bacteria | 2960610863 | 2960615723 | 287 |
| 252 | iso_pu_bacteria | 2960617483 | 2960617960 | 287 |
| 253 | iso_pu_bacteria | 2960624210 | 2960628133 | 287 |
| 254 | iso_pu_bacteria | 2960631154 | 2960633879 | 287 |
| 255 | iso_pu_bacteria | 2960637947 | 2960641084 | 287 |
| 256 | iso_pu_bacteria | 2960652885 | 2960654371 | 287 |
| 257 | iso_pu_bacteria | 2960660292 | 2960661420 | 287 |
| 258 | iso_pu_bacteria | 2960667422 | 2960673747 | 287 |
| 259 | iso_pu_bacteria | 2960674078 | 2960677332 | 287 |
| 260 | iso_pu_bacteria | 2960680706 | 2960685074 | 287 |
| 261 | iso_pu_bacteria | 2960687367 | 2960691546 | 287 |
| 262 | iso_pu_bacteria | 2960693952 | 2960698706 | 287 |
| 263 | iso_pu_bacteria | 2964607997 | 2964611316 | 287 |
| 264 | iso_pu_bacteria | 2964615318 | 2964618775 | 287 |
| 265 | iso_pu_bacteria | 2964621998 | 2964624436 | 287 |
| 266 | iso_pu_bacteria | 2964628898 | 2964632765 | 287 |
| 267 | iso_pu_bacteria | 2964636051 | 2964641180 | 287 |
| 268 | iso_pu_bacteria | 2964643177 | 2964647027 | 287 |
| 269 | iso_pu_bacteria | 2964649959 | 2964652809 | 287 |
| 270 | iso_pu_bacteria | 2964656573 | 2964661985 | 287 |
| 271 | iso_pu_bacteria | 2964663802 | 2964670749 | 287 |
| 272 | iso_pu_bacteria | 2964670856 | 2964676147 | 287 |
| 273 | iso_pu_bacteria | 2964678106 | 2964679732 | 287 |
| 274 | iso_pu_bacteria | 2964685014 | 2964686250 | 287 |
| 275 | iso_pu_bacteria | 2964691889 | 2964692629 | 287 |
| 276 | iso_pu_bacteria | 2964698721 | 2964699816 | 287 |
| 277 | iso_pu_bacteria | 2964705432 | 2964706934 | 287 |
| 278 | iso_pu_bacteria | 2964712639 | 2964717100 | 287 |
| 279 | iso_pu_bacteria | 2964719344 | 2964723825 | 287 |
| 280 | iso_pu_bacteria | 2967664464 | 2967670387 | 287 |
| 281 | iso_pu_bacteria | 2967671571 | 2967672644 | 287 |
| 282 | iso_pu_bacteria | 2967678726 | 2967683446 | 287 |
| 283 | iso_pu_bacteria | 2967686174 | 2967688599 | 287 |
| 284 | iso_pu_bacteria | 2967693043 | 2967694534 | 287 |
| 285 | iso_pu_bacteria | 2967699805 | 2967701759 | 287 |
| 286 | iso_pu_bacteria | 2967706974 | 2967709856 | 287 |
| 287 | iso_pu_bacteria | 2967714385 | 2967718805 | 287 |
| 288 | iso_pu_bacteria | 2967721400 | 2967726209 | 287 |
| 289 | iso_pu_bacteria | 2967728569 | 2967729688 | 287 |
| 290 | iso_pu_bacteria | 2967735183 | 2967738898 | 287 |
| 291 | iso_pu_bacteria | 2967742019 | 2967743319 | 287 |
| 292 | iso_pu_bacteria | 2967748971 | 2967755346 | 287 |
| 293 | iso_pu_bacteria | 2967755722 | 2967761592 | 287 |
| 294 | iso_pu_bacteria | 2967762386 | 2967766777 | 287 |
| 295 | iso_pu_bacteria | 2967769361 | 2967772583 | 287 |
| 296 | iso_pu_bacteria | 2967775926 | 2967779044 | 287 |
| 297 | iso_pu_bacteria | 2970019648 | 2970022712 | 287 |
| 298 | iso_pu_bacteria | 2970026789 | 2970027870 | 287 |
| 299 | iso_pu_bacteria | 2970033650 | 2970036724 | 287 |
| 300 | iso_pu_bacteria | 2970040964 | 2970042683 | 287 |
| 301 | iso_pu_bacteria | 2970047711 | 2970051757 | 287 |
| 302 | iso_pu_bacteria | 2970054988 | 2970058081 | 287 |
| 303 | iso_pu_bacteria | 2970061556 | 2970062894 | 287 |
| 304 | iso_pu_bacteria | 2970068827 | 2970072158 | 287 |
| 305 | iso_pu_bacteria | 2970076120 | 2970079509 | 287 |
| 306 | iso_pu_bacteria | 2970082768 | 2970086640 | 287 |
| 307 | iso_pu_bacteria | 2970088815 | 2970091776 | 287 |
| 308 | iso_pu_bacteria | 2970095765 | 2970098663 | 287 |
| 309 | iso_pu_bacteria | 2970102677 | 2970105813 | 287 |
| 310 | iso_pu_bacteria | 2970109326 | 2970111934 | 287 |
| 311 | iso_pu_bacteria | 2970116247 | 2970120744 | 287 |
| 312 | iso_pu_bacteria | 2970122695 | 2970123206 | 287 |
| 313 | iso_pu_bacteria | 2970129317 | 2970129776 | 287 |
| 314 | iso_pu_bacteria | 2970136068 | 2970139045 | 287 |
| 315 | iso_pu_bacteria | 2970143518 | 2970149774 | 287 |
| 316 | iso_pu_bacteria | 2970149975 | 2970154205 | 287 |
| 317 | iso_pu_bacteria | 2970156795 | 2970160609 | 287 |
| 318 | iso_pu_bacteria | 2970164137 | 2970167569 | 287 |
| 319 | iso_pu_bacteria | 2970170962 | 2970173609 | 287 |
| 320 | iso_pu_bacteria | 2970177841 | 2970178704 | 287 |
| 321 | iso_pu_bacteria | 2970184632 | 2970186563 | 287 |
| 322 | iso_pu_bacteria | 2970191845 | 2970193270 | 287 |
| 323 | iso_pu_bacteria | 2977516862 | 2977520539 | 287 |
| 324 | iso_pu_bacteria | 2977523885 | 2977530194 | 287 |
| 325 | iso_pu_bacteria | 2977530762 | 2977532308 | 287 |
| 326 | iso_pu_bacteria | 2977537788 | 2977541409 | 287 |
| 327 | iso_pu_bacteria | 2977551784 | 2977557537 | 287 |
| 328 | iso_pu_bacteria | 2977558990 | 2977560824 | 287 |
| 329 | iso_pu_bacteria | 2977565890 | 2977569791 | 287 |
| 330 | iso_pu_bacteria | 2977572785 | 2977577767 | 287 |
| 331 | iso_pu_bacteria | 2977579622 | 2977583905 | 287 |
| 332 | iso_pu_bacteria | 2979089926 | 2979094566 | 287 |
| 333 | iso_pu_bacteria | 2979095461 | 2979098051 | 287 |
| 334 | iso_pu_bacteria | 2979100975 | 2979103808 | 287 |
| 335 | iso_pu_bacteria | 2984509177 | 2984511626 | 287 |
| 336 | iso_pu_bacteria | 2984518228 | 2984522013 | 287 |
| 337 | iso_pu_bacteria | 2984537506 | 2984541311 | 287 |
| 338 | iso_pu_bacteria | 2984587000 | 2984589824 | 287 |
| 339 | iso_pu_bacteria | 2984601300 | 2984603589 | 287 |
| 340 | iso_pu_bacteria | 2989349275 | 2989353438 | 287 |
| 341 | iso_pu_bacteria | 643692032 | 643825375 | 287 |
| 342 | iso_pu_bacteria | 648276728 | 648741536 | 287 |
| 343 | iso_pu_bacteria | 650716007 | 650740445 | 287 |
| 344 | iso_pu_bacteria | 8003570095 | 8003571508 | 287 |
| 345 | iso_pu_bacteria | 8003992118 | 8003993204 | 287 |
| 346 | iso_pu_bacteria | 8003999396 | 8004000461 | 287 |
| 347 | iso_pu_bacteria | 2643221637 | 2644206032 | 288 |
| 348 | iso_pu_bacteria | 2643221718 | 2644649679 | 288 |
| 349 | iso_pu_bacteria | 2791355253 | 2793282420 | 288 |
| 350 | iso_pu_bacteria | 2842922631 | 2842925048 | 288 |
| 351 | 3300002773 | JGI25152J39213_1008753 | JGI25152J39213_10087532 | 289 |
| 352 | 3300005347 | Ga0070668_100181647 | Ga0070668_1001816471 | 289 |
| 353 | 3300005355 | Ga0070671_100038063 | Ga0070671_1000380634 | 289 |
| 354 | 3300005457 | Ga0070662_100086648 | Ga0070662_1000866484 | 289 |
| 355 | 3300005466 | Ga0070685_10147333 | Ga0070685_101473331 | 289 |
| 356 | 3300006038 | Ga0075365_10028260 | Ga0075365_100282603 | 289 |
| 357 | 3300006186 | Ga0075369_10082166 | Ga0075369_100821662 | 289 |
| 358 | 3300009177 | Ga0105248_10322768 | Ga0105248_103227682 | 289 |
| 359 | 3300009553 | Ga0105249_10084573 | Ga0105249_100845732 | 289 |
| 360 | 3300009766 | Ga0123342_1041008 | Ga0123342_10410082 | 289 |
| 361 | 3300025258 | Ga0209129_1004233 | Ga0209129_10042336 | 289 |
| 362 | 3300025295 | Ga0209564_1016735 | Ga0209564_10167352 | 289 |
| 363 | 3300025297 | Ga0209758_1029025 | Ga0209758_10290252 | 289 |
| 364 | 3300025302 | Ga0207426_1011540 | Ga0207426_10115401 | 289 |
| 365 | 3300025303 | Ga0209051_1032838 | Ga0209051_10328382 | 289 |
| 366 | 3300025931 | Ga0207644_10048176 | Ga0207644_100481765 | 289 |
| 367 | 3300025933 | Ga0207706_10131423 | Ga0207706_101314233 | 289 |
| 368 | 3300025941 | Ga0207711_10206609 | Ga0207711_102066093 | 289 |
| 369 | 3300025961 | Ga0207712_10457396 | Ga0207712_104573962 | 289 |
| 370 | 3300046507 | Ga0495606_0049109 | Ga0495606_0049109_1830_2732 | 289 |
| 371 | 3300048908 | Ga0496105_0117115 | Ga0496105_0117115_1181_2071 | 289 |
| 372 | 3300048914 | Ga0496111_0269516 | Ga0496111_0269516_169_1059 | 289 |
| 373 | 3300048916 | Ga0496113_0256652 | Ga0496113_0256652_61_951 | 289 |
| 374 | 3300048917 | Ga0496114_0076506 | Ga0496114_0076506_98_1000 | 289 |
| 375 | 3300048922 | Ga0496119_0025832 | Ga0496119_0025832_3114_4004 | 289 |
| 376 | 3300048925 | Ga0496122_0037418 | Ga0496122_0037418_76_966 | 289 |
| 377 | 3300048927 | Ga0496124_0055128 | Ga0496124_0055128_134_1024 | 289 |
| 378 | 3300048928 | Ga0496125_0118953 | Ga0496125_0118953_99_989 | 289 |
| 379 | 3300049570 | Ga0501033_0022920 | Ga0501033_0022920_2545_3423 | 289 |
| 380 | 3300049822 | Ga0501035_0042498 | Ga0501035_0042498_2541_3419 | 289 |
| 381 | iso_pu_bacteria | 2643221558 | 2643809818 | 289 |
| 382 | iso_pu_bacteria | 2657244999 | 2657683047 | 289 |
| 383 | iso_pu_bacteria | 2791355082 | 2792584411 | 289 |
| 384 | iso_pu_bacteria | 2791355092 | 2792628620 | 289 |
| 385 | iso_pu_bacteria | 8049293176 | 8049294254 | 289 |
| 386 | 3300003187 | JGI25151J46595_10008103 | JGI25151J46595_100081034 | 290 |
| 387 | 3300003856 | Ga0058692_1002661 | Ga0058692_10026615 | 290 |
| 388 | 3300003856 | Ga0058692_1004925 | Ga0058692_10049255 | 290 |
| 389 | 3300005548 | Ga0070665_100032328 | Ga0070665_1000323284 | 290 |
| 390 | 3300006042 | Ga0075368_10002087 | Ga0075368_100020874 | 290 |
| 391 | 3300006178 | Ga0075367_10108192 | Ga0075367_101081922 | 290 |
| 392 | 3300006948 | Ga0099826_10000098 | Ga0099826_1000009828 | 290 |
| 393 | 3300009036 | Ga0105244_10041955 | Ga0105244_100419551 | 290 |
| 394 | 3300009148 | Ga0105243_10052642 | Ga0105243_100526423 | 290 |
| 395 | 3300013102 | Ga0157371_10001437 | Ga0157371_1000143722 | 290 |
| 396 | 3300013104 | Ga0157370_10000351 | Ga0157370_1000035110 | 290 |
| 397 | 3300013307 | Ga0157372_10655200 | Ga0157372_106552002 | 290 |
| 398 | 3300025294 | Ga0209025_1000405 | Ga0209025_100040546 | 290 |
| 399 | 3300025294 | Ga0209025_1049232 | Ga0209025_10492322 | 290 |
| 400 | 3300025935 | Ga0207709_10008294 | Ga0207709_100082946 | 290 |
| 401 | 3300027312 | Ga0209371_1000328 | Ga0209371_100032859 | 290 |
| 402 | 3300027312 | Ga0209371_1001894 | Ga0209371_100189411 | 290 |
| 403 | 3300027666 | Ga0209282_1000147 | Ga0209282_100014722 | 290 |
| 404 | 3300027866 | Ga0209813_10004171 | Ga0209813_100041716 | 290 |
| 405 | 3300028379 | Ga0268266_10083415 | Ga0268266_100834154 | 290 |
| 406 | 3300030500 | Ga0268256_1000019 | Ga0268256_1000019577 | 290 |
| 407 | 3300030500 | Ga0268256_1004165 | Ga0268256_10041659 | 290 |
| 408 | 3300030744 | Ga0316181_1156578 | Ga0316181_11565784 | 290 |
| 409 | 3300031852 | Ga0307410_10261927 | Ga0307410_102619271 | 290 |
| 410 | 3300037471 | Ga0395905_0010488 | Ga0395905_0010488_656_1537 | 290 |
| 411 | 3300046674 | Ga0495588_0002878 | Ga0495588_0002878_192_1079 | 290 |
| 412 | 3300048907 | Ga0496104_0119719 | Ga0496104_0119719_881_1768 | 290 |
| 413 | 3300048919 | Ga0496116_0000322 | Ga0496116_0000322_64983_65864 | 290 |
| 414 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_603434_604321 | 290 |
| 415 | 3300048921 | Ga0496118_0001028 | Ga0496118_0001028_4088_4975 | 290 |
| 416 | 3300048922 | Ga0496119_0036640 | Ga0496119_0036640_723_1610 | 290 |
| 417 | 3300048923 | Ga0496120_0000180 | Ga0496120_0000180_4111_4998 | 290 |
| 418 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_264360_265253 | 290 |
| 419 | 3300048925 | Ga0496122_0000004 | Ga0496122_0000004_4116_5003 | 290 |
| 420 | 3300048925 | Ga0496122_0023868 | Ga0496122_0023868_2621_3502 | 290 |
| 421 | 3300048925 | Ga0496122_0081101 | Ga0496122_0081101_1274_2167 | 290 |
| 422 | 3300048926 | Ga0496123_0000007 | Ga0496123_0000007_4116_5003 | 290 |
| 423 | 3300048926 | Ga0496123_0040255 | Ga0496123_0040255_89_970 | 290 |
| 424 | 3300048927 | Ga0496124_0011204 | Ga0496124_0011204_4126_5013 | 290 |
| 425 | 3300048927 | Ga0496124_0014415 | Ga0496124_0014415_2786_3667 | 290 |
| 426 | 3300048927 | Ga0496124_0198997 | Ga0496124_0198997_413_1294 | 290 |
| 427 | 3300048929 | Ga0496126_0001008 | Ga0496126_0001008_44644_45525 | 290 |
| 428 | 3300048929 | Ga0496126_0390676 | Ga0496126_0390676_95_982 | 290 |
| 429 | 3300048929 | Ga0496126_0390680 | Ga0496126_0390680_95_982 | 290 |
| 430 | 3300050491 | nmdc:mga00v17_43489_c1 | nmdc:mga00v17_43489_c1_1732_2619 | 290 |
| 431 | 3300050492 | nmdc:mga0yw44_2589_c1 | nmdc:mga0yw44_2589_c1_4115_5002 | 290 |
| 432 | 3300050495 | nmdc:mga04h51_6320_c1 | nmdc:mga04h51_6320_c1_1423_2310 | 290 |
| 433 | 3300050496 | nmdc:mga07m45_44172_c1 | nmdc:mga07m45_44172_c1_403_1290 | 290 |
| 434 | 3300050516 | nmdc:mga0sz30_1247_c1 | nmdc:mga0sz30_1247_c1_4107_4994 | 290 |
| 435 | 3300053111 | Ga0500572_023543 | Ga0500572_023543_585_1466 | 290 |
| 436 | 3300053137 | Ga0500561_0000181 | Ga0500561_0000181_4128_5015 | 290 |
| 437 | 3300053157 | Ga0500624_004970 | Ga0500624_004970_563_1450 | 290 |
| 438 | 3300053161 | Ga0500634_0130207 | Ga0500634_0130207_51_938 | 290 |
| 439 | 3300053177 | Ga0500636_0001051 | Ga0500636_0001051_4660_5541 | 290 |
| 440 | 3300053177 | Ga0500636_0016209 | Ga0500636_0016209_3134_4015 | 290 |
| 441 | 3300002987 | JGI25159J45721_1000002 | JGI25159J45721_10000023 | 291 |
| 442 | 3300003187 | JGI25151J46595_10033779 | JGI25151J46595_100337795 | 291 |
| 443 | 3300003354 | JGI25160J50197_1000008 | JGI25160J50197_10000083 | 291 |
| 444 | 3300003374 | JGI25161J50226_1000986 | JGI25161J50226_10009863 | 291 |
| 445 | 3300003771 | Ga0055526_1002661 | Ga0055526_100266112 | 291 |
| 446 | 3300003775 | Ga0055524_1001683 | Ga0055524_10016834 | 291 |
| 447 | 3300003781 | Ga0055536_1001156 | Ga0055536_10011563 | 291 |
| 448 | 3300003791 | Ga0055530_10012989 | Ga0055530_100129892 | 291 |
| 449 | 3300004625 | Ga0055543_1000027 | Ga0055543_1000027134 | 291 |
| 450 | 3300005262 | Ga0065165_1000015 | Ga0065165_10000154 | 291 |
| 451 | 3300006946 | Ga0079104_1001945 | Ga0079104_10019452 | 291 |
| 452 | 3300006946 | Ga0079104_1024882 | Ga0079104_10248822 | 291 |
| 453 | 3300013249 | Ga0171463_1011 | Ga0171463_10116 | 291 |
| 454 | 3300015690 | Ga0183363_1362 | Ga0183363_13626 | 291 |
| 455 | 3300021320 | Ga0214544_1022053 | Ga0214544_10220535 | 291 |
| 456 | 3300021321 | Ga0214542_1000006 | Ga0214542_1000006319 | 291 |
| 457 | 3300021327 | Ga0214543_1000014 | Ga0214543_10000144 | 291 |
| 458 | 3300021327 | Ga0214543_1022635 | Ga0214543_10226354 | 291 |
| 459 | 3300022739 | Ga0228711_1000015 | Ga0228711_100001562 | 291 |
| 460 | 3300022740 | Ga0228710_1000015 | Ga0228710_100001586 | 291 |
| 461 | 3300025208 | Ga0209436_109891 | Ga0209436_1098912 | 291 |
| 462 | 3300025273 | Ga0209673_1039255 | Ga0209673_10392553 | 291 |
| 463 | 3300025284 | Ga0209130_1000007 | Ga0209130_1000007300 | 291 |
| 464 | 3300025292 | Ga0209676_1001917 | Ga0209676_10019174 | 291 |
| 465 | 3300025294 | Ga0209025_1000303 | Ga0209025_100030330 | 291 |
| 466 | 3300025294 | Ga0209025_1000361 | Ga0209025_100036191 | 291 |
| 467 | 3300025295 | Ga0209564_1000296 | Ga0209564_100029694 | 291 |
| 468 | 3300025298 | Ga0209050_1017392 | Ga0209050_10173924 | 291 |
| 469 | 3300025299 | Ga0209256_1003048 | Ga0209256_10030484 | 291 |
| 470 | 3300025299 | Ga0209256_1018331 | Ga0209256_10183313 | 291 |
| 471 | 3300025302 | Ga0207426_1000064 | Ga0207426_1000064300 | 291 |
| 472 | 3300025303 | Ga0209051_1021865 | Ga0209051_10218654 | 291 |
| 473 | 3300025304 | Ga0209257_1000817 | Ga0209257_100081751 | 291 |
| 474 | 3300027111 | Ga0209281_1000339 | Ga0209281_100033976 | 291 |
| 475 | 3300027111 | Ga0209281_1001295 | Ga0209281_100129515 | 291 |
| 476 | 3300027666 | Ga0209282_1000054 | Ga0209282_100005471 | 291 |
| 477 | 3300028794 | Ga0307515_10001636 | Ga0307515_100016364 | 291 |
| 478 | 3300031456 | Ga0307513_10006680 | Ga0307513_1000668013 | 291 |
| 479 | 3300031548 | Ga0307408_100072916 | Ga0307408_1000729164 | 291 |
| 480 | 3300031967 | Ga0315914_1000013 | Ga0315914_100001362 | 291 |
| 481 | 3300033430 | Ga0315913_1000097 | Ga0315913_100009762 | 291 |
| 482 | 3300033464 | Ga0315915_1000001 | Ga0315915_100000162 | 291 |
| 483 | 3300037471 | Ga0395905_0013381 | Ga0395905_0013381_677_1666 | 291 |
| 484 | 3300041404 | Ga0439436_0049072 | Ga0439436_0049072_149_1024 | 291 |
| 485 | 3300041411 | Ga0439466_0065366 | Ga0439466_0065366_130_1005 | 291 |
| 486 | 3300042007 | Ga0439449_0009113 | Ga0439449_0009113_2140_3015 | 291 |
| 487 | 3300053140 | Ga0500573_0047899 | Ga0500573_0047899_1292_2167 | 291 |
| 488 | iso_pu_bacteria | 2791355256 | 2793296403 | 291 |
| 489 | iso_pu_bacteria | 2791355262 | 2793333821 | 291 |
| 490 | iso_pu_bacteria | 2838661181 | 2838662944 | 291 |
| 491 | iso_pu_bacteria | 2509276021 | 2509387474 | 292 |
| 492 | iso_pu_bacteria | 2510065019 | 2510132513 | 292 |
| 493 | iso_pu_bacteria | 2510461076 | 2510898881 | 292 |
| 494 | iso_pu_bacteria | 2510917028 | 2511183110 | 292 |
| 495 | iso_pu_bacteria | 2510917030 | 2511199009 | 292 |
| 496 | iso_pu_bacteria | 2513237084 | 2513569351 | 292 |
| 497 | iso_pu_bacteria | 2513237085 | 2513579021 | 292 |
| 498 | iso_pu_bacteria | 2513237088 | 2513596366 | 292 |
| 499 | iso_pu_bacteria | 2513237093 | 2513632542 | 292 |
| 500 | iso_pu_bacteria | 2513237103 | 2513708991 | 292 |
| 501 | iso_pu_bacteria | 2513237138 | 2513868895 | 292 |
| 502 | iso_pu_bacteria | 2513237144 | 2513908877 | 292 |
| 503 | iso_pu_bacteria | 2513237146 | 2513930703 | 292 |
| 504 | iso_pu_bacteria | 2513237162 | 2514020529 | 292 |
| 505 | iso_pu_bacteria | 2515075009 | 2515111503 | 292 |
| 506 | iso_pu_bacteria | 2515154114 | 2515644186 | 292 |
| 507 | iso_pu_bacteria | 2515154116 | 2515660379 | 292 |
| 508 | iso_pu_bacteria | 2515154134 | 2515740684 | 292 |
| 509 | iso_pu_bacteria | 2516653077 | 2517040149 | 292 |
| 510 | iso_pu_bacteria | 2516653085 | 2517075691 | 292 |
| 511 | iso_pu_bacteria | 2517093000 | 2517094280 | 292 |
| 512 | iso_pu_bacteria | 2517287029 | 2517406082 | 292 |
| 513 | iso_pu_bacteria | 2519899620 | 2520375150 | 292 |
| 514 | iso_pu_bacteria | 2529292951 | 2530643676 | 292 |
| 515 | iso_pu_bacteria | 2534681796 | 2535515834 | 292 |
| 516 | iso_pu_bacteria | 2582581294 | 2585203192 | 292 |
| 517 | iso_pu_bacteria | 2582581298 | 2585221288 | 292 |
| 518 | iso_pu_bacteria | 2582581299 | 2585233689 | 292 |
| 519 | iso_pu_bacteria | 2582581304 | 2585256501 | 292 |
| 520 | iso_pu_bacteria | 2582581867 | 2585400009 | 292 |
| 521 | iso_pu_bacteria | 2585427526 | 2585529480 | 292 |
| 522 | iso_pu_bacteria | 2585427528 | 2585541223 | 292 |
| 523 | iso_pu_bacteria | 2585427529 | 2585549490 | 292 |
| 524 | iso_pu_bacteria | 2585427590 | 2585822567 | 292 |
| 525 | iso_pu_bacteria | 2585427593 | 2585839644 | 292 |
| 526 | iso_pu_bacteria | 2585427594 | 2585847106 | 292 |
| 527 | iso_pu_bacteria | 2599185170 | 2599418355 | 292 |
| 528 | iso_pu_bacteria | 2615840624 | 2616296007 | 292 |
| 529 | iso_pu_bacteria | 2643221599 | 2644008036 | 292 |
| 530 | iso_pu_bacteria | 2643221634 | 2644196120 | 292 |
| 531 | iso_pu_bacteria | 2718217882 | 2719180488 | 292 |
| 532 | iso_pu_bacteria | 2718217927 | 2719385082 | 292 |
| 533 | iso_pu_bacteria | 2718217997 | 2719664841 | 292 |
| 534 | iso_pu_bacteria | 2718218009 | 2719731237 | 292 |
| 535 | iso_pu_bacteria | 2718218199 | 2720491261 | 292 |
| 536 | iso_pu_bacteria | 2718218232 | 2720612621 | 292 |
| 537 | iso_pu_bacteria | 2718218233 | 2720619459 | 292 |
| 538 | iso_pu_bacteria | 2718218235 | 2720630915 | 292 |
| 539 | iso_pu_bacteria | 2718218269 | 2720774553 | 292 |
| 540 | iso_pu_bacteria | 2718218363 | 2721146582 | 292 |
| 541 | iso_pu_bacteria | 2718218365 | 2721158107 | 292 |
| 542 | iso_pu_bacteria | 2718218366 | 2721163461 | 292 |
| 543 | iso_pu_bacteria | 2718218423 | 2721398802 | 292 |
| 544 | iso_pu_bacteria | 2721755514 | 2722839631 | 292 |
| 545 | iso_pu_bacteria | 2721755556 | 2723026278 | 292 |
| 546 | iso_pu_bacteria | 2721755684 | 2723559821 | 292 |
| 547 | iso_pu_bacteria | 2721755685 | 2723566441 | 292 |
| 548 | iso_pu_bacteria | 2721755809 | 2724037615 | 292 |
| 549 | iso_pu_bacteria | 2721755810 | 2724043993 | 292 |
| 550 | iso_pu_bacteria | 2721755819 | 2724089160 | 292 |
| 551 | iso_pu_bacteria | 2721755822 | 2724103706 | 292 |
| 552 | iso_pu_bacteria | 2721755823 | 2724109544 | 292 |
| 553 | iso_pu_bacteria | 2724679232 | 2725945524 | 292 |
| 554 | iso_pu_bacteria | 2728369352 | 2730107214 | 292 |
| 555 | iso_pu_bacteria | 2728369365 | 2730163725 | 292 |
| 556 | iso_pu_bacteria | 2728369397 | 2730297739 | 292 |
| 557 | iso_pu_bacteria | 2738541293 | 2738802270 | 292 |
| 558 | iso_pu_bacteria | 2738541333 | 2739036104 | 292 |
| 559 | iso_pu_bacteria | 2765235942 | 2766063745 | 292 |
| 560 | iso_pu_bacteria | 2791355260 | 2793320885 | 292 |
| 561 | iso_pu_bacteria | 2791355261 | 2793326927 | 292 |
| 562 | iso_pu_bacteria | 2791355263 | 2793339576 | 292 |
| 563 | iso_pu_bacteria | 2791355265 | 2793354990 | 292 |
| 564 | iso_pu_bacteria | 2791355266 | 2793359135 | 292 |
| 565 | iso_pu_bacteria | 2791355267 | 2793368056 | 292 |
| 566 | iso_pu_bacteria | 2802429605 | 2805926371 | 292 |
| 567 | iso_pu_bacteria | 2802429606 | 2805933176 | 292 |
| 568 | iso_pu_bacteria | 2802429633 | 2806048858 | 292 |
| 569 | iso_pu_bacteria | 2802429634 | 2806052300 | 292 |
| 570 | iso_pu_bacteria | 2802429635 | 2806058929 | 292 |
| 571 | iso_pu_bacteria | 2802429636 | 2806067284 | 292 |
| 572 | iso_pu_bacteria | 2802429637 | 2806074195 | 292 |
| 573 | iso_pu_bacteria | 2838016132 | 2838017509 | 292 |
| 574 | iso_pu_bacteria | 2838022645 | 2838022923 | 292 |
| 575 | iso_pu_bacteria | 2838035591 | 2838037955 | 292 |
| 576 | iso_pu_bacteria | 2838042994 | 2838046156 | 292 |
| 577 | iso_pu_bacteria | 2838048938 | 2838049009 | 292 |
| 578 | iso_pu_bacteria | 2838061910 | 2838063560 | 292 |
| 579 | iso_pu_bacteria | 2838068647 | 2838072787 | 292 |
| 580 | iso_pu_bacteria | 2838668709 | 2838671057 | 292 |
| 581 | iso_pu_bacteria | 2838680041 | 2838681554 | 292 |
| 582 | iso_pu_bacteria | 2838686498 | 2838692756 | 292 |
| 583 | iso_pu_bacteria | 2838694306 | 2838694411 | 292 |
| 584 | iso_pu_bacteria | 2838701080 | 2838703428 | 292 |
| 585 | iso_pu_bacteria | 2838707686 | 2838707789 | 292 |
| 586 | iso_pu_bacteria | 2838729681 | 2838735058 | 292 |
| 587 | iso_pu_bacteria | 2838742623 | 2838747583 | 292 |
| 588 | iso_pu_bacteria | 2841851746 | 2841857294 | 292 |
| 589 | iso_pu_bacteria | 2841864319 | 2841865256 | 292 |
| 590 | iso_pu_bacteria | 2842077413 | 2842080980 | 292 |
| 591 | iso_pu_bacteria | 2842110456 | 2842117544 | 292 |
| 592 | iso_pu_bacteria | 2842118031 | 2842121599 | 292 |
| 593 | iso_pu_bacteria | 2842146304 | 2842147348 | 292 |
| 594 | iso_pu_bacteria | 2842156927 | 2842163248 | 292 |
| 595 | iso_pu_bacteria | 2842163707 | 2842168515 | 292 |
| 596 | iso_pu_bacteria | 2842180545 | 2842186852 | 292 |
| 597 | iso_pu_bacteria | 2842192696 | 2842197604 | 292 |
| 598 | iso_pu_bacteria | 2842198810 | 2842199352 | 292 |
| 599 | iso_pu_bacteria | 2842205361 | 2842210126 | 292 |
| 600 | iso_pu_bacteria | 2842217011 | 2842221423 | 292 |
| 601 | iso_pu_bacteria | 2842229732 | 2842234858 | 292 |
| 602 | iso_pu_bacteria | 2842237096 | 2842237200 | 292 |
| 603 | iso_pu_bacteria | 2842243621 | 2842248923 | 292 |
| 604 | iso_pu_bacteria | 2842250916 | 2842252414 | 292 |
| 605 | iso_pu_bacteria | 2842257432 | 2842262787 | 292 |
| 606 | iso_pu_bacteria | 2842264693 | 2842266688 | 292 |
| 607 | iso_pu_bacteria | 2842271015 | 2842277225 | 292 |
| 608 | iso_pu_bacteria | 2842278818 | 2842283580 | 292 |
| 609 | iso_pu_bacteria | 2842285085 | 2842286912 | 292 |
| 610 | iso_pu_bacteria | 2842291075 | 2842294636 | 292 |
| 611 | iso_pu_bacteria | 2842304105 | 2842310222 | 292 |
| 612 | iso_pu_bacteria | 2842311132 | 2842316821 | 292 |
| 613 | iso_pu_bacteria | 2842317721 | 2842318442 | 292 |
| 614 | iso_pu_bacteria | 2842341865 | 2842343378 | 292 |
| 615 | iso_pu_bacteria | 2842363717 | 2842365482 | 292 |
| 616 | iso_pu_bacteria | 2842370503 | 2842372017 | 292 |
| 617 | iso_pu_bacteria | 2842377471 | 2842381034 | 292 |
| 618 | iso_pu_bacteria | 2842384541 | 2842388105 | 292 |
| 619 | iso_pu_bacteria | 2842395702 | 2842398024 | 292 |
| 620 | iso_pu_bacteria | 2842402390 | 2842404180 | 292 |
| 621 | iso_pu_bacteria | 2842409023 | 2842411135 | 292 |
| 622 | iso_pu_bacteria | 2842415677 | 2842417409 | 292 |
| 623 | iso_pu_bacteria | 2842422224 | 2842426528 | 292 |
| 624 | iso_pu_bacteria | 2842428310 | 2842434762 | 292 |
| 625 | iso_pu_bacteria | 2842434925 | 2842437168 | 292 |
| 626 | iso_pu_bacteria | 2842441272 | 2842443260 | 292 |
| 627 | iso_pu_bacteria | 2842447887 | 2842452767 | 292 |
| 628 | iso_pu_bacteria | 2842462802 | 2842469123 | 292 |
| 629 | iso_pu_bacteria | 2842469257 | 2842471517 | 292 |
| 630 | iso_pu_bacteria | 2842489311 | 2842495173 | 292 |
| 631 | iso_pu_bacteria | 2842495871 | 2842497077 | 292 |
| 632 | iso_pu_bacteria | 2844454524 | 2844454907 | 292 |
| 633 | iso_pu_bacteria | 2857516855 | 2857521626 | 292 |
| 634 | iso_pu_bacteria | 2919100787 | 2919104054 | 292 |
| 635 | iso_pu_bacteria | 2923556063 | 2923557456 | 292 |
| 636 | iso_pu_bacteria | 2933016740 | 2933021991 | 292 |
| 637 | iso_pu_bacteria | 2933570622 | 2933576588 | 292 |
| 638 | iso_pu_bacteria | 2933586486 | 2933593641 | 292 |
| 639 | iso_pu_bacteria | 2933599457 | 2933603716 | 292 |
| 640 | iso_pu_bacteria | 2935894831 | 2935894934 | 292 |
| 641 | iso_pu_bacteria | 2935901341 | 2935903912 | 292 |
| 642 | iso_pu_bacteria | 2936367885 | 2936367888 | 292 |
| 643 | iso_pu_bacteria | 2936375103 | 2936381695 | 292 |
| 644 | iso_pu_bacteria | 2936381700 | 2936388093 | 292 |
| 645 | iso_pu_bacteria | 2996887358 | 2996888809 | 292 |
| 646 | iso_pu_bacteria | 2996893221 | 2996898846 | 292 |
| 647 | iso_pu_bacteria | 3005409236 | 3005412720 | 292 |
| 648 | iso_pu_bacteria | 3005452660 | 3005453589 | 292 |
| 649 | iso_pu_bacteria | 639633055 | 639647638 | 292 |
| 650 | iso_pu_bacteria | 8005258706 | 8005260080 | 292 |
| 651 | iso_pu_bacteria | 8005275841 | 8005279852 | 292 |
| 652 | iso_pu_bacteria | 8005282627 | 8005283418 | 292 |
| 653 | iso_pu_bacteria | 8005289223 | 8005292998 | 292 |
| 654 | iso_pu_bacteria | 8005307578 | 8005308600 | 292 |
| 655 | iso_pu_bacteria | 8005321885 | 8005323336 | 292 |
| 656 | iso_pu_bacteria | 8005382845 | 8005385783 | 292 |
| 657 | iso_pu_bacteria | 8005395548 | 8005400537 | 292 |
| 658 | iso_pu_bacteria | 8005430974 | 8005437325 | 292 |
| 659 | iso_pu_bacteria | 8005460587 | 8005462151 | 292 |
| 660 | iso_pu_bacteria | 8005497431 | 8005499570 | 292 |
| 661 | iso_pu_bacteria | 8005542996 | 8005544467 | 292 |
| 662 | iso_pu_bacteria | 8005556819 | 8005559758 | 292 |
| 663 | iso_pu_bacteria | 8005563573 | 8005570695 | 292 |
| 664 | iso_pu_bacteria | 8005570704 | 8005572896 | 292 |
| 665 | iso_pu_bacteria | 8005619151 | 8005620750 | 292 |
| 666 | iso_pu_bacteria | 8005626139 | 8005626888 | 292 |
| 667 | iso_pu_bacteria | 8005668836 | 8005670987 | 292 |
| 668 | iso_pu_bacteria | 8005688590 | 8005691235 | 292 |
| 669 | iso_pu_bacteria | 8005695170 | 8005698559 | 292 |
| 670 | iso_pu_bacteria | 8018127388 | 8018131542 | 292 |
| 671 | iso_pu_bacteria | 8018163183 | 8018169277 | 292 |
| 672 | iso_pu_bacteria | 8018176218 | 8018180177 | 292 |
| 673 | iso_pu_bacteria | 8023680758 | 8023681947 | 292 |
| 674 | iso_pu_bacteria | 8024479707 | 8024481374 | 292 |
| 675 | iso_pu_bacteria | 8024501048 | 8024503041 | 292 |
| 676 | iso_pu_bacteria | 8056375014 | 8056380942 | 292 |
| 677 | iso_pu_bacteria | 8056382006 | 8056384532 | 292 |
| 678 | iso_pu_bacteria | 8057874678 | 8057876523 | 292 |
| 679 | 3300002987 | JGI25159J45721_1003547 | JGI25159J45721_10035477 | 294 |
| 680 | 3300003214 | JGI25165J46597_1006328 | JGI25165J46597_10063283 | 294 |
| 681 | 3300003354 | JGI25160J50197_1003935 | JGI25160J50197_10039355 | 294 |
| 682 | 3300003374 | JGI25161J50226_1000014 | JGI25161J50226_1000014196 | 294 |
| 683 | 3300004625 | Ga0055543_1000109 | Ga0055543_100010974 | 294 |
| 684 | 3300005262 | Ga0065165_1000915 | Ga0065165_10009157 | 294 |
| 685 | 3300005367 | Ga0070667_100234492 | Ga0070667_1002344922 | 294 |
| 686 | 3300005563 | Ga0068855_100180241 | Ga0068855_1001802412 | 294 |
| 687 | 3300005834 | Ga0068851_10018396 | Ga0068851_100183961 | 294 |
| 688 | 3300009093 | Ga0105240_10004701 | Ga0105240_100047016 | 294 |
| 689 | 3300009545 | Ga0105237_10002935 | Ga0105237_100029355 | 294 |
| 690 | 3300013104 | Ga0157370_10007253 | Ga0157370_100072533 | 294 |
| 691 | 3300015265 | Ga0182005_1008917 | Ga0182005_10089175 | 294 |
| 692 | 3300025208 | Ga0209436_111918 | Ga0209436_1119182 | 294 |
| 693 | 3300025253 | Ga0209677_101074 | Ga0209677_10107412 | 294 |
| 694 | 3300025261 | Ga0209233_1001047 | Ga0209233_100104711 | 294 |
| 695 | 3300025284 | Ga0209130_1000018 | Ga0209130_100001825 | 294 |
| 696 | 3300025302 | Ga0207426_1000044 | Ga0207426_1000044365 | 294 |
| 697 | 3300025913 | Ga0207695_10003914 | Ga0207695_1000391418 | 294 |
| 698 | 3300025914 | Ga0207671_10012250 | Ga0207671_100122508 | 294 |
| 699 | 3300025949 | Ga0207667_10553377 | Ga0207667_105533771 | 294 |
| 700 | 3300048905 | Ga0496102_0050644 | Ga0496102_0050644_420_1328 | 294 |
| 701 | 3300048919 | Ga0496116_0128141 | Ga0496116_0128141_131_1039 | 294 |
| 702 | 3300048920 | Ga0496117_0006432 | Ga0496117_0006432_387_1295 | 294 |
| 703 | 3300048921 | Ga0496118_0007239 | Ga0496118_0007239_387_1295 | 294 |
| 704 | 3300048922 | Ga0496119_0139703 | Ga0496119_0139703_88_996 | 294 |
| 705 | 3300048923 | Ga0496120_0038438 | Ga0496120_0038438_1792_2700 | 294 |
| 706 | 3300048924 | Ga0496121_0003794 | Ga0496121_0003794_9756_10664 | 294 |
| 707 | 3300048925 | Ga0496122_0012241 | Ga0496122_0012241_4065_4973 | 294 |
| 708 | 3300048926 | Ga0496123_0012453 | Ga0496123_0012453_4127_5035 | 294 |
| 709 | 3300048927 | Ga0496124_0066083 | Ga0496124_0066083_1792_2700 | 294 |
| 710 | 3300048929 | Ga0496126_0039838 | Ga0496126_0039838_750_1658 | 294 |
| 711 | 3300002773 | JGI25152J39213_1002523 | JGI25152J39213_10025232 | 295 |
| 712 | 3300002773 | JGI25152J39213_1003647 | JGI25152J39213_10036471 | 295 |
| 713 | 3300002773 | JGI25152J39213_1012472 | JGI25152J39213_10124722 | 295 |
| 714 | 3300002774 | JGI25150J39212_1000153 | JGI25150J39212_100015343 | 295 |
| 715 | 3300002774 | JGI25150J39212_1002615 | JGI25150J39212_10026154 | 295 |
| 716 | 3300002987 | JGI25159J45721_1005935 | JGI25159J45721_10059353 | 295 |
| 717 | 3300003187 | JGI25151J46595_10000108 | JGI25151J46595_10000108112 | 295 |
| 718 | 3300003187 | JGI25151J46595_10004679 | JGI25151J46595_100046793 | 295 |
| 719 | 3300003187 | JGI25151J46595_10005084 | JGI25151J46595_100050843 | 295 |
| 720 | 3300003215 | JGI25153J46596_10006470 | JGI25153J46596_100064709 | 295 |
| 721 | 3300003215 | JGI25153J46596_10007593 | JGI25153J46596_100075932 | 295 |
| 722 | 3300003215 | JGI25153J46596_10016965 | JGI25153J46596_100169652 | 295 |
| 723 | 3300003374 | JGI25161J50226_1000839 | JGI25161J50226_100083911 | 295 |
| 724 | 3300003374 | JGI25161J50226_1006713 | JGI25161J50226_10067135 | 295 |
| 725 | 3300003775 | Ga0055524_1007422 | Ga0055524_10074223 | 295 |
| 726 | 3300003775 | Ga0055524_1016863 | Ga0055524_10168632 | 295 |
| 727 | 3300003790 | Ga0055528_1004080 | Ga0055528_10040803 | 295 |
| 728 | 3300003790 | Ga0055528_1004197 | Ga0055528_100419711 | 295 |
| 729 | 3300003790 | Ga0055528_1006267 | Ga0055528_10062676 | 295 |
| 730 | 3300003790 | Ga0055528_1016805 | Ga0055528_10168055 | 295 |
| 731 | 3300003792 | Ga0055540_1003094 | Ga0055540_10030943 | 295 |
| 732 | 3300003792 | Ga0055540_1003655 | Ga0055540_10036559 | 295 |
| 733 | 3300003792 | Ga0055540_1038030 | Ga0055540_10380301 | 295 |
| 734 | 3300004625 | Ga0055543_1000193 | Ga0055543_10001935 | 295 |
| 735 | 3300004625 | Ga0055543_1004741 | Ga0055543_10047417 | 295 |
| 736 | 3300005262 | Ga0065165_1004124 | Ga0065165_10041249 | 295 |
| 737 | 3300005262 | Ga0065165_1019249 | Ga0065165_10192492 | 295 |
| 738 | 3300005262 | Ga0065165_1021974 | Ga0065165_10219745 | 295 |
| 739 | 3300005347 | Ga0070668_100202824 | Ga0070668_1002028241 | 295 |
| 740 | 3300006038 | Ga0075365_10094626 | Ga0075365_100946262 | 295 |
| 741 | 3300006048 | Ga0075363_100114733 | Ga0075363_1001147332 | 295 |
| 742 | 3300006048 | Ga0075363_100145860 | Ga0075363_1001458603 | 295 |
| 743 | 3300006177 | Ga0075362_10004901 | Ga0075362_100049015 | 295 |
| 744 | 3300006178 | Ga0075367_10005429 | Ga0075367_1000542910 | 295 |
| 745 | 3300006178 | Ga0075367_10061958 | Ga0075367_100619581 | 295 |
| 746 | 3300006178 | Ga0075367_10221576 | Ga0075367_102215761 | 295 |
| 747 | 3300006186 | Ga0075369_10018710 | Ga0075369_100187105 | 295 |
| 748 | 3300006195 | Ga0075366_10091007 | Ga0075366_100910071 | 295 |
| 749 | 3300006353 | Ga0075370_10012045 | Ga0075370_100120456 | 295 |
| 750 | 3300012490 | Ga0157322_1000552 | Ga0157322_10005522 | 295 |
| 751 | 3300025208 | Ga0209436_100075 | Ga0209436_10007528 | 295 |
| 752 | 3300025245 | Ga0207425_1000031 | Ga0207425_10000315 | 295 |
| 753 | 3300025245 | Ga0207425_1019089 | Ga0207425_10190892 | 295 |
| 754 | 3300025258 | Ga0209129_1000053 | Ga0209129_10000536 | 295 |
| 755 | 3300025258 | Ga0209129_1000285 | Ga0209129_10002854 | 295 |
| 756 | 3300025258 | Ga0209129_1003123 | Ga0209129_100312310 | 295 |
| 757 | 3300025258 | Ga0209129_1007223 | Ga0209129_10072232 | 295 |
| 758 | 3300025273 | Ga0209673_1000041 | Ga0209673_1000041328 | 295 |
| 759 | 3300025273 | Ga0209673_1001438 | Ga0209673_100143820 | 295 |
| 760 | 3300025273 | Ga0209673_1001549 | Ga0209673_100154917 | 295 |
| 761 | 3300025273 | Ga0209673_1003714 | Ga0209673_100371412 | 295 |
| 762 | 3300025273 | Ga0209673_1043499 | Ga0209673_10434992 | 295 |
| 763 | 3300025284 | Ga0209130_1000006 | Ga0209130_1000006323 | 295 |
| 764 | 3300025292 | Ga0209676_1044033 | Ga0209676_10440332 | 295 |
| 765 | 3300025294 | Ga0209025_1000087 | Ga0209025_10000875 | 295 |
| 766 | 3300025294 | Ga0209025_1000440 | Ga0209025_100044075 | 295 |
| 767 | 3300025294 | Ga0209025_1004972 | Ga0209025_10049724 | 295 |
| 768 | 3300025294 | Ga0209025_1015852 | Ga0209025_10158525 | 295 |
| 769 | 3300025294 | Ga0209025_1063087 | Ga0209025_10630872 | 295 |
| 770 | 3300025295 | Ga0209564_1000640 | Ga0209564_10006406 | 295 |
| 771 | 3300025295 | Ga0209564_1000652 | Ga0209564_10006526 | 295 |
| 772 | 3300025295 | Ga0209564_1001439 | Ga0209564_100143921 | 295 |
| 773 | 3300025295 | Ga0209564_1005795 | Ga0209564_10057959 | 295 |
| 774 | 3300025297 | Ga0209758_1000081 | Ga0209758_10000815 | 295 |
| 775 | 3300025297 | Ga0209758_1000717 | Ga0209758_10007176 | 295 |
| 776 | 3300025297 | Ga0209758_1002836 | Ga0209758_100283615 | 295 |
| 777 | 3300025297 | Ga0209758_1006242 | Ga0209758_100624211 | 295 |
| 778 | 3300025299 | Ga0209256_1004700 | Ga0209256_100470012 | 295 |
| 779 | 3300025299 | Ga0209256_1005851 | Ga0209256_10058519 | 295 |
| 780 | 3300025299 | Ga0209256_1011473 | Ga0209256_10114735 | 295 |
| 781 | 3300025299 | Ga0209256_1014956 | Ga0209256_10149566 | 295 |
| 782 | 3300025302 | Ga0207426_1000119 | Ga0207426_10001196 | 295 |
| 783 | 3300025302 | Ga0207426_1000231 | Ga0207426_100023199 | 295 |
| 784 | 3300025303 | Ga0209051_1002625 | Ga0209051_100262513 | 295 |
| 785 | 3300025303 | Ga0209051_1003932 | Ga0209051_10039327 | 295 |
| 786 | 3300025303 | Ga0209051_1021924 | Ga0209051_10219242 | 295 |
| 787 | 3300025303 | Ga0209051_1062919 | Ga0209051_10629191 | 295 |
| 788 | 3300025304 | Ga0209257_1005720 | Ga0209257_100572012 | 295 |
| 789 | 3300028794 | Ga0307515_10061088 | Ga0307515_100610889 | 295 |
| 790 | 3300031731 | Ga0307405_10050597 | Ga0307405_100505975 | 295 |
| 791 | 3300031911 | Ga0307412_10008803 | Ga0307412_100088038 | 295 |
| 792 | 3300041413 | Ga0439465_0036015 | Ga0439465_0036015_386_1276 | 295 |
| 793 | 3300041413 | Ga0439465_0047441 | Ga0439465_0047441_166_1056 | 295 |
| 794 | 3300042007 | Ga0439449_0017670 | Ga0439449_0017670_1404_2294 | 295 |
| 795 | 3300044765 | Ga0466970_0006167 | Ga0466970_0006167_2953_3861 | 295 |
| 796 | 3300046453 | Ga0495627_044109 | Ga0495627_044109_42_932 | 295 |
| 797 | 3300046506 | Ga0495583_0005892 | Ga0495583_0005892_2729_3619 | 295 |
| 798 | 3300046512 | Ga0495610_0006312 | Ga0495610_0006312_5967_6857 | 295 |
| 799 | 3300046512 | Ga0495610_0046380 | Ga0495610_0046380_600_1490 | 295 |
| 800 | 3300046513 | Ga0495616_0069025 | Ga0495616_0069025_115_1005 | 295 |
| 801 | 3300046519 | Ga0495632_0007495 | Ga0495632_0007495_4652_5542 | 295 |
| 802 | 3300046522 | Ga0495643_0031311 | Ga0495643_0031311_290_1180 | 295 |
| 803 | 3300046694 | Ga0495649_0058104 | Ga0495649_0058104_109_999 | 295 |
| 804 | 3300047472 | Ga0495686_0039822 | Ga0495686_0039822_2089_2979 | 295 |
| 805 | 3300047472 | Ga0495686_0092438 | Ga0495686_0092438_46_936 | 295 |
| 806 | 3300048904 | Ga0496101_0277464 | Ga0496101_0277464_24_914 | 295 |
| 807 | 3300048909 | Ga0496106_0007845 | Ga0496106_0007845_5533_6423 | 295 |
| 808 | 3300048919 | Ga0496116_0008412 | Ga0496116_0008412_7957_8847 | 295 |
| 809 | 3300048919 | Ga0496116_0011264 | Ga0496116_0011264_110_1000 | 295 |
| 810 | 3300048919 | Ga0496116_0117374 | Ga0496116_0117374_83_973 | 295 |
| 811 | 3300048920 | Ga0496117_0036996 | Ga0496117_0036996_2677_3567 | 295 |
| 812 | 3300048920 | Ga0496117_0089470 | Ga0496117_0089470_705_1595 | 295 |
| 813 | 3300048921 | Ga0496118_0039631 | Ga0496118_0039631_191_1081 | 295 |
| 814 | 3300048921 | Ga0496118_0151282 | Ga0496118_0151282_160_1050 | 295 |
| 815 | 3300048922 | Ga0496119_0034739 | Ga0496119_0034739_245_1135 | 295 |
| 816 | 3300048924 | Ga0496121_0009418 | Ga0496121_0009418_8865_9755 | 295 |
| 817 | 3300048924 | Ga0496121_0038542 | Ga0496121_0038542_1079_1969 | 295 |
| 818 | 3300048925 | Ga0496122_0022833 | Ga0496122_0022833_2704_3594 | 295 |
| 819 | 3300048925 | Ga0496122_0114081 | Ga0496122_0114081_699_1589 | 295 |
| 820 | 3300048926 | Ga0496123_0007644 | Ga0496123_0007644_7948_8838 | 295 |
| 821 | 3300048926 | Ga0496123_0112812 | Ga0496123_0112812_522_1412 | 295 |
| 822 | 3300048926 | Ga0496123_0163342 | Ga0496123_0163342_106_996 | 295 |
| 823 | 3300048927 | Ga0496124_0026193 | Ga0496124_0026193_3980_4870 | 295 |
| 824 | 3300048927 | Ga0496124_0044913 | Ga0496124_0044913_113_1003 | 295 |
| 825 | 3300048927 | Ga0496124_0163634 | Ga0496124_0163634_189_1079 | 295 |
| 826 | 3300048928 | Ga0496125_0016573 | Ga0496125_0016573_3375_4265 | 295 |
| 827 | 3300048929 | Ga0496126_0044472 | Ga0496126_0044472_146_1036 | 295 |
| 828 | 3300048929 | Ga0496126_0306511 | Ga0496126_0306511_401_1291 | 295 |
| 829 | 3300049580 | Ga0501046_0256338 | Ga0501046_0256338_265_1155 | 295 |
| 830 | 3300050489 | nmdc:mga03683_12158_c1 | nmdc:mga03683_12158_c1_495_1385 | 295 |
| 831 | 3300050492 | nmdc:mga0yw44_5539_c1 | nmdc:mga0yw44_5539_c1_4146_5036 | 295 |
| 832 | 3300050493 | nmdc:mga0k408_5841_c1 | nmdc:mga0k408_5841_c1_4861_5751 | 295 |
| 833 | 3300050494 | nmdc:mga06z11_5276_c1 | nmdc:mga06z11_5276_c1_454_1344 | 295 |
| 834 | 3300050496 | nmdc:mga07m45_36026_c1 | nmdc:mga07m45_36026_c1_1231_2121 | 295 |
| 835 | 3300050516 | nmdc:mga0sz30_6040_c1 | nmdc:mga0sz30_6040_c1_141_1031 | 295 |
| 836 | 3300053093 | Ga0500651_0159814 | Ga0500651_0159814_352_1242 | 295 |
| 837 | 3300053125 | Ga0500618_006831 | Ga0500618_006831_1088_1978 | 295 |
| 838 | 3300053134 | Ga0500658_0077727 | Ga0500658_0077727_217_1107 | 295 |
| 839 | 3300053139 | Ga0500568_0009947 | Ga0500568_0009947_2869_3759 | 295 |
| 840 | 3300053139 | Ga0500568_0028794 | Ga0500568_0028794_511_1401 | 295 |
| 841 | 3300053156 | Ga0500622_0002236 | Ga0500622_0002236_1077_1967 | 295 |
| 842 | 3300061719 | Ga0466962_0110495 | Ga0466962_0110495_398_1306 | 295 |
| 843 | iso_pu_bacteria | 2524023209 | 2524463285 | 298 |
| 844 | iso_pu_bacteria | 2582581308 | 2585283696 | 298 |
| 845 | iso_pu_bacteria | 2582581316 | 2585329331 | 298 |
| 846 | iso_pu_bacteria | 2585427527 | 2585530951 | 298 |
| 847 | iso_pu_bacteria | 2585427530 | 2585557919 | 298 |
| 848 | iso_pu_bacteria | 2615840626 | 2616312072 | 298 |
| 849 | iso_pu_bacteria | 2615840698 | 2616554173 | 298 |
| 850 | iso_pu_bacteria | 2617270742 | 2617381466 | 298 |
| 851 | iso_pu_bacteria | 2667528174 | 2671114797 | 298 |
| 852 | iso_pu_bacteria | 2775507266 | 2778177711 | 298 |
| 853 | iso_pu_bacteria | 2818991448 | 2819611373 | 298 |
| 854 | iso_pu_bacteria | 2818991453 | 2819638399 | 298 |
| 855 | iso_pu_bacteria | 2838029111 | 2838032422 | 298 |
| 856 | iso_pu_bacteria | 2842298080 | 2842303994 | 298 |
| 857 | iso_pu_bacteria | 2842357229 | 2842361377 | 298 |
| 858 | iso_pu_bacteria | 2842475841 | 2842478949 | 298 |
| 859 | iso_pu_bacteria | 2842482326 | 2842483080 | 298 |
| 860 | iso_pu_bacteria | 2842502639 | 2842506331 | 298 |
| 861 | iso_pu_bacteria | 2842509118 | 2842509954 | 298 |
| 862 | iso_pu_bacteria | 2852387548 | 2852389324 | 298 |
| 863 | iso_pu_bacteria | 2919408235 | 2919409536 | 298 |
| 864 | iso_pu_bacteria | 3005416602 | 3005417781 | 298 |
| 865 | iso_pu_bacteria | 8005314921 | 8005316489 | 298 |
| 866 | iso_pu_bacteria | 8005484373 | 8005485400 | 298 |
| 867 | iso_pu_bacteria | 8005645114 | 8005650075 | 298 |
| 868 | iso_pu_bacteria | 8005682033 | 8005686605 | 298 |
| 869 | iso_pu_bacteria | 8024486573 | 8024489523 | 298 |
| 870 | iso_pu_bacteria | 8046767195 | 8046768275 | 298 |
| 871 | iso_pu_bacteria | 8057575449 | 8057577061 | 298 |
| 872 | 3300046460 | Ga0495638_0001063 | Ga0495638_0001063_24135_25034 | 299 |
| 873 | 3300046492 | Ga0495585_0021779 | Ga0495585_0021779_2148_3047 | 299 |
| 874 | 3300046501 | Ga0495607_0131150 | Ga0495607_0131150_129_1028 | 299 |
| 875 | 3300046506 | Ga0495583_0026515 | Ga0495583_0026515_1510_2409 | 299 |
| 876 | 3300046513 | Ga0495616_0104691 | Ga0495616_0104691_387_1286 | 299 |
| 877 | 3300046515 | Ga0495620_0074437 | Ga0495620_0074437_354_1253 | 299 |
| 878 | 3300046518 | Ga0495631_0009977 | Ga0495631_0009977_3117_4016 | 299 |
| 879 | 3300046522 | Ga0495643_0057513 | Ga0495643_0057513_529_1428 | 299 |
| 880 | 3300046538 | Ga0495609_0028041 | Ga0495609_0028041_489_1388 | 299 |
| 881 | 3300046660 | Ga0495625_0010082 | Ga0495625_0010082_6258_7157 | 299 |
| 882 | 3300046810 | Ga0495660_0053967 | Ga0495660_0053967_810_1709 | 299 |
| 883 | 3300047320 | Ga0495672_0012037 | Ga0495672_0012037_4463_5362 | 299 |
| 884 | 3300049459 | Ga0495678_051710 | Ga0495678_051710_69_968 | 299 |
| 885 | 3300053118 | Ga0500594_0000757 | Ga0500594_0000757_5388_6287 | 299 |
| 886 | 3300053134 | Ga0500658_0165042 | Ga0500658_0165042_45_944 | 299 |
| 887 | 3300053139 | Ga0500568_0001996 | Ga0500568_0001996_10826_11725 | 299 |
| 888 | 3300053153 | Ga0500616_0025961 | Ga0500616_0025961_714_1613 | 299 |
| 889 | 3300048924 | Ga0496121_0121718 | Ga0496121_0121718_488_1390 | 300 |
| 890 | 3300046459 | Ga0495629_0062690 | Ga0495629_0062690_801_1706 | 301 |
| 891 | 3300046476 | Ga0495662_0004497 | Ga0495662_0004497_871_1776 | 301 |
| 892 | 3300046507 | Ga0495606_0020058 | Ga0495606_0020058_3272_4192 | 301 |
| 893 | 3300046557 | Ga0495622_0017513 | Ga0495622_0017513_195_1100 | 301 |
| 894 | 3300046675 | Ga0495657_0084509 | Ga0495657_0084509_727_1632 | 301 |
| 895 | 3300046681 | Ga0495647_0056346 | Ga0495647_0056346_518_1423 | 301 |
| 896 | 3300047317 | Ga0495604_0046794 | Ga0495604_0046794_892_1797 | 301 |
| 897 | 3300047472 | Ga0495686_0081255 | Ga0495686_0081255_115_1035 | 301 |
| 898 | 3300053148 | Ga0500590_004391 | Ga0500590_004391_862_1767 | 301 |
| 899 | 3300002704 | JGI25155J39150_1000019 | JGI25155J39150_1000019167 | 302 |
| 900 | 3300002705 | JGI25156J39149_1000020 | JGI25156J39149_10000205 | 302 |
| 901 | 3300002737 | JGI25162J39368_1001894 | JGI25162J39368_10018949 | 302 |
| 902 | 3300002737 | JGI25162J39368_1002010 | JGI25162J39368_10020108 | 302 |
| 903 | 3300002738 | JGI25154J39366_1000355 | JGI25154J39366_100035525 | 302 |
| 904 | 3300002741 | JGI25157J39369_1000129 | JGI25157J39369_10001294 | 302 |
| 905 | 3300003214 | JGI25165J46597_1001808 | JGI25165J46597_10018088 | 302 |
| 906 | 3300003214 | JGI25165J46597_1002226 | JGI25165J46597_10022261 | 302 |
| 907 | 3300003320 | rootH2_10064249 | rootH2_100642492 | 302 |
| 908 | 3300003322 | rootL2_10015680 | rootL2_100156807 | 302 |
| 909 | 3300003323 | rootH1_10129292 | rootH1_101292927 | 302 |
| 910 | 3300005331 | Ga0070670_100012947 | Ga0070670_1000129473 | 302 |
| 911 | 3300025206 | Ga0209435_100024 | Ga0209435_100024162 | 302 |
| 912 | 3300025233 | Ga0209437_100033 | Ga0209437_100033502 | 302 |
| 913 | 3300025233 | Ga0209437_100075 | Ga0209437_1000755 | 302 |
| 914 | 3300025246 | Ga0209646_1000064 | Ga0209646_1000064162 | 302 |
| 915 | 3300025250 | Ga0209026_1000053 | Ga0209026_1000053162 | 302 |
| 916 | 3300025256 | Ga0209759_1000042 | Ga0209759_1000042162 | 302 |
| 917 | 3300025261 | Ga0209233_1000262 | Ga0209233_100026272 | 302 |
| 918 | 3300025261 | Ga0209233_1000277 | Ga0209233_10002775 | 302 |
| 919 | 3300025272 | Ga0209455_1014930 | Ga0209455_10149302 | 302 |
| 920 | 3300025925 | Ga0207650_10060240 | Ga0207650_100602403 | 302 |
| 921 | 3300046471 | Ga0495650_0018078 | Ga0495650_0018078_2152_3063 | 302 |
| 922 | 3300047472 | Ga0495686_0021587 | Ga0495686_0021587_3152_4060 | 302 |
| 923 | 3300048922 | Ga0496119_0049630 | Ga0496119_0049630_1409_2317 | 302 |
| 924 | 3300048925 | Ga0496122_0056646 | Ga0496122_0056646_1501_2409 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gz0-assembly4.cif.gz_E | 23s ribosomal rna g2251 2'o-methyltransferase rlmb | 0.8496 | 146 | 298 |
| 3nk7-assembly1.cif.gz_B | structure of the nosiheptide-resistance methyltransferase s-adenosyl-l-methionine complex | 0.8475 | 67 | 301 |
| 3nk6-assembly1.cif.gz_B | structure of the nosiheptide-resistance methyltransferase | 0.8402 | 67 | 301 |
| 3nk6-assembly1.cif.gz_A | structure of the nosiheptide-resistance methyltransferase | 0.8363 | 68 | 298 |
| 5co4-assembly1.cif.gz_A | structural insights into the 2-oh methylation of c/u34 on trna | 0.8294 | 152 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q76NT0_373_525_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8665 | 153 | 295 | 3.40.1280.10 |
| af_P9WFY5_148_322_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8613 | 146 | 302 | 3.40.1280.10 |
| af_P94978_97_258_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8553 | 144 | 300 | 3.40.1280.10 |
| af_C6TCU8_69_240_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8552 | 152 | 301 | 3.40.1280.10 |
| af_Q2FZE0_99_246_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8527 | 149 | 297 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6F537-F1-model_v4 | deleted | 0.9523 | 210 | 298 |
|
| AF-A0A4Q6F537-F1-model_v4 | deleted | 0.932 | 210 | 298 |
|
| AF-A0A3D3IY67-F1-model_v4 | 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB | 0.8893 | 63 | 300 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
| AF-A0A356FWP9-F1-model_v4 | 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB | 0.8877 | 139 | 300 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
| AF-A0A7X4FH93-F1-model_v4 | RNA methyltransferase | 0.8864 | 151 | 301 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar