F485889
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 925 | 379 | 892 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300025933|Ga0207706_10032813|Ga0207706_100328134 |
| Length | 372 |
| Sequence | MAATDQAGAHDVGGSQAGPAGDPLGSWREGATKQAVLDFVQRVTTEGGSDAVPPEERVAVFDNDGTLWCEKPMPIQLDFVLRRLVVMADQDPALRTRQPWQAAYTRDYGWLGEVITKHYHGDDSELPVLAAGVLQAFAGVTVEDFEAQADRFLRTTQHPTLGRPYLACGYAPMVELLGHLAANGFRNYIASGGGRDFMRPVSQDMYGVPRQRVIGSSVSLAYQQDEHGGRIVHQPELDVLDDGPAKPVRIWSRVGRRPLLAAGNSNGDIPMLQFVEQPGRPCLRLLVVHDDPDREFDYLVGAEQALQLANTNDWTVVSIKRWTPQSSTIKARGRLDLAVTNPARDMTPVVTGSTSRGDQEALVIRSGSSERP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 3 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 4 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 5 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 6 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 7 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 8 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 9 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 10 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 11 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 12 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 13 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 14 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 15 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 16 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 17 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 18 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 19 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 20 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 21 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 22 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 23 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 24 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 25 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 26 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 27 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 28 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 29 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 200 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 240 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 241 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 242 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 246 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 371 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 375 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 376 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 377 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 378 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 379 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.22 |
| Metatranscriptomes | 0.22 |
| Isolates | 3.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 2.92 |
| Rhizoplane | 8.65 |
| Rhizosphere | 86.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10013614 | 3300003373 | Bacteria | 2091 |
| 2 | JGI25407J50210_10017012 | 3300003373 | Bacteria | 1886 |
| 3 | Ga0070683_100001559 | 3300005329 | Bacteria | 17711 |
| 4 | Ga0070683_100151132 | 3300005329 | Bacteria | 2202 |
| 5 | Ga0070677_10086337 | 3300005333 | Bacteria | 1355 |
| 6 | Ga0068869_100025995 | 3300005334 | Bacteria | 4071 |
| 7 | Ga0070666_10034735 | 3300005335 | Bacteria | 3341 |
| 8 | Ga0070666_10063153 | 3300005335 | Bacteria | 2510 |
| 9 | Ga0070680_100092341 | 3300005336 | Bacteria | 2506 |
| 10 | Ga0070680_100097269 | 3300005336 | Bacteria | 2441 |
| 11 | Ga0070682_100039364 | 3300005337 | Bacteria | 2905 |
| 12 | Ga0070682_100341295 | 3300005337 | Bacteria | 1113 |
| 13 | Ga0068868_100043185 | 3300005338 | Bacteria | 3521 |
| 14 | Ga0070660_100019890 | 3300005339 | Bacteria | 4925 |
| 15 | Ga0070691_10094643 | 3300005341 | Bacteria | 1477 |
| 16 | Ga0070668_100115231 | 3300005347 | Bacteria | 2142 |
| 17 | Ga0070668_100412954 | 3300005347 | Bacteria | 1154 |
| 18 | Ga0070669_100169127 | 3300005353 | Bacteria | 1703 |
| 19 | Ga0070675_100001430 | 3300005354 | Bacteria | 17528 |
| 20 | Ga0070675_100003184 | 3300005354 | Bacteria | 12423 |
| 21 | Ga0070675_100035588 | 3300005354 | Bacteria | 4046 |
| 22 | Ga0070671_100032512 | 3300005355 | Bacteria | 4313 |
| 23 | Ga0070671_100207550 | 3300005355 | Bacteria | 1661 |
| 24 | Ga0070671_100253987 | 3300005355 | Bacteria | 1493 |
| 25 | Ga0070671_100410209 | 3300005355 | Bacteria | 1159 |
| 26 | Ga0070674_100000263 | 3300005356 | Bacteria | 26068 |
| 27 | Ga0070674_100062824 | 3300005356 | Bacteria | 2597 |
| 28 | Ga0070673_100039134 | 3300005364 | Bacteria | 3627 |
| 29 | Ga0070673_100113924 | 3300005364 | Bacteria | 2246 |
| 30 | Ga0070673_100218736 | 3300005364 | Bacteria | 1648 |
| 31 | Ga0070673_100266611 | 3300005364 | Bacteria | 1498 |
| 32 | Ga0070688_100000851 | 3300005365 | Bacteria | 15140 |
| 33 | Ga0070688_100015231 | 3300005365 | Unclassified | 4369 |
| 34 | Ga0070688_100064309 | 3300005365 | Bacteria | 2328 |
| 35 | Ga0070659_100040250 | 3300005366 | Bacteria | 3651 |
| 36 | Ga0070659_100062092 | 3300005366 | Bacteria | 2953 |
| 37 | Ga0070659_100114974 | 3300005366 | Bacteria | 2174 |
| 38 | Ga0070659_100222707 | 3300005366 | Bacteria | 1557 |
| 39 | Ga0070659_100361252 | 3300005366 | Bacteria | 1220 |
| 40 | Ga0070667_100010285 | 3300005367 | Bacteria | 7730 |
| 41 | Ga0070667_100055334 | 3300005367 | Bacteria | 3351 |
| 42 | Ga0070667_100110329 | 3300005367 | Bacteria | 2385 |
| 43 | Ga0070667_100262191 | 3300005367 | Unclassified | 1548 |
| 44 | Ga0070709_10230513 | 3300005434 | Bacteria | 1325 |
| 45 | Ga0070714_100168347 | 3300005435 | Bacteria | 1987 |
| 46 | Ga0070713_100273355 | 3300005436 | Bacteria | 1548 |
| 47 | Ga0070710_10084035 | 3300005437 | Bacteria | 1864 |
| 48 | Ga0070710_10156626 | 3300005437 | Bacteria | 1409 |
| 49 | Ga0070701_10011014 | 3300005438 | Bacteria | 4023 |
| 50 | Ga0070711_100153506 | 3300005439 | Bacteria | 1739 |
| 51 | Ga0070705_100024914 | 3300005440 | Bacteria | 3236 |
| 52 | Ga0070705_100109695 | 3300005440 | Bacteria | 1760 |
| 53 | Ga0070700_100124059 | 3300005441 | Bacteria | 1734 |
| 54 | Ga0070694_100011625 | 3300005444 | Bacteria | 5450 |
| 55 | Ga0070663_100209428 | 3300005455 | Bacteria | 1526 |
| 56 | Ga0070678_100021755 | 3300005456 | Bacteria | 4236 |
| 57 | Ga0070678_100181643 | 3300005456 | Bacteria | 1723 |
| 58 | Ga0070678_100187495 | 3300005456 | Bacteria | 1698 |
| 59 | Ga0070662_100001886 | 3300005457 | Bacteria | 12852 |
| 60 | Ga0070662_100003441 | 3300005457 | Bacteria | 9866 |
| 61 | Ga0070662_100105553 | 3300005457 | Bacteria | 2139 |
| 62 | Ga0070681_10002312 | 3300005458 | Bacteria | 17416 |
| 63 | Ga0070681_10147739 | 3300005458 | Bacteria | 2279 |
| 64 | Ga0068867_100004528 | 3300005459 | Bacteria | 9772 |
| 65 | Ga0070685_10008294 | 3300005466 | Bacteria | 5334 |
| 66 | Ga0070685_10010416 | 3300005466 | Bacteria | 4831 |
| 67 | Ga0070685_10121091 | 3300005466 | Bacteria | 1625 |
| 68 | Ga0070685_10149147 | 3300005466 | Bacteria | 1480 |
| 69 | Ga0070707_100390456 | 3300005468 | Bacteria | 1352 |
| 70 | Ga0070684_100123078 | 3300005535 | Bacteria | 2334 |
| 71 | Ga0070684_100302479 | 3300005535 | Bacteria | 1468 |
| 72 | Ga0070684_100380466 | 3300005535 | Bacteria | 1300 |
| 73 | Ga0068853_100052396 | 3300005539 | Bacteria | 3516 |
| 74 | Ga0070672_100062994 | 3300005543 | Bacteria | 2928 |
| 75 | Ga0070672_100092950 | 3300005543 | Bacteria | 2436 |
| 76 | Ga0070686_100014934 | 3300005544 | Bacteria | 4485 |
| 77 | Ga0070686_100086753 | 3300005544 | Bacteria | 2084 |
| 78 | Ga0070686_100255566 | 3300005544 | Bacteria | 1282 |
| 79 | Ga0070696_100083959 | 3300005546 | Bacteria | 2259 |
| 80 | Ga0070696_100273590 | 3300005546 | Bacteria | 1285 |
| 81 | Ga0070693_100023508 | 3300005547 | Bacteria | 3295 |
| 82 | Ga0070665_100004780 | 3300005548 | Bacteria | 14100 |
| 83 | Ga0070665_100066585 | 3300005548 | Bacteria | 3613 |
| 84 | Ga0070704_100038038 | 3300005549 | Bacteria | 3293 |
| 85 | Ga0068855_100178450 | 3300005563 | Bacteria | 2402 |
| 86 | Ga0070664_100017677 | 3300005564 | Bacteria | 5855 |
| 87 | Ga0070664_100056116 | 3300005564 | Bacteria | 3346 |
| 88 | Ga0070664_100063892 | 3300005564 | Bacteria | 3139 |
| 89 | Ga0070664_100085440 | 3300005564 | Bacteria | 2725 |
| 90 | Ga0068857_100130578 | 3300005577 | Bacteria | 2266 |
| 91 | Ga0068854_100006428 | 3300005578 | Bacteria | 7474 |
| 92 | Ga0068854_100177441 | 3300005578 | Bacteria | 1662 |
| 93 | Ga0068856_100011064 | 3300005614 | Bacteria | 8760 |
| 94 | Ga0068856_100069184 | 3300005614 | Bacteria | 3490 |
| 95 | Ga0070702_100001102 | 3300005615 | Bacteria | 10830 |
| 96 | Ga0070702_100067915 | 3300005615 | Bacteria | 2096 |
| 97 | Ga0068859_100001255 | 3300005617 | Bacteria | 25905 |
| 98 | Ga0068859_100003183 | 3300005617 | Bacteria | 16694 |
| 99 | Ga0068859_100388711 | 3300005617 | Bacteria | 1491 |
| 100 | Ga0068864_100000682 | 3300005618 | Bacteria | 28462 |
| 101 | Ga0068864_100006902 | 3300005618 | Bacteria | 9309 |
| 102 | Ga0068864_100205776 | 3300005618 | Bacteria | 1810 |
| 103 | Ga0068866_10001635 | 3300005718 | Bacteria | 9455 |
| 104 | Ga0068861_100008513 | 3300005719 | Bacteria | 7063 |
| 105 | Ga0068861_100079131 | 3300005719 | Bacteria | 2569 |
| 106 | Ga0068863_100004645 | 3300005841 | Bacteria | 13539 |
| 107 | Ga0068863_100256446 | 3300005841 | Bacteria | 1690 |
| 108 | Ga0068863_100540856 | 3300005841 | Bacteria | 1149 |
| 109 | Ga0068858_100030123 | 3300005842 | Bacteria | 5040 |
| 110 | Ga0068858_100113135 | 3300005842 | Bacteria | 2535 |
| 111 | Ga0068858_100121950 | 3300005842 | Bacteria | 2438 |
| 112 | Ga0068860_100003074 | 3300005843 | Bacteria | 17251 |
| 113 | Ga0068862_100155996 | 3300005844 | Bacteria | 2035 |
| 114 | Ga0081455_10000949 | 3300005937 | Bacteria | 37086 |
| 115 | Ga0081455_10002610 | 3300005937 | Bacteria | 21361 |
| 116 | Ga0081455_10002826 | 3300005937 | Bacteria | 20450 |
| 117 | Ga0081455_10004215 | 3300005937 | Bacteria | 16209 |
| 118 | Ga0081455_10006017 | 3300005937 | Bacteria | 13145 |
| 119 | Ga0081455_10017049 | 3300005937 | Bacteria | 6981 |
| 120 | Ga0081538_10000738 | 3300005981 | Bacteria | 35697 |
| 121 | Ga0081538_10001529 | 3300005981 | Bacteria | 23732 |
| 122 | Ga0081540_1000278 | 3300005983 | Bacteria | 53271 |
| 123 | Ga0081540_1000467 | 3300005983 | Bacteria | 39985 |
| 124 | Ga0081540_1002683 | 3300005983 | Bacteria | 14475 |
| 125 | Ga0081540_1069182 | 3300005983 | Bacteria | 1642 |
| 126 | Ga0081539_10021607 | 3300005985 | Bacteria | 4289 |
| 127 | Ga0070717_10054332 | 3300006028 | Bacteria | 3303 |
| 128 | Ga0075365_10007515 | 3300006038 | Bacteria | 6113 |
| 129 | Ga0075432_10000401 | 3300006058 | Bacteria | 12654 |
| 130 | Ga0070712_100061217 | 3300006175 | Bacteria | 2658 |
| 131 | Ga0097621_100010095 | 3300006237 | Bacteria | 6889 |
| 132 | Ga0097621_100029164 | 3300006237 | Bacteria | 4356 |
| 133 | Ga0097621_100266877 | 3300006237 | Bacteria | 1503 |
| 134 | Ga0068871_100005312 | 3300006358 | Bacteria | 9023 |
| 135 | Ga0068871_100035019 | 3300006358 | Bacteria | 3987 |
| 136 | Ga0075428_100000974 | 3300006844 | Bacteria | 30272 |
| 137 | Ga0075428_100011053 | 3300006844 | Bacteria | 10040 |
| 138 | Ga0075430_100021693 | 3300006846 | Bacteria | 5458 |
| 139 | Ga0075430_100025130 | 3300006846 | Bacteria | 5066 |
| 140 | Ga0075430_100028490 | 3300006846 | Bacteria | 4744 |
| 141 | Ga0075430_100039143 | 3300006846 | Bacteria | 4015 |
| 142 | Ga0075431_100001516 | 3300006847 | Bacteria | 21529 |
| 143 | Ga0075431_100001616 | 3300006847 | Bacteria | 21032 |
| 144 | Ga0075431_100007887 | 3300006847 | Bacteria | 10608 |
| 145 | Ga0075431_100048484 | 3300006847 | Bacteria | 4381 |
| 146 | Ga0075433_10000223 | 3300006852 | Bacteria | 32380 |
| 147 | Ga0075433_10016389 | 3300006852 | Bacteria | 6106 |
| 148 | Ga0075433_10155044 | 3300006852 | Bacteria | 2038 |
| 149 | Ga0075434_100000419 | 3300006871 | Bacteria | 31470 |
| 150 | Ga0075434_100015794 | 3300006871 | Bacteria | 7249 |
| 151 | Ga0075434_100085028 | 3300006871 | Bacteria | 3162 |
| 152 | Ga0075434_100248517 | 3300006871 | Bacteria | 1798 |
| 153 | Ga0075434_100533583 | 3300006871 | Bacteria | 1194 |
| 154 | Ga0075429_100001011 | 3300006880 | Bacteria | 22404 |
| 155 | Ga0068865_100004144 | 3300006881 | Bacteria | 8716 |
| 156 | Ga0068865_100005141 | 3300006881 | Bacteria | 7923 |
| 157 | Ga0068865_100009098 | 3300006881 | Bacteria | 6146 |
| 158 | Ga0068865_100014592 | 3300006881 | Bacteria | 4996 |
| 159 | Ga0068865_100068637 | 3300006881 | Bacteria | 2506 |
| 160 | Ga0068865_100260418 | 3300006881 | Bacteria | 1373 |
| 161 | Ga0075436_100004817 | 3300006914 | Bacteria | 9274 |
| 162 | Ga0097620_100001255 | 3300006931 | Bacteria | 25905 |
| 163 | Ga0097620_100003183 | 3300006931 | Bacteria | 16694 |
| 164 | Ga0097620_100388637 | 3300006931 | Bacteria | 1491 |
| 165 | Ga0075435_100013474 | 3300007076 | Bacteria | 6084 |
| 166 | Ga0075435_100022118 | 3300007076 | Bacteria | 4902 |
| 167 | Ga0105240_10066698 | 3300009093 | Bacteria | 4463 |
| 168 | Ga0111539_10000164 | 3300009094 | Bacteria | 76464 |
| 169 | Ga0111539_10003119 | 3300009094 | Bacteria | 21952 |
| 170 | Ga0111539_10005251 | 3300009094 | Bacteria | 16780 |
| 171 | Ga0111539_10054098 | 3300009094 | Bacteria | 4777 |
| 172 | Ga0111539_10059966 | 3300009094 | Bacteria | 4510 |
| 173 | Ga0111539_10073120 | 3300009094 | Bacteria | 4042 |
| 174 | Ga0111539_10150236 | 3300009094 | Bacteria | 2727 |
| 175 | Ga0111539_10265214 | 3300009094 | Bacteria | 1999 |
| 176 | Ga0111539_10324273 | 3300009094 | Bacteria | 1793 |
| 177 | Ga0111539_10558400 | 3300009094 | Bacteria | 1333 |
| 178 | Ga0105245_10016616 | 3300009098 | Bacteria | 6423 |
| 179 | Ga0105245_10029247 | 3300009098 | Bacteria | 4867 |
| 180 | Ga0105245_10034003 | 3300009098 | Bacteria | 4518 |
| 181 | Ga0105245_10053297 | 3300009098 | Bacteria | 3630 |
| 182 | Ga0105245_10058164 | 3300009098 | Bacteria | 3479 |
| 183 | Ga0105245_10266363 | 3300009098 | Bacteria | 1669 |
| 184 | Ga0105245_10277933 | 3300009098 | Bacteria | 1636 |
| 185 | Ga0105245_10419749 | 3300009098 | Bacteria | 1341 |
| 186 | Ga0105247_10078426 | 3300009101 | Bacteria | 2077 |
| 187 | Ga0105247_10144276 | 3300009101 | Bacteria | 1563 |
| 188 | Ga0114129_10001975 | 3300009147 | Bacteria | 28045 |
| 189 | Ga0114129_10026801 | 3300009147 | Bacteria | 8161 |
| 190 | Ga0114129_10060297 | 3300009147 | Bacteria | 5305 |
| 191 | Ga0114129_10090489 | 3300009147 | Bacteria | 4242 |
| 192 | Ga0114129_10110255 | 3300009147 | Bacteria | 3799 |
| 193 | Ga0114129_10267198 | 3300009147 | Bacteria | 2290 |
| 194 | Ga0114129_10332899 | 3300009147 | Bacteria | 2015 |
| 195 | Ga0114129_10446343 | 3300009147 | Bacteria | 1697 |
| 196 | Ga0114129_10630845 | 3300009147 | Bacteria | 1385 |
| 197 | Ga0105243_10003664 | 3300009148 | Bacteria | 12350 |
| 198 | Ga0105243_10006906 | 3300009148 | Bacteria | 8748 |
| 199 | Ga0105243_10009290 | 3300009148 | Bacteria | 7502 |
| 200 | Ga0105243_10028174 | 3300009148 | Bacteria | 4310 |
| 201 | Ga0105243_10034486 | 3300009148 | Bacteria | 3918 |
| 202 | Ga0105243_10041016 | 3300009148 | Bacteria | 3619 |
| 203 | Ga0105243_10060504 | 3300009148 | Bacteria | 3026 |
| 204 | Ga0105243_10069591 | 3300009148 | Bacteria | 2839 |
| 205 | Ga0105243_10445690 | 3300009148 | Bacteria | 1213 |
| 206 | Ga0105242_10000297 | 3300009176 | Bacteria | 39548 |
| 207 | Ga0105242_10053758 | 3300009176 | Bacteria | 3290 |
| 208 | Ga0105242_10496598 | 3300009176 | Bacteria | 1160 |
| 209 | Ga0105248_10000630 | 3300009177 | Bacteria | 40000 |
| 210 | Ga0105248_10010673 | 3300009177 | Bacteria | 10133 |
| 211 | Ga0105248_10038207 | 3300009177 | Bacteria | 5372 |
| 212 | Ga0105248_10055105 | 3300009177 | Bacteria | 4459 |
| 213 | Ga0105248_10157208 | 3300009177 | Bacteria | 2565 |
| 214 | Ga0105248_10191101 | 3300009177 | Bacteria | 2307 |
| 215 | Ga0105248_10299218 | 3300009177 | Bacteria | 1812 |
| 216 | Ga0105248_10364462 | 3300009177 | Bacteria | 1627 |
| 217 | Ga0105248_10382060 | 3300009177 | Bacteria | 1586 |
| 218 | Ga0105238_10005657 | 3300009551 | Bacteria | 12353 |
| 219 | Ga0105238_10124752 | 3300009551 | Bacteria | 2554 |
| 220 | Ga0105238_10261711 | 3300009551 | Bacteria | 1709 |
| 221 | Ga0105249_10115320 | 3300009553 | Bacteria | 2545 |
| 222 | Ga0105249_10162184 | 3300009553 | Bacteria | 2161 |
| 223 | Ga0105239_10004153 | 3300010375 | Bacteria | 17392 |
| 224 | Ga0105239_10108509 | 3300010375 | Bacteria | 3075 |
| 225 | Ga0105239_10515830 | 3300010375 | Unclassified | 1360 |
| 226 | Ga0105246_10031281 | 3300011119 | Bacteria | 3521 |
| 227 | Ga0105246_10092722 | 3300011119 | Bacteria | 2180 |
| 228 | Ga0105246_10096432 | 3300011119 | Bacteria | 2144 |
| 229 | Ga0105246_10151560 | 3300011119 | Bacteria | 1755 |
| 230 | Ga0157338_1000636 | 3300012515 | Bacteria | 2171 |
| 231 | Ga0157373_10028612 | 3300013100 | Bacteria | 4020 |
| 232 | Ga0157371_10029425 | 3300013102 | Bacteria | 3973 |
| 233 | Ga0157374_10012881 | 3300013296 | Bacteria | 7285 |
| 234 | Ga0157378_10000780 | 3300013297 | Bacteria | 29624 |
| 235 | Ga0157378_10354040 | 3300013297 | Bacteria | 1435 |
| 236 | Ga0163162_10011679 | 3300013306 | Bacteria | 8564 |
| 237 | Ga0163162_10074587 | 3300013306 | Bacteria | 3451 |
| 238 | Ga0163162_10136701 | 3300013306 | Bacteria | 2562 |
| 239 | Ga0163162_10253056 | 3300013306 | Bacteria | 1893 |
| 240 | Ga0157372_10046853 | 3300013307 | Bacteria | 4801 |
| 241 | Ga0157372_10310406 | 3300013307 | Bacteria | 1836 |
| 242 | Ga0157372_10501017 | 3300013307 | Bacteria | 1416 |
| 243 | Ga0157375_10002770 | 3300013308 | Bacteria | 15166 |
| 244 | Ga0157375_10047524 | 3300013308 | Bacteria | 4192 |
| 245 | Ga0157375_10109686 | 3300013308 | Plasmid | 2856 |
| 246 | Ga0157375_10115108 | 3300013308 | Bacteria | 2792 |
| 247 | Ga0157375_10146736 | 3300013308 | Bacteria | 2490 |
| 248 | Ga0157375_10264716 | 3300013308 | Bacteria | 1881 |
| 249 | Ga0157375_10273909 | 3300013308 | Bacteria | 1850 |
| 250 | Ga0157375_10387162 | 3300013308 | Bacteria | 1565 |
| 251 | Ga0163163_10025119 | 3300014325 | Bacteria | 5677 |
| 252 | Ga0163163_10029108 | 3300014325 | Bacteria | 5311 |
| 253 | Ga0163163_10052907 | 3300014325 | Bacteria | 4007 |
| 254 | Ga0163163_10395601 | 3300014325 | Bacteria | 1440 |
| 255 | Ga0163163_10419216 | 3300014325 | Bacteria | 1397 |
| 256 | Ga0157380_10069332 | 3300014326 | Bacteria | 2845 |
| 257 | Ga0157380_10087027 | 3300014326 | Bacteria | 2568 |
| 258 | Ga0182008_10137369 | 3300014497 | Bacteria | 1221 |
| 259 | Ga0157377_10215609 | 3300014745 | Unclassified | 1226 |
| 260 | Ga0157379_10004195 | 3300014968 | Bacteria | 12302 |
| 261 | Ga0157379_10019662 | 3300014968 | Bacteria | 5967 |
| 262 | Ga0157376_10024352 | 3300014969 | Unclassified | 4750 |
| 263 | Ga0157376_10053083 | 3300014969 | Bacteria | 3373 |
| 264 | Ga0157376_10076137 | 3300014969 | Bacteria | 2866 |
| 265 | Ga0157376_10152912 | 3300014969 | Bacteria | 2083 |
| 266 | Ga0157376_10181504 | 3300014969 | Bacteria | 1924 |
| 267 | Ga0157376_10181951 | 3300014969 | Bacteria | 1922 |
| 268 | Ga0163161_10264549 | 3300017792 | Bacteria | 1344 |
| 269 | Ga0206356_11443902 | 3300020070 | Bacteria | 1821 |
| 270 | Ga0206354_11259363 | 3300020081 | Bacteria | 2562 |
| 271 | Ga0207653_10001129 | 3300025885 | Bacteria | 8732 |
| 272 | Ga0207692_10099733 | 3300025898 | Bacteria | 1592 |
| 273 | Ga0207642_10000270 | 3300025899 | Bacteria | 15603 |
| 274 | Ga0207688_10004267 | 3300025901 | Bacteria | 7795 |
| 275 | Ga0207688_10011591 | 3300025901 | Bacteria | 4796 |
| 276 | Ga0207680_10041617 | 3300025903 | Bacteria | 2683 |
| 277 | Ga0207647_10145771 | 3300025904 | Bacteria | 1386 |
| 278 | Ga0207699_10045154 | 3300025906 | Bacteria | 2570 |
| 279 | Ga0207699_10100289 | 3300025906 | Bacteria | 1836 |
| 280 | Ga0207645_10001002 | 3300025907 | Bacteria | 23327 |
| 281 | Ga0207645_10066791 | 3300025907 | Bacteria | 2299 |
| 282 | Ga0207643_10012769 | 3300025908 | Bacteria | 4541 |
| 283 | Ga0207643_10152440 | 3300025908 | Bacteria | 1386 |
| 284 | Ga0207705_10234860 | 3300025909 | Bacteria | 1395 |
| 285 | Ga0207707_10010628 | 3300025912 | Bacteria | 7994 |
| 286 | Ga0207671_10263910 | 3300025914 | Bacteria | 1356 |
| 287 | Ga0207693_10016810 | 3300025915 | Bacteria | 5841 |
| 288 | Ga0207693_10041075 | 3300025915 | Bacteria | 3643 |
| 289 | Ga0207693_10141736 | 3300025915 | Bacteria | 1890 |
| 290 | Ga0207693_10232183 | 3300025915 | Bacteria | 1449 |
| 291 | Ga0207663_10136442 | 3300025916 | Bacteria | 1703 |
| 292 | Ga0207660_10077349 | 3300025917 | Bacteria | 2436 |
| 293 | Ga0207649_10190318 | 3300025920 | Bacteria | 1443 |
| 294 | Ga0207652_10008278 | 3300025921 | Bacteria | 8360 |
| 295 | Ga0207652_10200759 | 3300025921 | Bacteria | 1794 |
| 296 | Ga0207681_10170215 | 3300025923 | Bacteria | 1650 |
| 297 | Ga0207694_10209344 | 3300025924 | Bacteria | 1588 |
| 298 | Ga0207650_10037891 | 3300025925 | Bacteria | 3516 |
| 299 | Ga0207650_10179450 | 3300025925 | Bacteria | 1687 |
| 300 | Ga0207659_10010403 | 3300025926 | Bacteria | 5847 |
| 301 | Ga0207659_10273965 | 3300025926 | Bacteria | 1377 |
| 302 | Ga0207659_10365390 | 3300025926 | Bacteria | 1200 |
| 303 | Ga0207687_10054649 | 3300025927 | Bacteria | 2794 |
| 304 | Ga0207687_10061789 | 3300025927 | Bacteria | 2647 |
| 305 | Ga0207687_10082177 | 3300025927 | Bacteria | 2330 |
| 306 | Ga0207687_10195500 | 3300025927 | Bacteria | 1577 |
| 307 | Ga0207700_10004883 | 3300025928 | Bacteria | 7965 |
| 308 | Ga0207644_10017805 | 3300025931 | Bacteria | 4804 |
| 309 | Ga0207644_10085166 | 3300025931 | Bacteria | 2344 |
| 310 | Ga0207644_10199196 | 3300025931 | Bacteria | 1579 |
| 311 | Ga0207690_10035249 | 3300025932 | Bacteria | 3231 |
| 312 | Ga0207690_10248543 | 3300025932 | Bacteria | 1373 |
| 313 | Ga0207706_10000065 | 3300025933 | Bacteria | 109080 |
| 314 | Ga0207706_10032813 | 3300025933 | Bacteria | 4621 |
| 315 | Ga0207686_10000390 | 3300025934 | Bacteria | 30564 |
| 316 | Ga0207686_10164984 | 3300025934 | Bacteria | 1556 |
| 317 | Ga0207686_10198539 | 3300025934 | Bacteria | 1435 |
| 318 | Ga0207686_10289639 | 3300025934 | Bacteria | 1212 |
| 319 | Ga0207709_10041254 | 3300025935 | Bacteria | 2768 |
| 320 | Ga0207709_10169204 | 3300025935 | Bacteria | 1532 |
| 321 | Ga0207709_10205953 | 3300025935 | Bacteria | 1408 |
| 322 | Ga0207669_10002903 | 3300025937 | Bacteria | 7356 |
| 323 | Ga0207669_10070246 | 3300025937 | Bacteria | 2195 |
| 324 | Ga0207704_10003859 | 3300025938 | Bacteria | 6809 |
| 325 | Ga0207704_10106457 | 3300025938 | Bacteria | 1884 |
| 326 | Ga0207704_10158764 | 3300025938 | Bacteria | 1606 |
| 327 | Ga0207665_10010913 | 3300025939 | Bacteria | 5962 |
| 328 | Ga0207691_10019700 | 3300025940 | Bacteria | 6380 |
| 329 | Ga0207691_10240200 | 3300025940 | Bacteria | 1566 |
| 330 | Ga0207691_10270129 | 3300025940 | Bacteria | 1464 |
| 331 | Ga0207711_10003997 | 3300025941 | Bacteria | 12662 |
| 332 | Ga0207711_10017179 | 3300025941 | Bacteria | 6012 |
| 333 | Ga0207711_10274591 | 3300025941 | Bacteria | 1551 |
| 334 | Ga0207689_10015253 | 3300025942 | Bacteria | 6506 |
| 335 | Ga0207689_10066420 | 3300025942 | Bacteria | 2966 |
| 336 | Ga0207661_10021776 | 3300025944 | Bacteria | 4810 |
| 337 | Ga0207661_10022062 | 3300025944 | Bacteria | 4786 |
| 338 | Ga0207661_10023870 | 3300025944 | Bacteria | 4626 |
| 339 | Ga0207661_10144910 | 3300025944 | Bacteria | 2048 |
| 340 | Ga0207661_10264500 | 3300025944 | Bacteria | 1533 |
| 341 | Ga0207661_10433024 | 3300025944 | Bacteria | 1196 |
| 342 | Ga0207679_10027170 | 3300025945 | Bacteria | 3955 |
| 343 | Ga0207679_10174625 | 3300025945 | Bacteria | 1772 |
| 344 | Ga0207667_10201493 | 3300025949 | Bacteria | 2042 |
| 345 | Ga0207651_10031128 | 3300025960 | Bacteria | 3407 |
| 346 | Ga0207651_10036814 | 3300025960 | Bacteria | 3199 |
| 347 | Ga0207712_10160591 | 3300025961 | Bacteria | 1746 |
| 348 | Ga0207712_10241943 | 3300025961 | Bacteria | 1454 |
| 349 | Ga0207668_10109281 | 3300025972 | Bacteria | 2071 |
| 350 | Ga0207640_10020688 | 3300025981 | Bacteria | 3910 |
| 351 | Ga0207640_10322933 | 3300025981 | Bacteria | 1230 |
| 352 | Ga0207658_10027328 | 3300025986 | Bacteria | 4007 |
| 353 | Ga0207677_10238547 | 3300026023 | Bacteria | 1469 |
| 354 | Ga0207703_10020144 | 3300026035 | Bacteria | 5214 |
| 355 | Ga0207703_10047263 | 3300026035 | Bacteria | 3469 |
| 356 | Ga0207639_10180107 | 3300026041 | Bacteria | 1797 |
| 357 | Ga0207678_10007041 | 3300026067 | Bacteria | 9984 |
| 358 | Ga0207678_10014744 | 3300026067 | Bacteria | 6878 |
| 359 | Ga0207678_10217604 | 3300026067 | Bacteria | 1635 |
| 360 | Ga0207678_10403110 | 3300026067 | Bacteria | 1184 |
| 361 | Ga0207708_10018339 | 3300026075 | Bacteria | 5271 |
| 362 | Ga0207708_10090855 | 3300026075 | Bacteria | 2354 |
| 363 | Ga0207708_10191654 | 3300026075 | Bacteria | 1627 |
| 364 | Ga0207702_10027837 | 3300026078 | Bacteria | 4696 |
| 365 | Ga0207702_10034645 | 3300026078 | Bacteria | 4222 |
| 366 | Ga0207641_10011879 | 3300026088 | Bacteria | 7143 |
| 367 | Ga0207641_10253681 | 3300026088 | Bacteria | 1644 |
| 368 | Ga0207648_10000211 | 3300026089 | Bacteria | 62641 |
| 369 | Ga0207676_10013407 | 3300026095 | Bacteria | 5887 |
| 370 | Ga0207676_10066841 | 3300026095 | Bacteria | 2869 |
| 371 | Ga0207676_10271700 | 3300026095 | Bacteria | 1535 |
| 372 | Ga0207676_10441340 | 3300026095 | Bacteria | 1225 |
| 373 | Ga0207674_10008192 | 3300026116 | Bacteria | 12112 |
| 374 | Ga0207674_10020587 | 3300026116 | Bacteria | 7123 |
| 375 | Ga0207675_100062532 | 3300026118 | Bacteria | 3477 |
| 376 | Ga0207675_100389575 | 3300026118 | Bacteria | 1371 |
| 377 | Ga0207683_10262286 | 3300026121 | Bacteria | 1578 |
| 378 | Ga0207698_10193980 | 3300026142 | Bacteria | 1812 |
| 379 | Ga0209179_1001588 | 3300027512 | Bacteria | 2837 |
| 380 | Ga0207428_10000696 | 3300027907 | Bacteria | 39096 |
| 381 | Ga0207428_10002628 | 3300027907 | Bacteria | 17910 |
| 382 | Ga0207428_10009996 | 3300027907 | Bacteria | 8492 |
| 383 | Ga0207428_10013268 | 3300027907 | Bacteria | 7203 |
| 384 | Ga0207428_10057368 | 3300027907 | Bacteria | 3091 |
| 385 | Ga0268266_10001206 | 3300028379 | Bacteria | 31890 |
| 386 | Ga0268265_10081705 | 3300028380 | Bacteria | 2553 |
| 387 | Ga0268265_10127667 | 3300028380 | Bacteria | 2108 |
| 388 | Ga0268264_10006781 | 3300028381 | Bacteria | 9618 |
| 389 | Ga0268264_10011848 | 3300028381 | Bacteria | 7185 |
| 390 | Ga0268264_10339688 | 3300028381 | Bacteria | 1426 |
| 391 | Ga0265338_10016076 | 3300028800 | Bacteria | 8168 |
| 392 | Ga0265338_10031037 | 3300028800 | Bacteria | 5247 |
| 393 | Ga0307513_10246227 | 3300031456 | Bacteria | 1588 |
| 394 | Ga0307509_10191332 | 3300031507 | Bacteria | 1897 |
| 395 | Ga0307408_100007383 | 3300031548 | Bacteria | 7272 |
| 396 | Ga0307408_100020650 | 3300031548 | Bacteria | 4448 |
| 397 | Ga0307408_100109824 | 3300031548 | Bacteria | 2116 |
| 398 | Ga0307408_100153573 | 3300031548 | Bacteria | 1820 |
| 399 | Ga0307408_100338341 | 3300031548 | Bacteria | 1273 |
| 400 | Ga0316576_10000338 | 3300031727 | Bacteria | 21141 |
| 401 | Ga0316578_10004402 | 3300031728 | Bacteria | 6649 |
| 402 | Ga0307516_10031692 | 3300031730 | Bacteria | 5328 |
| 403 | Ga0307405_10000670 | 3300031731 | Bacteria | 13228 |
| 404 | Ga0307405_10028107 | 3300031731 | Bacteria | 3271 |
| 405 | Ga0307405_10051186 | 3300031731 | Bacteria | 2561 |
| 406 | Ga0307405_10216192 | 3300031731 | Bacteria | 1403 |
| 407 | Ga0307405_10331756 | 3300031731 | Bacteria | 1166 |
| 408 | Ga0307413_10026814 | 3300031824 | Bacteria | 3182 |
| 409 | Ga0307413_10065723 | 3300031824 | Bacteria | 2259 |
| 410 | Ga0307413_10069488 | 3300031824 | Bacteria | 2210 |
| 411 | Ga0307413_10076444 | 3300031824 | Bacteria | 2128 |
| 412 | Ga0307413_10087607 | 3300031824 | Bacteria | 2017 |
| 413 | Ga0307413_10132126 | 3300031824 | Bacteria | 1711 |
| 414 | Ga0307410_10000147 | 3300031852 | Bacteria | 25255 |
| 415 | Ga0307410_10000824 | 3300031852 | Bacteria | 13170 |
| 416 | Ga0307410_10005511 | 3300031852 | Bacteria | 6707 |
| 417 | Ga0307410_10009969 | 3300031852 | Bacteria | 5359 |
| 418 | Ga0307410_10057506 | 3300031852 | Bacteria | 2648 |
| 419 | Ga0307410_10148596 | 3300031852 | Bacteria | 1742 |
| 420 | Ga0307406_10000058 | 3300031901 | Bacteria | 61600 |
| 421 | Ga0307406_10010406 | 3300031901 | Bacteria | 5244 |
| 422 | Ga0307406_10021189 | 3300031901 | Bacteria | 3841 |
| 423 | Ga0307406_10077071 | 3300031901 | Bacteria | 2204 |
| 424 | Ga0307406_10198114 | 3300031901 | Bacteria | 1476 |
| 425 | Ga0307406_10288143 | 3300031901 | Bacteria | 1256 |
| 426 | Ga0307406_10384744 | 3300031901 | Bacteria | 1107 |
| 427 | Ga0307407_10007658 | 3300031903 | Bacteria | 4902 |
| 428 | Ga0307407_10030353 | 3300031903 | Bacteria | 2915 |
| 429 | Ga0307407_10057468 | 3300031903 | Bacteria | 2257 |
| 430 | Ga0307407_10116144 | 3300031903 | Bacteria | 1688 |
| 431 | Ga0307407_10188812 | 3300031903 | Bacteria | 1372 |
| 432 | Ga0307409_100000233 | 3300031995 | Bacteria | 22466 |
| 433 | Ga0307409_100009628 | 3300031995 | Bacteria | 5950 |
| 434 | Ga0307409_100016467 | 3300031995 | Bacteria | 4892 |
| 435 | Ga0307409_100023078 | 3300031995 | Bacteria | 4303 |
| 436 | Ga0307409_100027954 | 3300031995 | Bacteria | 4008 |
| 437 | Ga0307409_100067504 | 3300031995 | Bacteria | 2824 |
| 438 | Ga0307409_100083169 | 3300031995 | Bacteria | 2594 |
| 439 | Ga0307409_100106606 | 3300031995 | Bacteria | 2339 |
| 440 | Ga0307409_100137754 | 3300031995 | Bacteria | 2098 |
| 441 | Ga0307409_100154693 | 3300031995 | Bacteria | 1996 |
| 442 | Ga0307409_100325431 | 3300031995 | Bacteria | 1440 |
| 443 | Ga0307416_100000063 | 3300032002 | Bacteria | 97632 |
| 444 | Ga0307416_100002018 | 3300032002 | Bacteria | 11408 |
| 445 | Ga0307416_100032531 | 3300032002 | Bacteria | 3942 |
| 446 | Ga0307416_100036367 | 3300032002 | Bacteria | 3775 |
| 447 | Ga0307416_100060718 | 3300032002 | Bacteria | 3081 |
| 448 | Ga0307416_100122924 | 3300032002 | Bacteria | 2318 |
| 449 | Ga0307416_100125375 | 3300032002 | Bacteria | 2299 |
| 450 | Ga0307416_100171946 | 3300032002 | Bacteria | 2018 |
| 451 | Ga0307416_100406118 | 3300032002 | Bacteria | 1401 |
| 452 | Ga0307416_100645821 | 3300032002 | Bacteria | 1142 |
| 453 | Ga0307414_10004969 | 3300032004 | Bacteria | 7270 |
| 454 | Ga0307414_10036028 | 3300032004 | Bacteria | 3299 |
| 455 | Ga0307414_10229635 | 3300032004 | Bacteria | 1529 |
| 456 | Ga0307414_10289909 | 3300032004 | Bacteria | 1379 |
| 457 | Ga0307411_10009346 | 3300032005 | Bacteria | 5149 |
| 458 | Ga0307411_10098101 | 3300032005 | Bacteria | 2064 |
| 459 | Ga0307411_10230658 | 3300032005 | Bacteria | 1443 |
| 460 | Ga0307415_100000327 | 3300032126 | Bacteria | 20647 |
| 461 | Ga0307415_100007592 | 3300032126 | Bacteria | 5942 |
| 462 | Ga0307415_100012698 | 3300032126 | Bacteria | 4880 |
| 463 | Ga0307415_100097799 | 3300032126 | Bacteria | 2143 |
| 464 | Ga0307415_100140744 | 3300032126 | Bacteria | 1842 |
| 465 | Ga0307415_100162745 | 3300032126 | Bacteria | 1731 |
| 466 | Ga0307415_100192805 | 3300032126 | Bacteria | 1609 |
| 467 | Ga0307415_100381815 | 3300032126 | Bacteria | 1196 |
| 468 | Ga0307510_10032760 | 3300033180 | Bacteria | 5850 |
| 469 | Ga0373926_0045688 | 3300035083 | Unclassified | 1570 |
| 470 | Ga0373934_0077857 | 3300035086 | Bacteria | 1330 |
| 471 | Ga0373951_0005964 | 3300035091 | Bacteria | 2809 |
| 472 | Ga0373923_0005923 | 3300035111 | Bacteria | 4182 |
| 473 | Ga0373923_0051439 | 3300035111 | Unclassified | 1728 |
| 474 | Ga0373941_0017161 | 3300035115 | Bacteria | 1979 |
| 475 | Ga0373945_0009746 | 3300035116 | Bacteria | 3152 |
| 476 | Ga0373945_0034316 | 3300035116 | Bacteria | 1807 |
| 477 | Ga0373956_0004182 | 3300035119 | Bacteria | 5785 |
| 478 | Ga0373957_0025363 | 3300035120 | Unclassified | 2135 |
| 479 | Ga0373960_0022650 | 3300035121 | Bacteria | 1685 |
| 480 | Ga0373955_0042476 | 3300035172 | Bacteria | 2441 |
| 481 | Ga0316574_0006476 | 3300035398 | Bacteria | 6331 |
| 482 | Ga0373924_0055516 | 3300035410 | Bacteria | 1648 |
| 483 | Ga0373931_0013954 | 3300035691 | Bacteria | 3920 |
| 484 | Ga0373935_0147360 | 3300035692 | Bacteria | 1594 |
| 485 | Ga0373927_0076563 | 3300035695 | Bacteria | 2166 |
| 486 | Ga0373927_0094275 | 3300035695 | Bacteria | 1945 |
| 487 | Ga0373933_0007691 | 3300035724 | Bacteria | 5886 |
| 488 | Ga0373933_0186726 | 3300035724 | Unclassified | 1323 |
| 489 | Ga0373947_0024089 | 3300035725 | Bacteria | 3544 |
| 490 | Ga0373937_0013422 | 3300036401 | Bacteria | 7215 |
| 491 | Ga0373937_0038316 | 3300036401 | Bacteria | 4368 |
| 492 | Ga0373937_0061202 | 3300036401 | Bacteria | 3460 |
| 493 | Ga0373937_0324678 | 3300036401 | Bacteria | 1456 |
| 494 | Ga0316582_0008819 | 3300036647 | Bacteria | 5437 |
| 495 | Ga0373925_0073967 | 3300037068 | Bacteria | 2580 |
| 496 | Ga0373925_0148524 | 3300037068 | Bacteria | 1838 |
| 497 | Ga0373925_0167526 | 3300037068 | Bacteria | 1733 |
| 498 | Ga0395900_0015864 | 3300037418 | Bacteria | 7675 |
| 499 | Ga0395900_0283115 | 3300037418 | Bacteria | 1649 |
| 500 | Ga0395898_0097773 | 3300037466 | Bacteria | 2819 |
| 501 | Ga0395898_0526001 | 3300037466 | Bacteria | 1124 |
| 502 | Ga0395905_0072278 | 3300037471 | Bacteria | 3234 |
| 503 | Ga0395905_0352875 | 3300037471 | Bacteria | 1363 |
| 504 | Ga0395905_0385386 | 3300037471 | Bacteria | 1296 |
| 505 | Ga0395901_0054966 | 3300038443 | Bacteria | 4139 |
| 506 | Ga0395901_0077737 | 3300038443 | Bacteria | 3464 |
| 507 | Ga0436365_0719229 | 3300039437 | Bacteria | 1083 |
| 508 | Ga0436365_1837480 | 3300039437 | Bacteria | 3359 |
| 509 | Ga0439448_0007876 | 3300042005 | Bacteria | 3100 |
| 510 | Ga0439448_0008232 | 3300042005 | Bacteria | 3048 |
| 511 | Ga0439455_0007675 | 3300042012 | Bacteria | 2290 |
| 512 | Ga0450914_002455 | 3300042118 | Bacteria | 1326 |
| 513 | Ga0450905_006766 | 3300042142 | Bacteria | 1554 |
| 514 | Ga0439458_0016974 | 3300042157 | Bacteria | 1659 |
| 515 | Ga0439464_0004085 | 3300042439 | Bacteria | 3712 |
| 516 | Ga0439464_0011158 | 3300042439 | Bacteria | 2376 |
| 517 | Ga0439464_0019438 | 3300042439 | Bacteria | 1854 |
| 518 | Ga0439460_0005870 | 3300042461 | Bacteria | 3026 |
| 519 | Ga0439440_0002861 | 3300042993 | Bacteria | 3283 |
| 520 | Ga0495617_027151 | 3300046452 | Unclassified | 1927 |
| 521 | Ga0495592_0020215 | 3300046454 | Bacteria | 5065 |
| 522 | Ga0495592_0167023 | 3300046454 | Bacteria | 1509 |
| 523 | Ga0495592_0269943 | 3300046454 | Bacteria | 1116 |
| 524 | Ga0495603_0100912 | 3300046455 | Unclassified | 1684 |
| 525 | Ga0495629_0100043 | 3300046459 | Unclassified | 2023 |
| 526 | Ga0495629_0110235 | 3300046459 | Bacteria | 1919 |
| 527 | Ga0495629_0124779 | 3300046459 | Bacteria | 1794 |
| 528 | Ga0495629_0131648 | 3300046459 | Unclassified | 1742 |
| 529 | Ga0495629_0134350 | 3300046459 | Bacteria | 1722 |
| 530 | Ga0495641_0083293 | 3300046461 | Bacteria | 1433 |
| 531 | Ga0495641_0098303 | 3300046461 | Bacteria | 1306 |
| 532 | Ga0495651_0022494 | 3300046462 | Bacteria | 4899 |
| 533 | Ga0495653_0005591 | 3300046463 | Bacteria | 10252 |
| 534 | Ga0495653_0018111 | 3300046463 | Bacteria | 5726 |
| 535 | Ga0495653_0043858 | 3300046463 | Bacteria | 3474 |
| 536 | Ga0495653_0121063 | 3300046463 | Bacteria | 1865 |
| 537 | Ga0495653_0193078 | 3300046463 | Bacteria | 1388 |
| 538 | Ga0495580_0001173 | 3300046472 | Bacteria | 23050 |
| 539 | Ga0495580_0185535 | 3300046472 | Unclassified | 1436 |
| 540 | Ga0495582_0096835 | 3300046473 | Bacteria | 1650 |
| 541 | Ga0495662_0020041 | 3300046476 | Bacteria | 3236 |
| 542 | Ga0495664_0012948 | 3300046477 | Bacteria | 4728 |
| 543 | Ga0495664_0015231 | 3300046477 | Bacteria | 4368 |
| 544 | Ga0495584_0000005 | 3300046491 | Bacteria | 306957 |
| 545 | Ga0495584_0072395 | 3300046491 | Unclassified | 1732 |
| 546 | Ga0495584_0080331 | 3300046491 | Bacteria | 1641 |
| 547 | Ga0495585_0024011 | 3300046492 | Bacteria | 3497 |
| 548 | Ga0495594_0113172 | 3300046499 | Unclassified | 1531 |
| 549 | Ga0495607_0019910 | 3300046501 | Bacteria | 4252 |
| 550 | Ga0495606_0018041 | 3300046507 | Bacteria | 5308 |
| 551 | Ga0495608_0023371 | 3300046511 | Bacteria | 4236 |
| 552 | Ga0495608_0042656 | 3300046511 | Unclassified | 3033 |
| 553 | Ga0495608_0042969 | 3300046511 | Bacteria | 3021 |
| 554 | Ga0495608_0147267 | 3300046511 | Bacteria | 1501 |
| 555 | Ga0495618_0002676 | 3300046514 | Bacteria | 11349 |
| 556 | Ga0495618_0010917 | 3300046514 | Bacteria | 5501 |
| 557 | Ga0495618_0025147 | 3300046514 | Bacteria | 3694 |
| 558 | Ga0495628_0243256 | 3300046516 | Bacteria | 1345 |
| 559 | Ga0495628_0289923 | 3300046516 | Unclassified | 1213 |
| 560 | Ga0495630_0003589 | 3300046517 | Bacteria | 10804 |
| 561 | Ga0495630_0029817 | 3300046517 | Bacteria | 4056 |
| 562 | Ga0495630_0046616 | 3300046517 | Plasmid | 3240 |
| 563 | Ga0495637_0102763 | 3300046520 | Unclassified | 1115 |
| 564 | Ga0495644_0035871 | 3300046523 | Unclassified | 1871 |
| 565 | Ga0495663_0015205 | 3300046525 | Bacteria | 2166 |
| 566 | Ga0495666_0054396 | 3300046526 | Bacteria | 1919 |
| 567 | Ga0495652_0019749 | 3300046529 | Bacteria | 5994 |
| 568 | Ga0495652_0045718 | 3300046529 | Bacteria | 3761 |
| 569 | Ga0495652_0187095 | 3300046529 | Unclassified | 1583 |
| 570 | Ga0495640_0001188 | 3300046533 | Bacteria | 20367 |
| 571 | Ga0495640_0011004 | 3300046533 | Bacteria | 6968 |
| 572 | Ga0495640_0121859 | 3300046533 | Bacteria | 1694 |
| 573 | Ga0495586_0045951 | 3300046535 | Bacteria | 2354 |
| 574 | Ga0495586_0061151 | 3300046535 | Bacteria | 2049 |
| 575 | Ga0495586_0113780 | 3300046535 | Unclassified | 1507 |
| 576 | Ga0495587_0002769 | 3300046536 | Bacteria | 11699 |
| 577 | Ga0495587_0019408 | 3300046536 | Bacteria | 4207 |
| 578 | Ga0495598_0014740 | 3300046537 | Unclassified | 1959 |
| 579 | Ga0495609_0089780 | 3300046538 | Bacteria | 1337 |
| 580 | Ga0495645_0004016 | 3300046543 | Bacteria | 10048 |
| 581 | Ga0495645_0013960 | 3300046543 | Bacteria | 5692 |
| 582 | Ga0495645_0179292 | 3300046543 | Unclassified | 1453 |
| 583 | Ga0495622_0077285 | 3300046557 | Unclassified | 1534 |
| 584 | Ga0495633_0023749 | 3300046558 | Bacteria | 3035 |
| 585 | Ga0495667_0002063 | 3300046559 | Bacteria | 13337 |
| 586 | Ga0495667_0010593 | 3300046559 | Bacteria | 6237 |
| 587 | Ga0495667_0086055 | 3300046559 | Bacteria | 2039 |
| 588 | Ga0495667_0213930 | 3300046559 | Bacteria | 1231 |
| 589 | Ga0495656_0029998 | 3300046615 | Unclassified | 2194 |
| 590 | Ga0495656_0100810 | 3300046615 | Bacteria | 1335 |
| 591 | Ga0495634_0033701 | 3300046642 | Bacteria | 3517 |
| 592 | Ga0495634_0046446 | 3300046642 | Bacteria | 2931 |
| 593 | Ga0495634_0073892 | 3300046642 | Unclassified | 2241 |
| 594 | Ga0495611_0045768 | 3300046648 | Unclassified | 1960 |
| 595 | Ga0495635_0069760 | 3300046663 | Bacteria | 2409 |
| 596 | Ga0495635_0106290 | 3300046663 | Bacteria | 1917 |
| 597 | Ga0495635_0175655 | 3300046663 | Bacteria | 1456 |
| 598 | Ga0495635_0235425 | 3300046663 | Bacteria | 1236 |
| 599 | Ga0495659_0014854 | 3300046664 | Bacteria | 2554 |
| 600 | Ga0495661_0131618 | 3300046665 | Unclassified | 1370 |
| 601 | Ga0495588_0024681 | 3300046674 | Bacteria | 2988 |
| 602 | Ga0495588_0045188 | 3300046674 | Bacteria | 2257 |
| 603 | Ga0495657_0029251 | 3300046675 | Unclassified | 3866 |
| 604 | Ga0495599_0008532 | 3300046678 | Bacteria | 6235 |
| 605 | Ga0495599_0029551 | 3300046678 | Bacteria | 3435 |
| 606 | Ga0495623_0004038 | 3300046679 | Bacteria | 9663 |
| 607 | Ga0495646_0108646 | 3300046680 | Unclassified | 1581 |
| 608 | Ga0495647_0008477 | 3300046681 | Unclassified | 3457 |
| 609 | Ga0495658_0002446 | 3300046683 | Bacteria | 9350 |
| 610 | Ga0495658_0127736 | 3300046683 | Bacteria | 1544 |
| 611 | Ga0495669_0058084 | 3300046684 | Unclassified | 1746 |
| 612 | Ga0495613_0013468 | 3300046689 | Bacteria | 6073 |
| 613 | Ga0495613_0042179 | 3300046689 | Bacteria | 3377 |
| 614 | Ga0495613_0047429 | 3300046689 | Bacteria | 3173 |
| 615 | Ga0495613_0062744 | 3300046689 | Plasmid | 2719 |
| 616 | Ga0495613_0147310 | 3300046689 | Bacteria | 1680 |
| 617 | Ga0495613_0217792 | 3300046689 | Bacteria | 1341 |
| 618 | Ga0495624_0016059 | 3300046690 | Bacteria | 5040 |
| 619 | Ga0495589_0074262 | 3300046794 | Unclassified | 1659 |
| 620 | Ga0495600_0002596 | 3300046809 | Bacteria | 10412 |
| 621 | Ga0495600_0005724 | 3300046809 | Bacteria | 7507 |
| 622 | Ga0495600_0025218 | 3300046809 | Bacteria | 3831 |
| 623 | Ga0495600_0123417 | 3300046809 | Bacteria | 1684 |
| 624 | Ga0495581_0049407 | 3300047315 | Bacteria | 2428 |
| 625 | Ga0495581_0096264 | 3300047315 | Bacteria | 1719 |
| 626 | Ga0495604_0019876 | 3300047317 | Bacteria | 5373 |
| 627 | Ga0495604_0038494 | 3300047317 | Bacteria | 3762 |
| 628 | Ga0495604_0042140 | 3300047317 | Unclassified | 3578 |
| 629 | Ga0495604_0162753 | 3300047317 | Bacteria | 1575 |
| 630 | Ga0495604_0236908 | 3300047317 | Bacteria | 1250 |
| 631 | Ga0495604_0308136 | 3300047317 | Bacteria | 1061 |
| 632 | Ga0495674_0001467 | 3300047319 | Bacteria | 23112 |
| 633 | Ga0495674_0018328 | 3300047319 | Bacteria | 6516 |
| 634 | Ga0495674_0088391 | 3300047319 | Bacteria | 2650 |
| 635 | Ga0495674_0151283 | 3300047319 | Bacteria | 1946 |
| 636 | Ga0495674_0194645 | 3300047319 | Bacteria | 1684 |
| 637 | Ga0495674_0321624 | 3300047319 | Bacteria | 1260 |
| 638 | Ga0495672_0008285 | 3300047320 | Bacteria | 7699 |
| 639 | Ga0495676_0086098 | 3300047321 | Bacteria | 2366 |
| 640 | Ga0495680_0002298 | 3300047322 | Bacteria | 19632 |
| 641 | Ga0495680_0002570 | 3300047322 | Bacteria | 18505 |
| 642 | Ga0495680_0010629 | 3300047322 | Bacteria | 8207 |
| 643 | Ga0495680_0013843 | 3300047322 | Bacteria | 7018 |
| 644 | Ga0495680_0016453 | 3300047322 | Bacteria | 6351 |
| 645 | Ga0495680_0018429 | 3300047322 | Bacteria | 5929 |
| 646 | Ga0495680_0031972 | 3300047322 | Bacteria | 4277 |
| 647 | Ga0495680_0102827 | 3300047322 | Unclassified | 2127 |
| 648 | Ga0495675_0002616 | 3300047444 | Bacteria | 10790 |
| 649 | Ga0495679_054652 | 3300047446 | Unclassified | 1188 |
| 650 | Ga0495684_0009809 | 3300047471 | Bacteria | 7391 |
| 651 | Ga0495684_0017859 | 3300047471 | Bacteria | 5465 |
| 652 | Ga0495684_0030151 | 3300047471 | Plasmid | 4164 |
| 653 | Ga0495684_0130828 | 3300047471 | Bacteria | 1885 |
| 654 | Ga0495593_0009266 | 3300047673 | Bacteria | 5712 |
| 655 | Ga0495593_0035745 | 3300047673 | Unclassified | 2696 |
| 656 | Ga0495593_0158879 | 3300047673 | Bacteria | 1141 |
| 657 | Ga0495602_0033049 | 3300048088 | Bacteria | 4860 |
| 658 | Ga0495602_0072169 | 3300048088 | Unclassified | 2945 |
| 659 | Ga0495614_0069554 | 3300048089 | Bacteria | 1516 |
| 660 | Ga0496100_0036973 | 3300048903 | Bacteria | 3083 |
| 661 | Ga0496100_0054431 | 3300048903 | Bacteria | 2610 |
| 662 | Ga0496100_0277280 | 3300048903 | Bacteria | 1249 |
| 663 | Ga0496101_0007471 | 3300048904 | Bacteria | 7084 |
| 664 | Ga0496101_0010440 | 3300048904 | Bacteria | 6134 |
| 665 | Ga0496101_0468543 | 3300048904 | Bacteria | 994 |
| 666 | Ga0496102_0006178 | 3300048905 | Bacteria | 10212 |
| 667 | Ga0496102_0145618 | 3300048905 | Bacteria | 2223 |
| 668 | Ga0496102_0159734 | 3300048905 | Bacteria | 2120 |
| 669 | Ga0496102_0332804 | 3300048905 | Bacteria | 1430 |
| 670 | Ga0496102_0409027 | 3300048905 | Bacteria | 1275 |
| 671 | Ga0496103_0111364 | 3300048906 | Bacteria | 1739 |
| 672 | Ga0496104_0000757 | 3300048907 | Bacteria | 27662 |
| 673 | Ga0496104_0004139 | 3300048907 | Bacteria | 12596 |
| 674 | Ga0496104_0008974 | 3300048907 | Bacteria | 8891 |
| 675 | Ga0496104_0093086 | 3300048907 | Bacteria | 2882 |
| 676 | Ga0496104_0126726 | 3300048907 | Bacteria | 2452 |
| 677 | Ga0496104_0203444 | 3300048907 | Bacteria | 1892 |
| 678 | Ga0496104_0218736 | 3300048907 | Bacteria | 1817 |
| 679 | Ga0496104_0261356 | 3300048907 | Bacteria | 1644 |
| 680 | Ga0496105_0002226 | 3300048908 | Bacteria | 14052 |
| 681 | Ga0496105_0046640 | 3300048908 | Bacteria | 3576 |
| 682 | Ga0496105_0057070 | 3300048908 | Bacteria | 3224 |
| 683 | Ga0496105_0093718 | 3300048908 | Bacteria | 2480 |
| 684 | Ga0496105_0168551 | 3300048908 | Bacteria | 1796 |
| 685 | Ga0496105_0273452 | 3300048908 | Bacteria | 1364 |
| 686 | Ga0496105_0328148 | 3300048908 | Bacteria | 1225 |
| 687 | Ga0496105_0417979 | 3300048908 | Bacteria | 1062 |
| 688 | Ga0496106_0062560 | 3300048909 | Bacteria | 2826 |
| 689 | Ga0496106_0083355 | 3300048909 | Bacteria | 2459 |
| 690 | Ga0496106_0087736 | 3300048909 | Bacteria | 2397 |
| 691 | Ga0496106_0120430 | 3300048909 | Bacteria | 2051 |
| 692 | Ga0496106_0425655 | 3300048909 | Bacteria | 1067 |
| 693 | Ga0496107_0008752 | 3300048910 | Bacteria | 7012 |
| 694 | Ga0496107_0107688 | 3300048910 | Bacteria | 2047 |
| 695 | Ga0496107_0220012 | 3300048910 | Bacteria | 1412 |
| 696 | Ga0496108_0011231 | 3300048911 | Bacteria | 7275 |
| 697 | Ga0496108_0093685 | 3300048911 | Bacteria | 2555 |
| 698 | Ga0496108_0103414 | 3300048911 | Bacteria | 2430 |
| 699 | Ga0496108_0146531 | 3300048911 | Bacteria | 2036 |
| 700 | Ga0496108_0301565 | 3300048911 | Bacteria | 1395 |
| 701 | Ga0496109_0005069 | 3300048912 | Bacteria | 11005 |
| 702 | Ga0496109_0008339 | 3300048912 | Bacteria | 8801 |
| 703 | Ga0496109_0047294 | 3300048912 | Bacteria | 3911 |
| 704 | Ga0496109_0075921 | 3300048912 | Bacteria | 3090 |
| 705 | Ga0496109_0090528 | 3300048912 | Bacteria | 2829 |
| 706 | Ga0496109_0107352 | 3300048912 | Bacteria | 2593 |
| 707 | Ga0496109_0254703 | 3300048912 | Bacteria | 1653 |
| 708 | Ga0496109_0333176 | 3300048912 | Bacteria | 1433 |
| 709 | Ga0496110_0001589 | 3300048913 | Bacteria | 16599 |
| 710 | Ga0496110_0004299 | 3300048913 | Bacteria | 11023 |
| 711 | Ga0496110_0025590 | 3300048913 | Bacteria | 5045 |
| 712 | Ga0496110_0076484 | 3300048913 | Bacteria | 2976 |
| 713 | Ga0496111_0001995 | 3300048914 | Bacteria | 12140 |
| 714 | Ga0496111_0003435 | 3300048914 | Bacteria | 9801 |
| 715 | Ga0496111_0011341 | 3300048914 | Bacteria | 6000 |
| 716 | Ga0496111_0051811 | 3300048914 | Bacteria | 2963 |
| 717 | Ga0496111_0208628 | 3300048914 | Bacteria | 1451 |
| 718 | Ga0496111_0208863 | 3300048914 | Bacteria | 1450 |
| 719 | Ga0496111_0251141 | 3300048914 | Bacteria | 1313 |
| 720 | Ga0496111_0451696 | 3300048914 | Bacteria | 948 |
| 721 | Ga0496112_0006723 | 3300048915 | Bacteria | 10127 |
| 722 | Ga0496112_0006933 | 3300048915 | Bacteria | 10000 |
| 723 | Ga0496113_0003729 | 3300048916 | Bacteria | 9188 |
| 724 | Ga0496113_0241990 | 3300048916 | Bacteria | 1440 |
| 725 | Ga0496114_0001139 | 3300048917 | Bacteria | 20090 |
| 726 | Ga0496114_0002549 | 3300048917 | Bacteria | 13907 |
| 727 | Ga0496114_0006052 | 3300048917 | Bacteria | 9520 |
| 728 | Ga0496114_0017732 | 3300048917 | Bacteria | 5753 |
| 729 | Ga0496114_0032819 | 3300048917 | Bacteria | 4276 |
| 730 | Ga0496114_0037181 | 3300048917 | Bacteria | 4026 |
| 731 | Ga0496114_0038768 | 3300048917 | Bacteria | 3942 |
| 732 | Ga0496114_0076407 | 3300048917 | Bacteria | 2822 |
| 733 | Ga0496114_0076849 | 3300048917 | Bacteria | 2814 |
| 734 | Ga0496114_0083596 | 3300048917 | Bacteria | 2701 |
| 735 | Ga0496115_0017884 | 3300048918 | Bacteria | 5429 |
| 736 | Ga0496115_0032592 | 3300048918 | Plasmid | 4110 |
| 737 | Ga0496115_0119854 | 3300048918 | Bacteria | 2164 |
| 738 | Ga0496115_0181662 | 3300048918 | Bacteria | 1739 |
| 739 | Ga0496115_0422934 | 3300048918 | Bacteria | 1079 |
| 740 | Ga0496121_0000194 | 3300048924 | Bacteria | 136324 |
| 741 | Ga0496121_0001789 | 3300048924 | Bacteria | 34756 |
| 742 | Ga0496126_0009087 | 3300048929 | Bacteria | 10621 |
| 743 | Ga0501031_0017507 | 3300049568 | Bacteria | 4658 |
| 744 | Ga0501032_0024192 | 3300049569 | Bacteria | 4195 |
| 745 | Ga0501032_0055741 | 3300049569 | Bacteria | 2659 |
| 746 | Ga0501032_0166369 | 3300049569 | Bacteria | 1447 |
| 747 | Ga0501033_0017964 | 3300049570 | Bacteria | 5340 |
| 748 | Ga0501034_0189348 | 3300049571 | Bacteria | 2020 |
| 749 | Ga0501036_0000024 | 3300049572 | Bacteria | 110026 |
| 750 | Ga0501036_0019206 | 3300049572 | Bacteria | 5734 |
| 751 | Ga0501038_0006128 | 3300049574 | Bacteria | 11130 |
| 752 | Ga0501038_0015159 | 3300049574 | Bacteria | 7013 |
| 753 | Ga0501038_0056352 | 3300049574 | Bacteria | 3375 |
| 754 | Ga0501039_0000545 | 3300049575 | Bacteria | 27233 |
| 755 | Ga0501039_0005795 | 3300049575 | Bacteria | 9357 |
| 756 | Ga0501039_0005839 | 3300049575 | Bacteria | 9323 |
| 757 | Ga0501040_0000548 | 3300049576 | Bacteria | 22755 |
| 758 | Ga0501040_0002444 | 3300049576 | Bacteria | 11968 |
| 759 | Ga0501040_0003752 | 3300049576 | Bacteria | 9849 |
| 760 | Ga0501040_0005846 | 3300049576 | Bacteria | 7962 |
| 761 | Ga0501040_0077744 | 3300049576 | Bacteria | 2295 |
| 762 | Ga0501040_0269799 | 3300049576 | Bacteria | 1215 |
| 763 | Ga0501041_0003287 | 3300049577 | Bacteria | 9297 |
| 764 | Ga0501041_0005145 | 3300049577 | Bacteria | 7632 |
| 765 | Ga0501041_0016957 | 3300049577 | Bacteria | 4333 |
| 766 | Ga0501042_0000127 | 3300049578 | Bacteria | 32933 |
| 767 | Ga0501042_0002659 | 3300049578 | Bacteria | 11000 |
| 768 | Ga0501042_0020524 | 3300049578 | Bacteria | 4599 |
| 769 | Ga0501042_0032831 | 3300049578 | Bacteria | 3677 |
| 770 | Ga0501043_0018311 | 3300049579 | Bacteria | 5491 |
| 771 | Ga0501043_0034336 | 3300049579 | Bacteria | 3989 |
| 772 | Ga0501046_0002235 | 3300049580 | Bacteria | 18266 |
| 773 | Ga0501046_0004821 | 3300049580 | Bacteria | 12160 |
| 774 | Ga0501046_0064867 | 3300049580 | Bacteria | 2850 |
| 775 | Ga0501047_0252291 | 3300049581 | Bacteria | 1613 |
| 776 | Ga0501048_0005887 | 3300049582 | Bacteria | 9333 |
| 777 | Ga0501048_0006439 | 3300049582 | Bacteria | 8924 |
| 778 | Ga0501048_0015041 | 3300049582 | Bacteria | 5719 |
| 779 | Ga0501048_0023235 | 3300049582 | Unclassified | 4534 |
| 780 | Ga0501048_0082728 | 3300049582 | Bacteria | 2264 |
| 781 | Ga0501068_0003313 | 3300049584 | Bacteria | 8634 |
| 782 | Ga0501068_0217116 | 3300049584 | Bacteria | 1215 |
| 783 | Ga0501069_0045790 | 3300049585 | Bacteria | 2424 |
| 784 | Ga0501069_0052160 | 3300049585 | Bacteria | 2277 |
| 785 | Ga0501070_0041191 | 3300049586 | Bacteria | 3848 |
| 786 | Ga0501070_0111656 | 3300049586 | Bacteria | 2259 |
| 787 | Ga0501071_0000240 | 3300049587 | Bacteria | 25237 |
| 788 | Ga0501071_0021452 | 3300049587 | Bacteria | 4498 |
| 789 | Ga0501071_0022642 | 3300049587 | Bacteria | 4381 |
| 790 | Ga0501071_0046338 | 3300049587 | Bacteria | 3122 |
| 791 | Ga0501071_0099615 | 3300049587 | Bacteria | 2141 |
| 792 | Ga0501071_0251608 | 3300049587 | Bacteria | 1334 |
| 793 | Ga0501071_0277901 | 3300049587 | Bacteria | 1267 |
| 794 | Ga0501072_0000135 | 3300049588 | Bacteria | 55479 |
| 795 | Ga0501072_0000860 | 3300049588 | Bacteria | 22296 |
| 796 | Ga0501072_0004841 | 3300049588 | Bacteria | 10251 |
| 797 | Ga0501072_0005557 | 3300049588 | Bacteria | 9589 |
| 798 | Ga0501072_0009084 | 3300049588 | Bacteria | 7548 |
| 799 | Ga0501074_0031894 | 3300049590 | Bacteria | 3819 |
| 800 | Ga0501074_0036786 | 3300049590 | Bacteria | 3546 |
| 801 | Ga0501075_0000252 | 3300049591 | Bacteria | 28970 |
| 802 | Ga0501075_0001006 | 3300049591 | Bacteria | 18017 |
| 803 | Ga0501075_0008589 | 3300049591 | Bacteria | 7121 |
| 804 | Ga0501075_0009624 | 3300049591 | Bacteria | 6766 |
| 805 | Ga0501075_0014224 | 3300049591 | Archaea | 5701 |
| 806 | Ga0501076_0001183 | 3300049592 | Bacteria | 17272 |
| 807 | Ga0501076_0002949 | 3300049592 | Bacteria | 11792 |
| 808 | Ga0501076_0002969 | 3300049592 | Bacteria | 11767 |
| 809 | Ga0501076_0047177 | 3300049592 | Bacteria | 3405 |
| 810 | Ga0501076_0096008 | 3300049592 | Unclassified | 2387 |
| 811 | Ga0501076_0196746 | 3300049592 | Bacteria | 1645 |
| 812 | Ga0501077_0001426 | 3300049593 | Bacteria | 14343 |
| 813 | Ga0501077_0003333 | 3300049593 | Bacteria | 9664 |
| 814 | Ga0501077_0011109 | 3300049593 | Bacteria | 5617 |
| 815 | Ga0501077_0072059 | 3300049593 | Bacteria | 2189 |
| 816 | Ga0501079_0000135 | 3300049741 | Bacteria | 39988 |
| 817 | Ga0501079_0007821 | 3300049741 | Archaea | 8095 |
| 818 | Ga0501079_0037086 | 3300049741 | Bacteria | 3756 |
| 819 | Ga0501079_0181029 | 3300049741 | Bacteria | 1644 |
| 820 | Ga0501080_0024649 | 3300049742 | Bacteria | 5579 |
| 821 | Ga0501080_0335111 | 3300049742 | Bacteria | 1368 |
| 822 | Ga0501081_0000233 | 3300049743 | Bacteria | 28110 |
| 823 | Ga0501081_0006069 | 3300049743 | Bacteria | 7830 |
| 824 | Ga0501081_0014471 | 3300049743 | Bacteria | 5203 |
| 825 | Ga0501081_0015776 | 3300049743 | Bacteria | 4987 |
| 826 | Ga0501081_0021674 | 3300049743 | Bacteria | 4289 |
| 827 | Ga0501083_0007199 | 3300049744 | Bacteria | 7900 |
| 828 | Ga0501035_0019343 | 3300049822 | Bacteria | 6264 |
| 829 | Ga0501035_0022998 | 3300049822 | Bacteria | 5721 |
| 830 | Ga0501035_0072175 | 3300049822 | Bacteria | 3056 |
| 831 | Ga0501045_0003184 | 3300049824 | Bacteria | 11225 |
| 832 | Ga0501045_0003585 | 3300049824 | Bacteria | 10661 |
| 833 | Ga0501045_0036826 | 3300049824 | Bacteria | 3554 |
| 834 | Ga0501045_0160825 | 3300049824 | Bacteria | 1671 |
| 835 | nmdc:mga05p37_165440_c1 | 3300050507 | Bacteria | 2700 |
| 836 | nmdc:mga05p37_21883_c1 | 3300050507 | Bacteria | 7747 |
| 837 | nmdc:mga05p37_219602_c1 | 3300050507 | Bacteria | 2294 |
| 838 | nmdc:mga05p37_27954_c1 | 3300050507 | Bacteria | 6871 |
| 839 | nmdc:mga05p37_3524_c1 | 3300050507 | Bacteria | 18277 |
| 840 | nmdc:mga05p37_42960_c1 | 3300050507 | Bacteria | 5557 |
| 841 | nmdc:mga05p37_460825_c1 | 3300050507 | Bacteria | 1469 |
| 842 | nmdc:mga05p37_9378_c1 | 3300050507 | Bacteria | 11584 |
| 843 | nmdc:mga09592_17151_c1 | 3300050508 | Bacteria | 5930 |
| 844 | nmdc:mga0qj67_2071_c1 | 3300050509 | Bacteria | 14316 |
| 845 | nmdc:mga0qj67_56364_c1 | 3300050509 | Bacteria | 3115 |
| 846 | nmdc:mga0qj67_84568_c1 | 3300050509 | Bacteria | 2544 |
| 847 | nmdc:mga06r32_15098_c1 | 3300050510 | Bacteria | 7013 |
| 848 | nmdc:mga06r32_391429_c1 | 3300050510 | Bacteria | 1372 |
| 849 | nmdc:mga08y16_130735_c1 | 3300050511 | Bacteria | 2611 |
| 850 | nmdc:mga08y16_13240_c1 | 3300050511 | Bacteria | 8674 |
| 851 | nmdc:mga08y16_18582_c1 | 3300050511 | Bacteria | 7325 |
| 852 | nmdc:mga08y16_240503_c1 | 3300050511 | Unclassified | 1871 |
| 853 | nmdc:mga08y16_366142_c1 | 3300050511 | Bacteria | 1479 |
| 854 | nmdc:mga08y16_733_c1 | 3300050511 | Bacteria | 31115 |
| 855 | nmdc:mga08y16_98879_c1 | 3300050511 | Bacteria | 3038 |
| 856 | nmdc:mga0n895_106342_c1 | 3300050512 | Bacteria | 2819 |
| 857 | nmdc:mga0n895_16208_c1 | 3300050512 | Bacteria | 6832 |
| 858 | nmdc:mga0n895_179723_c1 | 3300050512 | Bacteria | 2147 |
| 859 | nmdc:mga0n895_2119_c1 | 3300050512 | Bacteria | 15321 |
| 860 | nmdc:mga0rr50_19047_c1 | 3300050513 | Bacteria | 4623 |
| 861 | nmdc:mga0rr50_5888_c1 | 3300050513 | Bacteria | 7377 |
| 862 | nmdc:mga08x19_24796_c1 | 3300050514 | Bacteria | 3731 |
| 863 | nmdc:mga0a205_20798_c1 | 3300050515 | Bacteria | 6200 |
| 864 | nmdc:mga0a205_4323_c1 | 3300050515 | Bacteria | 12736 |
| 865 | nmdc:mga0a205_95348_c1 | 3300050515 | Bacteria | 2874 |
| 866 | Ga0495601_0001360 | 3300053077 | Bacteria | 13452 |
| 867 | Ga0495601_0002663 | 3300053077 | Bacteria | 10125 |
| 868 | Ga0495601_0012892 | 3300053077 | Bacteria | 5018 |
| 869 | Ga0495601_0041357 | 3300053077 | Bacteria | 2889 |
| 870 | Ga0495612_0002589 | 3300053078 | Bacteria | 7457 |
| 871 | Ga0495612_0005738 | 3300053078 | Bacteria | 5128 |
| 872 | Ga0495595_0047764 | 3300053084 | Bacteria | 1975 |
| 873 | Ga0495595_0050572 | 3300053084 | Bacteria | 1925 |
| 874 | Ga0495595_0126832 | 3300053084 | Unclassified | 1245 |
| 875 | Ga0495619_0046463 | 3300053085 | Bacteria | 2855 |
| 876 | Ga0495619_0069480 | 3300053085 | Bacteria | 2354 |
| 877 | Ga0495619_0144408 | 3300053085 | Bacteria | 1640 |
| 878 | Ga0500568_0015668 | 3300053139 | Bacteria | 3390 |
| 879 | Ga0500600_0084144 | 3300053149 | Bacteria | 1713 |
| 880 | Ga0501084_0000583 | 3300054114 | Bacteria | 27895 |
| 881 | Ga0501084_0000970 | 3300054114 | Bacteria | 22234 |
| 882 | Ga0501084_0005641 | 3300054114 | Bacteria | 10275 |
| 883 | Ga0501082_0002881 | 3300060353 | Bacteria | 14996 |
| 884 | Ga0501082_0005193 | 3300060353 | Bacteria | 11323 |
| 885 | Ga0501082_0016883 | 3300060353 | Bacteria | 6286 |
| 886 | Ga0501082_0023386 | 3300060353 | Bacteria | 5330 |
| 887 | Ga0501082_0059567 | 3300060353 | Bacteria | 3291 |
| 888 | Ga0530510_0000013 | 3300061734 | Bacteria | 110065 |
| 889 | Ga0530510_0000632 | 3300061734 | Bacteria | 22653 |
| 890 | Ga0530510_0000696 | 3300061734 | Bacteria | 21768 |
| 891 | Ga0530510_0010498 | 3300061734 | Bacteria | 6492 |
| 892 | Ga0530510_0277731 | 3300061734 | Bacteria | 1251 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014325 | Ga0163163_10052907 | Ga0163163_100529072 | 266 |
| 2 | 3300048914 | Ga0496111_0451696 | Ga0496111_0451696_15_863 | 269 |
| 3 | 3300025942 | Ga0207689_10066420 | Ga0207689_100664202 | 279 |
| 4 | 3300050507 | nmdc:mga05p37_21883_c1 | nmdc:mga05p37_21883_c1_2791_3771 | 286 |
| 5 | 3300006846 | Ga0075430_100021693 | Ga0075430_1000216935 | 288 |
| 6 | 3300006847 | Ga0075431_100007887 | Ga0075431_10000788712 | 288 |
| 7 | 3300009094 | Ga0111539_10059966 | Ga0111539_100599662 | 288 |
| 8 | 3300009147 | Ga0114129_10026801 | Ga0114129_100268012 | 288 |
| 9 | 3300050509 | nmdc:mga0qj67_84568_c1 | nmdc:mga0qj67_84568_c1_455_1462 | 288 |
| 10 | 3300026023 | Ga0207677_10238547 | Ga0207677_102385472 | 291 |
| 11 | 3300042118 | Ga0450914_002455 | Ga0450914_002455_340_1248 | 293 |
| 12 | 3300049569 | Ga0501032_0166369 | Ga0501032_0166369_299_1219 | 293 |
| 13 | 3300049572 | Ga0501036_0019206 | Ga0501036_0019206_1357_2277 | 293 |
| 14 | 3300049574 | Ga0501038_0056352 | Ga0501038_0056352_2151_3071 | 293 |
| 15 | 3300049576 | Ga0501040_0002444 | Ga0501040_0002444_3461_4381 | 293 |
| 16 | 3300049580 | Ga0501046_0064867 | Ga0501046_0064867_596_1516 | 293 |
| 17 | 3300049582 | Ga0501048_0006439 | Ga0501048_0006439_2806_3726 | 293 |
| 18 | 3300049587 | Ga0501071_0021452 | Ga0501071_0021452_2245_3165 | 293 |
| 19 | 3300049588 | Ga0501072_0009084 | Ga0501072_0009084_492_1412 | 293 |
| 20 | 3300049591 | Ga0501075_0009624 | Ga0501075_0009624_4960_5880 | 293 |
| 21 | 3300049592 | Ga0501076_0047177 | Ga0501076_0047177_2305_3225 | 293 |
| 22 | 3300060353 | Ga0501082_0023386 | Ga0501082_0023386_1780_2700 | 293 |
| 23 | 3300046491 | Ga0495584_0080331 | Ga0495584_0080331_39_1022 | 294 |
| 24 | 3300046664 | Ga0495659_0014854 | Ga0495659_0014854_1561_2544 | 294 |
| 25 | 3300042012 | Ga0439455_0007675 | Ga0439455_0007675_479_1387 | 295 |
| 26 | 3300005436 | Ga0070713_100273355 | Ga0070713_1002733552 | 296 |
| 27 | 3300009094 | Ga0111539_10000164 | Ga0111539_1000016424 | 296 |
| 28 | 3300026095 | Ga0207676_10441340 | Ga0207676_104413402 | 296 |
| 29 | 3300036401 | Ga0373937_0324678 | Ga0373937_0324678_67_1026 | 296 |
| 30 | 3300049576 | Ga0501040_0269799 | Ga0501040_0269799_40_981 | 296 |
| 31 | 3300049587 | Ga0501071_0251608 | Ga0501071_0251608_331_1272 | 296 |
| 32 | 3300049742 | Ga0501080_0335111 | Ga0501080_0335111_376_1317 | 296 |
| 33 | 3300050511 | nmdc:mga08y16_733_c1 | nmdc:mga08y16_733_c1_12604_13533 | 296 |
| 34 | 3300005366 | Ga0070659_100040250 | Ga0070659_1000402502 | 297 |
| 35 | 3300005439 | Ga0070711_100153506 | Ga0070711_1001535062 | 297 |
| 36 | 3300005457 | Ga0070662_100001886 | Ga0070662_1000018867 | 297 |
| 37 | 3300006844 | Ga0075428_100011053 | Ga0075428_1000110538 | 297 |
| 38 | 3300009094 | Ga0111539_10005251 | Ga0111539_1000525115 | 297 |
| 39 | 3300025915 | Ga0207693_10141736 | Ga0207693_101417361 | 297 |
| 40 | 3300025932 | Ga0207690_10035249 | Ga0207690_100352492 | 297 |
| 41 | 3300027907 | Ga0207428_10009996 | Ga0207428_100099963 | 297 |
| 42 | 3300028381 | Ga0268264_10339688 | Ga0268264_103396882 | 297 |
| 43 | 3300046538 | Ga0495609_0089780 | Ga0495609_0089780_155_1228 | 297 |
| 44 | 3300049569 | Ga0501032_0024192 | Ga0501032_0024192_2554_3495 | 297 |
| 45 | 3300049571 | Ga0501034_0189348 | Ga0501034_0189348_192_1133 | 297 |
| 46 | 3300050507 | nmdc:mga05p37_460825_c1 | nmdc:mga05p37_460825_c1_403_1407 | 297 |
| 47 | 3300050511 | nmdc:mga08y16_13240_c1 | nmdc:mga08y16_13240_c1_3510_4505 | 297 |
| 48 | 3300006846 | Ga0075430_100025130 | Ga0075430_1000251303 | 298 |
| 49 | 3300006847 | Ga0075431_100001516 | Ga0075431_10000151614 | 298 |
| 50 | 3300006871 | Ga0075434_100248517 | Ga0075434_1002485172 | 298 |
| 51 | 3300009147 | Ga0114129_10446343 | Ga0114129_104463432 | 298 |
| 52 | 3300009553 | Ga0105249_10115320 | Ga0105249_101153202 | 298 |
| 53 | 3300025961 | Ga0207712_10241943 | Ga0207712_102419432 | 298 |
| 54 | 3300027512 | Ga0209179_1001588 | Ga0209179_10015882 | 298 |
| 55 | 3300027907 | Ga0207428_10013268 | Ga0207428_100132686 | 298 |
| 56 | 3300031507 | Ga0307509_10191332 | Ga0307509_101913322 | 298 |
| 57 | 3300031727 | Ga0316576_10000338 | Ga0316576_100003389 | 298 |
| 58 | 3300031728 | Ga0316578_10004402 | Ga0316578_100044022 | 298 |
| 59 | 3300035398 | Ga0316574_0006476 | Ga0316574_0006476_2669_3697 | 298 |
| 60 | 3300036647 | Ga0316582_0008819 | Ga0316582_0008819_3495_4523 | 298 |
| 61 | 3300048908 | Ga0496105_0168551 | Ga0496105_0168551_560_1495 | 298 |
| 62 | 3300050509 | nmdc:mga0qj67_56364_c1 | nmdc:mga0qj67_56364_c1_1131_2216 | 298 |
| 63 | 3300053077 | Ga0495601_0041357 | Ga0495601_0041357_869_1921 | 298 |
| 64 | 3300053084 | Ga0495595_0050572 | Ga0495595_0050572_187_1239 | 298 |
| 65 | 3300046459 | Ga0495629_0131648 | Ga0495629_0131648_246_1235 | 299 |
| 66 | 3300046472 | Ga0495580_0001173 | Ga0495580_0001173_6511_7539 | 299 |
| 67 | 3300046491 | Ga0495584_0000005 | Ga0495584_0000005_207394_208422 | 299 |
| 68 | 3300046507 | Ga0495606_0018041 | Ga0495606_0018041_1209_2237 | 299 |
| 69 | 3300046678 | Ga0495599_0008532 | Ga0495599_0008532_1723_2751 | 299 |
| 70 | 3300046683 | Ga0495658_0127736 | Ga0495658_0127736_40_1140 | 299 |
| 71 | 3300046689 | Ga0495613_0217792 | Ga0495613_0217792_293_1282 | 299 |
| 72 | 3300047320 | Ga0495672_0008285 | Ga0495672_0008285_3022_3942 | 299 |
| 73 | 3300047322 | Ga0495680_0102827 | Ga0495680_0102827_152_1141 | 299 |
| 74 | 3300048088 | Ga0495602_0033049 | Ga0495602_0033049_1643_2671 | 299 |
| 75 | 3300048914 | Ga0496111_0251141 | Ga0496111_0251141_202_1152 | 299 |
| 76 | iso_pu_bacteria | 2941531003 | 2941538213 | 299 |
| 77 | 3300005364 | Ga0070673_100039134 | Ga0070673_1000391342 | 300 |
| 78 | 3300005365 | Ga0070688_100000851 | Ga0070688_10000085128 | 300 |
| 79 | 3300005366 | Ga0070659_100222707 | Ga0070659_1002227072 | 300 |
| 80 | 3300005466 | Ga0070685_10008294 | Ga0070685_100082943 | 300 |
| 81 | 3300005564 | Ga0070664_100085440 | Ga0070664_1000854402 | 300 |
| 82 | 3300009148 | Ga0105243_10041016 | Ga0105243_100410162 | 300 |
| 83 | 3300009177 | Ga0105248_10157208 | Ga0105248_101572082 | 300 |
| 84 | 3300010375 | Ga0105239_10108509 | Ga0105239_101085092 | 300 |
| 85 | 3300025901 | Ga0207688_10011591 | Ga0207688_100115912 | 300 |
| 86 | 3300025945 | Ga0207679_10174625 | Ga0207679_101746252 | 300 |
| 87 | 3300025960 | Ga0207651_10031128 | Ga0207651_100311283 | 300 |
| 88 | 3300037471 | Ga0395905_0352875 | Ga0395905_0352875_303_1313 | 300 |
| 89 | 3300042439 | Ga0439464_0019438 | Ga0439464_0019438_703_1611 | 300 |
| 90 | 3300048912 | Ga0496109_0047294 | Ga0496109_0047294_2420_3328 | 300 |
| 91 | 3300048917 | Ga0496114_0038768 | Ga0496114_0038768_2714_3622 | 300 |
| 92 | iso_pu_bacteria | 2513237098 | 2513670827 | 300 |
| 93 | iso_pu_bacteria | 2885383462 | 2885386868 | 300 |
| 94 | iso_pu_bacteria | 2903768456 | 2903769063 | 300 |
| 95 | 3300005353 | Ga0070669_100169127 | Ga0070669_1001691271 | 301 |
| 96 | 3300005367 | Ga0070667_100262191 | Ga0070667_1002621911 | 301 |
| 97 | 3300005434 | Ga0070709_10230513 | Ga0070709_102305132 | 301 |
| 98 | 3300005437 | Ga0070710_10084035 | Ga0070710_100840352 | 301 |
| 99 | 3300005548 | Ga0070665_100004780 | Ga0070665_1000047805 | 301 |
| 100 | 3300005937 | Ga0081455_10002826 | Ga0081455_1000282617 | 301 |
| 101 | 3300005983 | Ga0081540_1069182 | Ga0081540_10691821 | 301 |
| 102 | 3300006038 | Ga0075365_10007515 | Ga0075365_100075156 | 301 |
| 103 | 3300006175 | Ga0070712_100061217 | Ga0070712_1000612175 | 301 |
| 104 | 3300009148 | Ga0105243_10445690 | Ga0105243_104456901 | 301 |
| 105 | 3300009177 | Ga0105248_10382060 | Ga0105248_103820601 | 301 |
| 106 | 3300009551 | Ga0105238_10005657 | Ga0105238_100056576 | 301 |
| 107 | 3300009551 | Ga0105238_10124752 | Ga0105238_101247522 | 301 |
| 108 | 3300010375 | Ga0105239_10515830 | Ga0105239_105158301 | 301 |
| 109 | 3300013308 | Ga0157375_10109686 | Ga0157375_101096863 | 301 |
| 110 | 3300014969 | Ga0157376_10152912 | Ga0157376_101529121 | 301 |
| 111 | 3300025898 | Ga0207692_10099733 | Ga0207692_100997332 | 301 |
| 112 | 3300025906 | Ga0207699_10100289 | Ga0207699_101002892 | 301 |
| 113 | 3300025915 | Ga0207693_10041075 | Ga0207693_100410755 | 301 |
| 114 | 3300025916 | Ga0207663_10136442 | Ga0207663_101364422 | 301 |
| 115 | 3300025924 | Ga0207694_10209344 | Ga0207694_102093442 | 301 |
| 116 | 3300025925 | Ga0207650_10179450 | Ga0207650_101794502 | 301 |
| 117 | 3300026067 | Ga0207678_10217604 | Ga0207678_102176042 | 301 |
| 118 | 3300028379 | Ga0268266_10001206 | Ga0268266_100012066 | 301 |
| 119 | 3300028380 | Ga0268265_10127667 | Ga0268265_101276672 | 301 |
| 120 | 3300033180 | Ga0307510_10032760 | Ga0307510_100327603 | 301 |
| 121 | 3300035083 | Ga0373926_0045688 | Ga0373926_0045688_487_1506 | 301 |
| 122 | 3300035111 | Ga0373923_0005923 | Ga0373923_0005923_1223_2242 | 301 |
| 123 | 3300035111 | Ga0373923_0051439 | Ga0373923_0051439_124_1191 | 301 |
| 124 | 3300035116 | Ga0373945_0034316 | Ga0373945_0034316_238_1257 | 301 |
| 125 | 3300035119 | Ga0373956_0004182 | Ga0373956_0004182_1928_2995 | 301 |
| 126 | 3300035120 | Ga0373957_0025363 | Ga0373957_0025363_206_1273 | 301 |
| 127 | 3300035172 | Ga0373955_0042476 | Ga0373955_0042476_777_1796 | 301 |
| 128 | 3300035410 | Ga0373924_0055516 | Ga0373924_0055516_489_1508 | 301 |
| 129 | 3300035692 | Ga0373935_0147360 | Ga0373935_0147360_340_1359 | 301 |
| 130 | 3300035695 | Ga0373927_0076563 | Ga0373927_0076563_316_1335 | 301 |
| 131 | 3300035724 | Ga0373933_0007691 | Ga0373933_0007691_4408_5475 | 301 |
| 132 | 3300035724 | Ga0373933_0186726 | Ga0373933_0186726_240_1259 | 301 |
| 133 | 3300036401 | Ga0373937_0013422 | Ga0373937_0013422_6176_7189 | 301 |
| 134 | 3300036401 | Ga0373937_0038316 | Ga0373937_0038316_1201_2220 | 301 |
| 135 | 3300037068 | Ga0373925_0148524 | Ga0373925_0148524_480_1499 | 301 |
| 136 | 3300042439 | Ga0439464_0011158 | Ga0439464_0011158_568_1584 | 301 |
| 137 | 3300046452 | Ga0495617_027151 | Ga0495617_027151_425_1444 | 301 |
| 138 | 3300046454 | Ga0495592_0020215 | Ga0495592_0020215_3197_4264 | 301 |
| 139 | 3300046454 | Ga0495592_0167023 | Ga0495592_0167023_195_1214 | 301 |
| 140 | 3300046455 | Ga0495603_0100912 | Ga0495603_0100912_642_1661 | 301 |
| 141 | 3300046459 | Ga0495629_0100043 | Ga0495629_0100043_84_1151 | 301 |
| 142 | 3300046459 | Ga0495629_0134350 | Ga0495629_0134350_282_1301 | 301 |
| 143 | 3300046462 | Ga0495651_0022494 | Ga0495651_0022494_3127_4146 | 301 |
| 144 | 3300046463 | Ga0495653_0005591 | Ga0495653_0005591_6697_7764 | 301 |
| 145 | 3300046463 | Ga0495653_0043858 | Ga0495653_0043858_2098_3117 | 301 |
| 146 | 3300046472 | Ga0495580_0185535 | Ga0495580_0185535_185_1249 | 301 |
| 147 | 3300046476 | Ga0495662_0020041 | Ga0495662_0020041_171_1190 | 301 |
| 148 | 3300046477 | Ga0495664_0015231 | Ga0495664_0015231_1415_2434 | 301 |
| 149 | 3300046491 | Ga0495584_0072395 | Ga0495584_0072395_462_1481 | 301 |
| 150 | 3300046492 | Ga0495585_0024011 | Ga0495585_0024011_267_1286 | 301 |
| 151 | 3300046499 | Ga0495594_0113172 | Ga0495594_0113172_234_1301 | 301 |
| 152 | 3300046501 | Ga0495607_0019910 | Ga0495607_0019910_265_1284 | 301 |
| 153 | 3300046511 | Ga0495608_0042656 | Ga0495608_0042656_38_1105 | 301 |
| 154 | 3300046514 | Ga0495618_0002676 | Ga0495618_0002676_7694_8761 | 301 |
| 155 | 3300046514 | Ga0495618_0010917 | Ga0495618_0010917_119_1138 | 301 |
| 156 | 3300046516 | Ga0495628_0289923 | Ga0495628_0289923_24_1043 | 301 |
| 157 | 3300046517 | Ga0495630_0003589 | Ga0495630_0003589_690_1709 | 301 |
| 158 | 3300046517 | Ga0495630_0046616 | Ga0495630_0046616_63_1130 | 301 |
| 159 | 3300046520 | Ga0495637_0102763 | Ga0495637_0102763_73_1092 | 301 |
| 160 | 3300046523 | Ga0495644_0035871 | Ga0495644_0035871_629_1648 | 301 |
| 161 | 3300046525 | Ga0495663_0015205 | Ga0495663_0015205_718_1776 | 301 |
| 162 | 3300046526 | Ga0495666_0054396 | Ga0495666_0054396_588_1607 | 301 |
| 163 | 3300046529 | Ga0495652_0019749 | Ga0495652_0019749_2572_3591 | 301 |
| 164 | 3300046529 | Ga0495652_0187095 | Ga0495652_0187095_544_1557 | 301 |
| 165 | 3300046533 | Ga0495640_0011004 | Ga0495640_0011004_3974_5041 | 301 |
| 166 | 3300046535 | Ga0495586_0045951 | Ga0495586_0045951_635_1654 | 301 |
| 167 | 3300046535 | Ga0495586_0113780 | Ga0495586_0113780_206_1273 | 301 |
| 168 | 3300046536 | Ga0495587_0002769 | Ga0495587_0002769_4897_5964 | 301 |
| 169 | 3300046537 | Ga0495598_0014740 | Ga0495598_0014740_369_1385 | 301 |
| 170 | 3300046543 | Ga0495645_0004016 | Ga0495645_0004016_5954_7021 | 301 |
| 171 | 3300046543 | Ga0495645_0179292 | Ga0495645_0179292_205_1224 | 301 |
| 172 | 3300046557 | Ga0495622_0077285 | Ga0495622_0077285_438_1457 | 301 |
| 173 | 3300046558 | Ga0495633_0023749 | Ga0495633_0023749_1065_2084 | 301 |
| 174 | 3300046559 | Ga0495667_0002063 | Ga0495667_0002063_9999_11018 | 301 |
| 175 | 3300046559 | Ga0495667_0010593 | Ga0495667_0010593_2844_3911 | 301 |
| 176 | 3300046615 | Ga0495656_0029998 | Ga0495656_0029998_379_1398 | 301 |
| 177 | 3300046642 | Ga0495634_0073892 | Ga0495634_0073892_13_1080 | 301 |
| 178 | 3300046648 | Ga0495611_0045768 | Ga0495611_0045768_379_1398 | 301 |
| 179 | 3300046663 | Ga0495635_0069760 | Ga0495635_0069760_1303_2370 | 301 |
| 180 | 3300046665 | Ga0495661_0131618 | Ga0495661_0131618_254_1273 | 301 |
| 181 | 3300046674 | Ga0495588_0045188 | Ga0495588_0045188_642_1661 | 301 |
| 182 | 3300046675 | Ga0495657_0029251 | Ga0495657_0029251_206_1273 | 301 |
| 183 | 3300046679 | Ga0495623_0004038 | Ga0495623_0004038_2474_3541 | 301 |
| 184 | 3300046680 | Ga0495646_0108646 | Ga0495646_0108646_49_1068 | 301 |
| 185 | 3300046681 | Ga0495647_0008477 | Ga0495647_0008477_1939_2958 | 301 |
| 186 | 3300046683 | Ga0495658_0002446 | Ga0495658_0002446_44_1063 | 301 |
| 187 | 3300046684 | Ga0495669_0058084 | Ga0495669_0058084_542_1561 | 301 |
| 188 | 3300046689 | Ga0495613_0013468 | Ga0495613_0013468_2428_3447 | 301 |
| 189 | 3300046689 | Ga0495613_0062744 | Ga0495613_0062744_474_1541 | 301 |
| 190 | 3300046690 | Ga0495624_0016059 | Ga0495624_0016059_3190_4209 | 301 |
| 191 | 3300046794 | Ga0495589_0074262 | Ga0495589_0074262_232_1251 | 301 |
| 192 | 3300046809 | Ga0495600_0002596 | Ga0495600_0002596_5569_6636 | 301 |
| 193 | 3300046809 | Ga0495600_0005724 | Ga0495600_0005724_522_1541 | 301 |
| 194 | 3300047317 | Ga0495604_0019876 | Ga0495604_0019876_855_1874 | 301 |
| 195 | 3300047317 | Ga0495604_0042140 | Ga0495604_0042140_392_1459 | 301 |
| 196 | 3300047322 | Ga0495680_0002298 | Ga0495680_0002298_15594_16613 | 301 |
| 197 | 3300047322 | Ga0495680_0013843 | Ga0495680_0013843_214_1281 | 301 |
| 198 | 3300047444 | Ga0495675_0002616 | Ga0495675_0002616_2117_3184 | 301 |
| 199 | 3300047446 | Ga0495679_054652 | Ga0495679_054652_142_1161 | 301 |
| 200 | 3300047471 | Ga0495684_0030151 | Ga0495684_0030151_1433_2500 | 301 |
| 201 | 3300047673 | Ga0495593_0009266 | Ga0495593_0009266_4356_5375 | 301 |
| 202 | 3300047673 | Ga0495593_0035745 | Ga0495593_0035745_1087_2154 | 301 |
| 203 | 3300048088 | Ga0495602_0072169 | Ga0495602_0072169_1600_2667 | 301 |
| 204 | 3300048089 | Ga0495614_0069554 | Ga0495614_0069554_21_1040 | 301 |
| 205 | 3300048903 | Ga0496100_0277280 | Ga0496100_0277280_177_1235 | 301 |
| 206 | 3300048905 | Ga0496102_0409027 | Ga0496102_0409027_134_1192 | 301 |
| 207 | 3300048907 | Ga0496104_0261356 | Ga0496104_0261356_119_1177 | 301 |
| 208 | 3300048909 | Ga0496106_0062560 | Ga0496106_0062560_1708_2739 | 301 |
| 209 | 3300048909 | Ga0496106_0120430 | Ga0496106_0120430_49_1107 | 301 |
| 210 | 3300048914 | Ga0496111_0208628 | Ga0496111_0208628_369_1430 | 301 |
| 211 | 3300048918 | Ga0496115_0032592 | Ga0496115_0032592_2194_3261 | 301 |
| 212 | 3300048918 | Ga0496115_0422934 | Ga0496115_0422934_41_952 | 301 |
| 213 | 3300048924 | Ga0496121_0000194 | Ga0496121_0000194_62939_63997 | 301 |
| 214 | 3300048924 | Ga0496121_0001789 | Ga0496121_0001789_20663_21721 | 301 |
| 215 | 3300048929 | Ga0496126_0009087 | Ga0496126_0009087_7787_8845 | 301 |
| 216 | 3300053077 | Ga0495601_0001360 | Ga0495601_0001360_12012_13031 | 301 |
| 217 | 3300053078 | Ga0495612_0002589 | Ga0495612_0002589_6406_7425 | 301 |
| 218 | 3300053084 | Ga0495595_0126832 | Ga0495595_0126832_27_1040 | 301 |
| 219 | iso_pu_bacteria | 2824661429 | 2824669013 | 301 |
| 220 | iso_pu_bacteria | 2932784394 | 2932788977 | 301 |
| 221 | iso_pu_bacteria | 2932828146 | 2932834544 | 301 |
| 222 | iso_pu_bacteria | 2935616580 | 2935624526 | 301 |
| 223 | iso_pu_bacteria | 2935638405 | 2935645916 | 301 |
| 224 | iso_pu_bacteria | 2935665750 | 2935673483 | 301 |
| 225 | iso_pu_bacteria | 2935675223 | 2935682660 | 301 |
| 226 | iso_pu_bacteria | 2935684952 | 2935693536 | 301 |
| 227 | iso_pu_bacteria | 2935694250 | 2935701595 | 301 |
| 228 | iso_pu_bacteria | 2935703347 | 2935710431 | 301 |
| 229 | iso_pu_bacteria | 2935801545 | 2935806128 | 301 |
| 230 | iso_pu_bacteria | 2935810662 | 2935816893 | 301 |
| 231 | iso_pu_bacteria | 2935827899 | 2935835183 | 301 |
| 232 | iso_pu_bacteria | 2935837841 | 2935841436 | 301 |
| 233 | iso_pu_bacteria | 2935855204 | 2935862997 | 301 |
| 234 | iso_pu_bacteria | 2935864058 | 2935871807 | 301 |
| 235 | iso_pu_bacteria | 2935873716 | 2935882302 | 301 |
| 236 | iso_pu_bacteria | 2935992306 | 2936000127 | 301 |
| 237 | iso_pu_bacteria | 2936002035 | 2936010041 | 301 |
| 238 | iso_pu_bacteria | 2936037263 | 2936043884 | 301 |
| 239 | iso_pu_bacteria | 2941538514 | 2941543662 | 301 |
| 240 | iso_pu_bacteria | 8016511872 | 8016517825 | 301 |
| 241 | iso_pu_bacteria | 8017057580 | 8017058805 | 301 |
| 242 | iso_pu_bacteria | 8019576017 | 8019576852 | 301 |
| 243 | iso_pu_bacteria | 8019586578 | 8019594901 | 301 |
| 244 | iso_pu_bacteria | 8019608314 | 8019611675 | 301 |
| 245 | 3300005338 | Ga0068868_100043185 | Ga0068868_1000431853 | 302 |
| 246 | 3300005354 | Ga0070675_100035588 | Ga0070675_1000355883 | 302 |
| 247 | 3300005365 | Ga0070688_100064309 | Ga0070688_1000643092 | 302 |
| 248 | 3300005437 | Ga0070710_10156626 | Ga0070710_101566262 | 302 |
| 249 | 3300005456 | Ga0070678_100021755 | Ga0070678_1000217554 | 302 |
| 250 | 3300005549 | Ga0070704_100038038 | Ga0070704_1000380383 | 302 |
| 251 | 3300005564 | Ga0070664_100056116 | Ga0070664_1000561164 | 302 |
| 252 | 3300005614 | Ga0068856_100069184 | Ga0068856_1000691842 | 302 |
| 253 | 3300005617 | Ga0068859_100388711 | Ga0068859_1003887112 | 302 |
| 254 | 3300005618 | Ga0068864_100006902 | Ga0068864_1000069026 | 302 |
| 255 | 3300005841 | Ga0068863_100256446 | Ga0068863_1002564462 | 302 |
| 256 | 3300005937 | Ga0081455_10000949 | Ga0081455_1000094935 | 302 |
| 257 | 3300006931 | Ga0097620_100388637 | Ga0097620_1003886372 | 302 |
| 258 | 3300009094 | Ga0111539_10324273 | Ga0111539_103242732 | 302 |
| 259 | 3300009098 | Ga0105245_10053297 | Ga0105245_100532972 | 302 |
| 260 | 3300009148 | Ga0105243_10060504 | Ga0105243_100605042 | 302 |
| 261 | 3300009177 | Ga0105248_10055105 | Ga0105248_100551052 | 302 |
| 262 | 3300011119 | Ga0105246_10092722 | Ga0105246_100927222 | 302 |
| 263 | 3300013296 | Ga0157374_10012881 | Ga0157374_100128813 | 302 |
| 264 | 3300013307 | Ga0157372_10310406 | Ga0157372_103104062 | 302 |
| 265 | 3300013308 | Ga0157375_10115108 | Ga0157375_101151082 | 302 |
| 266 | 3300014325 | Ga0163163_10395601 | Ga0163163_103956012 | 302 |
| 267 | 3300025908 | Ga0207643_10152440 | Ga0207643_101524401 | 302 |
| 268 | 3300025944 | Ga0207661_10022062 | Ga0207661_100220623 | 302 |
| 269 | 3300025945 | Ga0207679_10027170 | Ga0207679_100271702 | 302 |
| 270 | 3300026067 | Ga0207678_10014744 | Ga0207678_100147445 | 302 |
| 271 | 3300026075 | Ga0207708_10018339 | Ga0207708_100183394 | 302 |
| 272 | 3300026088 | Ga0207641_10253681 | Ga0207641_102536812 | 302 |
| 273 | 3300026095 | Ga0207676_10066841 | Ga0207676_100668413 | 302 |
| 274 | 3300028800 | Ga0265338_10031037 | Ga0265338_100310373 | 302 |
| 275 | 3300046615 | Ga0495656_0100810 | Ga0495656_0100810_378_1292 | 302 |
| 276 | 3300047322 | Ga0495680_0010629 | Ga0495680_0010629_315_1238 | 302 |
| 277 | 3300047471 | Ga0495684_0130828 | Ga0495684_0130828_743_1666 | 302 |
| 278 | 3300048904 | Ga0496101_0010440 | Ga0496101_0010440_790_1704 | 302 |
| 279 | 3300048907 | Ga0496104_0008974 | Ga0496104_0008974_1924_2838 | 302 |
| 280 | 3300048908 | Ga0496105_0417979 | Ga0496105_0417979_57_971 | 302 |
| 281 | 3300048911 | Ga0496108_0011231 | Ga0496108_0011231_4145_5059 | 302 |
| 282 | 3300048912 | Ga0496109_0090528 | Ga0496109_0090528_1077_1991 | 302 |
| 283 | 3300048913 | Ga0496110_0076484 | Ga0496110_0076484_1168_2082 | 302 |
| 284 | iso_pu_bacteria | 2939657138 | 2939660606 | 302 |
| 285 | 3300005355 | Ga0070671_100410209 | Ga0070671_1004102092 | 303 |
| 286 | 3300005367 | Ga0070667_100110329 | Ga0070667_1001103292 | 303 |
| 287 | 3300005466 | Ga0070685_10121091 | Ga0070685_101210911 | 303 |
| 288 | 3300005535 | Ga0070684_100302479 | Ga0070684_1003024792 | 303 |
| 289 | 3300006881 | Ga0068865_100068637 | Ga0068865_1000686372 | 303 |
| 290 | 3300009094 | Ga0111539_10558400 | Ga0111539_105584002 | 303 |
| 291 | 3300009147 | Ga0114129_10267198 | Ga0114129_102671982 | 303 |
| 292 | 3300009148 | Ga0105243_10003664 | Ga0105243_1000366411 | 303 |
| 293 | 3300013306 | Ga0163162_10253056 | Ga0163162_102530563 | 303 |
| 294 | 3300014326 | Ga0157380_10087027 | Ga0157380_100870273 | 303 |
| 295 | 3300014969 | Ga0157376_10181951 | Ga0157376_101819512 | 303 |
| 296 | 3300017792 | Ga0163161_10264549 | Ga0163161_102645492 | 303 |
| 297 | 3300025927 | Ga0207687_10082177 | Ga0207687_100821773 | 303 |
| 298 | 3300025944 | Ga0207661_10433024 | Ga0207661_104330242 | 303 |
| 299 | 3300031901 | Ga0307406_10288143 | Ga0307406_102881432 | 303 |
| 300 | 3300032005 | Ga0307411_10230658 | Ga0307411_102306582 | 303 |
| 301 | 3300032126 | Ga0307415_100097799 | Ga0307415_1000977992 | 303 |
| 302 | 3300037466 | Ga0395898_0526001 | Ga0395898_0526001_26_952 | 303 |
| 303 | 3300048907 | Ga0496104_0218736 | Ga0496104_0218736_141_1073 | 303 |
| 304 | 3300049575 | Ga0501039_0005795 | Ga0501039_0005795_6460_7377 | 303 |
| 305 | 3300049576 | Ga0501040_0077744 | Ga0501040_0077744_321_1241 | 303 |
| 306 | 3300049577 | Ga0501041_0016957 | Ga0501041_0016957_3025_3945 | 303 |
| 307 | 3300049578 | Ga0501042_0002659 | Ga0501042_0002659_2162_3082 | 303 |
| 308 | 3300049579 | Ga0501043_0018311 | Ga0501043_0018311_1675_2595 | 303 |
| 309 | 3300049581 | Ga0501047_0252291 | Ga0501047_0252291_236_1156 | 303 |
| 310 | 3300049582 | Ga0501048_0015041 | Ga0501048_0015041_289_1209 | 303 |
| 311 | 3300049582 | Ga0501048_0082728 | Ga0501048_0082728_446_1363 | 303 |
| 312 | 3300049584 | Ga0501068_0003313 | Ga0501068_0003313_5555_6475 | 303 |
| 313 | 3300049587 | Ga0501071_0022642 | Ga0501071_0022642_241_1161 | 303 |
| 314 | 3300049587 | Ga0501071_0099615 | Ga0501071_0099615_1178_2095 | 303 |
| 315 | 3300049588 | Ga0501072_0000860 | Ga0501072_0000860_17833_18750 | 303 |
| 316 | 3300049590 | Ga0501074_0031894 | Ga0501074_0031894_2889_3806 | 303 |
| 317 | 3300049591 | Ga0501075_0008589 | Ga0501075_0008589_3151_4068 | 303 |
| 318 | 3300049592 | Ga0501076_0002969 | Ga0501076_0002969_8744_9661 | 303 |
| 319 | 3300049592 | Ga0501076_0196746 | Ga0501076_0196746_404_1324 | 303 |
| 320 | 3300049593 | Ga0501077_0011109 | Ga0501077_0011109_3188_4108 | 303 |
| 321 | 3300049593 | Ga0501077_0072059 | Ga0501077_0072059_883_1800 | 303 |
| 322 | 3300049741 | Ga0501079_0037086 | Ga0501079_0037086_375_1292 | 303 |
| 323 | 3300049741 | Ga0501079_0181029 | Ga0501079_0181029_321_1241 | 303 |
| 324 | 3300049743 | Ga0501081_0014471 | Ga0501081_0014471_1147_2064 | 303 |
| 325 | 3300049743 | Ga0501081_0015776 | Ga0501081_0015776_3664_4584 | 303 |
| 326 | 3300049744 | Ga0501083_0007199 | Ga0501083_0007199_3550_4470 | 303 |
| 327 | 3300049822 | Ga0501035_0019343 | Ga0501035_0019343_229_1149 | 303 |
| 328 | 3300049822 | Ga0501035_0072175 | Ga0501035_0072175_888_1805 | 303 |
| 329 | 3300049824 | Ga0501045_0003184 | Ga0501045_0003184_102_1019 | 303 |
| 330 | 3300050507 | nmdc:mga05p37_219602_c1 | nmdc:mga05p37_219602_c1_1262_2179 | 303 |
| 331 | 3300050511 | nmdc:mga08y16_366142_c1 | nmdc:mga08y16_366142_c1_97_1014 | 303 |
| 332 | 3300054114 | Ga0501084_0005641 | Ga0501084_0005641_8146_9063 | 303 |
| 333 | 3300060353 | Ga0501082_0016883 | Ga0501082_0016883_1798_2715 | 303 |
| 334 | 3300060353 | Ga0501082_0059567 | Ga0501082_0059567_1239_2159 | 303 |
| 335 | 3300061734 | Ga0530510_0000696 | Ga0530510_0000696_18603_19520 | 303 |
| 336 | 3300005842 | Ga0068858_100113135 | Ga0068858_1001131353 | 304 |
| 337 | 3300006844 | Ga0075428_100000974 | Ga0075428_10000097415 | 304 |
| 338 | 3300006846 | Ga0075430_100039143 | Ga0075430_1000391433 | 304 |
| 339 | 3300006847 | Ga0075431_100001616 | Ga0075431_10000161611 | 304 |
| 340 | 3300006880 | Ga0075429_100001011 | Ga0075429_10000101110 | 304 |
| 341 | 3300009098 | Ga0105245_10419749 | Ga0105245_104197492 | 304 |
| 342 | 3300009147 | Ga0114129_10001975 | Ga0114129_1000197510 | 304 |
| 343 | 3300009177 | Ga0105248_10191101 | Ga0105248_101911012 | 304 |
| 344 | 3300013307 | Ga0157372_10501017 | Ga0157372_105010172 | 304 |
| 345 | 3300013308 | Ga0157375_10146736 | Ga0157375_101467362 | 304 |
| 346 | 3300026067 | Ga0207678_10403110 | Ga0207678_104031102 | 304 |
| 347 | 3300031852 | Ga0307410_10148596 | Ga0307410_101485961 | 304 |
| 348 | 3300031995 | Ga0307409_100027954 | Ga0307409_1000279544 | 304 |
| 349 | 3300031995 | Ga0307409_100137754 | Ga0307409_1001377542 | 304 |
| 350 | 3300032002 | Ga0307416_100125375 | Ga0307416_1001253751 | 304 |
| 351 | 3300032126 | Ga0307415_100192805 | Ga0307415_1001928051 | 304 |
| 352 | 3300046463 | Ga0495653_0193078 | Ga0495653_0193078_200_1126 | 304 |
| 353 | 3300046473 | Ga0495582_0096835 | Ga0495582_0096835_156_1076 | 304 |
| 354 | 3300048904 | Ga0496101_0468543 | Ga0496101_0468543_26_970 | 304 |
| 355 | 3300050507 | nmdc:mga05p37_3524_c1 | nmdc:mga05p37_3524_c1_12823_13764 | 304 |
| 356 | 3300050508 | nmdc:mga09592_17151_c1 | nmdc:mga09592_17151_c1_3610_4551 | 304 |
| 357 | 3300050509 | nmdc:mga0qj67_2071_c1 | nmdc:mga0qj67_2071_c1_2728_3669 | 304 |
| 358 | 3300047322 | Ga0495680_0002570 | Ga0495680_0002570_6906_7829 | 305 |
| 359 | 3300005329 | Ga0070683_100001559 | Ga0070683_10000155917 | 306 |
| 360 | 3300005337 | Ga0070682_100039364 | Ga0070682_1000393644 | 306 |
| 361 | 3300005341 | Ga0070691_10094643 | Ga0070691_100946432 | 306 |
| 362 | 3300005366 | Ga0070659_100361252 | Ga0070659_1003612522 | 306 |
| 363 | 3300005455 | Ga0070663_100209428 | Ga0070663_1002094282 | 306 |
| 364 | 3300005458 | Ga0070681_10002312 | Ga0070681_100023129 | 306 |
| 365 | 3300005547 | Ga0070693_100023508 | Ga0070693_1000235083 | 306 |
| 366 | 3300005614 | Ga0068856_100011064 | Ga0068856_10001106411 | 306 |
| 367 | 3300006881 | Ga0068865_100260418 | Ga0068865_1002604182 | 306 |
| 368 | 3300009098 | Ga0105245_10016616 | Ga0105245_100166165 | 306 |
| 369 | 3300025912 | Ga0207707_10010628 | Ga0207707_100106282 | 306 |
| 370 | 3300025921 | Ga0207652_10008278 | Ga0207652_100082785 | 306 |
| 371 | 3300025927 | Ga0207687_10054649 | Ga0207687_100546492 | 306 |
| 372 | 3300025931 | Ga0207644_10199196 | Ga0207644_101991962 | 306 |
| 373 | 3300025934 | Ga0207686_10164984 | Ga0207686_101649843 | 306 |
| 374 | 3300025944 | Ga0207661_10023870 | Ga0207661_100238704 | 306 |
| 375 | 3300026078 | Ga0207702_10027837 | Ga0207702_100278373 | 306 |
| 376 | 3300026078 | Ga0207702_10034645 | Ga0207702_100346452 | 306 |
| 377 | 3300031730 | Ga0307516_10031692 | Ga0307516_100316924 | 306 |
| 378 | 3300037068 | Ga0373925_0167526 | Ga0373925_0167526_563_1489 | 306 |
| 379 | 3300048903 | Ga0496100_0054431 | Ga0496100_0054431_227_1153 | 306 |
| 380 | 3300048905 | Ga0496102_0006178 | Ga0496102_0006178_4735_5661 | 306 |
| 381 | 3300048906 | Ga0496103_0111364 | Ga0496103_0111364_759_1685 | 306 |
| 382 | 3300048907 | Ga0496104_0000757 | Ga0496104_0000757_26193_27119 | 306 |
| 383 | 3300048907 | Ga0496104_0004139 | Ga0496104_0004139_6062_6988 | 306 |
| 384 | 3300048908 | Ga0496105_0002226 | Ga0496105_0002226_1467_2393 | 306 |
| 385 | 3300048909 | Ga0496106_0087736 | Ga0496106_0087736_1073_1999 | 306 |
| 386 | 3300048910 | Ga0496107_0107688 | Ga0496107_0107688_178_1104 | 306 |
| 387 | 3300048912 | Ga0496109_0008339 | Ga0496109_0008339_939_1865 | 306 |
| 388 | 3300048913 | Ga0496110_0001589 | Ga0496110_0001589_1425_2351 | 306 |
| 389 | 3300048914 | Ga0496111_0001995 | Ga0496111_0001995_10292_11218 | 306 |
| 390 | 3300048914 | Ga0496111_0208863 | Ga0496111_0208863_281_1207 | 306 |
| 391 | 3300048917 | Ga0496114_0001139 | Ga0496114_0001139_17626_18552 | 306 |
| 392 | 3300048917 | Ga0496114_0037181 | Ga0496114_0037181_2913_3839 | 306 |
| 393 | 3300048918 | Ga0496115_0119854 | Ga0496115_0119854_907_1833 | 306 |
| 394 | 3300049585 | Ga0501069_0045790 | Ga0501069_0045790_908_1843 | 306 |
| 395 | 3300053149 | Ga0500600_0084144 | Ga0500600_0084144_339_1268 | 306 |
| 396 | 3300006058 | Ga0075432_10000401 | Ga0075432_100004019 | 307 |
| 397 | 3300006847 | Ga0075431_100048484 | Ga0075431_1000484844 | 307 |
| 398 | 3300007076 | Ga0075435_100022118 | Ga0075435_1000221182 | 307 |
| 399 | 3300009551 | Ga0105238_10261711 | Ga0105238_102617112 | 307 |
| 400 | 3300026075 | Ga0207708_10191654 | Ga0207708_101916542 | 307 |
| 401 | 3300027907 | Ga0207428_10002628 | Ga0207428_100026288 | 307 |
| 402 | 3300031548 | Ga0307408_100338341 | Ga0307408_1003383412 | 307 |
| 403 | 3300031995 | Ga0307409_100106606 | Ga0307409_1001066062 | 307 |
| 404 | 3300032002 | Ga0307416_100171946 | Ga0307416_1001719462 | 307 |
| 405 | 3300032126 | Ga0307415_100381815 | Ga0307415_1003818152 | 307 |
| 406 | 3300035086 | Ga0373934_0077857 | Ga0373934_0077857_17_949 | 307 |
| 407 | 3300035116 | Ga0373945_0009746 | Ga0373945_0009746_1910_2842 | 307 |
| 408 | 3300035725 | Ga0373947_0024089 | Ga0373947_0024089_140_1072 | 307 |
| 409 | 3300036401 | Ga0373937_0061202 | Ga0373937_0061202_2498_3430 | 307 |
| 410 | 3300037068 | Ga0373925_0073967 | Ga0373925_0073967_16_948 | 307 |
| 411 | 3300046454 | Ga0495592_0269943 | Ga0495592_0269943_156_1091 | 307 |
| 412 | 3300046463 | Ga0495653_0018111 | Ga0495653_0018111_4377_5312 | 307 |
| 413 | 3300046463 | Ga0495653_0121063 | Ga0495653_0121063_903_1832 | 307 |
| 414 | 3300046511 | Ga0495608_0042969 | Ga0495608_0042969_839_1771 | 307 |
| 415 | 3300046511 | Ga0495608_0147267 | Ga0495608_0147267_155_1090 | 307 |
| 416 | 3300046514 | Ga0495618_0025147 | Ga0495618_0025147_866_1798 | 307 |
| 417 | 3300046516 | Ga0495628_0243256 | Ga0495628_0243256_272_1207 | 307 |
| 418 | 3300046517 | Ga0495630_0029817 | Ga0495630_0029817_2289_3218 | 307 |
| 419 | 3300046529 | Ga0495652_0045718 | Ga0495652_0045718_394_1329 | 307 |
| 420 | 3300046533 | Ga0495640_0001188 | Ga0495640_0001188_7654_8583 | 307 |
| 421 | 3300046533 | Ga0495640_0121859 | Ga0495640_0121859_739_1671 | 307 |
| 422 | 3300046536 | Ga0495587_0019408 | Ga0495587_0019408_389_1324 | 307 |
| 423 | 3300046543 | Ga0495645_0013960 | Ga0495645_0013960_1783_2718 | 307 |
| 424 | 3300046559 | Ga0495667_0086055 | Ga0495667_0086055_1030_1959 | 307 |
| 425 | 3300046642 | Ga0495634_0033701 | Ga0495634_0033701_1300_2232 | 307 |
| 426 | 3300046642 | Ga0495634_0046446 | Ga0495634_0046446_1151_2080 | 307 |
| 427 | 3300046663 | Ga0495635_0106290 | Ga0495635_0106290_438_1367 | 307 |
| 428 | 3300046663 | Ga0495635_0175655 | Ga0495635_0175655_95_1030 | 307 |
| 429 | 3300046678 | Ga0495599_0029551 | Ga0495599_0029551_403_1338 | 307 |
| 430 | 3300046689 | Ga0495613_0042179 | Ga0495613_0042179_2154_3083 | 307 |
| 431 | 3300046689 | Ga0495613_0047429 | Ga0495613_0047429_1286_2218 | 307 |
| 432 | 3300046809 | Ga0495600_0123417 | Ga0495600_0123417_164_1099 | 307 |
| 433 | 3300047315 | Ga0495581_0049407 | Ga0495581_0049407_396_1328 | 307 |
| 434 | 3300047317 | Ga0495604_0162753 | Ga0495604_0162753_189_1121 | 307 |
| 435 | 3300047317 | Ga0495604_0308136 | Ga0495604_0308136_107_1036 | 307 |
| 436 | 3300047319 | Ga0495674_0001467 | Ga0495674_0001467_7589_8518 | 307 |
| 437 | 3300047319 | Ga0495674_0088391 | Ga0495674_0088391_568_1500 | 307 |
| 438 | 3300047319 | Ga0495674_0321624 | Ga0495674_0321624_313_1248 | 307 |
| 439 | 3300047322 | Ga0495680_0016453 | Ga0495680_0016453_4563_5498 | 307 |
| 440 | 3300047322 | Ga0495680_0018429 | Ga0495680_0018429_4479_5414 | 307 |
| 441 | 3300047471 | Ga0495684_0009809 | Ga0495684_0009809_2383_3312 | 307 |
| 442 | 3300047673 | Ga0495593_0158879 | Ga0495593_0158879_184_1116 | 307 |
| 443 | 3300048912 | Ga0496109_0107352 | Ga0496109_0107352_1576_2508 | 307 |
| 444 | 3300049574 | Ga0501038_0015159 | Ga0501038_0015159_3164_4093 | 307 |
| 445 | 3300049575 | Ga0501039_0005839 | Ga0501039_0005839_2036_2965 | 307 |
| 446 | 3300049576 | Ga0501040_0005846 | Ga0501040_0005846_2474_3403 | 307 |
| 447 | 3300049577 | Ga0501041_0005145 | Ga0501041_0005145_3762_4691 | 307 |
| 448 | 3300049578 | Ga0501042_0020524 | Ga0501042_0020524_945_1874 | 307 |
| 449 | 3300049582 | Ga0501048_0023235 | Ga0501048_0023235_638_1567 | 307 |
| 450 | 3300049584 | Ga0501068_0217116 | Ga0501068_0217116_87_1025 | 307 |
| 451 | 3300049586 | Ga0501070_0041191 | Ga0501070_0041191_2558_3487 | 307 |
| 452 | 3300049587 | Ga0501071_0046338 | Ga0501071_0046338_196_1125 | 307 |
| 453 | 3300049588 | Ga0501072_0005557 | Ga0501072_0005557_6080_7009 | 307 |
| 454 | 3300049591 | Ga0501075_0014224 | Ga0501075_0014224_4559_5488 | 307 |
| 455 | 3300049592 | Ga0501076_0096008 | Ga0501076_0096008_1301_2230 | 307 |
| 456 | 3300049741 | Ga0501079_0007821 | Ga0501079_0007821_5042_5971 | 307 |
| 457 | 3300049743 | Ga0501081_0006069 | Ga0501081_0006069_2073_3002 | 307 |
| 458 | 3300049824 | Ga0501045_0036826 | Ga0501045_0036826_2440_3369 | 307 |
| 459 | 3300050507 | nmdc:mga05p37_9378_c1 | nmdc:mga05p37_9378_c1_7859_8788 | 307 |
| 460 | 3300050511 | nmdc:mga08y16_18582_c1 | nmdc:mga08y16_18582_c1_6279_7208 | 307 |
| 461 | 3300050513 | nmdc:mga0rr50_19047_c1 | nmdc:mga0rr50_19047_c1_446_1375 | 307 |
| 462 | 3300050515 | nmdc:mga0a205_20798_c1 | nmdc:mga0a205_20798_c1_3697_4626 | 307 |
| 463 | 3300053085 | Ga0495619_0144408 | Ga0495619_0144408_198_1127 | 307 |
| 464 | 3300054114 | Ga0501084_0000970 | Ga0501084_0000970_16198_17127 | 307 |
| 465 | 3300060353 | Ga0501082_0002881 | Ga0501082_0002881_12276_13205 | 307 |
| 466 | 3300061734 | Ga0530510_0277731 | Ga0530510_0277731_104_1033 | 307 |
| 467 | iso_pu_bacteria | 2919713450 | 2919715167 | 307 |
| 468 | 3300003373 | JGI25407J50210_10017012 | JGI25407J50210_100170122 | 308 |
| 469 | 3300005329 | Ga0070683_100151132 | Ga0070683_1001511322 | 308 |
| 470 | 3300005441 | Ga0070700_100124059 | Ga0070700_1001240592 | 308 |
| 471 | 3300005457 | Ga0070662_100105553 | Ga0070662_1001055532 | 308 |
| 472 | 3300005535 | Ga0070684_100380466 | Ga0070684_1003804662 | 308 |
| 473 | 3300005618 | Ga0068864_100000682 | Ga0068864_1000006826 | 308 |
| 474 | 3300005719 | Ga0068861_100079131 | Ga0068861_1000791314 | 308 |
| 475 | 3300005937 | Ga0081455_10006017 | Ga0081455_100060172 | 308 |
| 476 | 3300005981 | Ga0081538_10001529 | Ga0081538_1000152924 | 308 |
| 477 | 3300005983 | Ga0081540_1000467 | Ga0081540_100046731 | 308 |
| 478 | 3300006028 | Ga0070717_10054332 | Ga0070717_100543321 | 308 |
| 479 | 3300006852 | Ga0075433_10016389 | Ga0075433_100163894 | 308 |
| 480 | 3300006871 | Ga0075434_100015794 | Ga0075434_1000157943 | 308 |
| 481 | 3300009094 | Ga0111539_10003119 | Ga0111539_1000311919 | 308 |
| 482 | 3300009094 | Ga0111539_10073120 | Ga0111539_100731203 | 308 |
| 483 | 3300009147 | Ga0114129_10060297 | Ga0114129_100602972 | 308 |
| 484 | 3300009147 | Ga0114129_10090489 | Ga0114129_100904893 | 308 |
| 485 | 3300009147 | Ga0114129_10332899 | Ga0114129_103328991 | 308 |
| 486 | 3300009147 | Ga0114129_10630845 | Ga0114129_106308451 | 308 |
| 487 | 3300011119 | Ga0105246_10151560 | Ga0105246_101515602 | 308 |
| 488 | 3300013308 | Ga0157375_10273909 | Ga0157375_102739091 | 308 |
| 489 | 3300014325 | Ga0163163_10419216 | Ga0163163_104192162 | 308 |
| 490 | 3300014969 | Ga0157376_10076137 | Ga0157376_100761372 | 308 |
| 491 | 3300025926 | Ga0207659_10365390 | Ga0207659_103653901 | 308 |
| 492 | 3300025934 | Ga0207686_10198539 | Ga0207686_101985392 | 308 |
| 493 | 3300025940 | Ga0207691_10270129 | Ga0207691_102701292 | 308 |
| 494 | 3300025944 | Ga0207661_10144910 | Ga0207661_101449102 | 308 |
| 495 | 3300026075 | Ga0207708_10090855 | Ga0207708_100908553 | 308 |
| 496 | 3300026095 | Ga0207676_10013407 | Ga0207676_100134077 | 308 |
| 497 | 3300026116 | Ga0207674_10008192 | Ga0207674_100081929 | 308 |
| 498 | 3300026118 | Ga0207675_100389575 | Ga0207675_1003895751 | 308 |
| 499 | 3300031548 | Ga0307408_100007383 | Ga0307408_1000073837 | 308 |
| 500 | 3300031548 | Ga0307408_100109824 | Ga0307408_1001098242 | 308 |
| 501 | 3300031731 | Ga0307405_10051186 | Ga0307405_100511864 | 308 |
| 502 | 3300031731 | Ga0307405_10331756 | Ga0307405_103317561 | 308 |
| 503 | 3300031824 | Ga0307413_10132126 | Ga0307413_101321262 | 308 |
| 504 | 3300031852 | Ga0307410_10000147 | Ga0307410_1000014715 | 308 |
| 505 | 3300031852 | Ga0307410_10009969 | Ga0307410_100099696 | 308 |
| 506 | 3300031901 | Ga0307406_10000058 | Ga0307406_1000005855 | 308 |
| 507 | 3300031901 | Ga0307406_10077071 | Ga0307406_100770712 | 308 |
| 508 | 3300031995 | Ga0307409_100009628 | Ga0307409_1000096287 | 308 |
| 509 | 3300032002 | Ga0307416_100000063 | Ga0307416_10000006310 | 308 |
| 510 | 3300032002 | Ga0307416_100036367 | Ga0307416_1000363673 | 308 |
| 511 | 3300032002 | Ga0307416_100406118 | Ga0307416_1004061182 | 308 |
| 512 | 3300032004 | Ga0307414_10036028 | Ga0307414_100360282 | 308 |
| 513 | 3300032126 | Ga0307415_100140744 | Ga0307415_1001407442 | 308 |
| 514 | 3300037418 | Ga0395900_0283115 | Ga0395900_0283115_572_1555 | 308 |
| 515 | 3300037471 | Ga0395905_0385386 | Ga0395905_0385386_12_995 | 308 |
| 516 | 3300038443 | Ga0395901_0077737 | Ga0395901_0077737_934_1917 | 308 |
| 517 | 3300042993 | Ga0439440_0002861 | Ga0439440_0002861_2273_3256 | 308 |
| 518 | 3300046459 | Ga0495629_0110235 | Ga0495629_0110235_405_1340 | 308 |
| 519 | 3300046459 | Ga0495629_0124779 | Ga0495629_0124779_82_1014 | 308 |
| 520 | 3300046461 | Ga0495641_0098303 | Ga0495641_0098303_173_1108 | 308 |
| 521 | 3300047315 | Ga0495581_0096264 | Ga0495581_0096264_764_1699 | 308 |
| 522 | 3300047317 | Ga0495604_0236908 | Ga0495604_0236908_238_1176 | 308 |
| 523 | 3300047321 | Ga0495676_0086098 | Ga0495676_0086098_300_1235 | 308 |
| 524 | 3300048905 | Ga0496102_0332804 | Ga0496102_0332804_167_1102 | 308 |
| 525 | 3300048907 | Ga0496104_0093086 | Ga0496104_0093086_1423_2355 | 308 |
| 526 | 3300048908 | Ga0496105_0057070 | Ga0496105_0057070_680_1612 | 308 |
| 527 | 3300048908 | Ga0496105_0093718 | Ga0496105_0093718_1366_2298 | 308 |
| 528 | 3300048909 | Ga0496106_0083355 | Ga0496106_0083355_948_1883 | 308 |
| 529 | 3300048909 | Ga0496106_0425655 | Ga0496106_0425655_68_1000 | 308 |
| 530 | 3300048911 | Ga0496108_0103414 | Ga0496108_0103414_1378_2310 | 308 |
| 531 | 3300048912 | Ga0496109_0005069 | Ga0496109_0005069_6857_7789 | 308 |
| 532 | 3300048912 | Ga0496109_0254703 | Ga0496109_0254703_146_1081 | 308 |
| 533 | 3300048912 | Ga0496109_0333176 | Ga0496109_0333176_346_1278 | 308 |
| 534 | 3300048913 | Ga0496110_0025590 | Ga0496110_0025590_1389_2321 | 308 |
| 535 | 3300048914 | Ga0496111_0011341 | Ga0496111_0011341_1247_2179 | 308 |
| 536 | 3300048915 | Ga0496112_0006933 | Ga0496112_0006933_9006_9938 | 308 |
| 537 | 3300048916 | Ga0496113_0003729 | Ga0496113_0003729_1640_2572 | 308 |
| 538 | 3300048916 | Ga0496113_0241990 | Ga0496113_0241990_81_1016 | 308 |
| 539 | 3300048917 | Ga0496114_0076407 | Ga0496114_0076407_1244_2206 | 308 |
| 540 | 3300048917 | Ga0496114_0083596 | Ga0496114_0083596_1248_2183 | 308 |
| 541 | 3300048918 | Ga0496115_0181662 | Ga0496115_0181662_565_1497 | 308 |
| 542 | 3300049576 | Ga0501040_0003752 | Ga0501040_0003752_783_1745 | 308 |
| 543 | 3300049578 | Ga0501042_0032831 | Ga0501042_0032831_172_1134 | 308 |
| 544 | 3300049580 | Ga0501046_0004821 | Ga0501046_0004821_8268_9230 | 308 |
| 545 | 3300049587 | Ga0501071_0277901 | Ga0501071_0277901_234_1184 | 308 |
| 546 | 3300049588 | Ga0501072_0004841 | Ga0501072_0004841_9189_10151 | 308 |
| 547 | 3300049591 | Ga0501075_0001006 | Ga0501075_0001006_10208_11170 | 308 |
| 548 | 3300049592 | Ga0501076_0002949 | Ga0501076_0002949_8849_9811 | 308 |
| 549 | 3300049593 | Ga0501077_0001426 | Ga0501077_0001426_10658_11620 | 308 |
| 550 | 3300049743 | Ga0501081_0021674 | Ga0501081_0021674_527_1489 | 308 |
| 551 | 3300049824 | Ga0501045_0160825 | Ga0501045_0160825_440_1402 | 308 |
| 552 | 3300050507 | nmdc:mga05p37_27954_c1 | nmdc:mga05p37_27954_c1_2189_3172 | 308 |
| 553 | 3300050507 | nmdc:mga05p37_42960_c1 | nmdc:mga05p37_42960_c1_4185_5165 | 308 |
| 554 | 3300050511 | nmdc:mga08y16_98879_c1 | nmdc:mga08y16_98879_c1_1300_2280 | 308 |
| 555 | 3300050512 | nmdc:mga0n895_16208_c1 | nmdc:mga0n895_16208_c1_2224_3207 | 308 |
| 556 | 3300050512 | nmdc:mga0n895_2119_c1 | nmdc:mga0n895_2119_c1_13125_14060 | 308 |
| 557 | 3300050513 | nmdc:mga0rr50_5888_c1 | nmdc:mga0rr50_5888_c1_1230_2165 | 308 |
| 558 | 3300050514 | nmdc:mga08x19_24796_c1 | nmdc:mga08x19_24796_c1_1408_2343 | 308 |
| 559 | 3300050515 | nmdc:mga0a205_4323_c1 | nmdc:mga0a205_4323_c1_2106_3041 | 308 |
| 560 | 3300061734 | Ga0530510_0000632 | Ga0530510_0000632_7162_8124 | 308 |
| 561 | 3300061734 | Ga0530510_0010498 | Ga0530510_0010498_3570_4511 | 308 |
| 562 | 3300005333 | Ga0070677_10086337 | Ga0070677_100863372 | 309 |
| 563 | 3300005334 | Ga0068869_100025995 | Ga0068869_1000259956 | 309 |
| 564 | 3300005335 | Ga0070666_10034735 | Ga0070666_100347352 | 309 |
| 565 | 3300005335 | Ga0070666_10063153 | Ga0070666_100631531 | 309 |
| 566 | 3300005336 | Ga0070680_100092341 | Ga0070680_1000923413 | 309 |
| 567 | 3300005336 | Ga0070680_100097269 | Ga0070680_1000972692 | 309 |
| 568 | 3300005337 | Ga0070682_100341295 | Ga0070682_1003412952 | 309 |
| 569 | 3300005339 | Ga0070660_100019890 | Ga0070660_1000198903 | 309 |
| 570 | 3300005347 | Ga0070668_100115231 | Ga0070668_1001152312 | 309 |
| 571 | 3300005347 | Ga0070668_100412954 | Ga0070668_1004129541 | 309 |
| 572 | 3300005354 | Ga0070675_100001430 | Ga0070675_1000014304 | 309 |
| 573 | 3300005354 | Ga0070675_100003184 | Ga0070675_1000031844 | 309 |
| 574 | 3300005355 | Ga0070671_100032512 | Ga0070671_1000325123 | 309 |
| 575 | 3300005355 | Ga0070671_100207550 | Ga0070671_1002075502 | 309 |
| 576 | 3300005355 | Ga0070671_100253987 | Ga0070671_1002539871 | 309 |
| 577 | 3300005356 | Ga0070674_100000263 | Ga0070674_10000026324 | 309 |
| 578 | 3300005356 | Ga0070674_100062824 | Ga0070674_1000628241 | 309 |
| 579 | 3300005364 | Ga0070673_100113924 | Ga0070673_1001139242 | 309 |
| 580 | 3300005364 | Ga0070673_100218736 | Ga0070673_1002187362 | 309 |
| 581 | 3300005364 | Ga0070673_100266611 | Ga0070673_1002666112 | 309 |
| 582 | 3300005365 | Ga0070688_100015231 | Ga0070688_1000152314 | 309 |
| 583 | 3300005366 | Ga0070659_100062092 | Ga0070659_1000620922 | 309 |
| 584 | 3300005366 | Ga0070659_100114974 | Ga0070659_1001149742 | 309 |
| 585 | 3300005367 | Ga0070667_100010285 | Ga0070667_1000102854 | 309 |
| 586 | 3300005367 | Ga0070667_100055334 | Ga0070667_1000553341 | 309 |
| 587 | 3300005435 | Ga0070714_100168347 | Ga0070714_1001683472 | 309 |
| 588 | 3300005438 | Ga0070701_10011014 | Ga0070701_100110143 | 309 |
| 589 | 3300005440 | Ga0070705_100024914 | Ga0070705_1000249142 | 309 |
| 590 | 3300005440 | Ga0070705_100109695 | Ga0070705_1001096953 | 309 |
| 591 | 3300005444 | Ga0070694_100011625 | Ga0070694_1000116252 | 309 |
| 592 | 3300005456 | Ga0070678_100181643 | Ga0070678_1001816432 | 309 |
| 593 | 3300005456 | Ga0070678_100187495 | Ga0070678_1001874952 | 309 |
| 594 | 3300005457 | Ga0070662_100003441 | Ga0070662_1000034419 | 309 |
| 595 | 3300005459 | Ga0068867_100004528 | Ga0068867_1000045282 | 309 |
| 596 | 3300005466 | Ga0070685_10010416 | Ga0070685_100104164 | 309 |
| 597 | 3300005466 | Ga0070685_10149147 | Ga0070685_101491471 | 309 |
| 598 | 3300005468 | Ga0070707_100390456 | Ga0070707_1003904562 | 309 |
| 599 | 3300005539 | Ga0068853_100052396 | Ga0068853_1000523962 | 309 |
| 600 | 3300005543 | Ga0070672_100062994 | Ga0070672_1000629942 | 309 |
| 601 | 3300005543 | Ga0070672_100092950 | Ga0070672_1000929502 | 309 |
| 602 | 3300005544 | Ga0070686_100014934 | Ga0070686_1000149343 | 309 |
| 603 | 3300005544 | Ga0070686_100086753 | Ga0070686_1000867532 | 309 |
| 604 | 3300005544 | Ga0070686_100255566 | Ga0070686_1002555661 | 309 |
| 605 | 3300005546 | Ga0070696_100083959 | Ga0070696_1000839592 | 309 |
| 606 | 3300005546 | Ga0070696_100273590 | Ga0070696_1002735902 | 309 |
| 607 | 3300005548 | Ga0070665_100066585 | Ga0070665_1000665853 | 309 |
| 608 | 3300005563 | Ga0068855_100178450 | Ga0068855_1001784502 | 309 |
| 609 | 3300005564 | Ga0070664_100017677 | Ga0070664_1000176775 | 309 |
| 610 | 3300005564 | Ga0070664_100063892 | Ga0070664_1000638924 | 309 |
| 611 | 3300005577 | Ga0068857_100130578 | Ga0068857_1001305784 | 309 |
| 612 | 3300005578 | Ga0068854_100006428 | Ga0068854_1000064285 | 309 |
| 613 | 3300005615 | Ga0070702_100067915 | Ga0070702_1000679152 | 309 |
| 614 | 3300005617 | Ga0068859_100001255 | Ga0068859_1000012557 | 309 |
| 615 | 3300005617 | Ga0068859_100003183 | Ga0068859_10000318312 | 309 |
| 616 | 3300005718 | Ga0068866_10001635 | Ga0068866_100016359 | 309 |
| 617 | 3300005719 | Ga0068861_100008513 | Ga0068861_1000085134 | 309 |
| 618 | 3300005841 | Ga0068863_100004645 | Ga0068863_10000464510 | 309 |
| 619 | 3300005841 | Ga0068863_100540856 | Ga0068863_1005408562 | 309 |
| 620 | 3300005842 | Ga0068858_100030123 | Ga0068858_1000301233 | 309 |
| 621 | 3300005842 | Ga0068858_100121950 | Ga0068858_1001219502 | 309 |
| 622 | 3300005843 | Ga0068860_100003074 | Ga0068860_10000307416 | 309 |
| 623 | 3300005844 | Ga0068862_100155996 | Ga0068862_1001559962 | 309 |
| 624 | 3300005937 | Ga0081455_10002610 | Ga0081455_100026105 | 309 |
| 625 | 3300005937 | Ga0081455_10004215 | Ga0081455_100042153 | 309 |
| 626 | 3300005983 | Ga0081540_1000278 | Ga0081540_100027813 | 309 |
| 627 | 3300006237 | Ga0097621_100010095 | Ga0097621_1000100953 | 309 |
| 628 | 3300006237 | Ga0097621_100029164 | Ga0097621_1000291642 | 309 |
| 629 | 3300006237 | Ga0097621_100266877 | Ga0097621_1002668772 | 309 |
| 630 | 3300006358 | Ga0068871_100005312 | Ga0068871_1000053122 | 309 |
| 631 | 3300006358 | Ga0068871_100035019 | Ga0068871_1000350192 | 309 |
| 632 | 3300006852 | Ga0075433_10000223 | Ga0075433_1000022325 | 309 |
| 633 | 3300006871 | Ga0075434_100000419 | Ga0075434_10000041928 | 309 |
| 634 | 3300006871 | Ga0075434_100085028 | Ga0075434_1000850282 | 309 |
| 635 | 3300006881 | Ga0068865_100004144 | Ga0068865_1000041444 | 309 |
| 636 | 3300006881 | Ga0068865_100005141 | Ga0068865_1000051417 | 309 |
| 637 | 3300006881 | Ga0068865_100009098 | Ga0068865_1000090986 | 309 |
| 638 | 3300006881 | Ga0068865_100014592 | Ga0068865_1000145924 | 309 |
| 639 | 3300006914 | Ga0075436_100004817 | Ga0075436_1000048173 | 309 |
| 640 | 3300006931 | Ga0097620_100001255 | Ga0097620_1000012557 | 309 |
| 641 | 3300006931 | Ga0097620_100003183 | Ga0097620_1000031838 | 309 |
| 642 | 3300007076 | Ga0075435_100013474 | Ga0075435_1000134742 | 309 |
| 643 | 3300009093 | Ga0105240_10066698 | Ga0105240_100666984 | 309 |
| 644 | 3300009094 | Ga0111539_10150236 | Ga0111539_101502363 | 309 |
| 645 | 3300009094 | Ga0111539_10265214 | Ga0111539_102652142 | 309 |
| 646 | 3300009098 | Ga0105245_10034003 | Ga0105245_100340034 | 309 |
| 647 | 3300009098 | Ga0105245_10266363 | Ga0105245_102663632 | 309 |
| 648 | 3300009098 | Ga0105245_10277933 | Ga0105245_102779332 | 309 |
| 649 | 3300009101 | Ga0105247_10078426 | Ga0105247_100784262 | 309 |
| 650 | 3300009101 | Ga0105247_10144276 | Ga0105247_101442762 | 309 |
| 651 | 3300009148 | Ga0105243_10006906 | Ga0105243_100069066 | 309 |
| 652 | 3300009148 | Ga0105243_10009290 | Ga0105243_100092909 | 309 |
| 653 | 3300009148 | Ga0105243_10034486 | Ga0105243_100344862 | 309 |
| 654 | 3300009148 | Ga0105243_10069591 | Ga0105243_100695914 | 309 |
| 655 | 3300009176 | Ga0105242_10000297 | Ga0105242_1000029724 | 309 |
| 656 | 3300009176 | Ga0105242_10053758 | Ga0105242_100537584 | 309 |
| 657 | 3300009176 | Ga0105242_10496598 | Ga0105242_104965982 | 309 |
| 658 | 3300009177 | Ga0105248_10000630 | Ga0105248_1000063030 | 309 |
| 659 | 3300009177 | Ga0105248_10010673 | Ga0105248_100106733 | 309 |
| 660 | 3300009177 | Ga0105248_10038207 | Ga0105248_100382076 | 309 |
| 661 | 3300009177 | Ga0105248_10299218 | Ga0105248_102992182 | 309 |
| 662 | 3300009177 | Ga0105248_10364462 | Ga0105248_103644621 | 309 |
| 663 | 3300009553 | Ga0105249_10162184 | Ga0105249_101621842 | 309 |
| 664 | 3300010375 | Ga0105239_10004153 | Ga0105239_1000415311 | 309 |
| 665 | 3300011119 | Ga0105246_10031281 | Ga0105246_100312812 | 309 |
| 666 | 3300012515 | Ga0157338_1000636 | Ga0157338_10006363 | 309 |
| 667 | 3300013100 | Ga0157373_10028612 | Ga0157373_100286122 | 309 |
| 668 | 3300013102 | Ga0157371_10029425 | Ga0157371_100294253 | 309 |
| 669 | 3300013297 | Ga0157378_10000780 | Ga0157378_1000078022 | 309 |
| 670 | 3300013297 | Ga0157378_10354040 | Ga0157378_103540401 | 309 |
| 671 | 3300013306 | Ga0163162_10011679 | Ga0163162_100116793 | 309 |
| 672 | 3300013306 | Ga0163162_10074587 | Ga0163162_100745872 | 309 |
| 673 | 3300013307 | Ga0157372_10046853 | Ga0157372_100468535 | 309 |
| 674 | 3300013308 | Ga0157375_10002770 | Ga0157375_100027709 | 309 |
| 675 | 3300013308 | Ga0157375_10264716 | Ga0157375_102647162 | 309 |
| 676 | 3300013308 | Ga0157375_10387162 | Ga0157375_103871622 | 309 |
| 677 | 3300014325 | Ga0163163_10025119 | Ga0163163_100251195 | 309 |
| 678 | 3300014325 | Ga0163163_10029108 | Ga0163163_100291084 | 309 |
| 679 | 3300014326 | Ga0157380_10069332 | Ga0157380_100693324 | 309 |
| 680 | 3300014745 | Ga0157377_10215609 | Ga0157377_102156091 | 309 |
| 681 | 3300014968 | Ga0157379_10004195 | Ga0157379_100041955 | 309 |
| 682 | 3300014968 | Ga0157379_10019662 | Ga0157379_100196622 | 309 |
| 683 | 3300014969 | Ga0157376_10024352 | Ga0157376_100243521 | 309 |
| 684 | 3300014969 | Ga0157376_10053083 | Ga0157376_100530833 | 309 |
| 685 | 3300014969 | Ga0157376_10181504 | Ga0157376_101815043 | 309 |
| 686 | 3300020070 | Ga0206356_11443902 | Ga0206356_114439022 | 309 |
| 687 | 3300020081 | Ga0206354_11259363 | Ga0206354_112593634 | 309 |
| 688 | 3300025885 | Ga0207653_10001129 | Ga0207653_100011297 | 309 |
| 689 | 3300025899 | Ga0207642_10000270 | Ga0207642_1000027012 | 309 |
| 690 | 3300025901 | Ga0207688_10004267 | Ga0207688_100042675 | 309 |
| 691 | 3300025903 | Ga0207680_10041617 | Ga0207680_100416172 | 309 |
| 692 | 3300025904 | Ga0207647_10145771 | Ga0207647_101457711 | 309 |
| 693 | 3300025906 | Ga0207699_10045154 | Ga0207699_100451542 | 309 |
| 694 | 3300025907 | Ga0207645_10001002 | Ga0207645_1000100225 | 309 |
| 695 | 3300025907 | Ga0207645_10066791 | Ga0207645_100667914 | 309 |
| 696 | 3300025908 | Ga0207643_10012769 | Ga0207643_100127693 | 309 |
| 697 | 3300025909 | Ga0207705_10234860 | Ga0207705_102348603 | 309 |
| 698 | 3300025914 | Ga0207671_10263910 | Ga0207671_102639103 | 309 |
| 699 | 3300025915 | Ga0207693_10016810 | Ga0207693_100168102 | 309 |
| 700 | 3300025915 | Ga0207693_10232183 | Ga0207693_102321831 | 309 |
| 701 | 3300025917 | Ga0207660_10077349 | Ga0207660_100773492 | 309 |
| 702 | 3300025920 | Ga0207649_10190318 | Ga0207649_101903182 | 309 |
| 703 | 3300025923 | Ga0207681_10170215 | Ga0207681_101702151 | 309 |
| 704 | 3300025925 | Ga0207650_10037891 | Ga0207650_100378913 | 309 |
| 705 | 3300025926 | Ga0207659_10010403 | Ga0207659_100104033 | 309 |
| 706 | 3300025926 | Ga0207659_10273965 | Ga0207659_102739651 | 309 |
| 707 | 3300025927 | Ga0207687_10195500 | Ga0207687_101955002 | 309 |
| 708 | 3300025928 | Ga0207700_10004883 | Ga0207700_100048832 | 309 |
| 709 | 3300025931 | Ga0207644_10017805 | Ga0207644_100178052 | 309 |
| 710 | 3300025931 | Ga0207644_10085166 | Ga0207644_100851662 | 309 |
| 711 | 3300025932 | Ga0207690_10248543 | Ga0207690_102485432 | 309 |
| 712 | 3300025933 | Ga0207706_10000065 | Ga0207706_1000006568 | 309 |
| 713 | 3300025934 | Ga0207686_10000390 | Ga0207686_1000039023 | 309 |
| 714 | 3300025934 | Ga0207686_10289639 | Ga0207686_102896392 | 309 |
| 715 | 3300025935 | Ga0207709_10041254 | Ga0207709_100412542 | 309 |
| 716 | 3300025935 | Ga0207709_10169204 | Ga0207709_101692042 | 309 |
| 717 | 3300025935 | Ga0207709_10205953 | Ga0207709_102059532 | 309 |
| 718 | 3300025937 | Ga0207669_10002903 | Ga0207669_100029034 | 309 |
| 719 | 3300025937 | Ga0207669_10070246 | Ga0207669_100702462 | 309 |
| 720 | 3300025938 | Ga0207704_10003859 | Ga0207704_100038595 | 309 |
| 721 | 3300025938 | Ga0207704_10158764 | Ga0207704_101587641 | 309 |
| 722 | 3300025939 | Ga0207665_10010913 | Ga0207665_100109133 | 309 |
| 723 | 3300025940 | Ga0207691_10019700 | Ga0207691_100197006 | 309 |
| 724 | 3300025940 | Ga0207691_10240200 | Ga0207691_102402002 | 309 |
| 725 | 3300025941 | Ga0207711_10003997 | Ga0207711_1000399711 | 309 |
| 726 | 3300025941 | Ga0207711_10017179 | Ga0207711_100171795 | 309 |
| 727 | 3300025942 | Ga0207689_10015253 | Ga0207689_100152533 | 309 |
| 728 | 3300025944 | Ga0207661_10264500 | Ga0207661_102645002 | 309 |
| 729 | 3300025949 | Ga0207667_10201493 | Ga0207667_102014932 | 309 |
| 730 | 3300025960 | Ga0207651_10036814 | Ga0207651_100368142 | 309 |
| 731 | 3300025961 | Ga0207712_10160591 | Ga0207712_101605911 | 309 |
| 732 | 3300025972 | Ga0207668_10109281 | Ga0207668_101092812 | 309 |
| 733 | 3300025981 | Ga0207640_10020688 | Ga0207640_100206882 | 309 |
| 734 | 3300025986 | Ga0207658_10027328 | Ga0207658_100273285 | 309 |
| 735 | 3300026035 | Ga0207703_10020144 | Ga0207703_100201444 | 309 |
| 736 | 3300026035 | Ga0207703_10047263 | Ga0207703_100472633 | 309 |
| 737 | 3300026041 | Ga0207639_10180107 | Ga0207639_101801072 | 309 |
| 738 | 3300026067 | Ga0207678_10007041 | Ga0207678_1000704110 | 309 |
| 739 | 3300026088 | Ga0207641_10011879 | Ga0207641_100118796 | 309 |
| 740 | 3300026089 | Ga0207648_10000211 | Ga0207648_1000021142 | 309 |
| 741 | 3300026095 | Ga0207676_10271700 | Ga0207676_102717002 | 309 |
| 742 | 3300026116 | Ga0207674_10020587 | Ga0207674_100205875 | 309 |
| 743 | 3300026118 | Ga0207675_100062532 | Ga0207675_1000625323 | 309 |
| 744 | 3300026121 | Ga0207683_10262286 | Ga0207683_102622862 | 309 |
| 745 | 3300026142 | Ga0207698_10193980 | Ga0207698_101939801 | 309 |
| 746 | 3300027907 | Ga0207428_10000696 | Ga0207428_1000069638 | 309 |
| 747 | 3300028380 | Ga0268265_10081705 | Ga0268265_100817054 | 309 |
| 748 | 3300028381 | Ga0268264_10006781 | Ga0268264_100067813 | 309 |
| 749 | 3300028381 | Ga0268264_10011848 | Ga0268264_100118485 | 309 |
| 750 | 3300028800 | Ga0265338_10016076 | Ga0265338_100160763 | 309 |
| 751 | 3300031731 | Ga0307405_10028107 | Ga0307405_100281075 | 309 |
| 752 | 3300031824 | Ga0307413_10065723 | Ga0307413_100657232 | 309 |
| 753 | 3300031824 | Ga0307413_10076444 | Ga0307413_100764442 | 309 |
| 754 | 3300031852 | Ga0307410_10005511 | Ga0307410_100055112 | 309 |
| 755 | 3300031852 | Ga0307410_10057506 | Ga0307410_100575063 | 309 |
| 756 | 3300031901 | Ga0307406_10384744 | Ga0307406_103847442 | 309 |
| 757 | 3300031903 | Ga0307407_10030353 | Ga0307407_100303532 | 309 |
| 758 | 3300031903 | Ga0307407_10188812 | Ga0307407_101888122 | 309 |
| 759 | 3300031995 | Ga0307409_100067504 | Ga0307409_1000675042 | 309 |
| 760 | 3300031995 | Ga0307409_100083169 | Ga0307409_1000831692 | 309 |
| 761 | 3300031995 | Ga0307409_100154693 | Ga0307409_1001546932 | 309 |
| 762 | 3300032002 | Ga0307416_100032531 | Ga0307416_1000325312 | 309 |
| 763 | 3300032002 | Ga0307416_100645821 | Ga0307416_1006458211 | 309 |
| 764 | 3300032005 | Ga0307411_10009346 | Ga0307411_100093465 | 309 |
| 765 | 3300032005 | Ga0307411_10098101 | Ga0307411_100981012 | 309 |
| 766 | 3300032126 | Ga0307415_100162745 | Ga0307415_1001627452 | 309 |
| 767 | 3300035091 | Ga0373951_0005964 | Ga0373951_0005964_1179_2120 | 309 |
| 768 | 3300035115 | Ga0373941_0017161 | Ga0373941_0017161_891_1832 | 309 |
| 769 | 3300035121 | Ga0373960_0022650 | Ga0373960_0022650_118_1059 | 309 |
| 770 | 3300035691 | Ga0373931_0013954 | Ga0373931_0013954_1952_2893 | 309 |
| 771 | 3300037418 | Ga0395900_0015864 | Ga0395900_0015864_2124_3065 | 309 |
| 772 | 3300037466 | Ga0395898_0097773 | Ga0395898_0097773_886_1827 | 309 |
| 773 | 3300037471 | Ga0395905_0072278 | Ga0395905_0072278_2233_3174 | 309 |
| 774 | 3300038443 | Ga0395901_0054966 | Ga0395901_0054966_952_1893 | 309 |
| 775 | 3300039437 | Ga0436365_0719229 | Ga0436365_0719229_14_952 | 309 |
| 776 | 3300039437 | Ga0436365_1837480 | Ga0436365_1837480_144_1121 | 309 |
| 777 | 3300042461 | Ga0439460_0005870 | Ga0439460_0005870_837_1775 | 309 |
| 778 | 3300046477 | Ga0495664_0012948 | Ga0495664_0012948_1879_2928 | 309 |
| 779 | 3300046511 | Ga0495608_0023371 | Ga0495608_0023371_27_968 | 309 |
| 780 | 3300046535 | Ga0495586_0061151 | Ga0495586_0061151_622_1560 | 309 |
| 781 | 3300046559 | Ga0495667_0213930 | Ga0495667_0213930_186_1127 | 309 |
| 782 | 3300046663 | Ga0495635_0235425 | Ga0495635_0235425_25_966 | 309 |
| 783 | 3300046674 | Ga0495588_0024681 | Ga0495588_0024681_1701_2750 | 309 |
| 784 | 3300046689 | Ga0495613_0147310 | Ga0495613_0147310_268_1206 | 309 |
| 785 | 3300046809 | Ga0495600_0025218 | Ga0495600_0025218_741_1682 | 309 |
| 786 | 3300047317 | Ga0495604_0038494 | Ga0495604_0038494_440_1381 | 309 |
| 787 | 3300047319 | Ga0495674_0018328 | Ga0495674_0018328_1167_2216 | 309 |
| 788 | 3300047319 | Ga0495674_0151283 | Ga0495674_0151283_877_1818 | 309 |
| 789 | 3300047319 | Ga0495674_0194645 | Ga0495674_0194645_611_1549 | 309 |
| 790 | 3300047322 | Ga0495680_0031972 | Ga0495680_0031972_3039_3980 | 309 |
| 791 | 3300047471 | Ga0495684_0017859 | Ga0495684_0017859_1155_2096 | 309 |
| 792 | 3300048903 | Ga0496100_0036973 | Ga0496100_0036973_1210_2148 | 309 |
| 793 | 3300048904 | Ga0496101_0007471 | Ga0496101_0007471_3753_4691 | 309 |
| 794 | 3300048905 | Ga0496102_0145618 | Ga0496102_0145618_833_1771 | 309 |
| 795 | 3300048907 | Ga0496104_0126726 | Ga0496104_0126726_546_1481 | 309 |
| 796 | 3300048907 | Ga0496104_0203444 | Ga0496104_0203444_847_1785 | 309 |
| 797 | 3300048908 | Ga0496105_0046640 | Ga0496105_0046640_2397_3338 | 309 |
| 798 | 3300048908 | Ga0496105_0273452 | Ga0496105_0273452_223_1161 | 309 |
| 799 | 3300048908 | Ga0496105_0328148 | Ga0496105_0328148_125_1066 | 309 |
| 800 | 3300048910 | Ga0496107_0008752 | Ga0496107_0008752_3578_4516 | 309 |
| 801 | 3300048910 | Ga0496107_0220012 | Ga0496107_0220012_235_1176 | 309 |
| 802 | 3300048911 | Ga0496108_0301565 | Ga0496108_0301565_244_1185 | 309 |
| 803 | 3300048912 | Ga0496109_0075921 | Ga0496109_0075921_1374_2309 | 309 |
| 804 | 3300048914 | Ga0496111_0051811 | Ga0496111_0051811_1189_2130 | 309 |
| 805 | 3300048917 | Ga0496114_0006052 | Ga0496114_0006052_7743_8681 | 309 |
| 806 | 3300048917 | Ga0496114_0017732 | Ga0496114_0017732_3925_4866 | 309 |
| 807 | 3300048917 | Ga0496114_0032819 | Ga0496114_0032819_1321_2256 | 309 |
| 808 | 3300048917 | Ga0496114_0076849 | Ga0496114_0076849_1600_2643 | 309 |
| 809 | 3300048918 | Ga0496115_0017884 | Ga0496115_0017884_2709_3650 | 309 |
| 810 | 3300050510 | nmdc:mga06r32_391429_c1 | nmdc:mga06r32_391429_c1_269_1207 | 309 |
| 811 | 3300050511 | nmdc:mga08y16_240503_c1 | nmdc:mga08y16_240503_c1_465_1439 | 309 |
| 812 | 3300050512 | nmdc:mga0n895_179723_c1 | nmdc:mga0n895_179723_c1_867_1808 | 309 |
| 813 | 3300053077 | Ga0495601_0002663 | Ga0495601_0002663_5745_6794 | 309 |
| 814 | 3300053077 | Ga0495601_0012892 | Ga0495601_0012892_1192_2136 | 309 |
| 815 | 3300053078 | Ga0495612_0005738 | Ga0495612_0005738_1512_2561 | 309 |
| 816 | 3300053084 | Ga0495595_0047764 | Ga0495595_0047764_758_1699 | 309 |
| 817 | 3300053085 | Ga0495619_0046463 | Ga0495619_0046463_1447_2388 | 309 |
| 818 | 3300053085 | Ga0495619_0069480 | Ga0495619_0069480_33_1082 | 309 |
| 819 | 3300053139 | Ga0500568_0015668 | Ga0500568_0015668_604_1548 | 309 |
| 820 | 3300005578 | Ga0068854_100177441 | Ga0068854_1001774412 | 310 |
| 821 | 3300005615 | Ga0070702_100001102 | Ga0070702_1000011025 | 310 |
| 822 | 3300005618 | Ga0068864_100205776 | Ga0068864_1002057762 | 310 |
| 823 | 3300009148 | Ga0105243_10028174 | Ga0105243_100281742 | 310 |
| 824 | 3300011119 | Ga0105246_10096432 | Ga0105246_100964322 | 310 |
| 825 | 3300025938 | Ga0207704_10106457 | Ga0207704_101064572 | 310 |
| 826 | 3300025981 | Ga0207640_10322933 | Ga0207640_103229331 | 310 |
| 827 | 3300031548 | Ga0307408_100153573 | Ga0307408_1001535732 | 310 |
| 828 | 3300031824 | Ga0307413_10069488 | Ga0307413_100694881 | 310 |
| 829 | 3300031824 | Ga0307413_10087607 | Ga0307413_100876072 | 310 |
| 830 | 3300031901 | Ga0307406_10021189 | Ga0307406_100211893 | 310 |
| 831 | 3300031903 | Ga0307407_10116144 | Ga0307407_101161442 | 310 |
| 832 | 3300031995 | Ga0307409_100023078 | Ga0307409_1000230782 | 310 |
| 833 | 3300032002 | Ga0307416_100060718 | Ga0307416_1000607182 | 310 |
| 834 | 3300032002 | Ga0307416_100122924 | Ga0307416_1001229241 | 310 |
| 835 | 3300032004 | Ga0307414_10289909 | Ga0307414_102899091 | 310 |
| 836 | 3300032126 | Ga0307415_100007592 | Ga0307415_1000075926 | 310 |
| 837 | 3300042142 | Ga0450905_006766 | Ga0450905_006766_199_1146 | 310 |
| 838 | 3300042439 | Ga0439464_0004085 | Ga0439464_0004085_1830_2777 | 310 |
| 839 | iso_pu_bacteria | 2738541308 | 2738890538 | 310 |
| 840 | 3300003373 | JGI25407J50210_10013614 | JGI25407J50210_100136142 | 311 |
| 841 | 3300005458 | Ga0070681_10147739 | Ga0070681_101477392 | 311 |
| 842 | 3300005535 | Ga0070684_100123078 | Ga0070684_1001230782 | 311 |
| 843 | 3300005937 | Ga0081455_10017049 | Ga0081455_100170495 | 311 |
| 844 | 3300005981 | Ga0081538_10000738 | Ga0081538_1000073828 | 311 |
| 845 | 3300005983 | Ga0081540_1002683 | Ga0081540_10026838 | 311 |
| 846 | 3300005985 | Ga0081539_10021607 | Ga0081539_100216072 | 311 |
| 847 | 3300006846 | Ga0075430_100028490 | Ga0075430_1000284905 | 311 |
| 848 | 3300006852 | Ga0075433_10155044 | Ga0075433_101550441 | 311 |
| 849 | 3300006871 | Ga0075434_100533583 | Ga0075434_1005335832 | 311 |
| 850 | 3300009094 | Ga0111539_10054098 | Ga0111539_100540983 | 311 |
| 851 | 3300009098 | Ga0105245_10029247 | Ga0105245_100292471 | 311 |
| 852 | 3300009098 | Ga0105245_10058164 | Ga0105245_100581642 | 311 |
| 853 | 3300009147 | Ga0114129_10110255 | Ga0114129_101102553 | 311 |
| 854 | 3300013306 | Ga0163162_10136701 | Ga0163162_101367012 | 311 |
| 855 | 3300013308 | Ga0157375_10047524 | Ga0157375_100475242 | 311 |
| 856 | 3300014497 | Ga0182008_10137369 | Ga0182008_101373691 | 311 |
| 857 | 3300025921 | Ga0207652_10200759 | Ga0207652_102007592 | 311 |
| 858 | 3300025927 | Ga0207687_10061789 | Ga0207687_100617892 | 311 |
| 859 | 3300025933 | Ga0207706_10032813 | Ga0207706_100328134 | 311 |
| 860 | 3300025941 | Ga0207711_10274591 | Ga0207711_102745912 | 311 |
| 861 | 3300025944 | Ga0207661_10021776 | Ga0207661_100217763 | 311 |
| 862 | 3300027907 | Ga0207428_10057368 | Ga0207428_100573682 | 311 |
| 863 | 3300031456 | Ga0307513_10246227 | Ga0307513_102462272 | 311 |
| 864 | 3300031548 | Ga0307408_100020650 | Ga0307408_1000206503 | 311 |
| 865 | 3300031731 | Ga0307405_10000670 | Ga0307405_100006707 | 311 |
| 866 | 3300031731 | Ga0307405_10216192 | Ga0307405_102161922 | 311 |
| 867 | 3300031824 | Ga0307413_10026814 | Ga0307413_100268144 | 311 |
| 868 | 3300031852 | Ga0307410_10000824 | Ga0307410_100008247 | 311 |
| 869 | 3300031901 | Ga0307406_10010406 | Ga0307406_100104065 | 311 |
| 870 | 3300031901 | Ga0307406_10198114 | Ga0307406_101981142 | 311 |
| 871 | 3300031903 | Ga0307407_10007658 | Ga0307407_100076581 | 311 |
| 872 | 3300031903 | Ga0307407_10057468 | Ga0307407_100574682 | 311 |
| 873 | 3300031995 | Ga0307409_100000233 | Ga0307409_10000023323 | 311 |
| 874 | 3300031995 | Ga0307409_100016467 | Ga0307409_1000164673 | 311 |
| 875 | 3300031995 | Ga0307409_100325431 | Ga0307409_1003254311 | 311 |
| 876 | 3300032002 | Ga0307416_100002018 | Ga0307416_10000201810 | 311 |
| 877 | 3300032004 | Ga0307414_10004969 | Ga0307414_100049696 | 311 |
| 878 | 3300032004 | Ga0307414_10229635 | Ga0307414_102296352 | 311 |
| 879 | 3300032126 | Ga0307415_100000327 | Ga0307415_10000032720 | 311 |
| 880 | 3300032126 | Ga0307415_100012698 | Ga0307415_1000126982 | 311 |
| 881 | 3300035695 | Ga0373927_0094275 | Ga0373927_0094275_921_1865 | 311 |
| 882 | 3300042005 | Ga0439448_0007876 | Ga0439448_0007876_1785_2720 | 311 |
| 883 | 3300042005 | Ga0439448_0008232 | Ga0439448_0008232_160_1122 | 311 |
| 884 | 3300042157 | Ga0439458_0016974 | Ga0439458_0016974_87_1049 | 311 |
| 885 | 3300046461 | Ga0495641_0083293 | Ga0495641_0083293_71_1057 | 311 |
| 886 | 3300048905 | Ga0496102_0159734 | Ga0496102_0159734_735_1703 | 311 |
| 887 | 3300048911 | Ga0496108_0093685 | Ga0496108_0093685_1500_2468 | 311 |
| 888 | 3300048911 | Ga0496108_0146531 | Ga0496108_0146531_375_1361 | 311 |
| 889 | 3300048913 | Ga0496110_0004299 | Ga0496110_0004299_908_1876 | 311 |
| 890 | 3300048914 | Ga0496111_0003435 | Ga0496111_0003435_3484_4452 | 311 |
| 891 | 3300048915 | Ga0496112_0006723 | Ga0496112_0006723_1264_2232 | 311 |
| 892 | 3300048917 | Ga0496114_0002549 | Ga0496114_0002549_8482_9450 | 311 |
| 893 | 3300049568 | Ga0501031_0017507 | Ga0501031_0017507_3454_4431 | 311 |
| 894 | 3300049569 | Ga0501032_0055741 | Ga0501032_0055741_1144_2121 | 311 |
| 895 | 3300049570 | Ga0501033_0017964 | Ga0501033_0017964_2192_3169 | 311 |
| 896 | 3300049572 | Ga0501036_0000024 | Ga0501036_0000024_48641_49618 | 311 |
| 897 | 3300049574 | Ga0501038_0006128 | Ga0501038_0006128_1870_2847 | 311 |
| 898 | 3300049575 | Ga0501039_0000545 | Ga0501039_0000545_10121_11098 | 311 |
| 899 | 3300049576 | Ga0501040_0000548 | Ga0501040_0000548_15245_16222 | 311 |
| 900 | 3300049577 | Ga0501041_0003287 | Ga0501041_0003287_2245_3222 | 311 |
| 901 | 3300049578 | Ga0501042_0000127 | Ga0501042_0000127_19616_20593 | 311 |
| 902 | 3300049579 | Ga0501043_0034336 | Ga0501043_0034336_2256_3233 | 311 |
| 903 | 3300049580 | Ga0501046_0002235 | Ga0501046_0002235_8240_9217 | 311 |
| 904 | 3300049582 | Ga0501048_0005887 | Ga0501048_0005887_8236_9213 | 311 |
| 905 | 3300049585 | Ga0501069_0052160 | Ga0501069_0052160_543_1520 | 311 |
| 906 | 3300049586 | Ga0501070_0111656 | Ga0501070_0111656_529_1506 | 311 |
| 907 | 3300049587 | Ga0501071_0000240 | Ga0501071_0000240_8446_9423 | 311 |
| 908 | 3300049588 | Ga0501072_0000135 | Ga0501072_0000135_21101_22078 | 311 |
| 909 | 3300049590 | Ga0501074_0036786 | Ga0501074_0036786_2224_3201 | 311 |
| 910 | 3300049591 | Ga0501075_0000252 | Ga0501075_0000252_21072_22049 | 311 |
| 911 | 3300049592 | Ga0501076_0001183 | Ga0501076_0001183_14055_15032 | 311 |
| 912 | 3300049593 | Ga0501077_0003333 | Ga0501077_0003333_8442_9419 | 311 |
| 913 | 3300049741 | Ga0501079_0000135 | Ga0501079_0000135_30557_31534 | 311 |
| 914 | 3300049742 | Ga0501080_0024649 | Ga0501080_0024649_2259_3236 | 311 |
| 915 | 3300049743 | Ga0501081_0000233 | Ga0501081_0000233_21052_22029 | 311 |
| 916 | 3300049822 | Ga0501035_0022998 | Ga0501035_0022998_430_1407 | 311 |
| 917 | 3300049824 | Ga0501045_0003585 | Ga0501045_0003585_1265_2242 | 311 |
| 918 | 3300050507 | nmdc:mga05p37_165440_c1 | nmdc:mga05p37_165440_c1_645_1607 | 311 |
| 919 | 3300050510 | nmdc:mga06r32_15098_c1 | nmdc:mga06r32_15098_c1_3340_4359 | 311 |
| 920 | 3300050511 | nmdc:mga08y16_130735_c1 | nmdc:mga08y16_130735_c1_893_1879 | 311 |
| 921 | 3300050512 | nmdc:mga0n895_106342_c1 | nmdc:mga0n895_106342_c1_1141_2103 | 311 |
| 922 | 3300050515 | nmdc:mga0a205_95348_c1 | nmdc:mga0a205_95348_c1_1125_2087 | 311 |
| 923 | 3300054114 | Ga0501084_0000583 | Ga0501084_0000583_18483_19460 | 311 |
| 924 | 3300060353 | Ga0501082_0005193 | Ga0501082_0005193_1927_2904 | 311 |
| 925 | 3300061734 | Ga0530510_0000013 | Ga0530510_0000013_60464_61441 | 311 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ovy-assembly1.cif.gz_A-2 | crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 | 0.9282 | 3 | 310 |
| 4ovy-assembly1.cif.gz_A-2 | crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 | 0.9223 | 3 | 310 |
| 6iuy-assembly1.cif.gz_B | structure of dsgpdh of dunaliella salina | 0.7066 | 148 | 267 |
| 6ki2-assembly1.cif.gz_B | the stas domain of cyanobacteria bicarbonate transporter bica | 0.6609 | 153 | 194 |
| 4as3-assembly2.cif.gz_D | pseudomonas aeruginosa phosphorylcholine phosphatase. orthorhombic form | 0.6504 | 4 | 301 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4umvA03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.74 | 154 | 267 | 3.40.50.1000 |
| af_Q58378_3_256_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.739 | 148 | 269 | 3.40.50.1000 |
| af_Q21394_33_251_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.6792 | 154 | 195 | 3.40.50.410 |
| 4as3C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.6568 | 10 | 301 | 3.40.50.1000 |
| 2hi0B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.6434 | 157 | 298 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1T5CNZ1-F1-model_v4 | Uncharacterized protein | 0.9943 | 223 | 307 |
|
| AF-A0A2S8M9F1-F1-model_v4 | deleted | 0.9863 | 120 | 308 |
|
| AF-A0A1H4FAA4-F1-model_v4 | deleted | 0.986 | 5 | 309 |
|
| AF-A0A7I7XL95-F1-model_v4 | Haloacid dehalogenase | 0.9846 | 5 | 309 |
|
| AF-A0A806S843-F1-model_v4 | deleted | 0.9831 | 1 | 310 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar