F485869

General Info

Members Datasets Scaffolds Average Seq Length
924 733 408 292

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0042498|Ga0501035_0042498_2541_3419
Length 292
Sequence MSKDEKSGGSDRDKHYATLRRAHRDQKRERGEIPTPSPKDRRKTRAEDWKAPQLAPEQVFLYGLHTVRAALDNKQRQLIRLSATLNALQRLEIDEANPPCPLVIVTPQEIEKFVGPEAIHQGVMLETRPLPVRRLEALKDSPLVLVLDQVTDPHNVGAIMRSAVAFGAGAVITTQRHSPTESGVLAKSASGALELIPYIQITNLADALAELRKLGFFSIGLDSEGPAELEKTFSGDKIALVMGNEGKGLRQKTRETVSALARLDMPGKIKSLNVSNAAAIALYASRQFLARA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
10 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
13 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
14 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
15 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
18 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
19 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
20 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
21 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
22 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
23 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
24 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
25 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
26 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
27 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
28 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
29 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
30 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
31 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
32 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
33 2516143018 Ensifer sp. BR816 Isolate Nodule
34 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
35 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
36 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
37 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
38 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
39 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
40 2519899620 Rhizobium sp. Pop5 Isolate Nodule
41 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
42 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
43 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
44 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
45 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
46 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
47 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
48 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
49 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
50 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
51 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
52 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
53 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
54 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
55 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
56 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
57 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
58 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
59 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
60 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
61 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
62 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
63 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
64 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
65 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
66 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
67 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
68 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
69 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
70 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
71 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
72 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
73 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
74 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
75 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
76 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
77 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
78 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
79 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
80 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
81 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
82 2643221557 Ensifer sp. Root558 Isolate Unclassified
83 2643221558 Rhizobium sp. Root149 Isolate Unclassified
84 2643221568 Rhizobium sp. Root564 Isolate Unclassified
85 2643221582 Rhizobium sp. Root651 Isolate Unclassified
86 2643221599 Rhizobium sp. Root708 Isolate Unclassified
87 2643221610 Ensifer sp. Root74 Isolate Unclassified
88 2643221618 Ensifer sp. Root231 Isolate Unclassified
89 2643221626 Ensifer sp. Root31 Isolate Unclassified
90 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
91 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
92 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
93 2643221655 Ensifer sp. Root1252 Isolate Unclassified
94 2643221659 Ensifer sp. Root127 Isolate Unclassified
95 2643221668 Ensifer sp. Root423 Isolate Unclassified
96 2643221675 Ensifer sp. Root1298 Isolate Unclassified
97 2643221680 Ensifer sp. Root1312 Isolate Unclassified
98 2643221693 Rhizobium sp. Root491 Isolate Unclassified
99 2643221698 Ensifer sp. Root142 Isolate Unclassified
100 2643221712 Ensifer sp. Root258 Isolate Unclassified
101 2643221718 Rhizobium sp. Root268 Isolate Unclassified
102 2643221719 Rhizobium sp. Root274 Isolate Unclassified
103 2643221723 Ensifer sp. Root278 Isolate Unclassified
104 2643221726 Ensifer sp. Root954 Isolate Unclassified
105 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
106 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
107 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
108 2718217882 Rhizobium sp. N741 Isolate Nodule
109 2718217927 Rhizobium sp. N324 Isolate Nodule
110 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
111 2718218009 Rhizobium sp. N561 Isolate Nodule
112 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
113 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
114 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
115 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
116 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
117 2718218363 Rhizobium sp. N113 Isolate Nodule
118 2718218365 Rhizobium sp. N731 Isolate Nodule
119 2718218366 Rhizobium sp. N621 Isolate Nodule
120 2718218423 Rhizobium sp. N941 Isolate Nodule
121 2721755514 Rhizobium sp. N6212 Isolate Nodule
122 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
123 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
124 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
125 2721755809 Rhizobium sp. N541 Isolate Nodule
126 2721755810 Rhizobium sp. N871 Isolate Nodule
127 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
128 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
129 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
130 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
131 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
132 2728369365 Rhizobium sp. N1341 Isolate Nodule
133 2728369397 Rhizobium sp. N1314 Isolate Nodule
134 2738541293 Rhizobium sp. GV031 Isolate Unclassified
135 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
136 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
137 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
138 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
139 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
140 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
141 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
142 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
143 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
144 2791355256 Rhizobium sp. M10 Isolate Nodule
145 2791355260 Rhizobium sp. L9 Isolate Nodule
146 2791355261 Rhizobium sp. J15 Isolate Nodule
147 2791355262 Rhizobium sp. M1 Isolate Nodule
148 2791355263 Rhizobium chutanense C5 Isolate Nodule
149 2791355265 Rhizobium sp. H4 Isolate Nodule
150 2791355266 Rhizobium sp. L43 Isolate Nodule
151 2791355267 Rhizobium sp. L18 Isolate Nodule
152 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
153 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
154 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
155 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
156 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
157 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
158 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
159 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
160 2802429633 Rhizobium anhuiense J3 Isolate Nodule
161 2802429634 Rhizobium anhuiense S10 Isolate Nodule
162 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
163 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
164 2802429637 Rhizobium anhuiense C15 Isolate Nodule
165 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
166 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
167 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
168 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
169 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
170 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
171 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
172 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
173 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
174 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
175 2838048938 Rhizobium pisi 27/80 Isolate Nodule
176 2838061910 Rhizobium phaseoli L15 Isolate Nodule
177 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
178 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
179 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
180 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
181 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
182 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
183 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
184 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
185 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
186 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
187 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
188 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
189 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
190 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
191 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
192 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
193 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
194 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
195 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
196 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
197 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
198 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
199 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
200 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
201 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
202 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
203 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
204 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
205 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
206 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
207 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
208 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
209 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
210 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
211 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
212 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
213 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
214 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
215 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
216 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
217 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
218 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
219 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
220 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
221 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
222 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
223 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
224 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
225 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
226 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
227 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
228 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
229 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
230 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
231 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
232 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
233 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
234 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
235 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
236 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
237 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
238 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
239 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
240 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
241 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
242 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
243 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
244 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
245 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
246 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
247 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
248 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
249 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
250 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
251 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
252 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
253 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
254 2844163670 Ensifer sp. 1H6 Isolate Unclassified
255 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
256 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
257 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
258 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
259 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
260 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
261 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
262 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
263 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
264 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
265 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
266 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
267 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
268 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
269 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
270 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
271 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
272 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
273 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
274 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
275 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
276 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
277 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
278 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
279 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
280 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
281 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
282 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
283 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
284 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
285 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
286 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
287 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
288 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
289 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
290 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
291 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
292 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
293 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
294 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
295 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
296 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
297 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
298 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
299 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
300 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
301 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
302 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
303 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
304 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
305 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
306 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
307 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
308 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
309 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
310 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
311 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
312 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
313 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
314 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
315 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
316 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
317 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
318 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
319 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
320 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
321 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
322 2933599457 Rhizobium phaseoli M3 Isolate Nodule
323 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
324 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
325 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
326 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
327 2936381700 Rhizobium chutanense C16 Isolate Unclassified
328 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
329 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
330 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
331 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
332 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
333 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
334 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
335 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
336 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
337 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
338 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
339 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
340 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
341 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
342 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
343 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
344 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
345 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
346 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
347 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
348 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
349 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
350 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
351 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
352 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
353 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
354 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
355 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
356 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
357 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
358 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
359 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
360 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
361 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
362 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
363 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
364 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
365 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
366 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
367 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
368 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
369 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
370 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
371 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
372 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
373 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
374 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
375 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
376 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
377 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
378 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
379 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
380 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
381 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
382 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
383 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
384 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
385 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
386 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
387 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
388 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
389 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
390 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
391 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
392 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
393 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
394 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
395 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
396 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
397 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
398 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
399 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
400 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
401 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
402 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
403 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
404 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
405 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
406 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
407 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
408 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
409 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
410 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
411 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
412 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
413 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
414 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
415 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
416 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
417 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
418 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
419 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
420 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
421 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
422 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
423 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
424 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
425 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
426 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
427 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
428 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
429 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
430 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
431 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
432 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
433 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
434 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
435 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
436 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
437 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
438 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
439 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
440 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
441 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
442 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
443 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
444 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
445 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
446 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
447 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
448 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
449 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
450 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
451 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
452 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
453 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
454 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
455 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
456 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
457 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
458 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
459 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
460 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
461 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
462 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
463 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
464 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
465 2996887358 Rhizobium sp. R711 Isolate Nodule
466 2996893221 Rhizobium sp. R635 Isolate Nodule
467 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
468 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
469 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
470 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
471 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
472 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
473 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
474 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
475 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
476 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
477 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
478 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
479 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
480 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
481 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
482 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
483 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
484 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
485 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
486 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
487 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
488 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
489 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
490 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
491 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
492 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
493 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
494 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
495 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
496 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
497 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
498 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
499 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
500 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
501 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
502 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
503 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
504 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
505 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
506 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
507 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
508 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
509 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
510 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
511 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
512 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
513 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
514 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
515 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
516 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
517 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
518 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
519 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
520 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
521 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
522 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
523 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
524 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
525 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
526 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
527 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
528 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
529 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
530 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
531 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
532 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
533 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
534 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
535 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
536 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
537 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
538 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
539 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
540 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
541 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
542 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
543 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
544 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
545 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
546 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
547 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
548 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
549 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
550 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
551 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
552 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
553 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
554 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
555 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
566 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
567 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
568 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
569 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
571 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
572 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
573 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
574 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
575 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
576 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
577 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
578 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
579 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
580 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
581 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
582 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
583 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
584 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
585 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
586 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
587 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
588 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
589 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
590 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
591 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
592 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
593 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
594 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
595 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
596 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
597 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
598 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
599 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
600 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
601 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
602 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
603 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
604 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
605 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
606 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
607 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
608 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
609 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
610 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
611 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
612 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
613 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
614 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
615 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
616 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
617 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
618 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
619 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
620 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
621 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
622 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
623 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
624 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
625 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
626 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
627 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
628 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
629 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
630 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
631 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
632 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
633 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
634 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
635 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
636 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
637 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
638 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
639 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
640 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
641 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
642 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
643 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
644 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
645 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
646 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
647 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
648 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
649 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
650 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
651 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
652 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
653 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
654 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
655 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
656 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
657 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
658 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
659 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
660 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
661 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
662 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
663 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
664 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
665 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
666 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
667 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
668 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
669 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
670 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
671 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
672 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
673 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
674 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
675 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
676 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
677 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
678 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
679 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
680 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
681 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
682 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
683 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
684 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
685 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
686 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
687 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
688 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
689 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
690 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
691 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
692 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
693 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
694 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
695 8005258706 Rhizobium sp. R693 Isolate Nodule
696 8005275841 Rhizobium sp. N4311 Isolate Nodule
697 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
698 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
699 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
700 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
701 8005321885 Rhizobium sp. R72 Isolate Nodule
702 8005382845 Rhizobium sp. R634 Isolate Nodule
703 8005395548 Rhizobium sp. R339 Isolate Nodule
704 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
705 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
706 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
707 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
708 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
709 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
710 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
711 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
712 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
713 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
714 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
715 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
716 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
717 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
718 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
719 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
720 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
721 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
722 8018176218 Rhizobium sp. N122 Isolate Nodule
723 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
724 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
725 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
726 8024501048 Rhizobium sp. H4 Isolate Nodule
727 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
728 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
729 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
730 8056382006 Rhizobium croatiense 13T Isolate Nodule
731 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
732 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
733 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.16
Metatranscriptomes 0
Isolates 55.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 19.48
Nodule 45.35
Rhizoplane 1.41
Rhizosphere 16.88
Stem 0
Stem Tuber 0
Unclassified 16.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000019 3300002704 Bacteria 155636
2 JGI25156J39149_1000020 3300002705 Bacteria 156628
3 JGI25162J39368_1001894 3300002737 Bacteria 9602
4 JGI25162J39368_1002010 3300002737 Bacteria 9034
5 JGI25154J39366_1000355 3300002738 Bacteria 26026
6 JGI25157J39369_1000129 3300002741 Bacteria 63620
7 JGI25152J39213_1002523 3300002773 Bacteria 6907
8 JGI25152J39213_1003647 3300002773 Bacteria 5186
9 JGI25152J39213_1008753 3300002773 Bacteria 2477
10 JGI25152J39213_1012472 3300002773 Bacteria 1822
11 JGI25150J39212_1000153 3300002774 Bacteria 39087
12 JGI25150J39212_1002615 3300002774 Bacteria 4427
13 JGI25159J45721_1000002 3300002987 Bacteria 289163
14 JGI25159J45721_1003547 3300002987 Bacteria 5480
15 JGI25159J45721_1005935 3300002987 Bacteria 3746
16 JGI25151J46595_10000108 3300003187 Bacteria 112874
17 JGI25151J46595_10004679 3300003187 Bacteria 7197
18 JGI25151J46595_10005084 3300003187 Bacteria 6838
19 JGI25151J46595_10008103 3300003187 Bacteria 5089
20 JGI25151J46595_10033779 3300003187 Bacteria 1964
21 JGI25165J46597_1001808 3300003214 Bacteria 9034
22 JGI25165J46597_1002226 3300003214 Bacteria 6784
23 JGI25165J46597_1006328 3300003214 Bacteria 2111
24 JGI25153J46596_10003463 3300003215 Bacteria 8838
25 JGI25153J46596_10006470 3300003215 Bacteria 5913
26 JGI25153J46596_10007593 3300003215 Bacteria 5304
27 JGI25153J46596_10016965 3300003215 Bacteria 2889
28 rootH2_10064249 3300003320 Bacteria 2074
29 rootL2_10015680 3300003322 Bacteria 5379
30 rootH1_10129292 3300003323 Bacteria 4106
31 JGI25160J50197_1000008 3300003354 Bacteria 289163
32 JGI25160J50197_1003935 3300003354 Bacteria 6499
33 JGI25161J50226_1000014 3300003374 Bacteria 191109
34 JGI25161J50226_1000839 3300003374 Bacteria 11452
35 JGI25161J50226_1000986 3300003374 Bacteria 10033
36 JGI25161J50226_1006713 3300003374 Bacteria 2041
37 Ga0055526_1002661 3300003771 Bacteria 11927
38 Ga0055524_1001683 3300003775 Bacteria 12306
39 Ga0055524_1007422 3300003775 Bacteria 4656
40 Ga0055524_1016863 3300003775 Bacteria 2597
41 Ga0055536_1001156 3300003781 Bacteria 16517
42 Ga0055528_1004080 3300003790 Bacteria 7130
43 Ga0055528_1004197 3300003790 Bacteria 6999
44 Ga0055528_1006267 3300003790 Bacteria 5410
45 Ga0055528_1016805 3300003790 Bacteria 2566
46 Ga0055528_1017972 3300003790 Bacteria 2421
47 Ga0055530_10012989 3300003791 Bacteria 2868
48 Ga0055540_1003094 3300003792 Bacteria 8269
49 Ga0055540_1003655 3300003792 Bacteria 7324
50 Ga0055540_1038030 3300003792 Bacteria 1057
51 Ga0058692_1002661 3300003856 Bacteria 5880
52 Ga0058692_1004925 3300003856 Bacteria 3879
53 Ga0055543_1000027 3300004625 Bacteria 136033
54 Ga0055543_1000109 3300004625 Bacteria 71370
55 Ga0055543_1000193 3300004625 Bacteria 50071
56 Ga0055543_1004741 3300004625 Bacteria 3630
57 Ga0065165_1000015 3300005262 Bacteria 289201
58 Ga0065165_1000915 3300005262 Bacteria 38053
59 Ga0065165_1004124 3300005262 Bacteria 9338
60 Ga0065165_1019249 3300005262 Bacteria 2445
61 Ga0065165_1021974 3300005262 Bacteria 2201
62 Ga0070670_100012947 3300005331 Bacteria 7141
63 Ga0070668_100181647 3300005347 Bacteria 1719
64 Ga0070668_100202824 3300005347 Bacteria 1629
65 Ga0070671_100038063 3300005355 Bacteria 3992
66 Ga0070667_100234492 3300005367 Bacteria 1637
67 Ga0070662_100086648 3300005457 Bacteria 2343
68 Ga0070685_10147333 3300005466 Bacteria 1489
69 Ga0070665_100032328 3300005548 Bacteria 5267
70 Ga0068855_100180241 3300005563 Bacteria 2389
71 Ga0068851_10018396 3300005834 Bacteria 3365
72 Ga0075365_10028260 3300006038 Bacteria 3576
73 Ga0075365_10094626 3300006038 Bacteria 2039
74 Ga0075368_10002087 3300006042 Bacteria 6452
75 Ga0075363_100114733 3300006048 Bacteria 1500
76 Ga0075363_100145860 3300006048 Bacteria 1334
77 Ga0075362_10004901 3300006177 Bacteria 4843
78 Ga0075367_10005429 3300006178 Bacteria 6329
79 Ga0075367_10061958 3300006178 Bacteria 2233
80 Ga0075367_10108192 3300006178 Bacteria 1704
81 Ga0075367_10221576 3300006178 Bacteria 1184
82 Ga0075369_10018710 3300006186 Bacteria 2822
83 Ga0075369_10082166 3300006186 Bacteria 1430
84 Ga0075366_10091007 3300006195 Bacteria 1827
85 Ga0075370_10012045 3300006353 Bacteria 4560
86 Ga0079104_1001945 3300006946 Bacteria 12272
87 Ga0079104_1024882 3300006946 Bacteria 1571
88 Ga0099826_10000098 3300006948 Bacteria 41270
89 Ga0105244_10041955 3300009036 Bacteria 2369
90 Ga0105240_10004701 3300009093 Bacteria 20645
91 Ga0105243_10052642 3300009148 Bacteria 3225
92 Ga0105248_10322768 3300009177 Bacteria 1739
93 Ga0105237_10002935 3300009545 Bacteria 20647
94 Ga0105249_10084573 3300009553 Bacteria 2955
95 Ga0123342_1041008 3300009766 Bacteria 1692
96 Ga0157322_1000552 3300012490 Bacteria 1461
97 Ga0157371_10001437 3300013102 Bacteria 24739
98 Ga0157370_10000351 3300013104 Bacteria 58496
99 Ga0157370_10007253 3300013104 Bacteria 12095
100 Ga0171463_1011 3300013249 Bacteria 230603
101 Ga0157372_10655200 3300013307 Bacteria 1223
102 Ga0182005_1008917 3300015265 Bacteria 2941
103 Ga0183363_1362 3300015690 Bacteria 4965
104 Ga0214544_1022053 3300021320 Bacteria 3963
105 Ga0214542_1000006 3300021321 Bacteria 345164
106 Ga0214543_1000014 3300021327 Bacteria 324986
107 Ga0214543_1022635 3300021327 Bacteria 4398
108 Ga0228711_1000015 3300022739 Bacteria 126974
109 Ga0228710_1000015 3300022740 Bacteria 133640
110 Ga0209435_100024 3300025206 Bacteria 199665
111 Ga0209436_100075 3300025208 Bacteria 50427
112 Ga0209436_109891 3300025208 Bacteria 1780
113 Ga0209436_111918 3300025208 Bacteria 1501
114 Ga0209437_100033 3300025233 Bacteria 512520
115 Ga0209437_100075 3300025233 Bacteria 297202
116 Ga0207425_1000031 3300025245 Bacteria 261181
117 Ga0207425_1019089 3300025245 Bacteria 1481
118 Ga0209646_1000064 3300025246 Bacteria 246524
119 Ga0209026_1000053 3300025250 Bacteria 246524
120 Ga0209677_101074 3300025253 Bacteria 12915
121 Ga0209759_1000042 3300025256 Bacteria 246524
122 Ga0209129_1000053 3300025258 Bacteria 262823
123 Ga0209129_1000285 3300025258 Bacteria 48259
124 Ga0209129_1003123 3300025258 Bacteria 7436
125 Ga0209129_1004233 3300025258 Bacteria 5747
126 Ga0209129_1007223 3300025258 Bacteria 3360
127 Ga0209233_1000262 3300025261 Bacteria 79485
128 Ga0209233_1000277 3300025261 Bacteria 72470
129 Ga0209233_1001047 3300025261 Bacteria 11598
130 Ga0209455_1014930 3300025272 Bacteria 1732
131 Ga0209673_1000041 3300025273 Bacteria 307397
132 Ga0209673_1001438 3300025273 Bacteria 22641
133 Ga0209673_1001549 3300025273 Bacteria 20760
134 Ga0209673_1003714 3300025273 Bacteria 8743
135 Ga0209673_1004785 3300025273 Bacteria 7110
136 Ga0209673_1039255 3300025273 Bacteria 1369
137 Ga0209673_1043499 3300025273 Bacteria 1253
138 Ga0209130_1000006 3300025284 Bacteria 596528
139 Ga0209130_1000007 3300025284 Bacteria 591584
140 Ga0209130_1000018 3300025284 Bacteria 388301
141 Ga0209676_1001917 3300025292 Bacteria 16836
142 Ga0209676_1044033 3300025292 Bacteria 1227
143 Ga0209025_1000087 3300025294 Bacteria 261181
144 Ga0209025_1000303 3300025294 Bacteria 110086
145 Ga0209025_1000361 3300025294 Bacteria 97060
146 Ga0209025_1000405 3300025294 Bacteria 87670
147 Ga0209025_1000440 3300025294 Bacteria 81964
148 Ga0209025_1004972 3300025294 Bacteria 11123
149 Ga0209025_1015852 3300025294 Bacteria 4501
150 Ga0209025_1049232 3300025294 Bacteria 1698
151 Ga0209025_1063087 3300025294 Bacteria 1370
152 Ga0209564_1000296 3300025295 Bacteria 100151
153 Ga0209564_1000640 3300025295 Bacteria 53056
154 Ga0209564_1000652 3300025295 Bacteria 51925
155 Ga0209564_1001439 3300025295 Bacteria 24403
156 Ga0209564_1005795 3300025295 Bacteria 6895
157 Ga0209564_1016735 3300025295 Bacteria 2898
158 Ga0209758_1000081 3300025297 Bacteria 261181
159 Ga0209758_1000717 3300025297 Bacteria 48915
160 Ga0209758_1002836 3300025297 Bacteria 16844
161 Ga0209758_1004957 3300025297 Bacteria 10663
162 Ga0209758_1006242 3300025297 Bacteria 8684
163 Ga0209758_1019478 3300025297 Bacteria 3269
164 Ga0209758_1029025 3300025297 Bacteria 2325
165 Ga0209050_1017392 3300025298 Bacteria 2870
166 Ga0209256_1003048 3300025299 Bacteria 12347
167 Ga0209256_1004700 3300025299 Bacteria 8370
168 Ga0209256_1005851 3300025299 Bacteria 6829
169 Ga0209256_1011473 3300025299 Bacteria 3536
170 Ga0209256_1014956 3300025299 Bacteria 2747
171 Ga0209256_1018331 3300025299 Bacteria 2280
172 Ga0209256_1023508 3300025299 Bacteria 1836
173 Ga0207426_1000044 3300025302 Bacteria 428043
174 Ga0207426_1000064 3300025302 Bacteria 358276
175 Ga0207426_1000119 3300025302 Bacteria 221800
176 Ga0207426_1000231 3300025302 Bacteria 128171
177 Ga0207426_1011540 3300025302 Bacteria 3359
178 Ga0209051_1002625 3300025303 Bacteria 12623
179 Ga0209051_1003932 3300025303 Bacteria 9468
180 Ga0209051_1021865 3300025303 Bacteria 2707
181 Ga0209051_1021924 3300025303 Bacteria 2702
182 Ga0209051_1032838 3300025303 Bacteria 1973
183 Ga0209051_1039419 3300025303 Bacteria 1706
184 Ga0209051_1062919 3300025303 Bacteria 1158
185 Ga0209257_1000817 3300025304 Bacteria 45150
186 Ga0209257_1005720 3300025304 Bacteria 8530
187 Ga0207647_10240430 3300025904 Bacteria 1040
188 Ga0207695_10003914 3300025913 Bacteria 20605
189 Ga0207671_10012250 3300025914 Bacteria 6909
190 Ga0207650_10060240 3300025925 Bacteria 2833
191 Ga0207644_10048176 3300025931 Bacteria 3045
192 Ga0207706_10131423 3300025933 Bacteria 2202
193 Ga0207709_10008294 3300025935 Bacteria 5755
194 Ga0207711_10206609 3300025941 Bacteria 1793
195 Ga0207667_10553377 3300025949 Bacteria 1163
196 Ga0207712_10457396 3300025961 Bacteria 1084
197 Ga0209281_1000339 3300027111 Bacteria 79862
198 Ga0209281_1001295 3300027111 Bacteria 16021
199 Ga0209371_1000328 3300027312 Bacteria 51735
200 Ga0209371_1001894 3300027312 Bacteria 12827
201 Ga0209282_1000054 3300027666 Bacteria 101427
202 Ga0209282_1000147 3300027666 Bacteria 41275
203 Ga0209813_10004171 3300027866 Bacteria 3434
204 Ga0268266_10083415 3300028379 Bacteria 2790
205 Ga0307515_10001636 3300028794 Bacteria 49786
206 Ga0307515_10001758 3300028794 Bacteria 48278
207 Ga0307515_10061088 3300028794 Bacteria 5356
208 Ga0268256_1000019 3300030500 Bacteria 587949
209 Ga0268256_1004165 3300030500 Bacteria 6129
210 Ga0316181_1156578 3300030744 Bacteria 3273
211 Ga0307513_10006680 3300031456 Bacteria 15048
212 Ga0307513_10124295 3300031456 Bacteria 2540
213 Ga0307408_100072916 3300031548 Bacteria 2543
214 Ga0307516_10129215 3300031730 Bacteria 2308
215 Ga0307405_10050597 3300031731 Bacteria 2574
216 Ga0307410_10261927 3300031852 Bacteria 1349
217 Ga0307412_10008803 3300031911 Bacteria 5780
218 Ga0315914_1000013 3300031967 Bacteria 133640
219 Ga0315913_1000097 3300033430 Bacteria 51051
220 Ga0315915_1000001 3300033464 Bacteria 481518
221 Ga0373935_0238748 3300035692 Bacteria 1268
222 Ga0373927_0000055 3300035695 Bacteria 81098
223 Ga0373925_0055752 3300037068 Bacteria 2959
224 Ga0395905_0000325 3300037471 Bacteria 68813
225 Ga0395905_0010488 3300037471 Bacteria 9011
226 Ga0395905_0013381 3300037471 Bacteria 7861
227 Ga0439436_0049072 3300041404 Bacteria 1196
228 Ga0439466_0065366 3300041411 Bacteria 1166
229 Ga0439465_0036015 3300041413 Bacteria 1588
230 Ga0439465_0047441 3300041413 Bacteria 1400
231 Ga0451837_0324802 3300041494 Bacteria 2894
232 Ga0451839_0811851 3300041496 Bacteria 4352
233 Ga0451841_0621192 3300041498 Bacteria 1659
234 Ga0451841_1210148 3300041498 Bacteria 1797
235 Ga0451851_0025954 3300041507 Bacteria 3955
236 Ga0451851_0839726 3300041507 Bacteria 1328
237 Ga0451853_2406349 3300041512 Bacteria 2143
238 Ga0439449_0009113 3300042007 Bacteria 3762
239 Ga0439449_0017670 3300042007 Bacteria 2678
240 Ga0466970_0006167 3300044765 Bacteria 5973
241 Ga0495627_044109 3300046453 Bacteria 1362
242 Ga0495629_0062690 3300046459 Bacteria 2596
243 Ga0495638_0001063 3300046460 Bacteria 26811
244 Ga0495638_0082458 3300046460 Bacteria 1950
245 Ga0495638_0089858 3300046460 Bacteria 1852
246 Ga0495650_0018078 3300046471 Bacteria 3515
247 Ga0495605_0043145 3300046474 Bacteria 2237
248 Ga0495662_0004497 3300046476 Bacteria 6995
249 Ga0495585_0021779 3300046492 Bacteria 3680
250 Ga0495585_0091614 3300046492 Bacteria 1636
251 Ga0495607_0131150 3300046501 Bacteria 1304
252 Ga0495607_0139652 3300046501 Bacteria 1251
253 Ga0495583_0005892 3300046506 Bacteria 8160
254 Ga0495583_0026515 3300046506 Bacteria 2871
255 Ga0495583_0097686 3300046506 Bacteria 1257
256 Ga0495606_0014273 3300046507 Bacteria 6212
257 Ga0495606_0020058 3300046507 Bacteria 4943
258 Ga0495606_0049109 3300046507 Bacteria 2770
259 Ga0495610_0006312 3300046512 Bacteria 8202
260 Ga0495610_0031663 3300046512 Bacteria 2756
261 Ga0495610_0046380 3300046512 Bacteria 2144
262 Ga0495616_0069025 3300046513 Bacteria 1715
263 Ga0495616_0104691 3300046513 Bacteria 1322
264 Ga0495620_0074437 3300046515 Bacteria 1383
265 Ga0495631_0009977 3300046518 Bacteria 4721
266 Ga0495632_0007495 3300046519 Bacteria 6842
267 Ga0495643_0031311 3300046522 Bacteria 2961
268 Ga0495643_0036191 3300046522 Bacteria 2713
269 Ga0495643_0057513 3300046522 Bacteria 2072
270 Ga0495648_0047141 3300046524 Bacteria 2666
271 Ga0495609_0028041 3300046538 Bacteria 2571
272 Ga0495597_0010356 3300046542 Bacteria 4560
273 Ga0495622_0017513 3300046557 Bacteria 3336
274 Ga0495633_0020432 3300046558 Bacteria 3330
275 Ga0495668_0085723 3300046616 Bacteria 1727
276 Ga0495625_0010082 3300046660 Bacteria 7852
277 Ga0495625_0064647 3300046660 Bacteria 2580
278 Ga0495588_0002878 3300046674 Bacteria 7414
279 Ga0495657_0084509 3300046675 Bacteria 2047
280 Ga0495647_0056346 3300046681 Bacteria 1541
281 Ga0495671_0145312 3300046692 Bacteria 1155
282 Ga0495649_0058104 3300046694 Bacteria 2085
283 Ga0495660_0053967 3300046810 Bacteria 2179
284 Ga0495604_0046794 3300047317 Bacteria 3372
285 Ga0495672_0012037 3300047320 Bacteria 6059
286 Ga0495681_0081455 3300047470 Bacteria 1444
287 Ga0495686_0021587 3300047472 Bacteria 4271
288 Ga0495686_0039822 3300047472 Bacteria 2999
289 Ga0495686_0040924 3300047472 Bacteria 2952
290 Ga0495686_0081255 3300047472 Bacteria 1980
291 Ga0495686_0092438 3300047472 Bacteria 1835
292 Ga0495615_0001752 3300048090 Bacteria 3311
293 Ga0496101_0277464 3300048904 Bacteria 1309
294 Ga0496102_0050644 3300048905 Bacteria 3782
295 Ga0496104_0119719 3300048907 Bacteria 2527
296 Ga0496105_0117115 3300048908 Bacteria 2197
297 Ga0496106_0007845 3300048909 Bacteria 7899
298 Ga0496111_0269516 3300048914 Bacteria 1263
299 Ga0496113_0256652 3300048916 Bacteria 1396
300 Ga0496114_0076506 3300048917 Bacteria 2820
301 Ga0496116_0000322 3300048919 Bacteria 78643
302 Ga0496116_0008412 3300048919 Bacteria 8956
303 Ga0496116_0011264 3300048919 Bacteria 7422
304 Ga0496116_0117374 3300048919 Bacteria 1548
305 Ga0496116_0128141 3300048919 Bacteria 1452
306 Ga0496117_0000002 3300048920 Bacteria 2483758
307 Ga0496117_0006432 3300048920 Bacteria 11891
308 Ga0496117_0036996 3300048920 Bacteria 3642
309 Ga0496117_0089470 3300048920 Bacteria 1988
310 Ga0496118_0001028 3300048921 Bacteria 43423
311 Ga0496118_0007239 3300048921 Bacteria 11840
312 Ga0496118_0039631 3300048921 Bacteria 3756
313 Ga0496118_0151282 3300048921 Bacteria 1452
314 Ga0496119_0025832 3300048922 Bacteria 4091
315 Ga0496119_0034739 3300048922 Bacteria 3313
316 Ga0496119_0036640 3300048922 Bacteria 3199
317 Ga0496119_0049630 3300048922 Bacteria 2593
318 Ga0496119_0139703 3300048922 Bacteria 1309
319 Ga0496120_0000180 3300048923 Bacteria 107518
320 Ga0496120_0038438 3300048923 Bacteria 2830
321 Ga0496121_0000003 3300048924 Bacteria 1191431
322 Ga0496121_0003794 3300048924 Bacteria 21073
323 Ga0496121_0009418 3300048924 Bacteria 11229
324 Ga0496121_0038542 3300048924 Bacteria 4228
325 Ga0496121_0121718 3300048924 Bacteria 1970
326 Ga0496122_0000004 3300048925 Bacteria 645283
327 Ga0496122_0012241 3300048925 Bacteria 8577
328 Ga0496122_0022833 3300048925 Bacteria 5542
329 Ga0496122_0023868 3300048925 Bacteria 5371
330 Ga0496122_0037418 3300048925 Bacteria 3906
331 Ga0496122_0046922 3300048925 Bacteria 3340
332 Ga0496122_0056646 3300048925 Bacteria 2920
333 Ga0496122_0081101 3300048925 Bacteria 2259
334 Ga0496122_0114081 3300048925 Bacteria 1763
335 Ga0496123_0000007 3300048926 Bacteria 645283
336 Ga0496123_0007644 3300048926 Bacteria 10116
337 Ga0496123_0012453 3300048926 Bacteria 7251
338 Ga0496123_0040255 3300048926 Bacteria 3258
339 Ga0496123_0109144 3300048926 Bacteria 1586
340 Ga0496123_0112812 3300048926 Bacteria 1549
341 Ga0496123_0163342 3300048926 Bacteria 1184
342 Ga0496124_0011204 3300048927 Bacteria 8987
343 Ga0496124_0014415 3300048927 Bacteria 7643
344 Ga0496124_0026193 3300048927 Bacteria 5263
345 Ga0496124_0044913 3300048927 Bacteria 3789
346 Ga0496124_0055128 3300048927 Bacteria 3361
347 Ga0496124_0066083 3300048927 Bacteria 3013
348 Ga0496124_0163634 3300048927 Bacteria 1731
349 Ga0496124_0198997 3300048927 Bacteria 1525
350 Ga0496125_0016573 3300048928 Bacteria 7068
351 Ga0496125_0049711 3300048928 Bacteria 3480
352 Ga0496125_0118953 3300048928 Bacteria 1890
353 Ga0496126_0001008 3300048929 Bacteria 47974
354 Ga0496126_0039838 3300048929 Bacteria 4356
355 Ga0496126_0044472 3300048929 Bacteria 4089
356 Ga0496126_0306511 3300048929 Bacteria 1308
357 Ga0496126_0390676 3300048929 Bacteria 1130
358 Ga0496126_0390680 3300048929 Bacteria 1130
359 Ga0495678_051710 3300049459 Bacteria 1586
360 Ga0501033_0022920 3300049570 Bacteria 4707
361 Ga0501037_0141844 3300049573 Bacteria 1719
362 Ga0501038_0404777 3300049574 Bacteria 1055
363 Ga0501046_0256338 3300049580 Bacteria 1286
364 Ga0501047_0129310 3300049581 Bacteria 2406
365 Ga0501068_0096479 3300049584 Bacteria 1829
366 Ga0501073_0032587 3300049589 Bacteria 3715
367 Ga0501035_0042498 3300049822 Bacteria 4099
368 nmdc:mga03683_12158_c1 3300050489 Bacteria 3137
369 nmdc:mga00v17_371652_c1 3300050491 Bacteria 930
370 nmdc:mga00v17_43489_c1 3300050491 Bacteria 2705
371 nmdc:mga0yw44_2589_c1 3300050492 Bacteria 7776
372 nmdc:mga0yw44_5539_c1 3300050492 Bacteria 5986
373 nmdc:mga0k408_5841_c1 3300050493 Bacteria 6558
374 nmdc:mga06z11_5276_c1 3300050494 Bacteria 5172
375 nmdc:mga04h51_6320_c1 3300050495 Bacteria 3067
376 nmdc:mga07m45_36026_c1 3300050496 Bacteria 2754
377 nmdc:mga07m45_44172_c1 3300050496 Bacteria 2500
378 nmdc:mga0sz30_1247_c1 3300050516 Bacteria 9108
379 nmdc:mga0sz30_6040_c1 3300050516 Bacteria 4476
380 Ga0500578_0037008 3300053086 Bacteria 3133
381 Ga0500651_0159814 3300053093 Bacteria 1348
382 Ga0500569_013278 3300053109 Bacteria 2013
383 Ga0500572_023543 3300053111 Bacteria 1654
384 Ga0500594_0000757 3300053118 Bacteria 6886
385 Ga0500608_132390 3300053122 Bacteria 1116
386 Ga0500618_006831 3300053125 Bacteria 3311
387 Ga0500652_137235 3300053131 Bacteria 1019
388 Ga0500658_0000879 3300053134 Bacteria 12329
389 Ga0500658_0077727 3300053134 Bacteria 1413
390 Ga0500658_0165042 3300053134 Bacteria 1004
391 Ga0500559_0005071 3300053136 Bacteria 6104
392 Ga0500561_0000181 3300053137 Bacteria 11504
393 Ga0500568_0001996 3300053139 Bacteria 12442
394 Ga0500568_0009947 3300053139 Bacteria 4487
395 Ga0500568_0028794 3300053139 Bacteria 2313
396 Ga0500573_0047899 3300053140 Bacteria 2460
397 Ga0500590_004391 3300053148 Bacteria 6656
398 Ga0500616_0017794 3300053153 Bacteria 4026
399 Ga0500616_0025961 3300053153 Bacteria 3247
400 Ga0500622_0000956 3300053156 Bacteria 24552
401 Ga0500622_0002236 3300053156 Bacteria 14231
402 Ga0500624_004970 3300053157 Bacteria 1759
403 Ga0500627_0020746 3300053158 Bacteria 2640
404 Ga0500627_0110330 3300053158 Bacteria 1238
405 Ga0500634_0130207 3300053161 Bacteria 1209
406 Ga0500636_0001051 3300053177 Bacteria 14819
407 Ga0500636_0016209 3300053177 Bacteria 4394
408 Ga0466962_0110495 3300061719 Bacteria 1323

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025904 Ga0207647_10240430 Ga0207647_102404301 262
2 3300050491 nmdc:mga00v17_371652_c1 nmdc:mga00v17_371652_c1_95_916 270
3 3300048925 Ga0496122_0046922 Ga0496122_0046922_33_851 272
4 iso_pu_bacteria 2977544691 2977551458 276
5 3300031456 Ga0307513_10124295 Ga0307513_101242953 282
6 3300035692 Ga0373935_0238748 Ga0373935_0238748_84_938 282
7 3300035695 Ga0373927_0000055 Ga0373927_0000055_35969_36823 282
8 3300037068 Ga0373925_0055752 Ga0373925_0055752_743_1597 282
9 3300025297 Ga0209758_1019478 Ga0209758_10194787 284
10 3300048926 Ga0496123_0109144 Ga0496123_0109144_287_1177 284
11 3300048928 Ga0496125_0049711 Ga0496125_0049711_1034_1924 284
12 3300049573 Ga0501037_0141844 Ga0501037_0141844_309_1199 284
13 3300049574 Ga0501038_0404777 Ga0501038_0404777_25_915 284
14 3300049581 Ga0501047_0129310 Ga0501047_0129310_955_1845 284
15 3300049584 Ga0501068_0096479 Ga0501068_0096479_777_1667 284
16 3300049589 Ga0501073_0032587 Ga0501073_0032587_1003_1893 284
17 3300053136 Ga0500559_0005071 Ga0500559_0005071_671_1570 284
18 3300037471 Ga0395905_0000325 Ga0395905_0000325_66566_67432 285
19 3300046460 Ga0495638_0089858 Ga0495638_0089858_705_1568 285
20 3300053122 Ga0500608_132390 Ga0500608_132390_79_942 285
21 3300053131 Ga0500652_137235 Ga0500652_137235_108_971 285
22 3300053156 Ga0500622_0000956 Ga0500622_0000956_20362_21225 285
23 3300053158 Ga0500627_0020746 Ga0500627_0020746_293_1156 285
24 iso_pu_bacteria 2818991461 2819683853 285
25 iso_pu_bacteria 8018150411 8018154011 285
26 iso_pu_bacteria 8056875544 8056879542 285
27 iso_pu_bacteria 2508501122 2509108782 286
28 iso_pu_bacteria 2643221653 2644296514 286
29 iso_pu_bacteria 2643221719 2644654768 286
30 iso_pu_bacteria 2738541317 2738948981 286
31 iso_pu_bacteria 2913308742 2913309907 286
32 iso_pu_bacteria 2989776772 2989778422 286
33 iso_pu_bacteria 8005246636 8005251055 286
34 3300003215 JGI25153J46596_10003463 JGI25153J46596_100034633 287
35 3300003790 Ga0055528_1017972 Ga0055528_10179725 287
36 3300025273 Ga0209673_1004785 Ga0209673_100478510 287
37 3300025297 Ga0209758_1004957 Ga0209758_100495711 287
38 3300025299 Ga0209256_1023508 Ga0209256_10235083 287
39 3300025303 Ga0209051_1039419 Ga0209051_10394192 287
40 3300028794 Ga0307515_10001758 Ga0307515_1000175851 287
41 3300031730 Ga0307516_10129215 Ga0307516_101292155 287
42 3300041494 Ga0451837_0324802 Ga0451837_0324802_872_1762 287
43 3300041496 Ga0451839_0811851 Ga0451839_0811851_1124_2014 287
44 3300041498 Ga0451841_0621192 Ga0451841_0621192_598_1488 287
45 3300041498 Ga0451841_1210148 Ga0451841_1210148_114_1004 287
46 3300041507 Ga0451851_0025954 Ga0451851_0025954_53_943 287
47 3300041507 Ga0451851_0839726 Ga0451851_0839726_53_943 287
48 3300041512 Ga0451853_2406349 Ga0451853_2406349_381_1271 287
49 3300046460 Ga0495638_0082458 Ga0495638_0082458_1068_1940 287
50 3300046474 Ga0495605_0043145 Ga0495605_0043145_924_1814 287
51 3300046492 Ga0495585_0091614 Ga0495585_0091614_305_1195 287
52 3300046501 Ga0495607_0139652 Ga0495607_0139652_342_1232 287
53 3300046506 Ga0495583_0097686 Ga0495583_0097686_315_1205 287
54 3300046507 Ga0495606_0014273 Ga0495606_0014273_112_1002 287
55 3300046512 Ga0495610_0031663 Ga0495610_0031663_456_1346 287
56 3300046522 Ga0495643_0036191 Ga0495643_0036191_27_917 287
57 3300046524 Ga0495648_0047141 Ga0495648_0047141_533_1423 287
58 3300046542 Ga0495597_0010356 Ga0495597_0010356_2264_3154 287
59 3300046558 Ga0495633_0020432 Ga0495633_0020432_2251_3141 287
60 3300046616 Ga0495668_0085723 Ga0495668_0085723_423_1313 287
61 3300046660 Ga0495625_0064647 Ga0495625_0064647_1330_2220 287
62 3300046692 Ga0495671_0145312 Ga0495671_0145312_220_1110 287
63 3300047470 Ga0495681_0081455 Ga0495681_0081455_278_1168 287
64 3300047472 Ga0495686_0040924 Ga0495686_0040924_266_1156 287
65 3300048090 Ga0495615_0001752 Ga0495615_0001752_2158_3048 287
66 3300053086 Ga0500578_0037008 Ga0500578_0037008_1030_1920 287
67 3300053109 Ga0500569_013278 Ga0500569_013278_274_1164 287
68 3300053134 Ga0500658_0000879 Ga0500658_0000879_1909_2799 287
69 3300053153 Ga0500616_0017794 Ga0500616_0017794_931_1821 287
70 3300053158 Ga0500627_0110330 Ga0500627_0110330_49_939 287
71 iso_pu_bacteria 2509276019 2509374238 287
72 iso_pu_bacteria 2510065057 2510307359 287
73 iso_pu_bacteria 2511231052 2511501234 287
74 iso_pu_bacteria 2512047086 2512532661 287
75 iso_pu_bacteria 2512875026 2512972010 287
76 iso_pu_bacteria 2513237086 2513587114 287
77 iso_pu_bacteria 2513237089 2513604679 287
78 iso_pu_bacteria 2513237091 2513616388 287
79 iso_pu_bacteria 2513237140 2513880890 287
80 iso_pu_bacteria 2513237143 2513907429 287
81 iso_pu_bacteria 2513237156 2513987316 287
82 iso_pu_bacteria 2513237160 2514007333 287
83 iso_pu_bacteria 2515154107 2515608408 287
84 iso_pu_bacteria 2516143018 2516209115 287
85 iso_pu_bacteria 2516653046 2516892517 287
86 iso_pu_bacteria 2517487022 2517569330 287
87 iso_pu_bacteria 2524023207 2524450930 287
88 iso_pu_bacteria 2537561587 2537875688 287
89 iso_pu_bacteria 2551306084 2551675551 287
90 iso_pu_bacteria 2551306085 2551689260 287
91 iso_pu_bacteria 2551306086 2551694320 287
92 iso_pu_bacteria 2551306087 2551699723 287
93 iso_pu_bacteria 2551306089 2551712783 287
94 iso_pu_bacteria 2551306090 2551722348 287
95 iso_pu_bacteria 2551306091 2551728632 287
96 iso_pu_bacteria 2551306092 2551734565 287
97 iso_pu_bacteria 2551306093 2551742236 287
98 iso_pu_bacteria 2554235003 2554248121 287
99 iso_pu_bacteria 2558860100 2558863263 287
100 iso_pu_bacteria 2558860242 2559295237 287
101 iso_pu_bacteria 2599185210 2599601550 287
102 iso_pu_bacteria 2599185352 2600192196 287
103 iso_pu_bacteria 2600255279 2601610186 287
104 iso_pu_bacteria 2600255308 2601746960 287
105 iso_pu_bacteria 2643221557 2643806959 287
106 iso_pu_bacteria 2643221568 2643856885 287
107 iso_pu_bacteria 2643221582 2643920457 287
108 iso_pu_bacteria 2643221610 2644067284 287
109 iso_pu_bacteria 2643221618 2644108769 287
110 iso_pu_bacteria 2643221626 2644151290 287
111 iso_pu_bacteria 2643221655 2644311425 287
112 iso_pu_bacteria 2643221659 2644329683 287
113 iso_pu_bacteria 2643221668 2644378327 287
114 iso_pu_bacteria 2643221675 2644420914 287
115 iso_pu_bacteria 2643221680 2644454438 287
116 iso_pu_bacteria 2643221693 2644522069 287
117 iso_pu_bacteria 2643221698 2644546357 287
118 iso_pu_bacteria 2643221712 2644617224 287
119 iso_pu_bacteria 2643221723 2644675338 287
120 iso_pu_bacteria 2643221726 2644689776 287
121 iso_pu_bacteria 2690316117 2692316568 287
122 iso_pu_bacteria 2791355091 2792622461 287
123 iso_pu_bacteria 2791355094 2792642792 287
124 iso_pu_bacteria 2802428858 2802719342 287
125 iso_pu_bacteria 2802428859 2802723097 287
126 iso_pu_bacteria 2802428860 2802732542 287
127 iso_pu_bacteria 2802428861 2802738459 287
128 iso_pu_bacteria 2802428862 2802745083 287
129 iso_pu_bacteria 2802428863 2802751518 287
130 iso_pu_bacteria 2808606387 2808988029 287
131 iso_pu_bacteria 2818991439 2819558937 287
132 iso_pu_bacteria 2838074704 2838076661 287
133 iso_pu_bacteria 2838675328 2838675886 287
134 iso_pu_bacteria 2838714209 2838714768 287
135 iso_pu_bacteria 2838719591 2838721431 287
136 iso_pu_bacteria 2838724970 2838725528 287
137 iso_pu_bacteria 2841846520 2841848380 287
138 iso_pu_bacteria 2841859092 2841862013 287
139 iso_pu_bacteria 2842124991 2842125589 287
140 iso_pu_bacteria 2842130223 2842130781 287
141 iso_pu_bacteria 2842152218 2842154049 287
142 iso_pu_bacteria 2842170452 2842171012 287
143 iso_pu_bacteria 2842175837 2842177669 287
144 iso_pu_bacteria 2842187318 2842187877 287
145 iso_pu_bacteria 2842211629 2842212188 287
146 iso_pu_bacteria 2842224351 2842226193 287
147 iso_pu_bacteria 2842515876 2842518797 287
148 iso_pu_bacteria 2844163670 2844168279 287
149 iso_pu_bacteria 2847417321 2847418364 287
150 iso_pu_bacteria 2848992105 2848993345 287
151 iso_pu_bacteria 2850079185 2850080703 287
152 iso_pu_bacteria 2855825444 2855831587 287
153 iso_pu_bacteria 2855839649 2855840705 287
154 iso_pu_bacteria 2855872281 2855878620 287
155 iso_pu_bacteria 2858800743 2858801233 287
156 iso_pu_bacteria 2896384573 2896386854 287
157 iso_pu_bacteria 2899792073 2899796167 287
158 iso_pu_bacteria 2899845264 2899850767 287
159 iso_pu_bacteria 2913295892 2913301813 287
160 iso_pu_bacteria 2915980308 2915985704 287
161 iso_pu_bacteria 2915986958 2915991765 287
162 iso_pu_bacteria 2915993759 2915995794 287
163 iso_pu_bacteria 2916000859 2916002664 287
164 iso_pu_bacteria 2916007675 2916009850 287
165 iso_pu_bacteria 2916014648 2916018812 287
166 iso_pu_bacteria 2916021584 2916022441 287
167 iso_pu_bacteria 2916028427 2916031835 287
168 iso_pu_bacteria 2916035215 2916040611 287
169 iso_pu_bacteria 2916041962 2916046643 287
170 iso_pu_bacteria 2916048683 2916052703 287
171 iso_pu_bacteria 2916055098 2916055101 287
172 iso_pu_bacteria 2916061851 2916065854 287
173 iso_pu_bacteria 2916068649 2916070037 287
174 iso_pu_bacteria 2916076590 2916078705 287
175 iso_pu_bacteria 2919114240 2919114859 287
176 iso_pu_bacteria 2920760137 2920765441 287
177 iso_pu_bacteria 2920822456 2920824072 287
178 iso_pu_bacteria 2921201388 2921205126 287
179 iso_pu_bacteria 2921208531 2921210042 287
180 iso_pu_bacteria 2921237296 2921242287 287
181 iso_pu_bacteria 2921244191 2921248035 287
182 iso_pu_bacteria 2921250672 2921251624 287
183 iso_pu_bacteria 2921257292 2921260819 287
184 iso_pu_bacteria 2921263974 2921263977 287
185 iso_pu_bacteria 2921282425 2921285946 287
186 iso_pu_bacteria 2921289301 2921292120 287
187 iso_pu_bacteria 2921296804 2921299866 287
188 iso_pu_bacteria 2924144063 2924147629 287
189 iso_pu_bacteria 2924150972 2924155037 287
190 iso_pu_bacteria 2924158325 2924165012 287
191 iso_pu_bacteria 2924165586 2924168028 287
192 iso_pu_bacteria 2924172951 2924177085 287
193 iso_pu_bacteria 2924179722 2924184775 287
194 iso_pu_bacteria 2924186466 2924188258 287
195 iso_pu_bacteria 2924193448 2924200322 287
196 iso_pu_bacteria 2924200457 2924206852 287
197 iso_pu_bacteria 2924207177 2924213775 287
198 iso_pu_bacteria 2924214083 2924220240 287
199 iso_pu_bacteria 2924221636 2924224365 287
200 iso_pu_bacteria 2924228884 2924233715 287
201 iso_pu_bacteria 2926754445 2926755823 287
202 iso_pu_bacteria 2926760298 2926762941 287
203 iso_pu_bacteria 2933006813 2933008694 287
204 iso_pu_bacteria 2933011516 2933015029 287
205 iso_pu_bacteria 2933594066 2933596705 287
206 iso_pu_bacteria 2936996657 2937000842 287
207 iso_pu_bacteria 2937002841 2937009656 287
208 iso_pu_bacteria 2937009748 2937016319 287
209 iso_pu_bacteria 2937016420 2937019562 287
210 iso_pu_bacteria 2937023124 2937028659 287
211 iso_pu_bacteria 2937029754 2937030347 287
212 iso_pu_bacteria 2937036028 2937040754 287
213 iso_pu_bacteria 2937042894 2937045912 287
214 iso_pu_bacteria 2937049772 2937056369 287
215 iso_pu_bacteria 2937056579 2937060831 287
216 iso_pu_bacteria 2937063883 2937069325 287
217 iso_pu_bacteria 2937071275 2937072484 287
218 iso_pu_bacteria 2937078374 2937079381 287
219 iso_pu_bacteria 2937084907 2937088890 287
220 iso_pu_bacteria 2937091812 2937095279 287
221 iso_pu_bacteria 2937098957 2937104518 287
222 iso_pu_bacteria 2937106411 2937109204 287
223 iso_pu_bacteria 2937113482 2937114124 287
224 iso_pu_bacteria 2937119839 2937125786 287
225 iso_pu_bacteria 2937126314 2937129931 287
226 iso_pu_bacteria 2941499720 2941499980 287
227 iso_pu_bacteria 2957375807 2957377168 287
228 iso_pu_bacteria 2957382221 2957385749 287
229 iso_pu_bacteria 2957388812 2957388872 287
230 iso_pu_bacteria 2957395598 2957397293 287
231 iso_pu_bacteria 2957402308 2957406478 287
232 iso_pu_bacteria 2957408893 2957413669 287
233 iso_pu_bacteria 2957415311 2957418205 287
234 iso_pu_bacteria 2957422303 2957426014 287
235 iso_pu_bacteria 2957430029 2957431815 287
236 iso_pu_bacteria 2957437181 2957441233 287
237 iso_pu_bacteria 2957443900 2957444737 287
238 iso_pu_bacteria 2957450854 2957453235 287
239 iso_pu_bacteria 2957457609 2957458989 287
240 iso_pu_bacteria 2957464669 2957468153 287
241 iso_pu_bacteria 2957471148 2957475172 287
242 iso_pu_bacteria 2957478035 2957481866 287
243 iso_pu_bacteria 2957484790 2957489217 287
244 iso_pu_bacteria 2957491536 2957491942 287
245 iso_pu_bacteria 2957498199 2957504692 287
246 iso_pu_bacteria 2957505466 2957509092 287
247 iso_pu_bacteria 2960584000 2960587034 287
248 iso_pu_bacteria 2960591022 2960593487 287
249 iso_pu_bacteria 2960597568 2960603590 287
250 iso_pu_bacteria 2960603979 2960604605 287
251 iso_pu_bacteria 2960610863 2960615723 287
252 iso_pu_bacteria 2960617483 2960617960 287
253 iso_pu_bacteria 2960624210 2960628133 287
254 iso_pu_bacteria 2960631154 2960633879 287
255 iso_pu_bacteria 2960637947 2960641084 287
256 iso_pu_bacteria 2960652885 2960654371 287
257 iso_pu_bacteria 2960660292 2960661420 287
258 iso_pu_bacteria 2960667422 2960673747 287
259 iso_pu_bacteria 2960674078 2960677332 287
260 iso_pu_bacteria 2960680706 2960685074 287
261 iso_pu_bacteria 2960687367 2960691546 287
262 iso_pu_bacteria 2960693952 2960698706 287
263 iso_pu_bacteria 2964607997 2964611316 287
264 iso_pu_bacteria 2964615318 2964618775 287
265 iso_pu_bacteria 2964621998 2964624436 287
266 iso_pu_bacteria 2964628898 2964632765 287
267 iso_pu_bacteria 2964636051 2964641180 287
268 iso_pu_bacteria 2964643177 2964647027 287
269 iso_pu_bacteria 2964649959 2964652809 287
270 iso_pu_bacteria 2964656573 2964661985 287
271 iso_pu_bacteria 2964663802 2964670749 287
272 iso_pu_bacteria 2964670856 2964676147 287
273 iso_pu_bacteria 2964678106 2964679732 287
274 iso_pu_bacteria 2964685014 2964686250 287
275 iso_pu_bacteria 2964691889 2964692629 287
276 iso_pu_bacteria 2964698721 2964699816 287
277 iso_pu_bacteria 2964705432 2964706934 287
278 iso_pu_bacteria 2964712639 2964717100 287
279 iso_pu_bacteria 2964719344 2964723825 287
280 iso_pu_bacteria 2967664464 2967670387 287
281 iso_pu_bacteria 2967671571 2967672644 287
282 iso_pu_bacteria 2967678726 2967683446 287
283 iso_pu_bacteria 2967686174 2967688599 287
284 iso_pu_bacteria 2967693043 2967694534 287
285 iso_pu_bacteria 2967699805 2967701759 287
286 iso_pu_bacteria 2967706974 2967709856 287
287 iso_pu_bacteria 2967714385 2967718805 287
288 iso_pu_bacteria 2967721400 2967726209 287
289 iso_pu_bacteria 2967728569 2967729688 287
290 iso_pu_bacteria 2967735183 2967738898 287
291 iso_pu_bacteria 2967742019 2967743319 287
292 iso_pu_bacteria 2967748971 2967755346 287
293 iso_pu_bacteria 2967755722 2967761592 287
294 iso_pu_bacteria 2967762386 2967766777 287
295 iso_pu_bacteria 2967769361 2967772583 287
296 iso_pu_bacteria 2967775926 2967779044 287
297 iso_pu_bacteria 2970019648 2970022712 287
298 iso_pu_bacteria 2970026789 2970027870 287
299 iso_pu_bacteria 2970033650 2970036724 287
300 iso_pu_bacteria 2970040964 2970042683 287
301 iso_pu_bacteria 2970047711 2970051757 287
302 iso_pu_bacteria 2970054988 2970058081 287
303 iso_pu_bacteria 2970061556 2970062894 287
304 iso_pu_bacteria 2970068827 2970072158 287
305 iso_pu_bacteria 2970076120 2970079509 287
306 iso_pu_bacteria 2970082768 2970086640 287
307 iso_pu_bacteria 2970088815 2970091776 287
308 iso_pu_bacteria 2970095765 2970098663 287
309 iso_pu_bacteria 2970102677 2970105813 287
310 iso_pu_bacteria 2970109326 2970111934 287
311 iso_pu_bacteria 2970116247 2970120744 287
312 iso_pu_bacteria 2970122695 2970123206 287
313 iso_pu_bacteria 2970129317 2970129776 287
314 iso_pu_bacteria 2970136068 2970139045 287
315 iso_pu_bacteria 2970143518 2970149774 287
316 iso_pu_bacteria 2970149975 2970154205 287
317 iso_pu_bacteria 2970156795 2970160609 287
318 iso_pu_bacteria 2970164137 2970167569 287
319 iso_pu_bacteria 2970170962 2970173609 287
320 iso_pu_bacteria 2970177841 2970178704 287
321 iso_pu_bacteria 2970184632 2970186563 287
322 iso_pu_bacteria 2970191845 2970193270 287
323 iso_pu_bacteria 2977516862 2977520539 287
324 iso_pu_bacteria 2977523885 2977530194 287
325 iso_pu_bacteria 2977530762 2977532308 287
326 iso_pu_bacteria 2977537788 2977541409 287
327 iso_pu_bacteria 2977551784 2977557537 287
328 iso_pu_bacteria 2977558990 2977560824 287
329 iso_pu_bacteria 2977565890 2977569791 287
330 iso_pu_bacteria 2977572785 2977577767 287
331 iso_pu_bacteria 2977579622 2977583905 287
332 iso_pu_bacteria 2979089926 2979094566 287
333 iso_pu_bacteria 2979095461 2979098051 287
334 iso_pu_bacteria 2979100975 2979103808 287
335 iso_pu_bacteria 2984509177 2984511626 287
336 iso_pu_bacteria 2984518228 2984522013 287
337 iso_pu_bacteria 2984537506 2984541311 287
338 iso_pu_bacteria 2984587000 2984589824 287
339 iso_pu_bacteria 2984601300 2984603589 287
340 iso_pu_bacteria 2989349275 2989353438 287
341 iso_pu_bacteria 643692032 643825375 287
342 iso_pu_bacteria 648276728 648741536 287
343 iso_pu_bacteria 650716007 650740445 287
344 iso_pu_bacteria 8003570095 8003571508 287
345 iso_pu_bacteria 8003992118 8003993204 287
346 iso_pu_bacteria 8003999396 8004000461 287
347 iso_pu_bacteria 2643221637 2644206032 288
348 iso_pu_bacteria 2643221718 2644649679 288
349 iso_pu_bacteria 2791355253 2793282420 288
350 iso_pu_bacteria 2842922631 2842925048 288
351 3300002773 JGI25152J39213_1008753 JGI25152J39213_10087532 289
352 3300005347 Ga0070668_100181647 Ga0070668_1001816471 289
353 3300005355 Ga0070671_100038063 Ga0070671_1000380634 289
354 3300005457 Ga0070662_100086648 Ga0070662_1000866484 289
355 3300005466 Ga0070685_10147333 Ga0070685_101473331 289
356 3300006038 Ga0075365_10028260 Ga0075365_100282603 289
357 3300006186 Ga0075369_10082166 Ga0075369_100821662 289
358 3300009177 Ga0105248_10322768 Ga0105248_103227682 289
359 3300009553 Ga0105249_10084573 Ga0105249_100845732 289
360 3300009766 Ga0123342_1041008 Ga0123342_10410082 289
361 3300025258 Ga0209129_1004233 Ga0209129_10042336 289
362 3300025295 Ga0209564_1016735 Ga0209564_10167352 289
363 3300025297 Ga0209758_1029025 Ga0209758_10290252 289
364 3300025302 Ga0207426_1011540 Ga0207426_10115401 289
365 3300025303 Ga0209051_1032838 Ga0209051_10328382 289
366 3300025931 Ga0207644_10048176 Ga0207644_100481765 289
367 3300025933 Ga0207706_10131423 Ga0207706_101314233 289
368 3300025941 Ga0207711_10206609 Ga0207711_102066093 289
369 3300025961 Ga0207712_10457396 Ga0207712_104573962 289
370 3300046507 Ga0495606_0049109 Ga0495606_0049109_1830_2732 289
371 3300048908 Ga0496105_0117115 Ga0496105_0117115_1181_2071 289
372 3300048914 Ga0496111_0269516 Ga0496111_0269516_169_1059 289
373 3300048916 Ga0496113_0256652 Ga0496113_0256652_61_951 289
374 3300048917 Ga0496114_0076506 Ga0496114_0076506_98_1000 289
375 3300048922 Ga0496119_0025832 Ga0496119_0025832_3114_4004 289
376 3300048925 Ga0496122_0037418 Ga0496122_0037418_76_966 289
377 3300048927 Ga0496124_0055128 Ga0496124_0055128_134_1024 289
378 3300048928 Ga0496125_0118953 Ga0496125_0118953_99_989 289
379 3300049570 Ga0501033_0022920 Ga0501033_0022920_2545_3423 289
380 3300049822 Ga0501035_0042498 Ga0501035_0042498_2541_3419 289
381 iso_pu_bacteria 2643221558 2643809818 289
382 iso_pu_bacteria 2657244999 2657683047 289
383 iso_pu_bacteria 2791355082 2792584411 289
384 iso_pu_bacteria 2791355092 2792628620 289
385 iso_pu_bacteria 8049293176 8049294254 289
386 3300003187 JGI25151J46595_10008103 JGI25151J46595_100081034 290
387 3300003856 Ga0058692_1002661 Ga0058692_10026615 290
388 3300003856 Ga0058692_1004925 Ga0058692_10049255 290
389 3300005548 Ga0070665_100032328 Ga0070665_1000323284 290
390 3300006042 Ga0075368_10002087 Ga0075368_100020874 290
391 3300006178 Ga0075367_10108192 Ga0075367_101081922 290
392 3300006948 Ga0099826_10000098 Ga0099826_1000009828 290
393 3300009036 Ga0105244_10041955 Ga0105244_100419551 290
394 3300009148 Ga0105243_10052642 Ga0105243_100526423 290
395 3300013102 Ga0157371_10001437 Ga0157371_1000143722 290
396 3300013104 Ga0157370_10000351 Ga0157370_1000035110 290
397 3300013307 Ga0157372_10655200 Ga0157372_106552002 290
398 3300025294 Ga0209025_1000405 Ga0209025_100040546 290
399 3300025294 Ga0209025_1049232 Ga0209025_10492322 290
400 3300025935 Ga0207709_10008294 Ga0207709_100082946 290
401 3300027312 Ga0209371_1000328 Ga0209371_100032859 290
402 3300027312 Ga0209371_1001894 Ga0209371_100189411 290
403 3300027666 Ga0209282_1000147 Ga0209282_100014722 290
404 3300027866 Ga0209813_10004171 Ga0209813_100041716 290
405 3300028379 Ga0268266_10083415 Ga0268266_100834154 290
406 3300030500 Ga0268256_1000019 Ga0268256_1000019577 290
407 3300030500 Ga0268256_1004165 Ga0268256_10041659 290
408 3300030744 Ga0316181_1156578 Ga0316181_11565784 290
409 3300031852 Ga0307410_10261927 Ga0307410_102619271 290
410 3300037471 Ga0395905_0010488 Ga0395905_0010488_656_1537 290
411 3300046674 Ga0495588_0002878 Ga0495588_0002878_192_1079 290
412 3300048907 Ga0496104_0119719 Ga0496104_0119719_881_1768 290
413 3300048919 Ga0496116_0000322 Ga0496116_0000322_64983_65864 290
414 3300048920 Ga0496117_0000002 Ga0496117_0000002_603434_604321 290
415 3300048921 Ga0496118_0001028 Ga0496118_0001028_4088_4975 290
416 3300048922 Ga0496119_0036640 Ga0496119_0036640_723_1610 290
417 3300048923 Ga0496120_0000180 Ga0496120_0000180_4111_4998 290
418 3300048924 Ga0496121_0000003 Ga0496121_0000003_264360_265253 290
419 3300048925 Ga0496122_0000004 Ga0496122_0000004_4116_5003 290
420 3300048925 Ga0496122_0023868 Ga0496122_0023868_2621_3502 290
421 3300048925 Ga0496122_0081101 Ga0496122_0081101_1274_2167 290
422 3300048926 Ga0496123_0000007 Ga0496123_0000007_4116_5003 290
423 3300048926 Ga0496123_0040255 Ga0496123_0040255_89_970 290
424 3300048927 Ga0496124_0011204 Ga0496124_0011204_4126_5013 290
425 3300048927 Ga0496124_0014415 Ga0496124_0014415_2786_3667 290
426 3300048927 Ga0496124_0198997 Ga0496124_0198997_413_1294 290
427 3300048929 Ga0496126_0001008 Ga0496126_0001008_44644_45525 290
428 3300048929 Ga0496126_0390676 Ga0496126_0390676_95_982 290
429 3300048929 Ga0496126_0390680 Ga0496126_0390680_95_982 290
430 3300050491 nmdc:mga00v17_43489_c1 nmdc:mga00v17_43489_c1_1732_2619 290
431 3300050492 nmdc:mga0yw44_2589_c1 nmdc:mga0yw44_2589_c1_4115_5002 290
432 3300050495 nmdc:mga04h51_6320_c1 nmdc:mga04h51_6320_c1_1423_2310 290
433 3300050496 nmdc:mga07m45_44172_c1 nmdc:mga07m45_44172_c1_403_1290 290
434 3300050516 nmdc:mga0sz30_1247_c1 nmdc:mga0sz30_1247_c1_4107_4994 290
435 3300053111 Ga0500572_023543 Ga0500572_023543_585_1466 290
436 3300053137 Ga0500561_0000181 Ga0500561_0000181_4128_5015 290
437 3300053157 Ga0500624_004970 Ga0500624_004970_563_1450 290
438 3300053161 Ga0500634_0130207 Ga0500634_0130207_51_938 290
439 3300053177 Ga0500636_0001051 Ga0500636_0001051_4660_5541 290
440 3300053177 Ga0500636_0016209 Ga0500636_0016209_3134_4015 290
441 3300002987 JGI25159J45721_1000002 JGI25159J45721_10000023 291
442 3300003187 JGI25151J46595_10033779 JGI25151J46595_100337795 291
443 3300003354 JGI25160J50197_1000008 JGI25160J50197_10000083 291
444 3300003374 JGI25161J50226_1000986 JGI25161J50226_10009863 291
445 3300003771 Ga0055526_1002661 Ga0055526_100266112 291
446 3300003775 Ga0055524_1001683 Ga0055524_10016834 291
447 3300003781 Ga0055536_1001156 Ga0055536_10011563 291
448 3300003791 Ga0055530_10012989 Ga0055530_100129892 291
449 3300004625 Ga0055543_1000027 Ga0055543_1000027134 291
450 3300005262 Ga0065165_1000015 Ga0065165_10000154 291
451 3300006946 Ga0079104_1001945 Ga0079104_10019452 291
452 3300006946 Ga0079104_1024882 Ga0079104_10248822 291
453 3300013249 Ga0171463_1011 Ga0171463_10116 291
454 3300015690 Ga0183363_1362 Ga0183363_13626 291
455 3300021320 Ga0214544_1022053 Ga0214544_10220535 291
456 3300021321 Ga0214542_1000006 Ga0214542_1000006319 291
457 3300021327 Ga0214543_1000014 Ga0214543_10000144 291
458 3300021327 Ga0214543_1022635 Ga0214543_10226354 291
459 3300022739 Ga0228711_1000015 Ga0228711_100001562 291
460 3300022740 Ga0228710_1000015 Ga0228710_100001586 291
461 3300025208 Ga0209436_109891 Ga0209436_1098912 291
462 3300025273 Ga0209673_1039255 Ga0209673_10392553 291
463 3300025284 Ga0209130_1000007 Ga0209130_1000007300 291
464 3300025292 Ga0209676_1001917 Ga0209676_10019174 291
465 3300025294 Ga0209025_1000303 Ga0209025_100030330 291
466 3300025294 Ga0209025_1000361 Ga0209025_100036191 291
467 3300025295 Ga0209564_1000296 Ga0209564_100029694 291
468 3300025298 Ga0209050_1017392 Ga0209050_10173924 291
469 3300025299 Ga0209256_1003048 Ga0209256_10030484 291
470 3300025299 Ga0209256_1018331 Ga0209256_10183313 291
471 3300025302 Ga0207426_1000064 Ga0207426_1000064300 291
472 3300025303 Ga0209051_1021865 Ga0209051_10218654 291
473 3300025304 Ga0209257_1000817 Ga0209257_100081751 291
474 3300027111 Ga0209281_1000339 Ga0209281_100033976 291
475 3300027111 Ga0209281_1001295 Ga0209281_100129515 291
476 3300027666 Ga0209282_1000054 Ga0209282_100005471 291
477 3300028794 Ga0307515_10001636 Ga0307515_100016364 291
478 3300031456 Ga0307513_10006680 Ga0307513_1000668013 291
479 3300031548 Ga0307408_100072916 Ga0307408_1000729164 291
480 3300031967 Ga0315914_1000013 Ga0315914_100001362 291
481 3300033430 Ga0315913_1000097 Ga0315913_100009762 291
482 3300033464 Ga0315915_1000001 Ga0315915_100000162 291
483 3300037471 Ga0395905_0013381 Ga0395905_0013381_677_1666 291
484 3300041404 Ga0439436_0049072 Ga0439436_0049072_149_1024 291
485 3300041411 Ga0439466_0065366 Ga0439466_0065366_130_1005 291
486 3300042007 Ga0439449_0009113 Ga0439449_0009113_2140_3015 291
487 3300053140 Ga0500573_0047899 Ga0500573_0047899_1292_2167 291
488 iso_pu_bacteria 2791355256 2793296403 291
489 iso_pu_bacteria 2791355262 2793333821 291
490 iso_pu_bacteria 2838661181 2838662944 291
491 iso_pu_bacteria 2509276021 2509387474 292
492 iso_pu_bacteria 2510065019 2510132513 292
493 iso_pu_bacteria 2510461076 2510898881 292
494 iso_pu_bacteria 2510917028 2511183110 292
495 iso_pu_bacteria 2510917030 2511199009 292
496 iso_pu_bacteria 2513237084 2513569351 292
497 iso_pu_bacteria 2513237085 2513579021 292
498 iso_pu_bacteria 2513237088 2513596366 292
499 iso_pu_bacteria 2513237093 2513632542 292
500 iso_pu_bacteria 2513237103 2513708991 292
501 iso_pu_bacteria 2513237138 2513868895 292
502 iso_pu_bacteria 2513237144 2513908877 292
503 iso_pu_bacteria 2513237146 2513930703 292
504 iso_pu_bacteria 2513237162 2514020529 292
505 iso_pu_bacteria 2515075009 2515111503 292
506 iso_pu_bacteria 2515154114 2515644186 292
507 iso_pu_bacteria 2515154116 2515660379 292
508 iso_pu_bacteria 2515154134 2515740684 292
509 iso_pu_bacteria 2516653077 2517040149 292
510 iso_pu_bacteria 2516653085 2517075691 292
511 iso_pu_bacteria 2517093000 2517094280 292
512 iso_pu_bacteria 2517287029 2517406082 292
513 iso_pu_bacteria 2519899620 2520375150 292
514 iso_pu_bacteria 2529292951 2530643676 292
515 iso_pu_bacteria 2534681796 2535515834 292
516 iso_pu_bacteria 2582581294 2585203192 292
517 iso_pu_bacteria 2582581298 2585221288 292
518 iso_pu_bacteria 2582581299 2585233689 292
519 iso_pu_bacteria 2582581304 2585256501 292
520 iso_pu_bacteria 2582581867 2585400009 292
521 iso_pu_bacteria 2585427526 2585529480 292
522 iso_pu_bacteria 2585427528 2585541223 292
523 iso_pu_bacteria 2585427529 2585549490 292
524 iso_pu_bacteria 2585427590 2585822567 292
525 iso_pu_bacteria 2585427593 2585839644 292
526 iso_pu_bacteria 2585427594 2585847106 292
527 iso_pu_bacteria 2599185170 2599418355 292
528 iso_pu_bacteria 2615840624 2616296007 292
529 iso_pu_bacteria 2643221599 2644008036 292
530 iso_pu_bacteria 2643221634 2644196120 292
531 iso_pu_bacteria 2718217882 2719180488 292
532 iso_pu_bacteria 2718217927 2719385082 292
533 iso_pu_bacteria 2718217997 2719664841 292
534 iso_pu_bacteria 2718218009 2719731237 292
535 iso_pu_bacteria 2718218199 2720491261 292
536 iso_pu_bacteria 2718218232 2720612621 292
537 iso_pu_bacteria 2718218233 2720619459 292
538 iso_pu_bacteria 2718218235 2720630915 292
539 iso_pu_bacteria 2718218269 2720774553 292
540 iso_pu_bacteria 2718218363 2721146582 292
541 iso_pu_bacteria 2718218365 2721158107 292
542 iso_pu_bacteria 2718218366 2721163461 292
543 iso_pu_bacteria 2718218423 2721398802 292
544 iso_pu_bacteria 2721755514 2722839631 292
545 iso_pu_bacteria 2721755556 2723026278 292
546 iso_pu_bacteria 2721755684 2723559821 292
547 iso_pu_bacteria 2721755685 2723566441 292
548 iso_pu_bacteria 2721755809 2724037615 292
549 iso_pu_bacteria 2721755810 2724043993 292
550 iso_pu_bacteria 2721755819 2724089160 292
551 iso_pu_bacteria 2721755822 2724103706 292
552 iso_pu_bacteria 2721755823 2724109544 292
553 iso_pu_bacteria 2724679232 2725945524 292
554 iso_pu_bacteria 2728369352 2730107214 292
555 iso_pu_bacteria 2728369365 2730163725 292
556 iso_pu_bacteria 2728369397 2730297739 292
557 iso_pu_bacteria 2738541293 2738802270 292
558 iso_pu_bacteria 2738541333 2739036104 292
559 iso_pu_bacteria 2765235942 2766063745 292
560 iso_pu_bacteria 2791355260 2793320885 292
561 iso_pu_bacteria 2791355261 2793326927 292
562 iso_pu_bacteria 2791355263 2793339576 292
563 iso_pu_bacteria 2791355265 2793354990 292
564 iso_pu_bacteria 2791355266 2793359135 292
565 iso_pu_bacteria 2791355267 2793368056 292
566 iso_pu_bacteria 2802429605 2805926371 292
567 iso_pu_bacteria 2802429606 2805933176 292
568 iso_pu_bacteria 2802429633 2806048858 292
569 iso_pu_bacteria 2802429634 2806052300 292
570 iso_pu_bacteria 2802429635 2806058929 292
571 iso_pu_bacteria 2802429636 2806067284 292
572 iso_pu_bacteria 2802429637 2806074195 292
573 iso_pu_bacteria 2838016132 2838017509 292
574 iso_pu_bacteria 2838022645 2838022923 292
575 iso_pu_bacteria 2838035591 2838037955 292
576 iso_pu_bacteria 2838042994 2838046156 292
577 iso_pu_bacteria 2838048938 2838049009 292
578 iso_pu_bacteria 2838061910 2838063560 292
579 iso_pu_bacteria 2838068647 2838072787 292
580 iso_pu_bacteria 2838668709 2838671057 292
581 iso_pu_bacteria 2838680041 2838681554 292
582 iso_pu_bacteria 2838686498 2838692756 292
583 iso_pu_bacteria 2838694306 2838694411 292
584 iso_pu_bacteria 2838701080 2838703428 292
585 iso_pu_bacteria 2838707686 2838707789 292
586 iso_pu_bacteria 2838729681 2838735058 292
587 iso_pu_bacteria 2838742623 2838747583 292
588 iso_pu_bacteria 2841851746 2841857294 292
589 iso_pu_bacteria 2841864319 2841865256 292
590 iso_pu_bacteria 2842077413 2842080980 292
591 iso_pu_bacteria 2842110456 2842117544 292
592 iso_pu_bacteria 2842118031 2842121599 292
593 iso_pu_bacteria 2842146304 2842147348 292
594 iso_pu_bacteria 2842156927 2842163248 292
595 iso_pu_bacteria 2842163707 2842168515 292
596 iso_pu_bacteria 2842180545 2842186852 292
597 iso_pu_bacteria 2842192696 2842197604 292
598 iso_pu_bacteria 2842198810 2842199352 292
599 iso_pu_bacteria 2842205361 2842210126 292
600 iso_pu_bacteria 2842217011 2842221423 292
601 iso_pu_bacteria 2842229732 2842234858 292
602 iso_pu_bacteria 2842237096 2842237200 292
603 iso_pu_bacteria 2842243621 2842248923 292
604 iso_pu_bacteria 2842250916 2842252414 292
605 iso_pu_bacteria 2842257432 2842262787 292
606 iso_pu_bacteria 2842264693 2842266688 292
607 iso_pu_bacteria 2842271015 2842277225 292
608 iso_pu_bacteria 2842278818 2842283580 292
609 iso_pu_bacteria 2842285085 2842286912 292
610 iso_pu_bacteria 2842291075 2842294636 292
611 iso_pu_bacteria 2842304105 2842310222 292
612 iso_pu_bacteria 2842311132 2842316821 292
613 iso_pu_bacteria 2842317721 2842318442 292
614 iso_pu_bacteria 2842341865 2842343378 292
615 iso_pu_bacteria 2842363717 2842365482 292
616 iso_pu_bacteria 2842370503 2842372017 292
617 iso_pu_bacteria 2842377471 2842381034 292
618 iso_pu_bacteria 2842384541 2842388105 292
619 iso_pu_bacteria 2842395702 2842398024 292
620 iso_pu_bacteria 2842402390 2842404180 292
621 iso_pu_bacteria 2842409023 2842411135 292
622 iso_pu_bacteria 2842415677 2842417409 292
623 iso_pu_bacteria 2842422224 2842426528 292
624 iso_pu_bacteria 2842428310 2842434762 292
625 iso_pu_bacteria 2842434925 2842437168 292
626 iso_pu_bacteria 2842441272 2842443260 292
627 iso_pu_bacteria 2842447887 2842452767 292
628 iso_pu_bacteria 2842462802 2842469123 292
629 iso_pu_bacteria 2842469257 2842471517 292
630 iso_pu_bacteria 2842489311 2842495173 292
631 iso_pu_bacteria 2842495871 2842497077 292
632 iso_pu_bacteria 2844454524 2844454907 292
633 iso_pu_bacteria 2857516855 2857521626 292
634 iso_pu_bacteria 2919100787 2919104054 292
635 iso_pu_bacteria 2923556063 2923557456 292
636 iso_pu_bacteria 2933016740 2933021991 292
637 iso_pu_bacteria 2933570622 2933576588 292
638 iso_pu_bacteria 2933586486 2933593641 292
639 iso_pu_bacteria 2933599457 2933603716 292
640 iso_pu_bacteria 2935894831 2935894934 292
641 iso_pu_bacteria 2935901341 2935903912 292
642 iso_pu_bacteria 2936367885 2936367888 292
643 iso_pu_bacteria 2936375103 2936381695 292
644 iso_pu_bacteria 2936381700 2936388093 292
645 iso_pu_bacteria 2996887358 2996888809 292
646 iso_pu_bacteria 2996893221 2996898846 292
647 iso_pu_bacteria 3005409236 3005412720 292
648 iso_pu_bacteria 3005452660 3005453589 292
649 iso_pu_bacteria 639633055 639647638 292
650 iso_pu_bacteria 8005258706 8005260080 292
651 iso_pu_bacteria 8005275841 8005279852 292
652 iso_pu_bacteria 8005282627 8005283418 292
653 iso_pu_bacteria 8005289223 8005292998 292
654 iso_pu_bacteria 8005307578 8005308600 292
655 iso_pu_bacteria 8005321885 8005323336 292
656 iso_pu_bacteria 8005382845 8005385783 292
657 iso_pu_bacteria 8005395548 8005400537 292
658 iso_pu_bacteria 8005430974 8005437325 292
659 iso_pu_bacteria 8005460587 8005462151 292
660 iso_pu_bacteria 8005497431 8005499570 292
661 iso_pu_bacteria 8005542996 8005544467 292
662 iso_pu_bacteria 8005556819 8005559758 292
663 iso_pu_bacteria 8005563573 8005570695 292
664 iso_pu_bacteria 8005570704 8005572896 292
665 iso_pu_bacteria 8005619151 8005620750 292
666 iso_pu_bacteria 8005626139 8005626888 292
667 iso_pu_bacteria 8005668836 8005670987 292
668 iso_pu_bacteria 8005688590 8005691235 292
669 iso_pu_bacteria 8005695170 8005698559 292
670 iso_pu_bacteria 8018127388 8018131542 292
671 iso_pu_bacteria 8018163183 8018169277 292
672 iso_pu_bacteria 8018176218 8018180177 292
673 iso_pu_bacteria 8023680758 8023681947 292
674 iso_pu_bacteria 8024479707 8024481374 292
675 iso_pu_bacteria 8024501048 8024503041 292
676 iso_pu_bacteria 8056375014 8056380942 292
677 iso_pu_bacteria 8056382006 8056384532 292
678 iso_pu_bacteria 8057874678 8057876523 292
679 3300002987 JGI25159J45721_1003547 JGI25159J45721_10035477 294
680 3300003214 JGI25165J46597_1006328 JGI25165J46597_10063283 294
681 3300003354 JGI25160J50197_1003935 JGI25160J50197_10039355 294
682 3300003374 JGI25161J50226_1000014 JGI25161J50226_1000014196 294
683 3300004625 Ga0055543_1000109 Ga0055543_100010974 294
684 3300005262 Ga0065165_1000915 Ga0065165_10009157 294
685 3300005367 Ga0070667_100234492 Ga0070667_1002344922 294
686 3300005563 Ga0068855_100180241 Ga0068855_1001802412 294
687 3300005834 Ga0068851_10018396 Ga0068851_100183961 294
688 3300009093 Ga0105240_10004701 Ga0105240_100047016 294
689 3300009545 Ga0105237_10002935 Ga0105237_100029355 294
690 3300013104 Ga0157370_10007253 Ga0157370_100072533 294
691 3300015265 Ga0182005_1008917 Ga0182005_10089175 294
692 3300025208 Ga0209436_111918 Ga0209436_1119182 294
693 3300025253 Ga0209677_101074 Ga0209677_10107412 294
694 3300025261 Ga0209233_1001047 Ga0209233_100104711 294
695 3300025284 Ga0209130_1000018 Ga0209130_100001825 294
696 3300025302 Ga0207426_1000044 Ga0207426_1000044365 294
697 3300025913 Ga0207695_10003914 Ga0207695_1000391418 294
698 3300025914 Ga0207671_10012250 Ga0207671_100122508 294
699 3300025949 Ga0207667_10553377 Ga0207667_105533771 294
700 3300048905 Ga0496102_0050644 Ga0496102_0050644_420_1328 294
701 3300048919 Ga0496116_0128141 Ga0496116_0128141_131_1039 294
702 3300048920 Ga0496117_0006432 Ga0496117_0006432_387_1295 294
703 3300048921 Ga0496118_0007239 Ga0496118_0007239_387_1295 294
704 3300048922 Ga0496119_0139703 Ga0496119_0139703_88_996 294
705 3300048923 Ga0496120_0038438 Ga0496120_0038438_1792_2700 294
706 3300048924 Ga0496121_0003794 Ga0496121_0003794_9756_10664 294
707 3300048925 Ga0496122_0012241 Ga0496122_0012241_4065_4973 294
708 3300048926 Ga0496123_0012453 Ga0496123_0012453_4127_5035 294
709 3300048927 Ga0496124_0066083 Ga0496124_0066083_1792_2700 294
710 3300048929 Ga0496126_0039838 Ga0496126_0039838_750_1658 294
711 3300002773 JGI25152J39213_1002523 JGI25152J39213_10025232 295
712 3300002773 JGI25152J39213_1003647 JGI25152J39213_10036471 295
713 3300002773 JGI25152J39213_1012472 JGI25152J39213_10124722 295
714 3300002774 JGI25150J39212_1000153 JGI25150J39212_100015343 295
715 3300002774 JGI25150J39212_1002615 JGI25150J39212_10026154 295
716 3300002987 JGI25159J45721_1005935 JGI25159J45721_10059353 295
717 3300003187 JGI25151J46595_10000108 JGI25151J46595_10000108112 295
718 3300003187 JGI25151J46595_10004679 JGI25151J46595_100046793 295
719 3300003187 JGI25151J46595_10005084 JGI25151J46595_100050843 295
720 3300003215 JGI25153J46596_10006470 JGI25153J46596_100064709 295
721 3300003215 JGI25153J46596_10007593 JGI25153J46596_100075932 295
722 3300003215 JGI25153J46596_10016965 JGI25153J46596_100169652 295
723 3300003374 JGI25161J50226_1000839 JGI25161J50226_100083911 295
724 3300003374 JGI25161J50226_1006713 JGI25161J50226_10067135 295
725 3300003775 Ga0055524_1007422 Ga0055524_10074223 295
726 3300003775 Ga0055524_1016863 Ga0055524_10168632 295
727 3300003790 Ga0055528_1004080 Ga0055528_10040803 295
728 3300003790 Ga0055528_1004197 Ga0055528_100419711 295
729 3300003790 Ga0055528_1006267 Ga0055528_10062676 295
730 3300003790 Ga0055528_1016805 Ga0055528_10168055 295
731 3300003792 Ga0055540_1003094 Ga0055540_10030943 295
732 3300003792 Ga0055540_1003655 Ga0055540_10036559 295
733 3300003792 Ga0055540_1038030 Ga0055540_10380301 295
734 3300004625 Ga0055543_1000193 Ga0055543_10001935 295
735 3300004625 Ga0055543_1004741 Ga0055543_10047417 295
736 3300005262 Ga0065165_1004124 Ga0065165_10041249 295
737 3300005262 Ga0065165_1019249 Ga0065165_10192492 295
738 3300005262 Ga0065165_1021974 Ga0065165_10219745 295
739 3300005347 Ga0070668_100202824 Ga0070668_1002028241 295
740 3300006038 Ga0075365_10094626 Ga0075365_100946262 295
741 3300006048 Ga0075363_100114733 Ga0075363_1001147332 295
742 3300006048 Ga0075363_100145860 Ga0075363_1001458603 295
743 3300006177 Ga0075362_10004901 Ga0075362_100049015 295
744 3300006178 Ga0075367_10005429 Ga0075367_1000542910 295
745 3300006178 Ga0075367_10061958 Ga0075367_100619581 295
746 3300006178 Ga0075367_10221576 Ga0075367_102215761 295
747 3300006186 Ga0075369_10018710 Ga0075369_100187105 295
748 3300006195 Ga0075366_10091007 Ga0075366_100910071 295
749 3300006353 Ga0075370_10012045 Ga0075370_100120456 295
750 3300012490 Ga0157322_1000552 Ga0157322_10005522 295
751 3300025208 Ga0209436_100075 Ga0209436_10007528 295
752 3300025245 Ga0207425_1000031 Ga0207425_10000315 295
753 3300025245 Ga0207425_1019089 Ga0207425_10190892 295
754 3300025258 Ga0209129_1000053 Ga0209129_10000536 295
755 3300025258 Ga0209129_1000285 Ga0209129_10002854 295
756 3300025258 Ga0209129_1003123 Ga0209129_100312310 295
757 3300025258 Ga0209129_1007223 Ga0209129_10072232 295
758 3300025273 Ga0209673_1000041 Ga0209673_1000041328 295
759 3300025273 Ga0209673_1001438 Ga0209673_100143820 295
760 3300025273 Ga0209673_1001549 Ga0209673_100154917 295
761 3300025273 Ga0209673_1003714 Ga0209673_100371412 295
762 3300025273 Ga0209673_1043499 Ga0209673_10434992 295
763 3300025284 Ga0209130_1000006 Ga0209130_1000006323 295
764 3300025292 Ga0209676_1044033 Ga0209676_10440332 295
765 3300025294 Ga0209025_1000087 Ga0209025_10000875 295
766 3300025294 Ga0209025_1000440 Ga0209025_100044075 295
767 3300025294 Ga0209025_1004972 Ga0209025_10049724 295
768 3300025294 Ga0209025_1015852 Ga0209025_10158525 295
769 3300025294 Ga0209025_1063087 Ga0209025_10630872 295
770 3300025295 Ga0209564_1000640 Ga0209564_10006406 295
771 3300025295 Ga0209564_1000652 Ga0209564_10006526 295
772 3300025295 Ga0209564_1001439 Ga0209564_100143921 295
773 3300025295 Ga0209564_1005795 Ga0209564_10057959 295
774 3300025297 Ga0209758_1000081 Ga0209758_10000815 295
775 3300025297 Ga0209758_1000717 Ga0209758_10007176 295
776 3300025297 Ga0209758_1002836 Ga0209758_100283615 295
777 3300025297 Ga0209758_1006242 Ga0209758_100624211 295
778 3300025299 Ga0209256_1004700 Ga0209256_100470012 295
779 3300025299 Ga0209256_1005851 Ga0209256_10058519 295
780 3300025299 Ga0209256_1011473 Ga0209256_10114735 295
781 3300025299 Ga0209256_1014956 Ga0209256_10149566 295
782 3300025302 Ga0207426_1000119 Ga0207426_10001196 295
783 3300025302 Ga0207426_1000231 Ga0207426_100023199 295
784 3300025303 Ga0209051_1002625 Ga0209051_100262513 295
785 3300025303 Ga0209051_1003932 Ga0209051_10039327 295
786 3300025303 Ga0209051_1021924 Ga0209051_10219242 295
787 3300025303 Ga0209051_1062919 Ga0209051_10629191 295
788 3300025304 Ga0209257_1005720 Ga0209257_100572012 295
789 3300028794 Ga0307515_10061088 Ga0307515_100610889 295
790 3300031731 Ga0307405_10050597 Ga0307405_100505975 295
791 3300031911 Ga0307412_10008803 Ga0307412_100088038 295
792 3300041413 Ga0439465_0036015 Ga0439465_0036015_386_1276 295
793 3300041413 Ga0439465_0047441 Ga0439465_0047441_166_1056 295
794 3300042007 Ga0439449_0017670 Ga0439449_0017670_1404_2294 295
795 3300044765 Ga0466970_0006167 Ga0466970_0006167_2953_3861 295
796 3300046453 Ga0495627_044109 Ga0495627_044109_42_932 295
797 3300046506 Ga0495583_0005892 Ga0495583_0005892_2729_3619 295
798 3300046512 Ga0495610_0006312 Ga0495610_0006312_5967_6857 295
799 3300046512 Ga0495610_0046380 Ga0495610_0046380_600_1490 295
800 3300046513 Ga0495616_0069025 Ga0495616_0069025_115_1005 295
801 3300046519 Ga0495632_0007495 Ga0495632_0007495_4652_5542 295
802 3300046522 Ga0495643_0031311 Ga0495643_0031311_290_1180 295
803 3300046694 Ga0495649_0058104 Ga0495649_0058104_109_999 295
804 3300047472 Ga0495686_0039822 Ga0495686_0039822_2089_2979 295
805 3300047472 Ga0495686_0092438 Ga0495686_0092438_46_936 295
806 3300048904 Ga0496101_0277464 Ga0496101_0277464_24_914 295
807 3300048909 Ga0496106_0007845 Ga0496106_0007845_5533_6423 295
808 3300048919 Ga0496116_0008412 Ga0496116_0008412_7957_8847 295
809 3300048919 Ga0496116_0011264 Ga0496116_0011264_110_1000 295
810 3300048919 Ga0496116_0117374 Ga0496116_0117374_83_973 295
811 3300048920 Ga0496117_0036996 Ga0496117_0036996_2677_3567 295
812 3300048920 Ga0496117_0089470 Ga0496117_0089470_705_1595 295
813 3300048921 Ga0496118_0039631 Ga0496118_0039631_191_1081 295
814 3300048921 Ga0496118_0151282 Ga0496118_0151282_160_1050 295
815 3300048922 Ga0496119_0034739 Ga0496119_0034739_245_1135 295
816 3300048924 Ga0496121_0009418 Ga0496121_0009418_8865_9755 295
817 3300048924 Ga0496121_0038542 Ga0496121_0038542_1079_1969 295
818 3300048925 Ga0496122_0022833 Ga0496122_0022833_2704_3594 295
819 3300048925 Ga0496122_0114081 Ga0496122_0114081_699_1589 295
820 3300048926 Ga0496123_0007644 Ga0496123_0007644_7948_8838 295
821 3300048926 Ga0496123_0112812 Ga0496123_0112812_522_1412 295
822 3300048926 Ga0496123_0163342 Ga0496123_0163342_106_996 295
823 3300048927 Ga0496124_0026193 Ga0496124_0026193_3980_4870 295
824 3300048927 Ga0496124_0044913 Ga0496124_0044913_113_1003 295
825 3300048927 Ga0496124_0163634 Ga0496124_0163634_189_1079 295
826 3300048928 Ga0496125_0016573 Ga0496125_0016573_3375_4265 295
827 3300048929 Ga0496126_0044472 Ga0496126_0044472_146_1036 295
828 3300048929 Ga0496126_0306511 Ga0496126_0306511_401_1291 295
829 3300049580 Ga0501046_0256338 Ga0501046_0256338_265_1155 295
830 3300050489 nmdc:mga03683_12158_c1 nmdc:mga03683_12158_c1_495_1385 295
831 3300050492 nmdc:mga0yw44_5539_c1 nmdc:mga0yw44_5539_c1_4146_5036 295
832 3300050493 nmdc:mga0k408_5841_c1 nmdc:mga0k408_5841_c1_4861_5751 295
833 3300050494 nmdc:mga06z11_5276_c1 nmdc:mga06z11_5276_c1_454_1344 295
834 3300050496 nmdc:mga07m45_36026_c1 nmdc:mga07m45_36026_c1_1231_2121 295
835 3300050516 nmdc:mga0sz30_6040_c1 nmdc:mga0sz30_6040_c1_141_1031 295
836 3300053093 Ga0500651_0159814 Ga0500651_0159814_352_1242 295
837 3300053125 Ga0500618_006831 Ga0500618_006831_1088_1978 295
838 3300053134 Ga0500658_0077727 Ga0500658_0077727_217_1107 295
839 3300053139 Ga0500568_0009947 Ga0500568_0009947_2869_3759 295
840 3300053139 Ga0500568_0028794 Ga0500568_0028794_511_1401 295
841 3300053156 Ga0500622_0002236 Ga0500622_0002236_1077_1967 295
842 3300061719 Ga0466962_0110495 Ga0466962_0110495_398_1306 295
843 iso_pu_bacteria 2524023209 2524463285 298
844 iso_pu_bacteria 2582581308 2585283696 298
845 iso_pu_bacteria 2582581316 2585329331 298
846 iso_pu_bacteria 2585427527 2585530951 298
847 iso_pu_bacteria 2585427530 2585557919 298
848 iso_pu_bacteria 2615840626 2616312072 298
849 iso_pu_bacteria 2615840698 2616554173 298
850 iso_pu_bacteria 2617270742 2617381466 298
851 iso_pu_bacteria 2667528174 2671114797 298
852 iso_pu_bacteria 2775507266 2778177711 298
853 iso_pu_bacteria 2818991448 2819611373 298
854 iso_pu_bacteria 2818991453 2819638399 298
855 iso_pu_bacteria 2838029111 2838032422 298
856 iso_pu_bacteria 2842298080 2842303994 298
857 iso_pu_bacteria 2842357229 2842361377 298
858 iso_pu_bacteria 2842475841 2842478949 298
859 iso_pu_bacteria 2842482326 2842483080 298
860 iso_pu_bacteria 2842502639 2842506331 298
861 iso_pu_bacteria 2842509118 2842509954 298
862 iso_pu_bacteria 2852387548 2852389324 298
863 iso_pu_bacteria 2919408235 2919409536 298
864 iso_pu_bacteria 3005416602 3005417781 298
865 iso_pu_bacteria 8005314921 8005316489 298
866 iso_pu_bacteria 8005484373 8005485400 298
867 iso_pu_bacteria 8005645114 8005650075 298
868 iso_pu_bacteria 8005682033 8005686605 298
869 iso_pu_bacteria 8024486573 8024489523 298
870 iso_pu_bacteria 8046767195 8046768275 298
871 iso_pu_bacteria 8057575449 8057577061 298
872 3300046460 Ga0495638_0001063 Ga0495638_0001063_24135_25034 299
873 3300046492 Ga0495585_0021779 Ga0495585_0021779_2148_3047 299
874 3300046501 Ga0495607_0131150 Ga0495607_0131150_129_1028 299
875 3300046506 Ga0495583_0026515 Ga0495583_0026515_1510_2409 299
876 3300046513 Ga0495616_0104691 Ga0495616_0104691_387_1286 299
877 3300046515 Ga0495620_0074437 Ga0495620_0074437_354_1253 299
878 3300046518 Ga0495631_0009977 Ga0495631_0009977_3117_4016 299
879 3300046522 Ga0495643_0057513 Ga0495643_0057513_529_1428 299
880 3300046538 Ga0495609_0028041 Ga0495609_0028041_489_1388 299
881 3300046660 Ga0495625_0010082 Ga0495625_0010082_6258_7157 299
882 3300046810 Ga0495660_0053967 Ga0495660_0053967_810_1709 299
883 3300047320 Ga0495672_0012037 Ga0495672_0012037_4463_5362 299
884 3300049459 Ga0495678_051710 Ga0495678_051710_69_968 299
885 3300053118 Ga0500594_0000757 Ga0500594_0000757_5388_6287 299
886 3300053134 Ga0500658_0165042 Ga0500658_0165042_45_944 299
887 3300053139 Ga0500568_0001996 Ga0500568_0001996_10826_11725 299
888 3300053153 Ga0500616_0025961 Ga0500616_0025961_714_1613 299
889 3300048924 Ga0496121_0121718 Ga0496121_0121718_488_1390 300
890 3300046459 Ga0495629_0062690 Ga0495629_0062690_801_1706 301
891 3300046476 Ga0495662_0004497 Ga0495662_0004497_871_1776 301
892 3300046507 Ga0495606_0020058 Ga0495606_0020058_3272_4192 301
893 3300046557 Ga0495622_0017513 Ga0495622_0017513_195_1100 301
894 3300046675 Ga0495657_0084509 Ga0495657_0084509_727_1632 301
895 3300046681 Ga0495647_0056346 Ga0495647_0056346_518_1423 301
896 3300047317 Ga0495604_0046794 Ga0495604_0046794_892_1797 301
897 3300047472 Ga0495686_0081255 Ga0495686_0081255_115_1035 301
898 3300053148 Ga0500590_004391 Ga0500590_004391_862_1767 301
899 3300002704 JGI25155J39150_1000019 JGI25155J39150_1000019167 302
900 3300002705 JGI25156J39149_1000020 JGI25156J39149_10000205 302
901 3300002737 JGI25162J39368_1001894 JGI25162J39368_10018949 302
902 3300002737 JGI25162J39368_1002010 JGI25162J39368_10020108 302
903 3300002738 JGI25154J39366_1000355 JGI25154J39366_100035525 302
904 3300002741 JGI25157J39369_1000129 JGI25157J39369_10001294 302
905 3300003214 JGI25165J46597_1001808 JGI25165J46597_10018088 302
906 3300003214 JGI25165J46597_1002226 JGI25165J46597_10022261 302
907 3300003320 rootH2_10064249 rootH2_100642492 302
908 3300003322 rootL2_10015680 rootL2_100156807 302
909 3300003323 rootH1_10129292 rootH1_101292927 302
910 3300005331 Ga0070670_100012947 Ga0070670_1000129473 302
911 3300025206 Ga0209435_100024 Ga0209435_100024162 302
912 3300025233 Ga0209437_100033 Ga0209437_100033502 302
913 3300025233 Ga0209437_100075 Ga0209437_1000755 302
914 3300025246 Ga0209646_1000064 Ga0209646_1000064162 302
915 3300025250 Ga0209026_1000053 Ga0209026_1000053162 302
916 3300025256 Ga0209759_1000042 Ga0209759_1000042162 302
917 3300025261 Ga0209233_1000262 Ga0209233_100026272 302
918 3300025261 Ga0209233_1000277 Ga0209233_10002775 302
919 3300025272 Ga0209455_1014930 Ga0209455_10149302 302
920 3300025925 Ga0207650_10060240 Ga0207650_100602403 302
921 3300046471 Ga0495650_0018078 Ga0495650_0018078_2152_3063 302
922 3300047472 Ga0495686_0021587 Ga0495686_0021587_3152_4060 302
923 3300048922 Ga0496119_0049630 Ga0496119_0049630_1409_2317 302
924 3300048925 Ga0496122_0056646 Ga0496122_0056646_1501_2409 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

142

283

0.93

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

60

133

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8496 146 298
3nk7-assembly1.cif.gz_B structure of the nosiheptide-resistance methyltransferase s-adenosyl-l-methionine complex 0.8475 67 301
3nk6-assembly1.cif.gz_B structure of the nosiheptide-resistance methyltransferase 0.8402 67 301
3nk6-assembly1.cif.gz_A structure of the nosiheptide-resistance methyltransferase 0.8363 68 298
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8294 152 302
ID Description Score Start End Superfamily
af_Q76NT0_373_525_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8665 153 295 3.40.1280.10
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8613 146 302 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8553 144 300 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8552 152 301 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8527 149 297 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A4Q6F537-F1-model_v4 deleted 0.9523 210 298
AF-A0A4Q6F537-F1-model_v4 deleted 0.932 210 298
AF-A0A3D3IY67-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.8893 63 300 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A356FWP9-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.8877 139 300 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A7X4FH93-F1-model_v4 RNA methyltransferase 0.8864 151 301 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Feature Viewer

pLDDT pTM Quality
78.85 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map