F485871
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 924 | 520 | 1848 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_080695|Ga0500643_080695_116_469 |
| Length | 117 |
| Sequence | MVAGDIRGVLPRSAIGYVTRDGEGFKGQLRTLSIRAPIEIVPNRRKAGDNHPDFRVNSEGVEVGAGWTRVGETSGKEYVSLSIAAPEFGPRRIYANLGRAAGQDDDDAFAIIWNPVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 174 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 186 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 187 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 188 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 211 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 212 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 213 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 214 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 215 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 218 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 238 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 239 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 240 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 241 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 242 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 246 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 247 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 248 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 249 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 250 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 251 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 252 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 253 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 254 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 255 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 256 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 257 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 258 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 259 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 260 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 261 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 262 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 263 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 264 | 2512875024 | |||
| 265 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 266 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 267 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 268 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 269 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 270 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 271 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 272 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 273 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 274 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 275 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 276 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 277 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 278 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 279 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 280 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 281 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 282 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 283 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 284 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 285 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 286 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 287 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 288 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 289 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 290 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 291 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 292 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 293 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 294 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 295 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 296 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 297 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 298 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 299 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 300 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 301 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 302 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 303 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 304 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 305 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 306 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 307 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 308 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 309 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 310 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 311 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 312 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 313 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 314 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 315 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 316 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 317 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 318 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 319 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 320 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 321 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 322 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 323 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 324 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 325 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 326 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 327 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 328 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 329 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 330 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 331 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 332 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 333 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 334 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 335 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 336 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 337 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 338 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 339 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 340 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 341 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 342 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 343 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 344 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 345 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 346 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 347 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 348 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 349 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 350 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 351 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 352 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 353 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 354 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 355 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 356 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 357 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 358 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 359 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 360 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 361 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 362 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 363 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 364 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 365 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 366 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 367 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 368 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 369 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 370 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 371 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 372 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 373 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 374 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 375 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 376 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 377 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 378 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 379 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 380 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 381 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 382 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 383 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 384 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 385 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 386 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 387 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 388 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 389 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 390 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 391 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 392 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 393 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 394 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 395 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 396 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 397 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 398 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 399 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 400 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 401 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 402 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 403 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 404 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 405 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 406 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 407 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 408 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 409 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 410 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 411 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 412 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 413 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 414 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 415 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 416 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 417 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 418 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 419 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 420 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 421 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 422 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 423 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 424 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 425 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 426 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 427 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 428 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 429 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 430 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 431 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 432 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 433 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 434 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 435 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 436 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 437 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 438 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 439 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 440 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 441 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 442 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 443 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 444 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 445 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 446 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 447 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 448 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 449 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 450 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 451 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 452 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 453 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 454 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 455 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 456 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 457 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 458 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 459 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 460 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 461 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 462 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 463 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 464 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 465 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 466 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 467 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 468 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 469 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 470 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 471 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 472 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 473 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 474 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 475 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 476 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 477 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 478 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 479 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 480 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 481 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 482 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 483 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 484 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 485 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 486 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 487 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 488 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 489 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 490 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 491 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 492 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 493 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 494 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 495 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 496 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 497 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 498 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 499 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 500 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 501 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 502 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 503 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 504 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 505 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 506 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 507 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 508 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 509 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 510 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 511 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 512 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 513 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 514 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 515 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 516 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 517 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 518 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 519 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 520 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.29 |
| Metatranscriptomes | 0 |
| Isolates | 35.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.39 |
| Nodule | 33.55 |
| Rhizoplane | 1.73 |
| Rhizosphere | 53.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500643_080695 | 3300053087 | Bacteria | 894 |
| 2 | SwRhRL2b_contig_1165699 | 2162886007 | Bacteria | 3108 |
| 3 | SwRhRL2b_contig_795850 | 2162886007 | Bacteria | 3790 |
| 4 | JGI24736J21556_1002225 | 3300001904 | Bacteria | 3432 |
| 5 | JGI24736J21556_1007043 | 3300001904 | Bacteria | 1895 |
| 6 | JGI24741J21665_1011201 | 3300001915 | Bacteria | 1575 |
| 7 | JGI24740J21852_10002439 | 3300001979 | Bacteria | 8437 |
| 8 | JGI24740J21852_10008085 | 3300001979 | Bacteria | 4221 |
| 9 | JGI24740J21852_10107512 | 3300001979 | Bacteria | 706 |
| 10 | JGI24739J22299_10089621 | 3300001989 | Bacteria | 937 |
| 11 | JGI24739J22299_10120832 | 3300001989 | Bacteria | 782 |
| 12 | JGI24737J22298_10001659 | 3300001990 | Bacteria | 7940 |
| 13 | JGI24737J22298_10012924 | 3300001990 | Bacteria | 2721 |
| 14 | JGI24737J22298_10042416 | 3300001990 | Bacteria | 1394 |
| 15 | JGI24735J21928_10001615 | 3300002067 | Bacteria | 7973 |
| 16 | JGI24735J21928_10004865 | 3300002067 | Bacteria | 4480 |
| 17 | JGI24735J21928_10008830 | 3300002067 | Bacteria | 3251 |
| 18 | JGI24750J21931_1000318 | 3300002070 | Bacteria | 8222 |
| 19 | JGI24750J21931_1083195 | 3300002070 | Bacteria | 534 |
| 20 | JGI24738J21930_10001024 | 3300002075 | Bacteria | 7975 |
| 21 | JGI24738J21930_10011266 | 3300002075 | Bacteria | 1969 |
| 22 | JGI24751J29686_10000063 | 3300002459 | Bacteria | 60668 |
| 23 | JGI25165J46597_1000098 | 3300003214 | Bacteria | 159458 |
| 24 | JGI25153J46596_10000002 | 3300003215 | Bacteria | 653569 |
| 25 | Ga0055530_10029487 | 3300003791 | Bacteria | 1466 |
| 26 | Ga0055531_10053293 | 3300003794 | Bacteria | 1046 |
| 27 | Ga0055531_10069289 | 3300003794 | Bacteria | 821 |
| 28 | JGI25405J52794_10082627 | 3300003911 | Bacteria | 708 |
| 29 | Ga0065704_10001128 | 3300005289 | Bacteria | 17214 |
| 30 | Ga0065704_10322314 | 3300005289 | Bacteria | 851 |
| 31 | Ga0065707_10163655 | 3300005295 | Bacteria | 1541 |
| 32 | Ga0070658_10000088 | 3300005327 | Bacteria | 85441 |
| 33 | Ga0070658_10004888 | 3300005327 | Bacteria | 10920 |
| 34 | Ga0070658_10232524 | 3300005327 | Bacteria | 1561 |
| 35 | Ga0070658_11896793 | 3300005327 | Bacteria | 515 |
| 36 | Ga0070683_100297485 | 3300005329 | Bacteria | 1535 |
| 37 | Ga0070683_101344247 | 3300005329 | Bacteria | 687 |
| 38 | Ga0070690_100000177 | 3300005330 | Bacteria | 32685 |
| 39 | Ga0070690_101760173 | 3300005330 | Bacteria | 505 |
| 40 | Ga0070670_100000245 | 3300005331 | Bacteria | 48841 |
| 41 | Ga0070666_10000014 | 3300005335 | Bacteria | 224479 |
| 42 | Ga0070680_100005289 | 3300005336 | Bacteria | 9762 |
| 43 | Ga0070660_100000780 | 3300005339 | Bacteria | 21157 |
| 44 | Ga0070660_100045563 | 3300005339 | Bacteria | 3358 |
| 45 | Ga0070660_101050121 | 3300005339 | Bacteria | 689 |
| 46 | Ga0070691_10038377 | 3300005341 | Bacteria | 2261 |
| 47 | Ga0070691_10201558 | 3300005341 | Bacteria | 1046 |
| 48 | Ga0070687_100354976 | 3300005343 | Bacteria | 947 |
| 49 | Ga0070661_100000018 | 3300005344 | Bacteria | 135723 |
| 50 | Ga0070661_100004782 | 3300005344 | Bacteria | 9323 |
| 51 | Ga0070661_100232067 | 3300005344 | Bacteria | 1418 |
| 52 | Ga0070661_101865637 | 3300005344 | Bacteria | 511 |
| 53 | Ga0070692_10051274 | 3300005345 | Bacteria | 2145 |
| 54 | Ga0070668_101280493 | 3300005347 | Bacteria | 666 |
| 55 | Ga0070669_100000048 | 3300005353 | Bacteria | 118472 |
| 56 | Ga0070669_100613601 | 3300005353 | Bacteria | 912 |
| 57 | Ga0070669_101708594 | 3300005353 | Unclassified | 549 |
| 58 | Ga0070671_100001321 | 3300005355 | Bacteria | 18639 |
| 59 | Ga0070673_101545758 | 3300005364 | Bacteria | 626 |
| 60 | Ga0070659_100000216 | 3300005366 | Bacteria | 44373 |
| 61 | Ga0070659_100107497 | 3300005366 | Bacteria | 2249 |
| 62 | Ga0070659_100149285 | 3300005366 | Bacteria | 1906 |
| 63 | Ga0070659_100225001 | 3300005366 | Bacteria | 1549 |
| 64 | Ga0070659_100377777 | 3300005366 | Bacteria | 1193 |
| 65 | Ga0070659_101656562 | 3300005366 | Bacteria | 572 |
| 66 | Ga0070659_101685435 | 3300005366 | Bacteria | 567 |
| 67 | Ga0070667_100000655 | 3300005367 | Bacteria | 33618 |
| 68 | Ga0070667_100273640 | 3300005367 | Bacteria | 1515 |
| 69 | Ga0070703_10002747 | 3300005406 | Bacteria | 5050 |
| 70 | Ga0070705_100003523 | 3300005440 | Bacteria | 7663 |
| 71 | Ga0070705_101444201 | 3300005440 | Unclassified | 575 |
| 72 | Ga0070694_100002075 | 3300005444 | Bacteria | 11895 |
| 73 | Ga0070694_100450044 | 3300005444 | Bacteria | 1016 |
| 74 | Ga0070708_100720535 | 3300005445 | Bacteria | 938 |
| 75 | Ga0070708_101575503 | 3300005445 | Bacteria | 611 |
| 76 | Ga0070663_100039490 | 3300005455 | Bacteria | 3298 |
| 77 | Ga0070663_100110416 | 3300005455 | Bacteria | 2065 |
| 78 | Ga0070663_100214515 | 3300005455 | Bacteria | 1509 |
| 79 | Ga0070663_100235489 | 3300005455 | Bacteria | 1443 |
| 80 | Ga0070663_100588399 | 3300005455 | Bacteria | 934 |
| 81 | Ga0070662_100000574 | 3300005457 | Bacteria | 22427 |
| 82 | Ga0070662_100017381 | 3300005457 | Bacteria | 4849 |
| 83 | Ga0070662_100106175 | 3300005457 | Bacteria | 2133 |
| 84 | Ga0070662_100172547 | 3300005457 | Bacteria | 1699 |
| 85 | Ga0070662_100292762 | 3300005457 | Bacteria | 1320 |
| 86 | Ga0070662_100901034 | 3300005457 | Bacteria | 755 |
| 87 | Ga0070681_10086932 | 3300005458 | Bacteria | 3079 |
| 88 | Ga0068867_101399223 | 3300005459 | Unclassified | 649 |
| 89 | Ga0070707_100123261 | 3300005468 | Bacteria | 2517 |
| 90 | Ga0070698_100255017 | 3300005471 | Bacteria | 1686 |
| 91 | Ga0070699_100015502 | 3300005518 | Bacteria | 6550 |
| 92 | Ga0070699_101632418 | 3300005518 | Unclassified | 591 |
| 93 | Ga0070699_101907526 | 3300005518 | Bacteria | 543 |
| 94 | Ga0070679_100000100 | 3300005530 | Bacteria | 66347 |
| 95 | Ga0070679_100951479 | 3300005530 | Unclassified | 803 |
| 96 | Ga0070684_100396960 | 3300005535 | Bacteria | 1271 |
| 97 | Ga0070697_100027326 | 3300005536 | Bacteria | 4564 |
| 98 | Ga0068853_100000475 | 3300005539 | Bacteria | 27392 |
| 99 | Ga0068853_100001731 | 3300005539 | Bacteria | 15995 |
| 100 | Ga0068853_100069465 | 3300005539 | Bacteria | 3064 |
| 101 | Ga0068853_100088393 | 3300005539 | Bacteria | 2720 |
| 102 | Ga0068853_100164661 | 3300005539 | Bacteria | 2003 |
| 103 | Ga0068853_100223032 | 3300005539 | Bacteria | 1722 |
| 104 | Ga0070672_100100890 | 3300005543 | Bacteria | 2341 |
| 105 | Ga0070672_100115374 | 3300005543 | Bacteria | 2193 |
| 106 | Ga0070672_100336110 | 3300005543 | Bacteria | 1285 |
| 107 | Ga0070672_101340007 | 3300005543 | Bacteria | 639 |
| 108 | Ga0070686_100000002 | 3300005544 | Bacteria | 336303 |
| 109 | Ga0070686_100040721 | 3300005544 | Bacteria | 2900 |
| 110 | Ga0070695_100000776 | 3300005545 | Bacteria | 17174 |
| 111 | Ga0070695_100005333 | 3300005545 | Bacteria | 7570 |
| 112 | Ga0070696_100025382 | 3300005546 | Bacteria | 4029 |
| 113 | Ga0070693_100118874 | 3300005547 | Bacteria | 1636 |
| 114 | Ga0070693_100563020 | 3300005547 | Unclassified | 818 |
| 115 | Ga0070665_100017512 | 3300005548 | Bacteria | 7195 |
| 116 | Ga0070665_100559148 | 3300005548 | Bacteria | 1156 |
| 117 | Ga0070665_100689342 | 3300005548 | Bacteria | 1035 |
| 118 | Ga0070704_100001730 | 3300005549 | Bacteria | 11915 |
| 119 | Ga0070704_100003383 | 3300005549 | Bacteria | 9142 |
| 120 | Ga0068855_100000173 | 3300005563 | Bacteria | 82962 |
| 121 | Ga0068855_100000486 | 3300005563 | Bacteria | 48988 |
| 122 | Ga0068855_100000648 | 3300005563 | Bacteria | 42506 |
| 123 | Ga0068855_100027484 | 3300005563 | Bacteria | 6804 |
| 124 | Ga0068855_100035428 | 3300005563 | Bacteria | 5945 |
| 125 | Ga0068855_100041641 | 3300005563 | Bacteria | 5444 |
| 126 | Ga0068855_100053677 | 3300005563 | Bacteria | 4740 |
| 127 | Ga0068855_100071700 | 3300005563 | Bacteria | 4027 |
| 128 | Ga0068855_100094952 | 3300005563 | Bacteria | 3438 |
| 129 | Ga0068855_100127616 | 3300005563 | Bacteria | 2907 |
| 130 | Ga0068855_100540763 | 3300005563 | Bacteria | 1262 |
| 131 | Ga0068855_100745425 | 3300005563 | Bacteria | 1045 |
| 132 | Ga0068855_101042032 | 3300005563 | Bacteria | 858 |
| 133 | Ga0068855_101584287 | 3300005563 | Bacteria | 670 |
| 134 | Ga0070664_100008244 | 3300005564 | Bacteria | 8425 |
| 135 | Ga0070664_100696608 | 3300005564 | Bacteria | 946 |
| 136 | Ga0070664_100963903 | 3300005564 | Bacteria | 801 |
| 137 | Ga0068857_100000037 | 3300005577 | Bacteria | 72271 |
| 138 | Ga0068857_100000670 | 3300005577 | Bacteria | 25389 |
| 139 | Ga0068857_100083024 | 3300005577 | Bacteria | 2862 |
| 140 | Ga0068857_100178075 | 3300005577 | Bacteria | 1934 |
| 141 | Ga0068857_100316500 | 3300005577 | Bacteria | 1440 |
| 142 | Ga0068857_101729854 | 3300005577 | Bacteria | 611 |
| 143 | Ga0068854_100000071 | 3300005578 | Bacteria | 73211 |
| 144 | Ga0068854_100000295 | 3300005578 | Bacteria | 33183 |
| 145 | Ga0068854_100004367 | 3300005578 | Bacteria | 8917 |
| 146 | Ga0068854_100039312 | 3300005578 | Bacteria | 3332 |
| 147 | Ga0068854_100593628 | 3300005578 | Bacteria | 944 |
| 148 | Ga0068854_100852909 | 3300005578 | Bacteria | 797 |
| 149 | Ga0068856_100008358 | 3300005614 | Bacteria | 10084 |
| 150 | Ga0068856_100346887 | 3300005614 | Bacteria | 1503 |
| 151 | Ga0068856_100547358 | 3300005614 | Bacteria | 1178 |
| 152 | Ga0068856_101704939 | 3300005614 | Bacteria | 642 |
| 153 | Ga0070702_100060989 | 3300005615 | Bacteria | 2195 |
| 154 | Ga0068852_100000060 | 3300005616 | Bacteria | 73764 |
| 155 | Ga0068852_100000450 | 3300005616 | Bacteria | 27149 |
| 156 | Ga0068852_100000709 | 3300005616 | Bacteria | 21797 |
| 157 | Ga0068852_100048301 | 3300005616 | Bacteria | 3635 |
| 158 | Ga0068852_100164025 | 3300005616 | Bacteria | 2077 |
| 159 | Ga0068852_100496157 | 3300005616 | Bacteria | 1215 |
| 160 | Ga0068852_100736753 | 3300005616 | Bacteria | 997 |
| 161 | Ga0068859_100044136 | 3300005617 | Bacteria | 4480 |
| 162 | Ga0068859_100421645 | 3300005617 | Bacteria | 1431 |
| 163 | Ga0068864_100000109 | 3300005618 | Bacteria | 80156 |
| 164 | Ga0068864_100009846 | 3300005618 | Bacteria | 7882 |
| 165 | Ga0068864_100032691 | 3300005618 | Bacteria | 4421 |
| 166 | Ga0068851_10001264 | 3300005834 | Bacteria | 11009 |
| 167 | Ga0068851_10026604 | 3300005834 | Bacteria | 2845 |
| 168 | Ga0068851_10072879 | 3300005834 | Bacteria | 1780 |
| 169 | Ga0068851_10230725 | 3300005834 | Bacteria | 1043 |
| 170 | Ga0068863_100050187 | 3300005841 | Bacteria | 3956 |
| 171 | Ga0068863_102213935 | 3300005841 | Unclassified | 560 |
| 172 | Ga0068858_100000507 | 3300005842 | Bacteria | 40808 |
| 173 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 174 | Ga0068860_100019529 | 3300005843 | Bacteria | 6570 |
| 175 | Ga0068860_100023878 | 3300005843 | Bacteria | 5911 |
| 176 | Ga0068860_100152433 | 3300005843 | Bacteria | 2226 |
| 177 | Ga0068860_100202870 | 3300005843 | Bacteria | 1922 |
| 178 | Ga0068860_101362672 | 3300005843 | Bacteria | 730 |
| 179 | Ga0068862_100000128 | 3300005844 | Bacteria | 88625 |
| 180 | Ga0068862_100402633 | 3300005844 | Unclassified | 1280 |
| 181 | Ga0081455_10005327 | 3300005937 | Bacteria | 14127 |
| 182 | Ga0081539_10315535 | 3300005985 | Bacteria | 667 |
| 183 | Ga0075365_10329684 | 3300006038 | Bacteria | 1075 |
| 184 | Ga0075363_100195989 | 3300006048 | Bacteria | 1153 |
| 185 | Ga0075367_10000157 | 3300006178 | Bacteria | 21309 |
| 186 | Ga0075367_10246963 | 3300006178 | Bacteria | 1119 |
| 187 | Ga0075369_10037536 | 3300006186 | Bacteria | 2064 |
| 188 | Ga0075366_10208200 | 3300006195 | Bacteria | 1190 |
| 189 | Ga0075370_10034233 | 3300006353 | Bacteria | 2848 |
| 190 | Ga0075370_10349782 | 3300006353 | Bacteria | 883 |
| 191 | Ga0075370_10835465 | 3300006353 | Bacteria | 562 |
| 192 | Ga0075428_100079995 | 3300006844 | Bacteria | 3566 |
| 193 | Ga0075430_100043343 | 3300006846 | Bacteria | 3802 |
| 194 | Ga0097620_100044139 | 3300006931 | Bacteria | 4480 |
| 195 | Ga0097620_100421662 | 3300006931 | Bacteria | 1431 |
| 196 | Ga0079104_1005064 | 3300006946 | Bacteria | 5373 |
| 197 | Ga0079104_1025888 | 3300006946 | Bacteria | 1524 |
| 198 | Ga0079104_1055730 | 3300006946 | Bacteria | 866 |
| 199 | Ga0079104_1076700 | 3300006946 | Bacteria | 693 |
| 200 | Ga0105250_10242078 | 3300009092 | Bacteria | 769 |
| 201 | Ga0105250_10570004 | 3300009092 | Bacteria | 521 |
| 202 | Ga0105240_10000052 | 3300009093 | Bacteria | 232583 |
| 203 | Ga0105240_10006734 | 3300009093 | Bacteria | 16825 |
| 204 | Ga0105240_10007113 | 3300009093 | Bacteria | 16306 |
| 205 | Ga0105240_10008661 | 3300009093 | Bacteria | 14524 |
| 206 | Ga0105240_10235179 | 3300009093 | Bacteria | 2127 |
| 207 | Ga0105240_10287243 | 3300009093 | Bacteria | 1887 |
| 208 | Ga0105240_11411647 | 3300009093 | Bacteria | 732 |
| 209 | Ga0105240_11588249 | 3300009093 | Bacteria | 684 |
| 210 | Ga0105245_10000294 | 3300009098 | Bacteria | 47730 |
| 211 | Ga0105247_10251351 | 3300009101 | Bacteria | 1208 |
| 212 | Ga0105243_10067387 | 3300009148 | Bacteria | 2881 |
| 213 | Ga0105243_12030858 | 3300009148 | Bacteria | 610 |
| 214 | Ga0105241_10001363 | 3300009174 | Bacteria | 18614 |
| 215 | Ga0105241_10090215 | 3300009174 | Bacteria | 2417 |
| 216 | Ga0105248_10010635 | 3300009177 | Bacteria | 10148 |
| 217 | Ga0105248_10095888 | 3300009177 | Bacteria | 3340 |
| 218 | Ga0105248_12043660 | 3300009177 | Bacteria | 651 |
| 219 | Ga0105237_10000378 | 3300009545 | Bacteria | 63407 |
| 220 | Ga0105237_10039744 | 3300009545 | Bacteria | 4748 |
| 221 | Ga0105237_10055645 | 3300009545 | Bacteria | 3962 |
| 222 | Ga0105237_10222648 | 3300009545 | Bacteria | 1887 |
| 223 | Ga0105237_10388742 | 3300009545 | Bacteria | 1400 |
| 224 | Ga0105237_10643275 | 3300009545 | Bacteria | 1067 |
| 225 | Ga0105238_10000912 | 3300009551 | Bacteria | 30323 |
| 226 | Ga0105238_10001089 | 3300009551 | Bacteria | 27423 |
| 227 | Ga0105238_10002804 | 3300009551 | Bacteria | 17388 |
| 228 | Ga0105238_10002947 | 3300009551 | Bacteria | 16982 |
| 229 | Ga0105238_10030532 | 3300009551 | Bacteria | 5486 |
| 230 | Ga0105238_10031424 | 3300009551 | Bacteria | 5405 |
| 231 | Ga0105238_10046330 | 3300009551 | Bacteria | 4389 |
| 232 | Ga0105238_10068105 | 3300009551 | Bacteria | 3560 |
| 233 | Ga0105238_10092256 | 3300009551 | Bacteria | 3016 |
| 234 | Ga0105238_10698366 | 3300009551 | Bacteria | 1026 |
| 235 | Ga0105238_11017676 | 3300009551 | Bacteria | 849 |
| 236 | Ga0105249_10000005 | 3300009553 | Bacteria | 362467 |
| 237 | Ga0105249_10009245 | 3300009553 | Bacteria | 8617 |
| 238 | Ga0105249_10012758 | 3300009553 | Bacteria | 7408 |
| 239 | Ga0105249_12052843 | 3300009553 | Unclassified | 644 |
| 240 | Ga0105148_104761 | 3300009978 | Bacteria | 975 |
| 241 | Ga0105239_10000232 | 3300010375 | Bacteria | 82037 |
| 242 | Ga0105239_10040953 | 3300010375 | Bacteria | 5077 |
| 243 | Ga0105239_10047285 | 3300010375 | Bacteria | 4716 |
| 244 | Ga0105239_10349828 | 3300010375 | Bacteria | 1668 |
| 245 | Ga0105239_10546007 | 3300010375 | Bacteria | 1320 |
| 246 | Ga0105239_10687205 | 3300010375 | Bacteria | 1170 |
| 247 | Ga0105239_11278368 | 3300010375 | Bacteria | 846 |
| 248 | Ga0105239_13354114 | 3300010375 | Bacteria | 521 |
| 249 | Ga0105246_10609175 | 3300011119 | Bacteria | 945 |
| 250 | Ga0105246_11830796 | 3300011119 | Unclassified | 581 |
| 251 | Ga0157373_10005064 | 3300013100 | Bacteria | 9903 |
| 252 | Ga0157373_10097581 | 3300013100 | Bacteria | 2068 |
| 253 | Ga0157373_10162024 | 3300013100 | Bacteria | 1574 |
| 254 | Ga0157373_10200186 | 3300013100 | Bacteria | 1408 |
| 255 | Ga0157373_10553420 | 3300013100 | Bacteria | 834 |
| 256 | Ga0157371_10001141 | 3300013102 | Bacteria | 28613 |
| 257 | Ga0157371_10086222 | 3300013102 | Bacteria | 2224 |
| 258 | Ga0157371_10894387 | 3300013102 | Bacteria | 673 |
| 259 | Ga0157370_10001089 | 3300013104 | Bacteria | 34040 |
| 260 | Ga0157370_10003021 | 3300013104 | Bacteria | 19971 |
| 261 | Ga0157370_10183250 | 3300013104 | Bacteria | 1945 |
| 262 | Ga0157370_10200033 | 3300013104 | Bacteria | 1853 |
| 263 | Ga0157369_10000632 | 3300013105 | Bacteria | 45648 |
| 264 | Ga0157369_10015667 | 3300013105 | Bacteria | 8543 |
| 265 | Ga0157369_10017908 | 3300013105 | Bacteria | 7952 |
| 266 | Ga0157369_10627040 | 3300013105 | Bacteria | 1109 |
| 267 | Ga0157369_11171167 | 3300013105 | Bacteria | 785 |
| 268 | Ga0157369_11395223 | 3300013105 | Bacteria | 713 |
| 269 | Ga0157374_10358274 | 3300013296 | Bacteria | 1450 |
| 270 | Ga0157374_10689565 | 3300013296 | Bacteria | 1034 |
| 271 | Ga0157378_10089372 | 3300013297 | Bacteria | 2797 |
| 272 | Ga0163162_10336202 | 3300013306 | Bacteria | 1643 |
| 273 | Ga0157372_10002816 | 3300013307 | Bacteria | 18789 |
| 274 | Ga0157372_10150953 | 3300013307 | Bacteria | 2682 |
| 275 | Ga0157372_13152796 | 3300013307 | Bacteria | 526 |
| 276 | Ga0163163_10195588 | 3300014325 | Bacteria | 2070 |
| 277 | Ga0157380_11782260 | 3300014326 | Bacteria | 674 |
| 278 | Ga0157379_10003511 | 3300014968 | Bacteria | 13275 |
| 279 | Ga0157379_12129181 | 3300014968 | Bacteria | 556 |
| 280 | Ga0163161_10000106 | 3300017792 | Bacteria | 79467 |
| 281 | Ga0163161_10259797 | 3300017792 | Bacteria | 1356 |
| 282 | Ga0163161_10367987 | 3300017792 | Bacteria | 1146 |
| 283 | Ga0213875_10006207 | 3300021388 | Bacteria | 6301 |
| 284 | Ga0209674_110441 | 3300025226 | Bacteria | 990 |
| 285 | Ga0207427_119840 | 3300025231 | Bacteria | 610 |
| 286 | Ga0209437_125878 | 3300025233 | Bacteria | 646 |
| 287 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 288 | Ga0209233_1000026 | 3300025261 | Bacteria | 678466 |
| 289 | Ga0209455_1013793 | 3300025272 | Bacteria | 1860 |
| 290 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 291 | Ga0209050_1000406 | 3300025298 | Bacteria | 80343 |
| 292 | Ga0209257_1005161 | 3300025304 | Bacteria | 9424 |
| 293 | Ga0209257_1011989 | 3300025304 | Bacteria | 4080 |
| 294 | Ga0207697_10000121 | 3300025315 | Bacteria | 37017 |
| 295 | Ga0207656_10000454 | 3300025321 | Bacteria | 13714 |
| 296 | Ga0207656_10008391 | 3300025321 | Bacteria | 3800 |
| 297 | Ga0207656_10037726 | 3300025321 | Bacteria | 2035 |
| 298 | Ga0207656_10119203 | 3300025321 | Bacteria | 1227 |
| 299 | Ga0207696_1208051 | 3300025711 | Bacteria | 513 |
| 300 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 301 | Ga0207647_10006656 | 3300025904 | Bacteria | 8398 |
| 302 | Ga0207647_10015569 | 3300025904 | Bacteria | 5209 |
| 303 | Ga0207647_10117185 | 3300025904 | Bacteria | 1572 |
| 304 | Ga0207647_10619093 | 3300025904 | Bacteria | 596 |
| 305 | Ga0207705_10000138 | 3300025909 | Bacteria | 78969 |
| 306 | Ga0207705_10005315 | 3300025909 | Bacteria | 9636 |
| 307 | Ga0207705_10213548 | 3300025909 | Bacteria | 1464 |
| 308 | Ga0207705_11130111 | 3300025909 | Bacteria | 603 |
| 309 | Ga0207654_10000427 | 3300025911 | Bacteria | 24174 |
| 310 | Ga0207654_10002086 | 3300025911 | Bacteria | 10238 |
| 311 | Ga0207654_10005142 | 3300025911 | Bacteria | 6602 |
| 312 | Ga0207654_10204198 | 3300025911 | Bacteria | 1303 |
| 313 | Ga0207654_10557832 | 3300025911 | Bacteria | 814 |
| 314 | Ga0207707_10330595 | 3300025912 | Bacteria | 1315 |
| 315 | Ga0207695_10000122 | 3300025913 | Bacteria | 232677 |
| 316 | Ga0207695_10001920 | 3300025913 | Bacteria | 32321 |
| 317 | Ga0207695_10002056 | 3300025913 | Bacteria | 30785 |
| 318 | Ga0207695_10002363 | 3300025913 | Bacteria | 28020 |
| 319 | Ga0207695_10012343 | 3300025913 | Bacteria | 10264 |
| 320 | Ga0207695_10022675 | 3300025913 | Bacteria | 7118 |
| 321 | Ga0207695_10028904 | 3300025913 | Bacteria | 6136 |
| 322 | Ga0207671_10000222 | 3300025914 | Bacteria | 85244 |
| 323 | Ga0207671_10016463 | 3300025914 | Bacteria | 5745 |
| 324 | Ga0207671_10019223 | 3300025914 | Bacteria | 5228 |
| 325 | Ga0207671_10141288 | 3300025914 | Bacteria | 1855 |
| 326 | Ga0207671_10167784 | 3300025914 | Bacteria | 1703 |
| 327 | Ga0207671_10284000 | 3300025914 | Bacteria | 1306 |
| 328 | Ga0207660_10022455 | 3300025917 | Bacteria | 4251 |
| 329 | Ga0207662_10295156 | 3300025918 | Bacteria | 1076 |
| 330 | Ga0207662_11367897 | 3300025918 | Unclassified | 503 |
| 331 | Ga0207657_10002145 | 3300025919 | Bacteria | 21378 |
| 332 | Ga0207657_11013215 | 3300025919 | Bacteria | 637 |
| 333 | Ga0207649_10000034 | 3300025920 | Bacteria | 136049 |
| 334 | Ga0207649_10002825 | 3300025920 | Bacteria | 9571 |
| 335 | Ga0207649_11534035 | 3300025920 | Bacteria | 527 |
| 336 | Ga0207652_10000133 | 3300025921 | Bacteria | 80146 |
| 337 | Ga0207652_11639433 | 3300025921 | Unclassified | 548 |
| 338 | Ga0207681_10000050 | 3300025923 | Bacteria | 118481 |
| 339 | Ga0207681_11015129 | 3300025923 | Bacteria | 696 |
| 340 | Ga0207681_11182731 | 3300025923 | Bacteria | 642 |
| 341 | Ga0207681_11456773 | 3300025923 | Unclassified | 574 |
| 342 | Ga0207694_10000230 | 3300025924 | Bacteria | 53897 |
| 343 | Ga0207694_10000611 | 3300025924 | Bacteria | 32401 |
| 344 | Ga0207694_10000630 | 3300025924 | Bacteria | 31969 |
| 345 | Ga0207694_10000844 | 3300025924 | Bacteria | 27280 |
| 346 | Ga0207694_10003020 | 3300025924 | Bacteria | 13492 |
| 347 | Ga0207694_10003984 | 3300025924 | Bacteria | 11643 |
| 348 | Ga0207694_10005011 | 3300025924 | Bacteria | 10244 |
| 349 | Ga0207694_10017772 | 3300025924 | Bacteria | 5374 |
| 350 | Ga0207694_10021833 | 3300025924 | Bacteria | 4853 |
| 351 | Ga0207694_10322962 | 3300025924 | Bacteria | 1274 |
| 352 | Ga0207650_10000039 | 3300025925 | Bacteria | 204737 |
| 353 | Ga0207687_10001319 | 3300025927 | Bacteria | 16976 |
| 354 | Ga0207644_10000028 | 3300025931 | Bacteria | 142921 |
| 355 | Ga0207690_10000052 | 3300025932 | Bacteria | 106112 |
| 356 | Ga0207690_10173800 | 3300025932 | Bacteria | 1616 |
| 357 | Ga0207690_10228136 | 3300025932 | Bacteria | 1428 |
| 358 | Ga0207690_10288693 | 3300025932 | Bacteria | 1280 |
| 359 | Ga0207690_10433123 | 3300025932 | Bacteria | 1054 |
| 360 | Ga0207690_11187901 | 3300025932 | Bacteria | 637 |
| 361 | Ga0207690_11561906 | 3300025932 | Bacteria | 552 |
| 362 | Ga0207706_10002199 | 3300025933 | Bacteria | 19005 |
| 363 | Ga0207706_10040418 | 3300025933 | Bacteria | 4133 |
| 364 | Ga0207706_10070809 | 3300025933 | Bacteria | 3067 |
| 365 | Ga0207709_10124475 | 3300025935 | Bacteria | 1746 |
| 366 | Ga0207691_10341136 | 3300025940 | Bacteria | 1282 |
| 367 | Ga0207691_10673946 | 3300025940 | Bacteria | 873 |
| 368 | Ga0207711_10005403 | 3300025941 | Bacteria | 10801 |
| 369 | Ga0207711_10060041 | 3300025941 | Bacteria | 3276 |
| 370 | Ga0207689_10278481 | 3300025942 | Bacteria | 1385 |
| 371 | Ga0207661_11168247 | 3300025944 | Bacteria | 708 |
| 372 | Ga0207679_10066208 | 3300025945 | Bacteria | 2706 |
| 373 | Ga0207679_10382189 | 3300025945 | Bacteria | 1235 |
| 374 | Ga0207679_10678584 | 3300025945 | Bacteria | 934 |
| 375 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 376 | Ga0207667_10000459 | 3300025949 | Bacteria | 54741 |
| 377 | Ga0207667_10004045 | 3300025949 | Bacteria | 18017 |
| 378 | Ga0207667_10006258 | 3300025949 | Bacteria | 14449 |
| 379 | Ga0207667_10013903 | 3300025949 | Bacteria | 9195 |
| 380 | Ga0207667_10043324 | 3300025949 | Bacteria | 4777 |
| 381 | Ga0207667_10061872 | 3300025949 | Bacteria | 3916 |
| 382 | Ga0207667_10088942 | 3300025949 | Bacteria | 3193 |
| 383 | Ga0207651_11226016 | 3300025960 | Bacteria | 674 |
| 384 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 385 | Ga0207712_10001025 | 3300025961 | Bacteria | 19817 |
| 386 | Ga0207712_10024738 | 3300025961 | Bacteria | 3981 |
| 387 | Ga0207712_10030145 | 3300025961 | Bacteria | 3644 |
| 388 | Ga0207712_10135203 | 3300025961 | Bacteria | 1884 |
| 389 | Ga0207668_10063881 | 3300025972 | Bacteria | 2599 |
| 390 | Ga0207640_10000041 | 3300025981 | Bacteria | 105374 |
| 391 | Ga0207640_10000086 | 3300025981 | Bacteria | 73224 |
| 392 | Ga0207640_10019858 | 3300025981 | Bacteria | 3978 |
| 393 | Ga0207640_10075647 | 3300025981 | Bacteria | 2283 |
| 394 | Ga0207640_10133334 | 3300025981 | Bacteria | 1799 |
| 395 | Ga0207640_10381697 | 3300025981 | Bacteria | 1142 |
| 396 | Ga0207640_10702335 | 3300025981 | Bacteria | 867 |
| 397 | Ga0207640_11610826 | 3300025981 | Bacteria | 585 |
| 398 | Ga0207658_10001581 | 3300025986 | Bacteria | 17579 |
| 399 | Ga0207703_10003358 | 3300026035 | Bacteria | 13441 |
| 400 | Ga0207639_10000081 | 3300026041 | Bacteria | 82747 |
| 401 | Ga0207639_10000495 | 3300026041 | Bacteria | 27230 |
| 402 | Ga0207639_10000519 | 3300026041 | Bacteria | 26590 |
| 403 | Ga0207639_10003480 | 3300026041 | Bacteria | 10596 |
| 404 | Ga0207639_10023205 | 3300026041 | Bacteria | 4477 |
| 405 | Ga0207639_10035055 | 3300026041 | Bacteria | 3712 |
| 406 | Ga0207639_10039794 | 3300026041 | Bacteria | 3505 |
| 407 | Ga0207639_11468050 | 3300026041 | Bacteria | 640 |
| 408 | Ga0207678_10016767 | 3300026067 | Bacteria | 6433 |
| 409 | Ga0207678_10077255 | 3300026067 | Bacteria | 2852 |
| 410 | Ga0207678_10131857 | 3300026067 | Bacteria | 2132 |
| 411 | Ga0207678_10712641 | 3300026067 | Bacteria | 883 |
| 412 | Ga0207678_11016168 | 3300026067 | Bacteria | 734 |
| 413 | Ga0207702_10001212 | 3300026078 | Bacteria | 26157 |
| 414 | Ga0207702_10013506 | 3300026078 | Bacteria | 6784 |
| 415 | Ga0207702_10019567 | 3300026078 | Bacteria | 5603 |
| 416 | Ga0207702_10164174 | 3300026078 | Bacteria | 2030 |
| 417 | Ga0207702_11510606 | 3300026078 | Bacteria | 665 |
| 418 | Ga0207641_10061456 | 3300026088 | Bacteria | 3204 |
| 419 | Ga0207648_11443073 | 3300026089 | Bacteria | 647 |
| 420 | Ga0207676_10000035 | 3300026095 | Bacteria | 204737 |
| 421 | Ga0207676_10000373 | 3300026095 | Bacteria | 38263 |
| 422 | Ga0207676_10075784 | 3300026095 | Bacteria | 2715 |
| 423 | Ga0207674_10001593 | 3300026116 | Bacteria | 29207 |
| 424 | Ga0207674_10003470 | 3300026116 | Bacteria | 19284 |
| 425 | Ga0207674_10021996 | 3300026116 | Bacteria | 6859 |
| 426 | Ga0207674_10192263 | 3300026116 | Bacteria | 1991 |
| 427 | Ga0207674_10267776 | 3300026116 | Bacteria | 1656 |
| 428 | Ga0207674_10349866 | 3300026116 | Bacteria | 1429 |
| 429 | Ga0207674_11295992 | 3300026116 | Bacteria | 698 |
| 430 | Ga0207675_100445303 | 3300026118 | Bacteria | 1283 |
| 431 | Ga0207698_10000054 | 3300026142 | Bacteria | 82681 |
| 432 | Ga0207698_10000357 | 3300026142 | Bacteria | 26870 |
| 433 | Ga0207698_10000574 | 3300026142 | Bacteria | 21465 |
| 434 | Ga0207698_10003339 | 3300026142 | Bacteria | 9657 |
| 435 | Ga0207698_10006940 | 3300026142 | Bacteria | 7087 |
| 436 | Ga0207698_10015464 | 3300026142 | Bacteria | 5109 |
| 437 | Ga0207698_10466173 | 3300026142 | Bacteria | 1222 |
| 438 | Ga0207698_10670860 | 3300026142 | Bacteria | 1029 |
| 439 | Ga0207698_10721355 | 3300026142 | Bacteria | 993 |
| 440 | Ga0207698_11820681 | 3300026142 | Bacteria | 624 |
| 441 | Ga0207698_12135818 | 3300026142 | Bacteria | 573 |
| 442 | Ga0209281_1006280 | 3300027111 | Bacteria | 3124 |
| 443 | Ga0209281_1018975 | 3300027111 | Bacteria | 1365 |
| 444 | Ga0209281_1056565 | 3300027111 | Bacteria | 610 |
| 445 | Ga0209998_10118785 | 3300027717 | Unclassified | 665 |
| 446 | Ga0209813_10000050 | 3300027866 | Bacteria | 48358 |
| 447 | Ga0207428_10902368 | 3300027907 | Bacteria | 624 |
| 448 | Ga0268266_10339734 | 3300028379 | Bacteria | 1409 |
| 449 | Ga0268266_10759408 | 3300028379 | Bacteria | 936 |
| 450 | Ga0268265_10000102 | 3300028380 | Bacteria | 106737 |
| 451 | Ga0268265_10004378 | 3300028380 | Bacteria | 9816 |
| 452 | Ga0268265_10406463 | 3300028380 | Bacteria | 1260 |
| 453 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 454 | Ga0268264_10007910 | 3300028381 | Bacteria | 8845 |
| 455 | Ga0268264_10011655 | 3300028381 | Bacteria | 7251 |
| 456 | Ga0268264_10011731 | 3300028381 | Bacteria | 7225 |
| 457 | Ga0268264_10130223 | 3300028381 | Bacteria | 2229 |
| 458 | Ga0268264_10178237 | 3300028381 | Bacteria | 1928 |
| 459 | Ga0307517_10000875 | 3300028786 | Bacteria | 51286 |
| 460 | Ga0307517_10034138 | 3300028786 | Bacteria | 5807 |
| 461 | Ga0307517_10035187 | 3300028786 | Bacteria | 5679 |
| 462 | Ga0307517_10051411 | 3300028786 | Bacteria | 4160 |
| 463 | Ga0307517_10189109 | 3300028786 | Bacteria | 1311 |
| 464 | Ga0307515_10300210 | 3300028794 | Bacteria | 1292 |
| 465 | Ga0307513_10696404 | 3300031456 | Bacteria | 722 |
| 466 | Ga0307408_100000067 | 3300031548 | Bacteria | 120790 |
| 467 | Ga0307510_10108145 | 3300033180 | Bacteria | 2536 |
| 468 | Ga0307510_10402613 | 3300033180 | Bacteria | 812 |
| 469 | Ga0373948_0046403 | 3300034817 | Bacteria | 923 |
| 470 | Ga0373939_0002076 | 3300035114 | Bacteria | 4776 |
| 471 | Ga0373942_0010804 | 3300035207 | Plasmid | 2153 |
| 472 | Ga0373927_0225378 | 3300035695 | Bacteria | 1231 |
| 473 | Ga0373925_1516906 | 3300037068 | Bacteria | 548 |
| 474 | Ga0395900_0947859 | 3300037418 | Bacteria | 782 |
| 475 | Ga0395905_1343653 | 3300037471 | Bacteria | 619 |
| 476 | Ga0436364_1318325 | 3300037853 | Bacteria | 19438 |
| 477 | Ga0395901_0351250 | 3300038443 | Bacteria | 1522 |
| 478 | Ga0395901_0447626 | 3300038443 | Bacteria | 1321 |
| 479 | Ga0395901_0804351 | 3300038443 | Bacteria | 929 |
| 480 | Ga0436365_1317422 | 3300039437 | Bacteria | 4837 |
| 481 | Ga0451791_0444167 | 3300041451 | Bacteria | 623 |
| 482 | Ga0451793_0529694 | 3300041452 | Bacteria | 711 |
| 483 | Ga0439458_0175962 | 3300042157 | Bacteria | 580 |
| 484 | Ga0466958_0426494 | 3300045836 | Bacteria | 857 |
| 485 | Ga0495627_000110 | 3300046453 | Bacteria | 101742 |
| 486 | Ga0495627_001084 | 3300046453 | Bacteria | 17875 |
| 487 | Ga0495627_046234 | 3300046453 | Bacteria | 1323 |
| 488 | Ga0495629_0123606 | 3300046459 | Bacteria | 1803 |
| 489 | Ga0495638_0045181 | 3300046460 | Bacteria | 2772 |
| 490 | Ga0495583_0000120 | 3300046506 | Bacteria | 133285 |
| 491 | Ga0495583_0048376 | 3300046506 | Bacteria | 1952 |
| 492 | Ga0495616_0121668 | 3300046513 | Bacteria | 1204 |
| 493 | Ga0495630_1163449 | 3300046517 | Unclassified | 584 |
| 494 | Ga0495632_0000112 | 3300046519 | Bacteria | 83248 |
| 495 | Ga0495643_0057875 | 3300046522 | Bacteria | 2064 |
| 496 | Ga0495648_0014058 | 3300046524 | Bacteria | 5886 |
| 497 | Ga0495648_0409264 | 3300046524 | Bacteria | 604 |
| 498 | Ga0495648_0493063 | 3300046524 | Bacteria | 527 |
| 499 | Ga0495633_0017426 | 3300046558 | Bacteria | 3674 |
| 500 | Ga0495668_0204805 | 3300046616 | Bacteria | 1080 |
| 501 | Ga0495668_0330702 | 3300046616 | Bacteria | 836 |
| 502 | Ga0495625_0024031 | 3300046660 | Bacteria | 4646 |
| 503 | Ga0495625_0133650 | 3300046660 | Bacteria | 1679 |
| 504 | Ga0495625_0288452 | 3300046660 | Bacteria | 1054 |
| 505 | Ga0495625_0788048 | 3300046660 | Bacteria | 554 |
| 506 | Ga0495670_0301335 | 3300046691 | Bacteria | 859 |
| 507 | Ga0495687_000200 | 3300047443 | Bacteria | 85752 |
| 508 | Ga0495687_152993 | 3300047443 | Bacteria | 786 |
| 509 | Ga0495686_0000469 | 3300047472 | Bacteria | 60229 |
| 510 | Ga0496100_1582580 | 3300048903 | Unclassified | 518 |
| 511 | Ga0496101_0053638 | 3300048904 | Bacteria | 2910 |
| 512 | Ga0496101_1032371 | 3300048904 | Bacteria | 646 |
| 513 | Ga0496102_0257902 | 3300048905 | Bacteria | 1644 |
| 514 | Ga0496102_1461328 | 3300048905 | Unclassified | 602 |
| 515 | Ga0496103_0006078 | 3300048906 | Bacteria | 7213 |
| 516 | Ga0496106_0004035 | 3300048909 | Bacteria | 10966 |
| 517 | Ga0496106_0037937 | 3300048909 | Bacteria | 3605 |
| 518 | Ga0496106_0545266 | 3300048909 | Bacteria | 931 |
| 519 | Ga0496107_0005932 | 3300048910 | Bacteria | 8371 |
| 520 | Ga0496112_0505880 | 3300048915 | Bacteria | 1143 |
| 521 | Ga0496114_0481792 | 3300048917 | Bacteria | 1098 |
| 522 | Ga0496115_0032342 | 3300048918 | Bacteria | 4127 |
| 523 | Ga0496116_0206109 | 3300048919 | Bacteria | 1023 |
| 524 | Ga0496116_0322665 | 3300048919 | Bacteria | 722 |
| 525 | Ga0496121_0119204 | 3300048924 | Bacteria | 1996 |
| 526 | Ga0496121_0172138 | 3300048924 | Bacteria | 1571 |
| 527 | Ga0496122_0171468 | 3300048925 | Bacteria | 1307 |
| 528 | Ga0496124_0002739 | 3300048927 | Bacteria | 22472 |
| 529 | Ga0496124_0063407 | 3300048927 | Bacteria | 3087 |
| 530 | Ga0496125_0011563 | 3300048928 | Bacteria | 8817 |
| 531 | Ga0496125_0071374 | 3300048928 | Bacteria | 2713 |
| 532 | Ga0496125_0147720 | 3300048928 | Bacteria | 1621 |
| 533 | Ga0496126_0011486 | 3300048929 | Bacteria | 9161 |
| 534 | Ga0496126_0159368 | 3300048929 | Bacteria | 1929 |
| 535 | Ga0495678_025306 | 3300049459 | Bacteria | 2551 |
| 536 | Ga0495682_0069998 | 3300049460 | Bacteria | 1263 |
| 537 | Ga0501033_0457313 | 3300049570 | Bacteria | 886 |
| 538 | Ga0501036_1006164 | 3300049572 | Bacteria | 682 |
| 539 | Ga0501036_1432990 | 3300049572 | Unclassified | 560 |
| 540 | Ga0501037_0981721 | 3300049573 | Bacteria | 551 |
| 541 | Ga0501038_1226926 | 3300049574 | Bacteria | 544 |
| 542 | Ga0501040_0363499 | 3300049576 | Bacteria | 1037 |
| 543 | Ga0501040_1123383 | 3300049576 | Unclassified | 570 |
| 544 | Ga0501041_0630792 | 3300049577 | Unclassified | 685 |
| 545 | Ga0501042_0491677 | 3300049578 | Unclassified | 891 |
| 546 | Ga0501047_0091336 | 3300049581 | Bacteria | 2923 |
| 547 | Ga0501047_0093898 | 3300049581 | Bacteria | 2879 |
| 548 | Ga0501047_0723820 | 3300049581 | Bacteria | 812 |
| 549 | Ga0501047_1288199 | 3300049581 | Bacteria | 545 |
| 550 | Ga0501048_0725016 | 3300049582 | Bacteria | 714 |
| 551 | Ga0501070_0472701 | 3300049586 | Bacteria | 1009 |
| 552 | Ga0501070_1382227 | 3300049586 | Bacteria | 535 |
| 553 | Ga0501071_0130701 | 3300049587 | Bacteria | 1865 |
| 554 | Ga0501072_0604222 | 3300049588 | Unclassified | 865 |
| 555 | Ga0501075_0410518 | 3300049591 | Bacteria | 1032 |
| 556 | Ga0501076_0394561 | 3300049592 | Bacteria | 1138 |
| 557 | Ga0501077_0369111 | 3300049593 | Unclassified | 916 |
| 558 | Ga0501249_000397 | 3300049679 | Bacteria | 11196 |
| 559 | Ga0501079_0713898 | 3300049741 | Unclassified | 789 |
| 560 | nmdc:mga03n38_190269_c1 | 3300050490 | Bacteria | 1057 |
| 561 | nmdc:mga0yw44_177140_c1 | 3300050492 | Bacteria | 1402 |
| 562 | nmdc:mga0k408_111219_c1 | 3300050493 | Bacteria | 608 |
| 563 | nmdc:mga0k408_307063_c1 | 3300050493 | Bacteria | 947 |
| 564 | nmdc:mga06z11_112384_c1 | 3300050494 | Bacteria | 1510 |
| 565 | nmdc:mga06z11_54_c1 | 3300050494 | Bacteria | 48385 |
| 566 | nmdc:mga04h51_32_c1 | 3300050495 | Bacteria | 48953 |
| 567 | nmdc:mga07m45_28170_c1 | 3300050496 | Bacteria | 3100 |
| 568 | nmdc:mga07m45_552709_c1 | 3300050496 | Bacteria | 666 |
| 569 | nmdc:mga07m45_746589_c1 | 3300050496 | Bacteria | 562 |
| 570 | nmdc:mga0qj67_1522703_c1 | 3300050509 | Bacteria | 514 |
| 571 | nmdc:mga06r32_915235_c1 | 3300050510 | Bacteria | 833 |
| 572 | Ga0500635_0335076 | 3300053080 | Unclassified | 598 |
| 573 | Ga0500643_000090 | 3300053087 | Bacteria | 93938 |
| 574 | Ga0500643_000573 | 3300053087 | Bacteria | 25547 |
| 575 | Ga0500644_0015454 | 3300053088 | Bacteria | 2177 |
| 576 | Ga0500651_0021989 | 3300053093 | Bacteria | 3982 |
| 577 | Ga0500651_0503868 | 3300053093 | Bacteria | 667 |
| 578 | Ga0500651_0683851 | 3300053093 | Unclassified | 550 |
| 579 | Ga0500555_000848 | 3300053103 | Bacteria | 10940 |
| 580 | Ga0500595_057278 | 3300053119 | Bacteria | 1188 |
| 581 | Ga0500559_0022081 | 3300053136 | Bacteria | 2699 |
| 582 | Ga0500559_0025794 | 3300053136 | Bacteria | 2502 |
| 583 | Ga0500559_0031307 | 3300053136 | Bacteria | 2282 |
| 584 | Ga0500559_0064172 | 3300053136 | Bacteria | 1643 |
| 585 | Ga0500577_0194816 | 3300053142 | Bacteria | 873 |
| 586 | Ga0500590_000019 | 3300053148 | Bacteria | 44823 |
| 587 | Ga0500590_000177 | 3300053148 | Bacteria | 19032 |
| 588 | Ga0500590_167656 | 3300053148 | Bacteria | 970 |
| 589 | Ga0500624_000002 | 3300053157 | Bacteria | 257900 |
| 590 | Ga0500637_0122189 | 3300053178 | Unclassified | 1511 |
| 591 | Ga0500570_008967 | 3300053724 | Bacteria | 5539 |
| 592 | Ga0500570_009926 | 3300053724 | Bacteria | 5296 |
| 593 | Ga0500596_036700 | 3300053735 | Unclassified | 773 |
| 594 | Ga0500661_011276 | 3300055283 | Bacteria | 1618 |
| 595 | 2503204172 | 2503198000 | Bacteria | 6884444 |
| 596 | 2509118284 | 2508501123 | Bacteria | 6283661 |
| 597 | 2509373840 | 2509276018 | Bacteria | 6910194 |
| 598 | 2509398505 | 2509276022 | Bacteria | 6200534 |
| 599 | 2510319613 | 2510065059 | Bacteria | 6847884 |
| 600 | 2512934982 | 2512875016 | Bacteria | 6529530 |
| 601 | 2512963344 | 2512875024 | Bacteria | 7195110 |
| 602 | 2514034380 | 2513237164 | Bacteria | 7563725 |
| 603 | 2514590660 | 2513237351 | Bacteria | 6968952 |
| 604 | 2597815393 | 2597489875 | Bacteria | 7010078 |
| 605 | 2600202113 | 2599185354 | Bacteria | 4398675 |
| 606 | 2643731426 | 2643221541 | Bacteria | 5498788 |
| 607 | 2644042246 | 2643221606 | Bacteria | 5588032 |
| 608 | 2644394112 | 2643221671 | Bacteria | 5496681 |
| 609 | 2688600920 | 2687453392 | Bacteria | 6880454 |
| 610 | 2694631823 | 2693429783 | Bacteria | 7019804 |
| 611 | 2694639243 | 2693429784 | Bacteria | 7241525 |
| 612 | 2756677636 | 2756170246 | Bacteria | 7451806 |
| 613 | 2792751157 | 2791355123 | Bacteria | 8049106 |
| 614 | 2841737968 | 2841734538 | Bacteria | 6784580 |
| 615 | 2844002579 | 2844002411 | Bacteria | 7168230 |
| 616 | 2844011710 | 2844009547 | Bacteria | 6728125 |
| 617 | 2847674247 | 2847670302 | Bacteria | 6165597 |
| 618 | 2847688771 | 2847686936 | Bacteria | 6278406 |
| 619 | 2856317836 | 2856314179 | Bacteria | 6477897 |
| 620 | 2856321242 | 2856320880 | Bacteria | 7263508 |
| 621 | 2856322571 | 2856320880 | Bacteria | 7263508 |
| 622 | 2856340772 | 2856334872 | Bacteria | 7037011 |
| 623 | 2856344468 | 2856342000 | Bacteria | 7176905 |
| 624 | 2856356066 | 2856349417 | Bacteria | 6230045 |
| 625 | 2856363473 | 2856356410 | Bacteria | 6297484 |
| 626 | 2856365452 | 2856364286 | Bacteria | 6939991 |
| 627 | 2856366341 | 2856364286 | Bacteria | 6939991 |
| 628 | 2857353821 | 2857349434 | Bacteria | 7926032 |
| 629 | 2857356973 | 2857349434 | Bacteria | 7926032 |
| 630 | 2857357693 | 2857349434 | Bacteria | 7926032 |
| 631 | 2857369438 | 2857367948 | Bacteria | 6965560 |
| 632 | 2869166147 | 2869162929 | Bacteria | 6399702 |
| 633 | 2869170901 | 2869169390 | Bacteria | 6659796 |
| 634 | 2869236401 | 2869234852 | Bacteria | 6654993 |
| 635 | 2869238462 | 2869234852 | Bacteria | 6654993 |
| 636 | 2869243865 | 2869242130 | Bacteria | 6609239 |
| 637 | 2869250712 | 2869249662 | Bacteria | 6868783 |
| 638 | 2869258057 | 2869256925 | Bacteria | 6981691 |
| 639 | 2869265446 | 2869264136 | Bacteria | 6880765 |
| 640 | 2869277929 | 2869271264 | Bacteria | 6908218 |
| 641 | 2869281826 | 2869278585 | Bacteria | 7077053 |
| 642 | 2869282177 | 2869278585 | Bacteria | 7077053 |
| 643 | 2869286927 | 2869285874 | Bacteria | 6901219 |
| 644 | 2869288248 | 2869285874 | Bacteria | 6901219 |
| 645 | 2871434233 | 2871429161 | Bacteria | 6547891 |
| 646 | 2871438005 | 2871435913 | Bacteria | 6880295 |
| 647 | 2871450108 | 2871444079 | Bacteria | 6423508 |
| 648 | 2871455666 | 2871451962 | Bacteria | 7336357 |
| 649 | 2871464806 | 2871459585 | Bacteria | 6866887 |
| 650 | 2871467021 | 2871466892 | Bacteria | 6923287 |
| 651 | 2871478912 | 2871474448 | Bacteria | 6806570 |
| 652 | 2871486386 | 2871481445 | Bacteria | 6700002 |
| 653 | 2871490501 | 2871488783 | Bacteria | 6929816 |
| 654 | 2871498203 | 2871495908 | Bacteria | 6935695 |
| 655 | 2874105166 | 2874102143 | Bacteria | 6342645 |
| 656 | 2874111364 | 2874109183 | Bacteria | 6517025 |
| 657 | 2874113685 | 2874109183 | Bacteria | 6517025 |
| 658 | 2874121270 | 2874116593 | Bacteria | 6674494 |
| 659 | 2874124638 | 2874123672 | Bacteria | 7238285 |
| 660 | 2874133314 | 2874131515 | Bacteria | 6820270 |
| 661 | 2874140249 | 2874139085 | Bacteria | 7021506 |
| 662 | 2874145499 | 2874139085 | Bacteria | 7021506 |
| 663 | 2874147368 | 2874146452 | Bacteria | 7533118 |
| 664 | 2874151882 | 2874146452 | Bacteria | 7533118 |
| 665 | 2874156374 | 2874155637 | Bacteria | 6724144 |
| 666 | 2874159514 | 2874155637 | Bacteria | 6724144 |
| 667 | 2874166082 | 2874162495 | Bacteria | 6174670 |
| 668 | 2874172794 | 2874168670 | Bacteria | 8062617 |
| 669 | 2876366050 | 2876363079 | Bacteria | 6544991 |
| 670 | 2876374935 | 2876369609 | Bacteria | 6807521 |
| 671 | 2876388378 | 2876386047 | Bacteria | 6698674 |
| 672 | 2876396637 | 2876392853 | Bacteria | 6660880 |
| 673 | 2876406589 | 2876399893 | Bacteria | 6927900 |
| 674 | 2876412927 | 2876406927 | Bacteria | 6191900 |
| 675 | 2876414562 | 2876413966 | Bacteria | 6831344 |
| 676 | 2876417932 | 2876413966 | Bacteria | 6831344 |
| 677 | 2876423561 | 2876420981 | Bacteria | 6687741 |
| 678 | 2878041238 | 2878035449 | Bacteria | 6555736 |
| 679 | 2878734790 | 2878730984 | Bacteria | 6380721 |
| 680 | 2878735409 | 2878730984 | Bacteria | 6380721 |
| 681 | 2878741587 | 2878738818 | Bacteria | 7136951 |
| 682 | 2878747108 | 2878745973 | Bacteria | 6867388 |
| 683 | 2878749759 | 2878745973 | Bacteria | 6867388 |
| 684 | 2878759435 | 2878753008 | Bacteria | 6922523 |
| 685 | 2878762425 | 2878760144 | Bacteria | 6823465 |
| 686 | 2878769392 | 2878767105 | Bacteria | 6898628 |
| 687 | 2878779304 | 2878774303 | Bacteria | 6108671 |
| 688 | 2878782673 | 2878781027 | Bacteria | 6834456 |
| 689 | 2878789994 | 2878788777 | Bacteria | 6567085 |
| 690 | 2881149004 | 2881147464 | Bacteria | 7779814 |
| 691 | 2881154470 | 2881147464 | Bacteria | 7779814 |
| 692 | 2881160240 | 2881155292 | Bacteria | 6461656 |
| 693 | 2881163871 | 2881161766 | Bacteria | 7127907 |
| 694 | 2881165840 | 2881161766 | Bacteria | 7127907 |
| 695 | 2881849875 | 2881845957 | Bacteria | 6611900 |
| 696 | 2881853023 | 2881845957 | Bacteria | 6611900 |
| 697 | 2881854744 | 2881853255 | Bacteria | 6698367 |
| 698 | 2881863005 | 2881861095 | Bacteria | 7128710 |
| 699 | 2881868481 | 2881861095 | Bacteria | 7128710 |
| 700 | 2882636705 | 2882632389 | Bacteria | 8154593 |
| 701 | 2882915813 | 2882912400 | Bacteria | 6801539 |
| 702 | 2885305231 | 2885305155 | Bacteria | 7348390 |
| 703 | 2885315353 | 2885312484 | Bacteria | 6415165 |
| 704 | 2885324993 | 2885318864 | Bacteria | 6729568 |
| 705 | 2885330323 | 2885326080 | Bacteria | 7134805 |
| 706 | 2885337277 | 2885334103 | Bacteria | 7216818 |
| 707 | 2885343032 | 2885342637 | Bacteria | 7011821 |
| 708 | 2885356866 | 2885350715 | Bacteria | 6787678 |
| 709 | 2888337529 | 2888337043 | Bacteria | 6629336 |
| 710 | 2888349543 | 2888343758 | Bacteria | 6611049 |
| 711 | 2888351585 | 2888350351 | Bacteria | 7372807 |
| 712 | 2888352511 | 2888350351 | Bacteria | 7372807 |
| 713 | 2888354049 | 2888350351 | Bacteria | 7372807 |
| 714 | 2889015761 | 2889010040 | Bacteria | 6749192 |
| 715 | 2889016634 | 2889010040 | Bacteria | 6749192 |
| 716 | 2889019189 | 2889016732 | Bacteria | 6700763 |
| 717 | 2903500125 | 2903492973 | Bacteria | 13473544 |
| 718 | 2903505214 | 2903492973 | Bacteria | 13473544 |
| 719 | 2903518116 | 2903513507 | Bacteria | 6344008 |
| 720 | 2903518532 | 2903513507 | Bacteria | 6344008 |
| 721 | 2903526174 | 2903521522 | Bacteria | 6525694 |
| 722 | 2903530464 | 2903528002 | Bacteria | 6586099 |
| 723 | 2903543000 | 2903540706 | Bacteria | 7062119 |
| 724 | 2904660876 | 2904659560 | Bacteria | 6685615 |
| 725 | 2904663414 | 2904659560 | Bacteria | 6685615 |
| 726 | 2906309280 | 2906308376 | Bacteria | 6841989 |
| 727 | 2906310797 | 2906308376 | Bacteria | 6841989 |
| 728 | 2906326930 | 2906321335 | Bacteria | 6579571 |
| 729 | 2906330823 | 2906328253 | Bacteria | 6585166 |
| 730 | 2906359911 | 2906354277 | Bacteria | 6991324 |
| 731 | 2906360223 | 2906354277 | Bacteria | 6991324 |
| 732 | 2906368083 | 2906363423 | Bacteria | 6856682 |
| 733 | 2906373312 | 2906370794 | Bacteria | 6881062 |
| 734 | 2906384277 | 2906378014 | Bacteria | 6911440 |
| 735 | 2906391927 | 2906386501 | Bacteria | 5977019 |
| 736 | 2906398804 | 2906393657 | Bacteria | 6790866 |
| 737 | 2906404140 | 2906401398 | Bacteria | 6693206 |
| 738 | 2906408653 | 2906408224 | Bacteria | 6162342 |
| 739 | 2906417901 | 2906414383 | Bacteria | 6580790 |
| 740 | 2906429636 | 2906427513 | Bacteria | 6375796 |
| 741 | 2919710911 | 2919709256 | Bacteria | 4318106 |
| 742 | 2919712264 | 2919709256 | Bacteria | 4318106 |
| 743 | 2922132368 | 2922130491 | Bacteria | 7173936 |
| 744 | 2922152596 | 2922151315 | Bacteria | 6902399 |
| 745 | 2922160505 | 2922158528 | Bacteria | 6573167 |
| 746 | 2922177024 | 2922172374 | Bacteria | 6167644 |
| 747 | 2922183207 | 2922178524 | Bacteria | 6025201 |
| 748 | 2922192522 | 2922185730 | Bacteria | 7113964 |
| 749 | 2922193721 | 2922185730 | Bacteria | 7113964 |
| 750 | 2924723424 | 2924718760 | Bacteria | 6331356 |
| 751 | 2924724471 | 2924718760 | Bacteria | 6331356 |
| 752 | 2924732043 | 2924726620 | Bacteria | 6271473 |
| 753 | 2924739011 | 2924733363 | Bacteria | 7574837 |
| 754 | 2924742308 | 2924741084 | Bacteria | 6661321 |
| 755 | 2924754157 | 2924748358 | Bacteria | 6154725 |
| 756 | 2924758025 | 2924754689 | Bacteria | 6774424 |
| 757 | 2924766596 | 2924762789 | Bacteria | 6561353 |
| 758 | 2924779269 | 2924776078 | Bacteria | 7492003 |
| 759 | 2924790572 | 2924784321 | Bacteria | 7416538 |
| 760 | 2937813639 | 2937813078 | Bacteria | 7783518 |
| 761 | 2937817624 | 2937813078 | Bacteria | 7783518 |
| 762 | 2937829432 | 2937822353 | Bacteria | 7290551 |
| 763 | 2937837277 | 2937836603 | Bacteria | 6811263 |
| 764 | 2937852811 | 2937848649 | Bacteria | 6983481 |
| 765 | 2937861911 | 2937861824 | Bacteria | 6660327 |
| 766 | 2937869401 | 2937868953 | Bacteria | 6639878 |
| 767 | 2937878624 | 2937877337 | Bacteria | 7246526 |
| 768 | 2937881446 | 2937877337 | Bacteria | 7246526 |
| 769 | 2937881557 | 2937877337 | Bacteria | 7246526 |
| 770 | 2937892655 | 2937891427 | Bacteria | 6357007 |
| 771 | 2937976760 | 2937972304 | Bacteria | 7532020 |
| 772 | 2937979307 | 2937972304 | Bacteria | 7532020 |
| 773 | 2937981980 | 2937980651 | Bacteria | 6517427 |
| 774 | 2937996853 | 2937994558 | Bacteria | 7036190 |
| 775 | 2958036722 | 2958034702 | Bacteria | 6989922 |
| 776 | 2958038018 | 2958034702 | Bacteria | 6989922 |
| 777 | 2958046873 | 2958041894 | Bacteria | 13082850 |
| 778 | 2958047795 | 2958041894 | Bacteria | 13082850 |
| 779 | 2958049332 | 2958041894 | Bacteria | 13082850 |
| 780 | 2958068575 | 2958064165 | Bacteria | 7158582 |
| 781 | 2958075947 | 2958071322 | Bacteria | 6815895 |
| 782 | 2958085777 | 2958084443 | Bacteria | 7312792 |
| 783 | 2958087997 | 2958084443 | Bacteria | 7312792 |
| 784 | 2958088687 | 2958084443 | Bacteria | 7312792 |
| 785 | 2958097568 | 2958092219 | Bacteria | 6861151 |
| 786 | 2958105160 | 2958100919 | Bacteria | 6800575 |
| 787 | 2958105456 | 2958100919 | Bacteria | 6800575 |
| 788 | 2958114283 | 2958108152 | Bacteria | 6681128 |
| 789 | 2958115307 | 2958115193 | Bacteria | 6923548 |
| 790 | 2958121831 | 2958115193 | Bacteria | 6923548 |
| 791 | 2958128161 | 2958122699 | Bacteria | 7280457 |
| 792 | 2958131327 | 2958130278 | Bacteria | 6897202 |
| 793 | 2958132650 | 2958130278 | Bacteria | 6897202 |
| 794 | 2958142269 | 2958137437 | Bacteria | 6050276 |
| 795 | 2958149297 | 2958144490 | Bacteria | 6677056 |
| 796 | 2958149700 | 2958144490 | Bacteria | 6677056 |
| 797 | 2958164198 | 2958158011 | Bacteria | 6058449 |
| 798 | 2958167321 | 2958165035 | Bacteria | 6906348 |
| 799 | 2958177041 | 2958172287 | Bacteria | 6716688 |
| 800 | 2958177341 | 2958172287 | Bacteria | 6716688 |
| 801 | 2958181152 | 2958179912 | Bacteria | 6874908 |
| 802 | 2958182464 | 2958179912 | Bacteria | 6874908 |
| 803 | 2961078990 | 2961077736 | Bacteria | 7079850 |
| 804 | 2961080309 | 2961077736 | Bacteria | 7079850 |
| 805 | 2961116035 | 2961114664 | Bacteria | 6680456 |
| 806 | 2961118441 | 2961114664 | Bacteria | 6680456 |
| 807 | 2961131642 | 2961127735 | Bacteria | 7196641 |
| 808 | 2961142160 | 2961136820 | Bacteria | 6775228 |
| 809 | 2961165794 | 2961163497 | Bacteria | 6901077 |
| 810 | 2961177622 | 2961170736 | Bacteria | 7072258 |
| 811 | 2961186984 | 2961183825 | Bacteria | 6688536 |
| 812 | 2963650642 | 2963644680 | Bacteria | 6530403 |
| 813 | 2965020613 | 2965018300 | Bacteria | 6883036 |
| 814 | 2965039763 | 2965032056 | Bacteria | 6887443 |
| 815 | 2965045993 | 2965040258 | Bacteria | 6855979 |
| 816 | 2965055387 | 2965047637 | Bacteria | 6623551 |
| 817 | 2965066862 | 2965062239 | Bacteria | 7412989 |
| 818 | 2965067053 | 2965062239 | Bacteria | 7412989 |
| 819 | 2965094391 | 2965089291 | Bacteria | 6866420 |
| 820 | 2965110697 | 2965102966 | Bacteria | 6800987 |
| 821 | 2965114241 | 2965110997 | Bacteria | 6693150 |
| 822 | 2965120146 | 2965119406 | Bacteria | 6956431 |
| 823 | 2965120430 | 2965119406 | Bacteria | 6956431 |
| 824 | 2967997279 | 2967996073 | Bacteria | 6787468 |
| 825 | 2968010599 | 2968003550 | Bacteria | 6929263 |
| 826 | 2968021405 | 2968016561 | Bacteria | 7022047 |
| 827 | 2968022517 | 2968016561 | Bacteria | 7022047 |
| 828 | 2968094330 | 2968091066 | Bacteria | 6052692 |
| 829 | 2968112020 | 2968110612 | Bacteria | 6814636 |
| 830 | 2968114502 | 2968110612 | Bacteria | 6814636 |
| 831 | 2968123915 | 2968117919 | Bacteria | 6536078 |
| 832 | 2968131017 | 2968128360 | Bacteria | 6270294 |
| 833 | 2968145914 | 2968138860 | Bacteria | 6605449 |
| 834 | 2968174193 | 2968171901 | Bacteria | 6894245 |
| 835 | 2970475101 | 2970469710 | Bacteria | 6969209 |
| 836 | 2970476510 | 2970469710 | Bacteria | 6969209 |
| 837 | 2970491273 | 2970489779 | Bacteria | 6517260 |
| 838 | 2970510300 | 2970503327 | Bacteria | 7099517 |
| 839 | 2970513908 | 2970510686 | Bacteria | 7006402 |
| 840 | 2970528878 | 2970524798 | Bacteria | 6840927 |
| 841 | 2970537084 | 2970532167 | Bacteria | 6553173 |
| 842 | 2970542421 | 2970540015 | Bacteria | 6977556 |
| 843 | 2970550295 | 2970547951 | Bacteria | 6931819 |
| 844 | 2970557283 | 2970554993 | Bacteria | 6814252 |
| 845 | 2970596431 | 2970593180 | Bacteria | 7073582 |
| 846 | 2970596783 | 2970593180 | Bacteria | 7073582 |
| 847 | 2970623788 | 2970619444 | Bacteria | 6986144 |
| 848 | 2970633089 | 2970627176 | Bacteria | 6680862 |
| 849 | 2977827968 | 2977821940 | Bacteria | 6906439 |
| 850 | 2977835351 | 2977828996 | Bacteria | 7007971 |
| 851 | 2977843968 | 2977843712 | Bacteria | 6753583 |
| 852 | 2977847912 | 2977843712 | Bacteria | 6753583 |
| 853 | 2977856134 | 2977851361 | Bacteria | 6694324 |
| 854 | 2977860012 | 2977858184 | Bacteria | 6215359 |
| 855 | 2977870909 | 2977864932 | Bacteria | 7534097 |
| 856 | 2977879074 | 2977872689 | Bacteria | 7270173 |
| 857 | 2977898730 | 2977898635 | Bacteria | 6675551 |
| 858 | 2977913092 | 2977907340 | Bacteria | 6577984 |
| 859 | 2977920515 | 2977915119 | Bacteria | 6829656 |
| 860 | 2977925414 | 2977922695 | Bacteria | 6956781 |
| 861 | 2977940718 | 2977935797 | Bacteria | 6252826 |
| 862 | 2977946195 | 2977942078 | Bacteria | 7570577 |
| 863 | 2977950186 | 2977942078 | Bacteria | 7570577 |
| 864 | 2977957200 | 2977950692 | Bacteria | 6893264 |
| 865 | 2977958711 | 2977957713 | Bacteria | 6877875 |
| 866 | 2977975421 | 2977971508 | Bacteria | 7472917 |
| 867 | 2977976099 | 2977971508 | Bacteria | 7472917 |
| 868 | 2977991414 | 2977986579 | Bacteria | 6581278 |
| 869 | 2979715540 | 2979710463 | Bacteria | 6785254 |
| 870 | 2979715703 | 2979710463 | Bacteria | 6785254 |
| 871 | 2979744281 | 2979742915 | Bacteria | 7301278 |
| 872 | 2979745801 | 2979742915 | Bacteria | 7301278 |
| 873 | 2979750843 | 2979742915 | Bacteria | 7301278 |
| 874 | 2979766526 | 2979764755 | Bacteria | 6610066 |
| 875 | 2979777799 | 2979772303 | Bacteria | 6618277 |
| 876 | 2979781076 | 2979779861 | Bacteria | 6219781 |
| 877 | 2979794781 | 2979793036 | Bacteria | 6808957 |
| 878 | 2979815173 | 2979808191 | Bacteria | 7179355 |
| 879 | 2987642767 | 2987636660 | Bacteria | 8088555 |
| 880 | 2987644254 | 2987636660 | Bacteria | 8088555 |
| 881 | 2987645196 | 2987636660 | Bacteria | 8088555 |
| 882 | 2987649599 | 2987645492 | Bacteria | 6117018 |
| 883 | 2987656092 | 2987652177 | Bacteria | 6969023 |
| 884 | 2987656909 | 2987652177 | Bacteria | 6969023 |
| 885 | 2987661800 | 2987659509 | Bacteria | 6966464 |
| 886 | 2987670928 | 2987666974 | Bacteria | 6509233 |
| 887 | 2987676131 | 2987673487 | Bacteria | 6884027 |
| 888 | 2996345440 | 2996341866 | Bacteria | 6643098 |
| 889 | 2996353473 | 2996348954 | Bacteria | 7239054 |
| 890 | 2996393350 | 2996386984 | Bacteria | 6978667 |
| 891 | 3000139198 | 3000135777 | Bacteria | 6891109 |
| 892 | 3004190849 | 3004188549 | Bacteria | 6952365 |
| 893 | 3004203485 | 3004195979 | Bacteria | 6776956 |
| 894 | 3004206568 | 3004203850 | Bacteria | 7307914 |
| 895 | 3004208403 | 3004203850 | Bacteria | 7307914 |
| 896 | 3004214246 | 3004211236 | Bacteria | 7417683 |
| 897 | 3004222673 | 3004218560 | Bacteria | 7421728 |
| 898 | 3004236356 | 3004232784 | Bacteria | 6662140 |
| 899 | 3004239952 | 3004232784 | Bacteria | 6662140 |
| 900 | 3004244700 | 3004239961 | Bacteria | 6892290 |
| 901 | 3004251925 | 3004248173 | Bacteria | 6563236 |
| 902 | 3004273615 | 3004268573 | Bacteria | 7043476 |
| 903 | 3004280155 | 3004275668 | Bacteria | 7114440 |
| 904 | 3004289870 | 3004289098 | Bacteria | 6135450 |
| 905 | 3004296948 | 3004289098 | Bacteria | 6135450 |
| 906 | 637078199 | 637000159 | Bacteria | 7596297 |
| 907 | 649875386 | 649633066 | Bacteria | 6690028 |
| 908 | 8002287203 | 8002285264 | Bacteria | 6717907 |
| 909 | 8004306213 | 8004300914 | Bacteria | 6132239 |
| 910 | 8004319318 | 8004312739 | Bacteria | 7444653 |
| 911 | 8004369041 | 8004361976 | Bacteria | 6858373 |
| 912 | 8004380944 | 8004374579 | Bacteria | 6898112 |
| 913 | 8004388970 | 8004387939 | Bacteria | 7049250 |
| 914 | 8004390035 | 8004387939 | Bacteria | 7049250 |
| 915 | 8004398077 | 8004395343 | Bacteria | 6620908 |
| 916 | 8004446850 | 8004445564 | Bacteria | 6322258 |
| 917 | 8004636553 | 8004633249 | Bacteria | 6723080 |
| 918 | 8004703440 | 8004695233 | Bacteria | 6731676 |
| 919 | 8004712674 | 8004703790 | Bacteria | 8006957 |
| 920 | 8004714064 | 8004703790 | Bacteria | 8006957 |
| 921 | 8004715539 | 8004714634 | Bacteria | 6776161 |
| 922 | 8004718432 | 8004714634 | Bacteria | 6776161 |
| 923 | 8004728374 | 8004727605 | Bacteria | 6643904 |
| 924 | 8055623986 | 8055617313 | Bacteria | 7548464 |
| 925 | Ga0500643_080695 | |||
| 926 | SwRhRL2b_contig_1165699 | |||
| 927 | SwRhRL2b_contig_795850 | |||
| 928 | JGI24736J21556_1002225 | |||
| 929 | JGI24736J21556_1007043 | |||
| 930 | JGI24741J21665_1011201 | |||
| 931 | JGI24740J21852_10002439 | |||
| 932 | JGI24740J21852_10008085 | |||
| 933 | JGI24740J21852_10107512 | |||
| 934 | JGI24739J22299_10089621 | |||
| 935 | JGI24739J22299_10120832 | |||
| 936 | JGI24737J22298_10001659 | |||
| 937 | JGI24737J22298_10012924 | |||
| 938 | JGI24737J22298_10042416 | |||
| 939 | JGI24735J21928_10001615 | |||
| 940 | JGI24735J21928_10004865 | |||
| 941 | JGI24735J21928_10008830 | |||
| 942 | JGI24750J21931_1000318 | |||
| 943 | JGI24750J21931_1083195 | |||
| 944 | JGI24738J21930_10001024 | |||
| 945 | JGI24738J21930_10011266 | |||
| 946 | JGI24751J29686_10000063 | |||
| 947 | JGI25165J46597_1000098 | |||
| 948 | JGI25153J46596_10000002 | |||
| 949 | Ga0055530_10029487 | |||
| 950 | Ga0055531_10053293 | |||
| 951 | Ga0055531_10069289 | |||
| 952 | JGI25405J52794_10082627 | |||
| 953 | Ga0065704_10001128 | |||
| 954 | Ga0065704_10322314 | |||
| 955 | Ga0065707_10163655 | |||
| 956 | Ga0070658_10000088 | |||
| 957 | Ga0070658_10004888 | |||
| 958 | Ga0070658_10232524 | |||
| 959 | Ga0070658_11896793 | |||
| 960 | Ga0070683_100297485 | |||
| 961 | Ga0070683_101344247 | |||
| 962 | Ga0070690_100000177 | |||
| 963 | Ga0070690_101760173 | |||
| 964 | Ga0070670_100000245 | |||
| 965 | Ga0070666_10000014 | |||
| 966 | Ga0070680_100005289 | |||
| 967 | Ga0070660_100000780 | |||
| 968 | Ga0070660_100045563 | |||
| 969 | Ga0070660_101050121 | |||
| 970 | Ga0070691_10038377 | |||
| 971 | Ga0070691_10201558 | |||
| 972 | Ga0070687_100354976 | |||
| 973 | Ga0070661_100000018 | |||
| 974 | Ga0070661_100004782 | |||
| 975 | Ga0070661_100232067 | |||
| 976 | Ga0070661_101865637 | |||
| 977 | Ga0070692_10051274 | |||
| 978 | Ga0070668_101280493 | |||
| 979 | Ga0070669_100000048 | |||
| 980 | Ga0070669_100613601 | |||
| 981 | Ga0070669_101708594 | |||
| 982 | Ga0070671_100001321 | |||
| 983 | Ga0070673_101545758 | |||
| 984 | Ga0070659_100000216 | |||
| 985 | Ga0070659_100107497 | |||
| 986 | Ga0070659_100149285 | |||
| 987 | Ga0070659_100225001 | |||
| 988 | Ga0070659_100377777 | |||
| 989 | Ga0070659_101656562 | |||
| 990 | Ga0070659_101685435 | |||
| 991 | Ga0070667_100000655 | |||
| 992 | Ga0070667_100273640 | |||
| 993 | Ga0070703_10002747 | |||
| 994 | Ga0070705_100003523 | |||
| 995 | Ga0070705_101444201 | |||
| 996 | Ga0070694_100002075 | |||
| 997 | Ga0070694_100450044 | |||
| 998 | Ga0070708_100720535 | |||
| 999 | Ga0070708_101575503 | |||
| 1000 | Ga0070663_100039490 | |||
| 1001 | Ga0070663_100110416 | |||
| 1002 | Ga0070663_100214515 | |||
| 1003 | Ga0070663_100235489 | |||
| 1004 | Ga0070663_100588399 | |||
| 1005 | Ga0070662_100000574 | |||
| 1006 | Ga0070662_100017381 | |||
| 1007 | Ga0070662_100106175 | |||
| 1008 | Ga0070662_100172547 | |||
| 1009 | Ga0070662_100292762 | |||
| 1010 | Ga0070662_100901034 | |||
| 1011 | Ga0070681_10086932 | |||
| 1012 | Ga0068867_101399223 | |||
| 1013 | Ga0070707_100123261 | |||
| 1014 | Ga0070698_100255017 | |||
| 1015 | Ga0070699_100015502 | |||
| 1016 | Ga0070699_101632418 | |||
| 1017 | Ga0070699_101907526 | |||
| 1018 | Ga0070679_100000100 | |||
| 1019 | Ga0070679_100951479 | |||
| 1020 | Ga0070684_100396960 | |||
| 1021 | Ga0070697_100027326 | |||
| 1022 | Ga0068853_100000475 | |||
| 1023 | Ga0068853_100001731 | |||
| 1024 | Ga0068853_100069465 | |||
| 1025 | Ga0068853_100088393 | |||
| 1026 | Ga0068853_100164661 | |||
| 1027 | Ga0068853_100223032 | |||
| 1028 | Ga0070672_100100890 | |||
| 1029 | Ga0070672_100115374 | |||
| 1030 | Ga0070672_100336110 | |||
| 1031 | Ga0070672_101340007 | |||
| 1032 | Ga0070686_100000002 | |||
| 1033 | Ga0070686_100040721 | |||
| 1034 | Ga0070695_100000776 | |||
| 1035 | Ga0070695_100005333 | |||
| 1036 | Ga0070696_100025382 | |||
| 1037 | Ga0070693_100118874 | |||
| 1038 | Ga0070693_100563020 | |||
| 1039 | Ga0070665_100017512 | |||
| 1040 | Ga0070665_100559148 | |||
| 1041 | Ga0070665_100689342 | |||
| 1042 | Ga0070704_100001730 | |||
| 1043 | Ga0070704_100003383 | |||
| 1044 | Ga0068855_100000173 | |||
| 1045 | Ga0068855_100000486 | |||
| 1046 | Ga0068855_100000648 | |||
| 1047 | Ga0068855_100027484 | |||
| 1048 | Ga0068855_100035428 | |||
| 1049 | Ga0068855_100041641 | |||
| 1050 | Ga0068855_100053677 | |||
| 1051 | Ga0068855_100071700 | |||
| 1052 | Ga0068855_100094952 | |||
| 1053 | Ga0068855_100127616 | |||
| 1054 | Ga0068855_100540763 | |||
| 1055 | Ga0068855_100745425 | |||
| 1056 | Ga0068855_101042032 | |||
| 1057 | Ga0068855_101584287 | |||
| 1058 | Ga0070664_100008244 | |||
| 1059 | Ga0070664_100696608 | |||
| 1060 | Ga0070664_100963903 | |||
| 1061 | Ga0068857_100000037 | |||
| 1062 | Ga0068857_100000670 | |||
| 1063 | Ga0068857_100083024 | |||
| 1064 | Ga0068857_100178075 | |||
| 1065 | Ga0068857_100316500 | |||
| 1066 | Ga0068857_101729854 | |||
| 1067 | Ga0068854_100000071 | |||
| 1068 | Ga0068854_100000295 | |||
| 1069 | Ga0068854_100004367 | |||
| 1070 | Ga0068854_100039312 | |||
| 1071 | Ga0068854_100593628 | |||
| 1072 | Ga0068854_100852909 | |||
| 1073 | Ga0068856_100008358 | |||
| 1074 | Ga0068856_100346887 | |||
| 1075 | Ga0068856_100547358 | |||
| 1076 | Ga0068856_101704939 | |||
| 1077 | Ga0070702_100060989 | |||
| 1078 | Ga0068852_100000060 | |||
| 1079 | Ga0068852_100000450 | |||
| 1080 | Ga0068852_100000709 | |||
| 1081 | Ga0068852_100048301 | |||
| 1082 | Ga0068852_100164025 | |||
| 1083 | Ga0068852_100496157 | |||
| 1084 | Ga0068852_100736753 | |||
| 1085 | Ga0068859_100044136 | |||
| 1086 | Ga0068859_100421645 | |||
| 1087 | Ga0068864_100000109 | |||
| 1088 | Ga0068864_100009846 | |||
| 1089 | Ga0068864_100032691 | |||
| 1090 | Ga0068851_10001264 | |||
| 1091 | Ga0068851_10026604 | |||
| 1092 | Ga0068851_10072879 | |||
| 1093 | Ga0068851_10230725 | |||
| 1094 | Ga0068863_100050187 | |||
| 1095 | Ga0068863_102213935 | |||
| 1096 | Ga0068858_100000507 | |||
| 1097 | Ga0068860_100000001 | |||
| 1098 | Ga0068860_100019529 | |||
| 1099 | Ga0068860_100023878 | |||
| 1100 | Ga0068860_100152433 | |||
| 1101 | Ga0068860_100202870 | |||
| 1102 | Ga0068860_101362672 | |||
| 1103 | Ga0068862_100000128 | |||
| 1104 | Ga0068862_100402633 | |||
| 1105 | Ga0081455_10005327 | |||
| 1106 | Ga0081539_10315535 | |||
| 1107 | Ga0075365_10329684 | |||
| 1108 | Ga0075363_100195989 | |||
| 1109 | Ga0075367_10000157 | |||
| 1110 | Ga0075367_10246963 | |||
| 1111 | Ga0075369_10037536 | |||
| 1112 | Ga0075366_10208200 | |||
| 1113 | Ga0075370_10034233 | |||
| 1114 | Ga0075370_10349782 | |||
| 1115 | Ga0075370_10835465 | |||
| 1116 | Ga0075428_100079995 | |||
| 1117 | Ga0075430_100043343 | |||
| 1118 | Ga0097620_100044139 | |||
| 1119 | Ga0097620_100421662 | |||
| 1120 | Ga0079104_1005064 | |||
| 1121 | Ga0079104_1025888 | |||
| 1122 | Ga0079104_1055730 | |||
| 1123 | Ga0079104_1076700 | |||
| 1124 | Ga0105250_10242078 | |||
| 1125 | Ga0105250_10570004 | |||
| 1126 | Ga0105240_10000052 | |||
| 1127 | Ga0105240_10006734 | |||
| 1128 | Ga0105240_10007113 | |||
| 1129 | Ga0105240_10008661 | |||
| 1130 | Ga0105240_10235179 | |||
| 1131 | Ga0105240_10287243 | |||
| 1132 | Ga0105240_11411647 | |||
| 1133 | Ga0105240_11588249 | |||
| 1134 | Ga0105245_10000294 | |||
| 1135 | Ga0105247_10251351 | |||
| 1136 | Ga0105243_10067387 | |||
| 1137 | Ga0105243_12030858 | |||
| 1138 | Ga0105241_10001363 | |||
| 1139 | Ga0105241_10090215 | |||
| 1140 | Ga0105248_10010635 | |||
| 1141 | Ga0105248_10095888 | |||
| 1142 | Ga0105248_12043660 | |||
| 1143 | Ga0105237_10000378 | |||
| 1144 | Ga0105237_10039744 | |||
| 1145 | Ga0105237_10055645 | |||
| 1146 | Ga0105237_10222648 | |||
| 1147 | Ga0105237_10388742 | |||
| 1148 | Ga0105237_10643275 | |||
| 1149 | Ga0105238_10000912 | |||
| 1150 | Ga0105238_10001089 | |||
| 1151 | Ga0105238_10002804 | |||
| 1152 | Ga0105238_10002947 | |||
| 1153 | Ga0105238_10030532 | |||
| 1154 | Ga0105238_10031424 | |||
| 1155 | Ga0105238_10046330 | |||
| 1156 | Ga0105238_10068105 | |||
| 1157 | Ga0105238_10092256 | |||
| 1158 | Ga0105238_10698366 | |||
| 1159 | Ga0105238_11017676 | |||
| 1160 | Ga0105249_10000005 | |||
| 1161 | Ga0105249_10009245 | |||
| 1162 | Ga0105249_10012758 | |||
| 1163 | Ga0105249_12052843 | |||
| 1164 | Ga0105148_104761 | |||
| 1165 | Ga0105239_10000232 | |||
| 1166 | Ga0105239_10040953 | |||
| 1167 | Ga0105239_10047285 | |||
| 1168 | Ga0105239_10349828 | |||
| 1169 | Ga0105239_10546007 | |||
| 1170 | Ga0105239_10687205 | |||
| 1171 | Ga0105239_11278368 | |||
| 1172 | Ga0105239_13354114 | |||
| 1173 | Ga0105246_10609175 | |||
| 1174 | Ga0105246_11830796 | |||
| 1175 | Ga0157373_10005064 | |||
| 1176 | Ga0157373_10097581 | |||
| 1177 | Ga0157373_10162024 | |||
| 1178 | Ga0157373_10200186 | |||
| 1179 | Ga0157373_10553420 | |||
| 1180 | Ga0157371_10001141 | |||
| 1181 | Ga0157371_10086222 | |||
| 1182 | Ga0157371_10894387 | |||
| 1183 | Ga0157370_10001089 | |||
| 1184 | Ga0157370_10003021 | |||
| 1185 | Ga0157370_10183250 | |||
| 1186 | Ga0157370_10200033 | |||
| 1187 | Ga0157369_10000632 | |||
| 1188 | Ga0157369_10015667 | |||
| 1189 | Ga0157369_10017908 | |||
| 1190 | Ga0157369_10627040 | |||
| 1191 | Ga0157369_11171167 | |||
| 1192 | Ga0157369_11395223 | |||
| 1193 | Ga0157374_10358274 | |||
| 1194 | Ga0157374_10689565 | |||
| 1195 | Ga0157378_10089372 | |||
| 1196 | Ga0163162_10336202 | |||
| 1197 | Ga0157372_10002816 | |||
| 1198 | Ga0157372_10150953 | |||
| 1199 | Ga0157372_13152796 | |||
| 1200 | Ga0163163_10195588 | |||
| 1201 | Ga0157380_11782260 | |||
| 1202 | Ga0157379_10003511 | |||
| 1203 | Ga0157379_12129181 | |||
| 1204 | Ga0163161_10000106 | |||
| 1205 | Ga0163161_10259797 | |||
| 1206 | Ga0163161_10367987 | |||
| 1207 | Ga0213875_10006207 | |||
| 1208 | Ga0209674_110441 | |||
| 1209 | Ga0207427_119840 | |||
| 1210 | Ga0209437_125878 | |||
| 1211 | Ga0209233_1000010 | |||
| 1212 | Ga0209233_1000026 | |||
| 1213 | Ga0209455_1013793 | |||
| 1214 | Ga0209758_1000001 | |||
| 1215 | Ga0209050_1000406 | |||
| 1216 | Ga0209257_1005161 | |||
| 1217 | Ga0209257_1011989 | |||
| 1218 | Ga0207697_10000121 | |||
| 1219 | Ga0207656_10000454 | |||
| 1220 | Ga0207656_10008391 | |||
| 1221 | Ga0207656_10037726 | |||
| 1222 | Ga0207656_10119203 | |||
| 1223 | Ga0207696_1208051 | |||
| 1224 | Ga0207680_10000004 | |||
| 1225 | Ga0207647_10006656 | |||
| 1226 | Ga0207647_10015569 | |||
| 1227 | Ga0207647_10117185 | |||
| 1228 | Ga0207647_10619093 | |||
| 1229 | Ga0207705_10000138 | |||
| 1230 | Ga0207705_10005315 | |||
| 1231 | Ga0207705_10213548 | |||
| 1232 | Ga0207705_11130111 | |||
| 1233 | Ga0207654_10000427 | |||
| 1234 | Ga0207654_10002086 | |||
| 1235 | Ga0207654_10005142 | |||
| 1236 | Ga0207654_10204198 | |||
| 1237 | Ga0207654_10557832 | |||
| 1238 | Ga0207707_10330595 | |||
| 1239 | Ga0207695_10000122 | |||
| 1240 | Ga0207695_10001920 | |||
| 1241 | Ga0207695_10002056 | |||
| 1242 | Ga0207695_10002363 | |||
| 1243 | Ga0207695_10012343 | |||
| 1244 | Ga0207695_10022675 | |||
| 1245 | Ga0207695_10028904 | |||
| 1246 | Ga0207671_10000222 | |||
| 1247 | Ga0207671_10016463 | |||
| 1248 | Ga0207671_10019223 | |||
| 1249 | Ga0207671_10141288 | |||
| 1250 | Ga0207671_10167784 | |||
| 1251 | Ga0207671_10284000 | |||
| 1252 | Ga0207660_10022455 | |||
| 1253 | Ga0207662_10295156 | |||
| 1254 | Ga0207662_11367897 | |||
| 1255 | Ga0207657_10002145 | |||
| 1256 | Ga0207657_11013215 | |||
| 1257 | Ga0207649_10000034 | |||
| 1258 | Ga0207649_10002825 | |||
| 1259 | Ga0207649_11534035 | |||
| 1260 | Ga0207652_10000133 | |||
| 1261 | Ga0207652_11639433 | |||
| 1262 | Ga0207681_10000050 | |||
| 1263 | Ga0207681_11015129 | |||
| 1264 | Ga0207681_11182731 | |||
| 1265 | Ga0207681_11456773 | |||
| 1266 | Ga0207694_10000230 | |||
| 1267 | Ga0207694_10000611 | |||
| 1268 | Ga0207694_10000630 | |||
| 1269 | Ga0207694_10000844 | |||
| 1270 | Ga0207694_10003020 | |||
| 1271 | Ga0207694_10003984 | |||
| 1272 | Ga0207694_10005011 | |||
| 1273 | Ga0207694_10017772 | |||
| 1274 | Ga0207694_10021833 | |||
| 1275 | Ga0207694_10322962 | |||
| 1276 | Ga0207650_10000039 | |||
| 1277 | Ga0207687_10001319 | |||
| 1278 | Ga0207644_10000028 | |||
| 1279 | Ga0207690_10000052 | |||
| 1280 | Ga0207690_10173800 | |||
| 1281 | Ga0207690_10228136 | |||
| 1282 | Ga0207690_10288693 | |||
| 1283 | Ga0207690_10433123 | |||
| 1284 | Ga0207690_11187901 | |||
| 1285 | Ga0207690_11561906 | |||
| 1286 | Ga0207706_10002199 | |||
| 1287 | Ga0207706_10040418 | |||
| 1288 | Ga0207706_10070809 | |||
| 1289 | Ga0207709_10124475 | |||
| 1290 | Ga0207691_10341136 | |||
| 1291 | Ga0207691_10673946 | |||
| 1292 | Ga0207711_10005403 | |||
| 1293 | Ga0207711_10060041 | |||
| 1294 | Ga0207689_10278481 | |||
| 1295 | Ga0207661_11168247 | |||
| 1296 | Ga0207679_10066208 | |||
| 1297 | Ga0207679_10382189 | |||
| 1298 | Ga0207679_10678584 | |||
| 1299 | Ga0207667_10000001 | |||
| 1300 | Ga0207667_10000459 | |||
| 1301 | Ga0207667_10004045 | |||
| 1302 | Ga0207667_10006258 | |||
| 1303 | Ga0207667_10013903 | |||
| 1304 | Ga0207667_10043324 | |||
| 1305 | Ga0207667_10061872 | |||
| 1306 | Ga0207667_10088942 | |||
| 1307 | Ga0207651_11226016 | |||
| 1308 | Ga0207712_10000001 | |||
| 1309 | Ga0207712_10001025 | |||
| 1310 | Ga0207712_10024738 | |||
| 1311 | Ga0207712_10030145 | |||
| 1312 | Ga0207712_10135203 | |||
| 1313 | Ga0207668_10063881 | |||
| 1314 | Ga0207640_10000041 | |||
| 1315 | Ga0207640_10000086 | |||
| 1316 | Ga0207640_10019858 | |||
| 1317 | Ga0207640_10075647 | |||
| 1318 | Ga0207640_10133334 | |||
| 1319 | Ga0207640_10381697 | |||
| 1320 | Ga0207640_10702335 | |||
| 1321 | Ga0207640_11610826 | |||
| 1322 | Ga0207658_10001581 | |||
| 1323 | Ga0207703_10003358 | |||
| 1324 | Ga0207639_10000081 | |||
| 1325 | Ga0207639_10000495 | |||
| 1326 | Ga0207639_10000519 | |||
| 1327 | Ga0207639_10003480 | |||
| 1328 | Ga0207639_10023205 | |||
| 1329 | Ga0207639_10035055 | |||
| 1330 | Ga0207639_10039794 | |||
| 1331 | Ga0207639_11468050 | |||
| 1332 | Ga0207678_10016767 | |||
| 1333 | Ga0207678_10077255 | |||
| 1334 | Ga0207678_10131857 | |||
| 1335 | Ga0207678_10712641 | |||
| 1336 | Ga0207678_11016168 | |||
| 1337 | Ga0207702_10001212 | |||
| 1338 | Ga0207702_10013506 | |||
| 1339 | Ga0207702_10019567 | |||
| 1340 | Ga0207702_10164174 | |||
| 1341 | Ga0207702_11510606 | |||
| 1342 | Ga0207641_10061456 | |||
| 1343 | Ga0207648_11443073 | |||
| 1344 | Ga0207676_10000035 | |||
| 1345 | Ga0207676_10000373 | |||
| 1346 | Ga0207676_10075784 | |||
| 1347 | Ga0207674_10001593 | |||
| 1348 | Ga0207674_10003470 | |||
| 1349 | Ga0207674_10021996 | |||
| 1350 | Ga0207674_10192263 | |||
| 1351 | Ga0207674_10267776 | |||
| 1352 | Ga0207674_10349866 | |||
| 1353 | Ga0207674_11295992 | |||
| 1354 | Ga0207675_100445303 | |||
| 1355 | Ga0207698_10000054 | |||
| 1356 | Ga0207698_10000357 | |||
| 1357 | Ga0207698_10000574 | |||
| 1358 | Ga0207698_10003339 | |||
| 1359 | Ga0207698_10006940 | |||
| 1360 | Ga0207698_10015464 | |||
| 1361 | Ga0207698_10466173 | |||
| 1362 | Ga0207698_10670860 | |||
| 1363 | Ga0207698_10721355 | |||
| 1364 | Ga0207698_11820681 | |||
| 1365 | Ga0207698_12135818 | |||
| 1366 | Ga0209281_1006280 | |||
| 1367 | Ga0209281_1018975 | |||
| 1368 | Ga0209281_1056565 | |||
| 1369 | Ga0209998_10118785 | |||
| 1370 | Ga0209813_10000050 | |||
| 1371 | Ga0207428_10902368 | |||
| 1372 | Ga0268266_10339734 | |||
| 1373 | Ga0268266_10759408 | |||
| 1374 | Ga0268265_10000102 | |||
| 1375 | Ga0268265_10004378 | |||
| 1376 | Ga0268265_10406463 | |||
| 1377 | Ga0268264_10000006 | |||
| 1378 | Ga0268264_10007910 | |||
| 1379 | Ga0268264_10011655 | |||
| 1380 | Ga0268264_10011731 | |||
| 1381 | Ga0268264_10130223 | |||
| 1382 | Ga0268264_10178237 | |||
| 1383 | Ga0307517_10000875 | |||
| 1384 | Ga0307517_10034138 | |||
| 1385 | Ga0307517_10035187 | |||
| 1386 | Ga0307517_10051411 | |||
| 1387 | Ga0307517_10189109 | |||
| 1388 | Ga0307515_10300210 | |||
| 1389 | Ga0307513_10696404 | |||
| 1390 | Ga0307408_100000067 | |||
| 1391 | Ga0307510_10108145 | |||
| 1392 | Ga0307510_10402613 | |||
| 1393 | Ga0373948_0046403 | |||
| 1394 | Ga0373939_0002076 | |||
| 1395 | Ga0373942_0010804 | |||
| 1396 | Ga0373927_0225378 | |||
| 1397 | Ga0373925_1516906 | |||
| 1398 | Ga0395900_0947859 | |||
| 1399 | Ga0395905_1343653 | |||
| 1400 | Ga0436364_1318325 | |||
| 1401 | Ga0395901_0351250 | |||
| 1402 | Ga0395901_0447626 | |||
| 1403 | Ga0395901_0804351 | |||
| 1404 | Ga0436365_1317422 | |||
| 1405 | Ga0451791_0444167 | |||
| 1406 | Ga0451793_0529694 | |||
| 1407 | Ga0439458_0175962 | |||
| 1408 | Ga0466958_0426494 | |||
| 1409 | Ga0495627_000110 | |||
| 1410 | Ga0495627_001084 | |||
| 1411 | Ga0495627_046234 | |||
| 1412 | Ga0495629_0123606 | |||
| 1413 | Ga0495638_0045181 | |||
| 1414 | Ga0495583_0000120 | |||
| 1415 | Ga0495583_0048376 | |||
| 1416 | Ga0495616_0121668 | |||
| 1417 | Ga0495630_1163449 | |||
| 1418 | Ga0495632_0000112 | |||
| 1419 | Ga0495643_0057875 | |||
| 1420 | Ga0495648_0014058 | |||
| 1421 | Ga0495648_0409264 | |||
| 1422 | Ga0495648_0493063 | |||
| 1423 | Ga0495633_0017426 | |||
| 1424 | Ga0495668_0204805 | |||
| 1425 | Ga0495668_0330702 | |||
| 1426 | Ga0495625_0024031 | |||
| 1427 | Ga0495625_0133650 | |||
| 1428 | Ga0495625_0288452 | |||
| 1429 | Ga0495625_0788048 | |||
| 1430 | Ga0495670_0301335 | |||
| 1431 | Ga0495687_000200 | |||
| 1432 | Ga0495687_152993 | |||
| 1433 | Ga0495686_0000469 | |||
| 1434 | Ga0496100_1582580 | |||
| 1435 | Ga0496101_0053638 | |||
| 1436 | Ga0496101_1032371 | |||
| 1437 | Ga0496102_0257902 | |||
| 1438 | Ga0496102_1461328 | |||
| 1439 | Ga0496103_0006078 | |||
| 1440 | Ga0496106_0004035 | |||
| 1441 | Ga0496106_0037937 | |||
| 1442 | Ga0496106_0545266 | |||
| 1443 | Ga0496107_0005932 | |||
| 1444 | Ga0496112_0505880 | |||
| 1445 | Ga0496114_0481792 | |||
| 1446 | Ga0496115_0032342 | |||
| 1447 | Ga0496116_0206109 | |||
| 1448 | Ga0496116_0322665 | |||
| 1449 | Ga0496121_0119204 | |||
| 1450 | Ga0496121_0172138 | |||
| 1451 | Ga0496122_0171468 | |||
| 1452 | Ga0496124_0002739 | |||
| 1453 | Ga0496124_0063407 | |||
| 1454 | Ga0496125_0011563 | |||
| 1455 | Ga0496125_0071374 | |||
| 1456 | Ga0496125_0147720 | |||
| 1457 | Ga0496126_0011486 | |||
| 1458 | Ga0496126_0159368 | |||
| 1459 | Ga0495678_025306 | |||
| 1460 | Ga0495682_0069998 | |||
| 1461 | Ga0501033_0457313 | |||
| 1462 | Ga0501036_1006164 | |||
| 1463 | Ga0501036_1432990 | |||
| 1464 | Ga0501037_0981721 | |||
| 1465 | Ga0501038_1226926 | |||
| 1466 | Ga0501040_0363499 | |||
| 1467 | Ga0501040_1123383 | |||
| 1468 | Ga0501041_0630792 | |||
| 1469 | Ga0501042_0491677 | |||
| 1470 | Ga0501047_0091336 | |||
| 1471 | Ga0501047_0093898 | |||
| 1472 | Ga0501047_0723820 | |||
| 1473 | Ga0501047_1288199 | |||
| 1474 | Ga0501048_0725016 | |||
| 1475 | Ga0501070_0472701 | |||
| 1476 | Ga0501070_1382227 | |||
| 1477 | Ga0501071_0130701 | |||
| 1478 | Ga0501072_0604222 | |||
| 1479 | Ga0501075_0410518 | |||
| 1480 | Ga0501076_0394561 | |||
| 1481 | Ga0501077_0369111 | |||
| 1482 | Ga0501249_000397 | |||
| 1483 | Ga0501079_0713898 | |||
| 1484 | nmdc:mga03n38_190269_c1 | |||
| 1485 | nmdc:mga0yw44_177140_c1 | |||
| 1486 | nmdc:mga0k408_111219_c1 | |||
| 1487 | nmdc:mga0k408_307063_c1 | |||
| 1488 | nmdc:mga06z11_112384_c1 | |||
| 1489 | nmdc:mga06z11_54_c1 | |||
| 1490 | nmdc:mga04h51_32_c1 | |||
| 1491 | nmdc:mga07m45_28170_c1 | |||
| 1492 | nmdc:mga07m45_552709_c1 | |||
| 1493 | nmdc:mga07m45_746589_c1 | |||
| 1494 | nmdc:mga0qj67_1522703_c1 | |||
| 1495 | nmdc:mga06r32_915235_c1 | |||
| 1496 | Ga0500635_0335076 | |||
| 1497 | Ga0500643_000090 | |||
| 1498 | Ga0500643_000573 | |||
| 1499 | Ga0500644_0015454 | |||
| 1500 | Ga0500651_0021989 | |||
| 1501 | Ga0500651_0503868 | |||
| 1502 | Ga0500651_0683851 | |||
| 1503 | Ga0500555_000848 | |||
| 1504 | Ga0500595_057278 | |||
| 1505 | Ga0500559_0022081 | |||
| 1506 | Ga0500559_0025794 | |||
| 1507 | Ga0500559_0031307 | |||
| 1508 | Ga0500559_0064172 | |||
| 1509 | Ga0500577_0194816 | |||
| 1510 | Ga0500590_000019 | |||
| 1511 | Ga0500590_000177 | |||
| 1512 | Ga0500590_167656 | |||
| 1513 | Ga0500624_000002 | |||
| 1514 | Ga0500637_0122189 | |||
| 1515 | Ga0500570_008967 | |||
| 1516 | Ga0500570_009926 | |||
| 1517 | Ga0500596_036700 | |||
| 1518 | Ga0500661_011276 | |||
| 1519 | 2503204172 | |||
| 1520 | 2509118284 | |||
| 1521 | 2509373840 | |||
| 1522 | 2509398505 | |||
| 1523 | 2510319613 | |||
| 1524 | 2512934982 | |||
| 1525 | 2512963344 | |||
| 1526 | 2514034380 | |||
| 1527 | 2514590660 | |||
| 1528 | 2597815393 | |||
| 1529 | 2600202113 | |||
| 1530 | 2643731426 | |||
| 1531 | 2644042246 | |||
| 1532 | 2644394112 | |||
| 1533 | 2688600920 | |||
| 1534 | 2694631823 | |||
| 1535 | 2694639243 | |||
| 1536 | 2756677636 | |||
| 1537 | 2792751157 | |||
| 1538 | 2841737968 | |||
| 1539 | 2844002579 | |||
| 1540 | 2844011710 | |||
| 1541 | 2847674247 | |||
| 1542 | 2847688771 | |||
| 1543 | 2856317836 | |||
| 1544 | 2856321242 | |||
| 1545 | 2856322571 | |||
| 1546 | 2856340772 | |||
| 1547 | 2856344468 | |||
| 1548 | 2856356066 | |||
| 1549 | 2856363473 | |||
| 1550 | 2856365452 | |||
| 1551 | 2856366341 | |||
| 1552 | 2857353821 | |||
| 1553 | 2857356973 | |||
| 1554 | 2857357693 | |||
| 1555 | 2857369438 | |||
| 1556 | 2869166147 | |||
| 1557 | 2869170901 | |||
| 1558 | 2869236401 | |||
| 1559 | 2869238462 | |||
| 1560 | 2869243865 | |||
| 1561 | 2869250712 | |||
| 1562 | 2869258057 | |||
| 1563 | 2869265446 | |||
| 1564 | 2869277929 | |||
| 1565 | 2869281826 | |||
| 1566 | 2869282177 | |||
| 1567 | 2869286927 | |||
| 1568 | 2869288248 | |||
| 1569 | 2871434233 | |||
| 1570 | 2871438005 | |||
| 1571 | 2871450108 | |||
| 1572 | 2871455666 | |||
| 1573 | 2871464806 | |||
| 1574 | 2871467021 | |||
| 1575 | 2871478912 | |||
| 1576 | 2871486386 | |||
| 1577 | 2871490501 | |||
| 1578 | 2871498203 | |||
| 1579 | 2874105166 | |||
| 1580 | 2874111364 | |||
| 1581 | 2874113685 | |||
| 1582 | 2874121270 | |||
| 1583 | 2874124638 | |||
| 1584 | 2874133314 | |||
| 1585 | 2874140249 | |||
| 1586 | 2874145499 | |||
| 1587 | 2874147368 | |||
| 1588 | 2874151882 | |||
| 1589 | 2874156374 | |||
| 1590 | 2874159514 | |||
| 1591 | 2874166082 | |||
| 1592 | 2874172794 | |||
| 1593 | 2876366050 | |||
| 1594 | 2876374935 | |||
| 1595 | 2876388378 | |||
| 1596 | 2876396637 | |||
| 1597 | 2876406589 | |||
| 1598 | 2876412927 | |||
| 1599 | 2876414562 | |||
| 1600 | 2876417932 | |||
| 1601 | 2876423561 | |||
| 1602 | 2878041238 | |||
| 1603 | 2878734790 | |||
| 1604 | 2878735409 | |||
| 1605 | 2878741587 | |||
| 1606 | 2878747108 | |||
| 1607 | 2878749759 | |||
| 1608 | 2878759435 | |||
| 1609 | 2878762425 | |||
| 1610 | 2878769392 | |||
| 1611 | 2878779304 | |||
| 1612 | 2878782673 | |||
| 1613 | 2878789994 | |||
| 1614 | 2881149004 | |||
| 1615 | 2881154470 | |||
| 1616 | 2881160240 | |||
| 1617 | 2881163871 | |||
| 1618 | 2881165840 | |||
| 1619 | 2881849875 | |||
| 1620 | 2881853023 | |||
| 1621 | 2881854744 | |||
| 1622 | 2881863005 | |||
| 1623 | 2881868481 | |||
| 1624 | 2882636705 | |||
| 1625 | 2882915813 | |||
| 1626 | 2885305231 | |||
| 1627 | 2885315353 | |||
| 1628 | 2885324993 | |||
| 1629 | 2885330323 | |||
| 1630 | 2885337277 | |||
| 1631 | 2885343032 | |||
| 1632 | 2885356866 | |||
| 1633 | 2888337529 | |||
| 1634 | 2888349543 | |||
| 1635 | 2888351585 | |||
| 1636 | 2888352511 | |||
| 1637 | 2888354049 | |||
| 1638 | 2889015761 | |||
| 1639 | 2889016634 | |||
| 1640 | 2889019189 | |||
| 1641 | 2903500125 | |||
| 1642 | 2903505214 | |||
| 1643 | 2903518116 | |||
| 1644 | 2903518532 | |||
| 1645 | 2903526174 | |||
| 1646 | 2903530464 | |||
| 1647 | 2903543000 | |||
| 1648 | 2904660876 | |||
| 1649 | 2904663414 | |||
| 1650 | 2906309280 | |||
| 1651 | 2906310797 | |||
| 1652 | 2906326930 | |||
| 1653 | 2906330823 | |||
| 1654 | 2906359911 | |||
| 1655 | 2906360223 | |||
| 1656 | 2906368083 | |||
| 1657 | 2906373312 | |||
| 1658 | 2906384277 | |||
| 1659 | 2906391927 | |||
| 1660 | 2906398804 | |||
| 1661 | 2906404140 | |||
| 1662 | 2906408653 | |||
| 1663 | 2906417901 | |||
| 1664 | 2906429636 | |||
| 1665 | 2919710911 | |||
| 1666 | 2919712264 | |||
| 1667 | 2922132368 | |||
| 1668 | 2922152596 | |||
| 1669 | 2922160505 | |||
| 1670 | 2922177024 | |||
| 1671 | 2922183207 | |||
| 1672 | 2922192522 | |||
| 1673 | 2922193721 | |||
| 1674 | 2924723424 | |||
| 1675 | 2924724471 | |||
| 1676 | 2924732043 | |||
| 1677 | 2924739011 | |||
| 1678 | 2924742308 | |||
| 1679 | 2924754157 | |||
| 1680 | 2924758025 | |||
| 1681 | 2924766596 | |||
| 1682 | 2924779269 | |||
| 1683 | 2924790572 | |||
| 1684 | 2937813639 | |||
| 1685 | 2937817624 | |||
| 1686 | 2937829432 | |||
| 1687 | 2937837277 | |||
| 1688 | 2937852811 | |||
| 1689 | 2937861911 | |||
| 1690 | 2937869401 | |||
| 1691 | 2937878624 | |||
| 1692 | 2937881446 | |||
| 1693 | 2937881557 | |||
| 1694 | 2937892655 | |||
| 1695 | 2937976760 | |||
| 1696 | 2937979307 | |||
| 1697 | 2937981980 | |||
| 1698 | 2937996853 | |||
| 1699 | 2958036722 | |||
| 1700 | 2958038018 | |||
| 1701 | 2958046873 | |||
| 1702 | 2958047795 | |||
| 1703 | 2958049332 | |||
| 1704 | 2958068575 | |||
| 1705 | 2958075947 | |||
| 1706 | 2958085777 | |||
| 1707 | 2958087997 | |||
| 1708 | 2958088687 | |||
| 1709 | 2958097568 | |||
| 1710 | 2958105160 | |||
| 1711 | 2958105456 | |||
| 1712 | 2958114283 | |||
| 1713 | 2958115307 | |||
| 1714 | 2958121831 | |||
| 1715 | 2958128161 | |||
| 1716 | 2958131327 | |||
| 1717 | 2958132650 | |||
| 1718 | 2958142269 | |||
| 1719 | 2958149297 | |||
| 1720 | 2958149700 | |||
| 1721 | 2958164198 | |||
| 1722 | 2958167321 | |||
| 1723 | 2958177041 | |||
| 1724 | 2958177341 | |||
| 1725 | 2958181152 | |||
| 1726 | 2958182464 | |||
| 1727 | 2961078990 | |||
| 1728 | 2961080309 | |||
| 1729 | 2961116035 | |||
| 1730 | 2961118441 | |||
| 1731 | 2961131642 | |||
| 1732 | 2961142160 | |||
| 1733 | 2961165794 | |||
| 1734 | 2961177622 | |||
| 1735 | 2961186984 | |||
| 1736 | 2963650642 | |||
| 1737 | 2965020613 | |||
| 1738 | 2965039763 | |||
| 1739 | 2965045993 | |||
| 1740 | 2965055387 | |||
| 1741 | 2965066862 | |||
| 1742 | 2965067053 | |||
| 1743 | 2965094391 | |||
| 1744 | 2965110697 | |||
| 1745 | 2965114241 | |||
| 1746 | 2965120146 | |||
| 1747 | 2965120430 | |||
| 1748 | 2967997279 | |||
| 1749 | 2968010599 | |||
| 1750 | 2968021405 | |||
| 1751 | 2968022517 | |||
| 1752 | 2968094330 | |||
| 1753 | 2968112020 | |||
| 1754 | 2968114502 | |||
| 1755 | 2968123915 | |||
| 1756 | 2968131017 | |||
| 1757 | 2968145914 | |||
| 1758 | 2968174193 | |||
| 1759 | 2970475101 | |||
| 1760 | 2970476510 | |||
| 1761 | 2970491273 | |||
| 1762 | 2970510300 | |||
| 1763 | 2970513908 | |||
| 1764 | 2970528878 | |||
| 1765 | 2970537084 | |||
| 1766 | 2970542421 | |||
| 1767 | 2970550295 | |||
| 1768 | 2970557283 | |||
| 1769 | 2970596431 | |||
| 1770 | 2970596783 | |||
| 1771 | 2970623788 | |||
| 1772 | 2970633089 | |||
| 1773 | 2977827968 | |||
| 1774 | 2977835351 | |||
| 1775 | 2977843968 | |||
| 1776 | 2977847912 | |||
| 1777 | 2977856134 | |||
| 1778 | 2977860012 | |||
| 1779 | 2977870909 | |||
| 1780 | 2977879074 | |||
| 1781 | 2977898730 | |||
| 1782 | 2977913092 | |||
| 1783 | 2977920515 | |||
| 1784 | 2977925414 | |||
| 1785 | 2977940718 | |||
| 1786 | 2977946195 | |||
| 1787 | 2977950186 | |||
| 1788 | 2977957200 | |||
| 1789 | 2977958711 | |||
| 1790 | 2977975421 | |||
| 1791 | 2977976099 | |||
| 1792 | 2977991414 | |||
| 1793 | 2979715540 | |||
| 1794 | 2979715703 | |||
| 1795 | 2979744281 | |||
| 1796 | 2979745801 | |||
| 1797 | 2979750843 | |||
| 1798 | 2979766526 | |||
| 1799 | 2979777799 | |||
| 1800 | 2979781076 | |||
| 1801 | 2979794781 | |||
| 1802 | 2979815173 | |||
| 1803 | 2987642767 | |||
| 1804 | 2987644254 | |||
| 1805 | 2987645196 | |||
| 1806 | 2987649599 | |||
| 1807 | 2987656092 | |||
| 1808 | 2987656909 | |||
| 1809 | 2987661800 | |||
| 1810 | 2987670928 | |||
| 1811 | 2987676131 | |||
| 1812 | 2996345440 | |||
| 1813 | 2996353473 | |||
| 1814 | 2996393350 | |||
| 1815 | 3000139198 | |||
| 1816 | 3004190849 | |||
| 1817 | 3004203485 | |||
| 1818 | 3004206568 | |||
| 1819 | 3004208403 | |||
| 1820 | 3004214246 | |||
| 1821 | 3004222673 | |||
| 1822 | 3004236356 | |||
| 1823 | 3004239952 | |||
| 1824 | 3004244700 | |||
| 1825 | 3004251925 | |||
| 1826 | 3004273615 | |||
| 1827 | 3004280155 | |||
| 1828 | 3004289870 | |||
| 1829 | 3004296948 | |||
| 1830 | 637078199 | |||
| 1831 | 649875386 | |||
| 1832 | 8002287203 | |||
| 1833 | 8004306213 | |||
| 1834 | 8004319318 | |||
| 1835 | 8004369041 | |||
| 1836 | 8004380944 | |||
| 1837 | 8004388970 | |||
| 1838 | 8004390035 | |||
| 1839 | 8004398077 | |||
| 1840 | 8004446850 | |||
| 1841 | 8004636553 | |||
| 1842 | 8004703440 | |||
| 1843 | 8004712674 | |||
| 1844 | 8004714064 | |||
| 1845 | 8004715539 | |||
| 1846 | 8004718432 | |||
| 1847 | 8004728374 | |||
| 1848 | 8055623986 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tt9-assembly2.cif.gz_C | structure of the c-terminal spoa domain of shigella flexneri spa33 | 0.563 | 24 | 72 |
| 5hut-assembly1.cif.gz_A | structure of candida albicans trehalose-6-phosphate synthase in complex with udp-glucose | 0.5502 | 3 | 23 |
| 1o6a-assembly1.cif.gz_A | crystal structure of a c-terminal fragment of the putative flagellar motor switch protein flin (tm0680) from thermotoga maritima at 1.85 a resolution | 0.5273 | 22 | 77 |
| 1yab-assembly2.cif.gz_B | structure of t. maritima flin flagellar rotor protein | 0.5263 | 24 | 77 |
| 1o6a-assembly1.cif.gz_B | crystal structure of a c-terminal fragment of the putative flagellar motor switch protein flin (tm0680) from thermotoga maritima at 1.85 a resolution | 0.5207 | 24 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5ANJ0_28_112_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.6298 | 37 | 72 | 3.30.200.20 |
| af_A0A0P0X457_113_319_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.6235 | 53 | 100 | 2.120.10.80 |
| af_Q7XZV4_359_445_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.6205 | 53 | 87 | 3.30.160.20 |
| af_Q21764_3_113_3.30.505.10 | Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain | 0.5565 | 53 | 99 | 3.30.505.10 |
| 3tfyA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.5417 | 43 | 79 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530B8C4-F1-model_v4 | deleted | 0.9498 | 29 | 104 |
|
| AF-A0A530QZT3-F1-model_v4 | DUF736 family protein | 0.9245 | 19 | 104 |
|
| AF-A0A440Y3V5-F1-model_v4 | DUF736 family protein | 0.8975 | 19 | 86 |
|
| AF-A0A530B8C4-F1-model_v4 | deleted | 0.8935 | 29 | 104 |
|
| AF-A0A062V8W0-F1-model_v4 | DUF736 domain-containing protein | 0.881 | 53 | 104 |
|