F485889

General Info

Members Datasets Scaffolds Average Seq Length
925 379 892 323

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10032813|Ga0207706_100328134
Length 372
Sequence MAATDQAGAHDVGGSQAGPAGDPLGSWREGATKQAVLDFVQRVTTEGGSDAVPPEERVAVFDNDGTLWCEKPMPIQLDFVLRRLVVMADQDPALRTRQPWQAAYTRDYGWLGEVITKHYHGDDSELPVLAAGVLQAFAGVTVEDFEAQADRFLRTTQHPTLGRPYLACGYAPMVELLGHLAANGFRNYIASGGGRDFMRPVSQDMYGVPRQRVIGSSVSLAYQQDEHGGRIVHQPELDVLDDGPAKPVRIWSRVGRRPLLAAGNSNGDIPMLQFVEQPGRPCLRLLVVHDDPDREFDYLVGAEQALQLANTNDWTVVSIKRWTPQSSTIKARGRLDLAVTNPARDMTPVVTGSTSRGDQEALVIRSGSSERP

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
3 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
4 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
5 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
6 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
7 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
8 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
9 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
10 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
11 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
12 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
13 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
14 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
15 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
16 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
17 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
18 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
19 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
20 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
21 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
22 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
23 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
24 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
25 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
26 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
27 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
28 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
29 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
240 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
241 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
242 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
246 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
295 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
296 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
344 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
345 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
346 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
359 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
360 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
367 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
368 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
369 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
374 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
375 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
376 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
377 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
378 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
379 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 0.22
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 2.92
Rhizoplane 8.65
Rhizosphere 86.7
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10013614 3300003373 Bacteria 2091
2 JGI25407J50210_10017012 3300003373 Bacteria 1886
3 Ga0070683_100001559 3300005329 Bacteria 17711
4 Ga0070683_100151132 3300005329 Bacteria 2202
5 Ga0070677_10086337 3300005333 Bacteria 1355
6 Ga0068869_100025995 3300005334 Bacteria 4071
7 Ga0070666_10034735 3300005335 Bacteria 3341
8 Ga0070666_10063153 3300005335 Bacteria 2510
9 Ga0070680_100092341 3300005336 Bacteria 2506
10 Ga0070680_100097269 3300005336 Bacteria 2441
11 Ga0070682_100039364 3300005337 Bacteria 2905
12 Ga0070682_100341295 3300005337 Bacteria 1113
13 Ga0068868_100043185 3300005338 Bacteria 3521
14 Ga0070660_100019890 3300005339 Bacteria 4925
15 Ga0070691_10094643 3300005341 Bacteria 1477
16 Ga0070668_100115231 3300005347 Bacteria 2142
17 Ga0070668_100412954 3300005347 Bacteria 1154
18 Ga0070669_100169127 3300005353 Bacteria 1703
19 Ga0070675_100001430 3300005354 Bacteria 17528
20 Ga0070675_100003184 3300005354 Bacteria 12423
21 Ga0070675_100035588 3300005354 Bacteria 4046
22 Ga0070671_100032512 3300005355 Bacteria 4313
23 Ga0070671_100207550 3300005355 Bacteria 1661
24 Ga0070671_100253987 3300005355 Bacteria 1493
25 Ga0070671_100410209 3300005355 Bacteria 1159
26 Ga0070674_100000263 3300005356 Bacteria 26068
27 Ga0070674_100062824 3300005356 Bacteria 2597
28 Ga0070673_100039134 3300005364 Bacteria 3627
29 Ga0070673_100113924 3300005364 Bacteria 2246
30 Ga0070673_100218736 3300005364 Bacteria 1648
31 Ga0070673_100266611 3300005364 Bacteria 1498
32 Ga0070688_100000851 3300005365 Bacteria 15140
33 Ga0070688_100015231 3300005365 Unclassified 4369
34 Ga0070688_100064309 3300005365 Bacteria 2328
35 Ga0070659_100040250 3300005366 Bacteria 3651
36 Ga0070659_100062092 3300005366 Bacteria 2953
37 Ga0070659_100114974 3300005366 Bacteria 2174
38 Ga0070659_100222707 3300005366 Bacteria 1557
39 Ga0070659_100361252 3300005366 Bacteria 1220
40 Ga0070667_100010285 3300005367 Bacteria 7730
41 Ga0070667_100055334 3300005367 Bacteria 3351
42 Ga0070667_100110329 3300005367 Bacteria 2385
43 Ga0070667_100262191 3300005367 Unclassified 1548
44 Ga0070709_10230513 3300005434 Bacteria 1325
45 Ga0070714_100168347 3300005435 Bacteria 1987
46 Ga0070713_100273355 3300005436 Bacteria 1548
47 Ga0070710_10084035 3300005437 Bacteria 1864
48 Ga0070710_10156626 3300005437 Bacteria 1409
49 Ga0070701_10011014 3300005438 Bacteria 4023
50 Ga0070711_100153506 3300005439 Bacteria 1739
51 Ga0070705_100024914 3300005440 Bacteria 3236
52 Ga0070705_100109695 3300005440 Bacteria 1760
53 Ga0070700_100124059 3300005441 Bacteria 1734
54 Ga0070694_100011625 3300005444 Bacteria 5450
55 Ga0070663_100209428 3300005455 Bacteria 1526
56 Ga0070678_100021755 3300005456 Bacteria 4236
57 Ga0070678_100181643 3300005456 Bacteria 1723
58 Ga0070678_100187495 3300005456 Bacteria 1698
59 Ga0070662_100001886 3300005457 Bacteria 12852
60 Ga0070662_100003441 3300005457 Bacteria 9866
61 Ga0070662_100105553 3300005457 Bacteria 2139
62 Ga0070681_10002312 3300005458 Bacteria 17416
63 Ga0070681_10147739 3300005458 Bacteria 2279
64 Ga0068867_100004528 3300005459 Bacteria 9772
65 Ga0070685_10008294 3300005466 Bacteria 5334
66 Ga0070685_10010416 3300005466 Bacteria 4831
67 Ga0070685_10121091 3300005466 Bacteria 1625
68 Ga0070685_10149147 3300005466 Bacteria 1480
69 Ga0070707_100390456 3300005468 Bacteria 1352
70 Ga0070684_100123078 3300005535 Bacteria 2334
71 Ga0070684_100302479 3300005535 Bacteria 1468
72 Ga0070684_100380466 3300005535 Bacteria 1300
73 Ga0068853_100052396 3300005539 Bacteria 3516
74 Ga0070672_100062994 3300005543 Bacteria 2928
75 Ga0070672_100092950 3300005543 Bacteria 2436
76 Ga0070686_100014934 3300005544 Bacteria 4485
77 Ga0070686_100086753 3300005544 Bacteria 2084
78 Ga0070686_100255566 3300005544 Bacteria 1282
79 Ga0070696_100083959 3300005546 Bacteria 2259
80 Ga0070696_100273590 3300005546 Bacteria 1285
81 Ga0070693_100023508 3300005547 Bacteria 3295
82 Ga0070665_100004780 3300005548 Bacteria 14100
83 Ga0070665_100066585 3300005548 Bacteria 3613
84 Ga0070704_100038038 3300005549 Bacteria 3293
85 Ga0068855_100178450 3300005563 Bacteria 2402
86 Ga0070664_100017677 3300005564 Bacteria 5855
87 Ga0070664_100056116 3300005564 Bacteria 3346
88 Ga0070664_100063892 3300005564 Bacteria 3139
89 Ga0070664_100085440 3300005564 Bacteria 2725
90 Ga0068857_100130578 3300005577 Bacteria 2266
91 Ga0068854_100006428 3300005578 Bacteria 7474
92 Ga0068854_100177441 3300005578 Bacteria 1662
93 Ga0068856_100011064 3300005614 Bacteria 8760
94 Ga0068856_100069184 3300005614 Bacteria 3490
95 Ga0070702_100001102 3300005615 Bacteria 10830
96 Ga0070702_100067915 3300005615 Bacteria 2096
97 Ga0068859_100001255 3300005617 Bacteria 25905
98 Ga0068859_100003183 3300005617 Bacteria 16694
99 Ga0068859_100388711 3300005617 Bacteria 1491
100 Ga0068864_100000682 3300005618 Bacteria 28462
101 Ga0068864_100006902 3300005618 Bacteria 9309
102 Ga0068864_100205776 3300005618 Bacteria 1810
103 Ga0068866_10001635 3300005718 Bacteria 9455
104 Ga0068861_100008513 3300005719 Bacteria 7063
105 Ga0068861_100079131 3300005719 Bacteria 2569
106 Ga0068863_100004645 3300005841 Bacteria 13539
107 Ga0068863_100256446 3300005841 Bacteria 1690
108 Ga0068863_100540856 3300005841 Bacteria 1149
109 Ga0068858_100030123 3300005842 Bacteria 5040
110 Ga0068858_100113135 3300005842 Bacteria 2535
111 Ga0068858_100121950 3300005842 Bacteria 2438
112 Ga0068860_100003074 3300005843 Bacteria 17251
113 Ga0068862_100155996 3300005844 Bacteria 2035
114 Ga0081455_10000949 3300005937 Bacteria 37086
115 Ga0081455_10002610 3300005937 Bacteria 21361
116 Ga0081455_10002826 3300005937 Bacteria 20450
117 Ga0081455_10004215 3300005937 Bacteria 16209
118 Ga0081455_10006017 3300005937 Bacteria 13145
119 Ga0081455_10017049 3300005937 Bacteria 6981
120 Ga0081538_10000738 3300005981 Bacteria 35697
121 Ga0081538_10001529 3300005981 Bacteria 23732
122 Ga0081540_1000278 3300005983 Bacteria 53271
123 Ga0081540_1000467 3300005983 Bacteria 39985
124 Ga0081540_1002683 3300005983 Bacteria 14475
125 Ga0081540_1069182 3300005983 Bacteria 1642
126 Ga0081539_10021607 3300005985 Bacteria 4289
127 Ga0070717_10054332 3300006028 Bacteria 3303
128 Ga0075365_10007515 3300006038 Bacteria 6113
129 Ga0075432_10000401 3300006058 Bacteria 12654
130 Ga0070712_100061217 3300006175 Bacteria 2658
131 Ga0097621_100010095 3300006237 Bacteria 6889
132 Ga0097621_100029164 3300006237 Bacteria 4356
133 Ga0097621_100266877 3300006237 Bacteria 1503
134 Ga0068871_100005312 3300006358 Bacteria 9023
135 Ga0068871_100035019 3300006358 Bacteria 3987
136 Ga0075428_100000974 3300006844 Bacteria 30272
137 Ga0075428_100011053 3300006844 Bacteria 10040
138 Ga0075430_100021693 3300006846 Bacteria 5458
139 Ga0075430_100025130 3300006846 Bacteria 5066
140 Ga0075430_100028490 3300006846 Bacteria 4744
141 Ga0075430_100039143 3300006846 Bacteria 4015
142 Ga0075431_100001516 3300006847 Bacteria 21529
143 Ga0075431_100001616 3300006847 Bacteria 21032
144 Ga0075431_100007887 3300006847 Bacteria 10608
145 Ga0075431_100048484 3300006847 Bacteria 4381
146 Ga0075433_10000223 3300006852 Bacteria 32380
147 Ga0075433_10016389 3300006852 Bacteria 6106
148 Ga0075433_10155044 3300006852 Bacteria 2038
149 Ga0075434_100000419 3300006871 Bacteria 31470
150 Ga0075434_100015794 3300006871 Bacteria 7249
151 Ga0075434_100085028 3300006871 Bacteria 3162
152 Ga0075434_100248517 3300006871 Bacteria 1798
153 Ga0075434_100533583 3300006871 Bacteria 1194
154 Ga0075429_100001011 3300006880 Bacteria 22404
155 Ga0068865_100004144 3300006881 Bacteria 8716
156 Ga0068865_100005141 3300006881 Bacteria 7923
157 Ga0068865_100009098 3300006881 Bacteria 6146
158 Ga0068865_100014592 3300006881 Bacteria 4996
159 Ga0068865_100068637 3300006881 Bacteria 2506
160 Ga0068865_100260418 3300006881 Bacteria 1373
161 Ga0075436_100004817 3300006914 Bacteria 9274
162 Ga0097620_100001255 3300006931 Bacteria 25905
163 Ga0097620_100003183 3300006931 Bacteria 16694
164 Ga0097620_100388637 3300006931 Bacteria 1491
165 Ga0075435_100013474 3300007076 Bacteria 6084
166 Ga0075435_100022118 3300007076 Bacteria 4902
167 Ga0105240_10066698 3300009093 Bacteria 4463
168 Ga0111539_10000164 3300009094 Bacteria 76464
169 Ga0111539_10003119 3300009094 Bacteria 21952
170 Ga0111539_10005251 3300009094 Bacteria 16780
171 Ga0111539_10054098 3300009094 Bacteria 4777
172 Ga0111539_10059966 3300009094 Bacteria 4510
173 Ga0111539_10073120 3300009094 Bacteria 4042
174 Ga0111539_10150236 3300009094 Bacteria 2727
175 Ga0111539_10265214 3300009094 Bacteria 1999
176 Ga0111539_10324273 3300009094 Bacteria 1793
177 Ga0111539_10558400 3300009094 Bacteria 1333
178 Ga0105245_10016616 3300009098 Bacteria 6423
179 Ga0105245_10029247 3300009098 Bacteria 4867
180 Ga0105245_10034003 3300009098 Bacteria 4518
181 Ga0105245_10053297 3300009098 Bacteria 3630
182 Ga0105245_10058164 3300009098 Bacteria 3479
183 Ga0105245_10266363 3300009098 Bacteria 1669
184 Ga0105245_10277933 3300009098 Bacteria 1636
185 Ga0105245_10419749 3300009098 Bacteria 1341
186 Ga0105247_10078426 3300009101 Bacteria 2077
187 Ga0105247_10144276 3300009101 Bacteria 1563
188 Ga0114129_10001975 3300009147 Bacteria 28045
189 Ga0114129_10026801 3300009147 Bacteria 8161
190 Ga0114129_10060297 3300009147 Bacteria 5305
191 Ga0114129_10090489 3300009147 Bacteria 4242
192 Ga0114129_10110255 3300009147 Bacteria 3799
193 Ga0114129_10267198 3300009147 Bacteria 2290
194 Ga0114129_10332899 3300009147 Bacteria 2015
195 Ga0114129_10446343 3300009147 Bacteria 1697
196 Ga0114129_10630845 3300009147 Bacteria 1385
197 Ga0105243_10003664 3300009148 Bacteria 12350
198 Ga0105243_10006906 3300009148 Bacteria 8748
199 Ga0105243_10009290 3300009148 Bacteria 7502
200 Ga0105243_10028174 3300009148 Bacteria 4310
201 Ga0105243_10034486 3300009148 Bacteria 3918
202 Ga0105243_10041016 3300009148 Bacteria 3619
203 Ga0105243_10060504 3300009148 Bacteria 3026
204 Ga0105243_10069591 3300009148 Bacteria 2839
205 Ga0105243_10445690 3300009148 Bacteria 1213
206 Ga0105242_10000297 3300009176 Bacteria 39548
207 Ga0105242_10053758 3300009176 Bacteria 3290
208 Ga0105242_10496598 3300009176 Bacteria 1160
209 Ga0105248_10000630 3300009177 Bacteria 40000
210 Ga0105248_10010673 3300009177 Bacteria 10133
211 Ga0105248_10038207 3300009177 Bacteria 5372
212 Ga0105248_10055105 3300009177 Bacteria 4459
213 Ga0105248_10157208 3300009177 Bacteria 2565
214 Ga0105248_10191101 3300009177 Bacteria 2307
215 Ga0105248_10299218 3300009177 Bacteria 1812
216 Ga0105248_10364462 3300009177 Bacteria 1627
217 Ga0105248_10382060 3300009177 Bacteria 1586
218 Ga0105238_10005657 3300009551 Bacteria 12353
219 Ga0105238_10124752 3300009551 Bacteria 2554
220 Ga0105238_10261711 3300009551 Bacteria 1709
221 Ga0105249_10115320 3300009553 Bacteria 2545
222 Ga0105249_10162184 3300009553 Bacteria 2161
223 Ga0105239_10004153 3300010375 Bacteria 17392
224 Ga0105239_10108509 3300010375 Bacteria 3075
225 Ga0105239_10515830 3300010375 Unclassified 1360
226 Ga0105246_10031281 3300011119 Bacteria 3521
227 Ga0105246_10092722 3300011119 Bacteria 2180
228 Ga0105246_10096432 3300011119 Bacteria 2144
229 Ga0105246_10151560 3300011119 Bacteria 1755
230 Ga0157338_1000636 3300012515 Bacteria 2171
231 Ga0157373_10028612 3300013100 Bacteria 4020
232 Ga0157371_10029425 3300013102 Bacteria 3973
233 Ga0157374_10012881 3300013296 Bacteria 7285
234 Ga0157378_10000780 3300013297 Bacteria 29624
235 Ga0157378_10354040 3300013297 Bacteria 1435
236 Ga0163162_10011679 3300013306 Bacteria 8564
237 Ga0163162_10074587 3300013306 Bacteria 3451
238 Ga0163162_10136701 3300013306 Bacteria 2562
239 Ga0163162_10253056 3300013306 Bacteria 1893
240 Ga0157372_10046853 3300013307 Bacteria 4801
241 Ga0157372_10310406 3300013307 Bacteria 1836
242 Ga0157372_10501017 3300013307 Bacteria 1416
243 Ga0157375_10002770 3300013308 Bacteria 15166
244 Ga0157375_10047524 3300013308 Bacteria 4192
245 Ga0157375_10109686 3300013308 Plasmid 2856
246 Ga0157375_10115108 3300013308 Bacteria 2792
247 Ga0157375_10146736 3300013308 Bacteria 2490
248 Ga0157375_10264716 3300013308 Bacteria 1881
249 Ga0157375_10273909 3300013308 Bacteria 1850
250 Ga0157375_10387162 3300013308 Bacteria 1565
251 Ga0163163_10025119 3300014325 Bacteria 5677
252 Ga0163163_10029108 3300014325 Bacteria 5311
253 Ga0163163_10052907 3300014325 Bacteria 4007
254 Ga0163163_10395601 3300014325 Bacteria 1440
255 Ga0163163_10419216 3300014325 Bacteria 1397
256 Ga0157380_10069332 3300014326 Bacteria 2845
257 Ga0157380_10087027 3300014326 Bacteria 2568
258 Ga0182008_10137369 3300014497 Bacteria 1221
259 Ga0157377_10215609 3300014745 Unclassified 1226
260 Ga0157379_10004195 3300014968 Bacteria 12302
261 Ga0157379_10019662 3300014968 Bacteria 5967
262 Ga0157376_10024352 3300014969 Unclassified 4750
263 Ga0157376_10053083 3300014969 Bacteria 3373
264 Ga0157376_10076137 3300014969 Bacteria 2866
265 Ga0157376_10152912 3300014969 Bacteria 2083
266 Ga0157376_10181504 3300014969 Bacteria 1924
267 Ga0157376_10181951 3300014969 Bacteria 1922
268 Ga0163161_10264549 3300017792 Bacteria 1344
269 Ga0206356_11443902 3300020070 Bacteria 1821
270 Ga0206354_11259363 3300020081 Bacteria 2562
271 Ga0207653_10001129 3300025885 Bacteria 8732
272 Ga0207692_10099733 3300025898 Bacteria 1592
273 Ga0207642_10000270 3300025899 Bacteria 15603
274 Ga0207688_10004267 3300025901 Bacteria 7795
275 Ga0207688_10011591 3300025901 Bacteria 4796
276 Ga0207680_10041617 3300025903 Bacteria 2683
277 Ga0207647_10145771 3300025904 Bacteria 1386
278 Ga0207699_10045154 3300025906 Bacteria 2570
279 Ga0207699_10100289 3300025906 Bacteria 1836
280 Ga0207645_10001002 3300025907 Bacteria 23327
281 Ga0207645_10066791 3300025907 Bacteria 2299
282 Ga0207643_10012769 3300025908 Bacteria 4541
283 Ga0207643_10152440 3300025908 Bacteria 1386
284 Ga0207705_10234860 3300025909 Bacteria 1395
285 Ga0207707_10010628 3300025912 Bacteria 7994
286 Ga0207671_10263910 3300025914 Bacteria 1356
287 Ga0207693_10016810 3300025915 Bacteria 5841
288 Ga0207693_10041075 3300025915 Bacteria 3643
289 Ga0207693_10141736 3300025915 Bacteria 1890
290 Ga0207693_10232183 3300025915 Bacteria 1449
291 Ga0207663_10136442 3300025916 Bacteria 1703
292 Ga0207660_10077349 3300025917 Bacteria 2436
293 Ga0207649_10190318 3300025920 Bacteria 1443
294 Ga0207652_10008278 3300025921 Bacteria 8360
295 Ga0207652_10200759 3300025921 Bacteria 1794
296 Ga0207681_10170215 3300025923 Bacteria 1650
297 Ga0207694_10209344 3300025924 Bacteria 1588
298 Ga0207650_10037891 3300025925 Bacteria 3516
299 Ga0207650_10179450 3300025925 Bacteria 1687
300 Ga0207659_10010403 3300025926 Bacteria 5847
301 Ga0207659_10273965 3300025926 Bacteria 1377
302 Ga0207659_10365390 3300025926 Bacteria 1200
303 Ga0207687_10054649 3300025927 Bacteria 2794
304 Ga0207687_10061789 3300025927 Bacteria 2647
305 Ga0207687_10082177 3300025927 Bacteria 2330
306 Ga0207687_10195500 3300025927 Bacteria 1577
307 Ga0207700_10004883 3300025928 Bacteria 7965
308 Ga0207644_10017805 3300025931 Bacteria 4804
309 Ga0207644_10085166 3300025931 Bacteria 2344
310 Ga0207644_10199196 3300025931 Bacteria 1579
311 Ga0207690_10035249 3300025932 Bacteria 3231
312 Ga0207690_10248543 3300025932 Bacteria 1373
313 Ga0207706_10000065 3300025933 Bacteria 109080
314 Ga0207706_10032813 3300025933 Bacteria 4621
315 Ga0207686_10000390 3300025934 Bacteria 30564
316 Ga0207686_10164984 3300025934 Bacteria 1556
317 Ga0207686_10198539 3300025934 Bacteria 1435
318 Ga0207686_10289639 3300025934 Bacteria 1212
319 Ga0207709_10041254 3300025935 Bacteria 2768
320 Ga0207709_10169204 3300025935 Bacteria 1532
321 Ga0207709_10205953 3300025935 Bacteria 1408
322 Ga0207669_10002903 3300025937 Bacteria 7356
323 Ga0207669_10070246 3300025937 Bacteria 2195
324 Ga0207704_10003859 3300025938 Bacteria 6809
325 Ga0207704_10106457 3300025938 Bacteria 1884
326 Ga0207704_10158764 3300025938 Bacteria 1606
327 Ga0207665_10010913 3300025939 Bacteria 5962
328 Ga0207691_10019700 3300025940 Bacteria 6380
329 Ga0207691_10240200 3300025940 Bacteria 1566
330 Ga0207691_10270129 3300025940 Bacteria 1464
331 Ga0207711_10003997 3300025941 Bacteria 12662
332 Ga0207711_10017179 3300025941 Bacteria 6012
333 Ga0207711_10274591 3300025941 Bacteria 1551
334 Ga0207689_10015253 3300025942 Bacteria 6506
335 Ga0207689_10066420 3300025942 Bacteria 2966
336 Ga0207661_10021776 3300025944 Bacteria 4810
337 Ga0207661_10022062 3300025944 Bacteria 4786
338 Ga0207661_10023870 3300025944 Bacteria 4626
339 Ga0207661_10144910 3300025944 Bacteria 2048
340 Ga0207661_10264500 3300025944 Bacteria 1533
341 Ga0207661_10433024 3300025944 Bacteria 1196
342 Ga0207679_10027170 3300025945 Bacteria 3955
343 Ga0207679_10174625 3300025945 Bacteria 1772
344 Ga0207667_10201493 3300025949 Bacteria 2042
345 Ga0207651_10031128 3300025960 Bacteria 3407
346 Ga0207651_10036814 3300025960 Bacteria 3199
347 Ga0207712_10160591 3300025961 Bacteria 1746
348 Ga0207712_10241943 3300025961 Bacteria 1454
349 Ga0207668_10109281 3300025972 Bacteria 2071
350 Ga0207640_10020688 3300025981 Bacteria 3910
351 Ga0207640_10322933 3300025981 Bacteria 1230
352 Ga0207658_10027328 3300025986 Bacteria 4007
353 Ga0207677_10238547 3300026023 Bacteria 1469
354 Ga0207703_10020144 3300026035 Bacteria 5214
355 Ga0207703_10047263 3300026035 Bacteria 3469
356 Ga0207639_10180107 3300026041 Bacteria 1797
357 Ga0207678_10007041 3300026067 Bacteria 9984
358 Ga0207678_10014744 3300026067 Bacteria 6878
359 Ga0207678_10217604 3300026067 Bacteria 1635
360 Ga0207678_10403110 3300026067 Bacteria 1184
361 Ga0207708_10018339 3300026075 Bacteria 5271
362 Ga0207708_10090855 3300026075 Bacteria 2354
363 Ga0207708_10191654 3300026075 Bacteria 1627
364 Ga0207702_10027837 3300026078 Bacteria 4696
365 Ga0207702_10034645 3300026078 Bacteria 4222
366 Ga0207641_10011879 3300026088 Bacteria 7143
367 Ga0207641_10253681 3300026088 Bacteria 1644
368 Ga0207648_10000211 3300026089 Bacteria 62641
369 Ga0207676_10013407 3300026095 Bacteria 5887
370 Ga0207676_10066841 3300026095 Bacteria 2869
371 Ga0207676_10271700 3300026095 Bacteria 1535
372 Ga0207676_10441340 3300026095 Bacteria 1225
373 Ga0207674_10008192 3300026116 Bacteria 12112
374 Ga0207674_10020587 3300026116 Bacteria 7123
375 Ga0207675_100062532 3300026118 Bacteria 3477
376 Ga0207675_100389575 3300026118 Bacteria 1371
377 Ga0207683_10262286 3300026121 Bacteria 1578
378 Ga0207698_10193980 3300026142 Bacteria 1812
379 Ga0209179_1001588 3300027512 Bacteria 2837
380 Ga0207428_10000696 3300027907 Bacteria 39096
381 Ga0207428_10002628 3300027907 Bacteria 17910
382 Ga0207428_10009996 3300027907 Bacteria 8492
383 Ga0207428_10013268 3300027907 Bacteria 7203
384 Ga0207428_10057368 3300027907 Bacteria 3091
385 Ga0268266_10001206 3300028379 Bacteria 31890
386 Ga0268265_10081705 3300028380 Bacteria 2553
387 Ga0268265_10127667 3300028380 Bacteria 2108
388 Ga0268264_10006781 3300028381 Bacteria 9618
389 Ga0268264_10011848 3300028381 Bacteria 7185
390 Ga0268264_10339688 3300028381 Bacteria 1426
391 Ga0265338_10016076 3300028800 Bacteria 8168
392 Ga0265338_10031037 3300028800 Bacteria 5247
393 Ga0307513_10246227 3300031456 Bacteria 1588
394 Ga0307509_10191332 3300031507 Bacteria 1897
395 Ga0307408_100007383 3300031548 Bacteria 7272
396 Ga0307408_100020650 3300031548 Bacteria 4448
397 Ga0307408_100109824 3300031548 Bacteria 2116
398 Ga0307408_100153573 3300031548 Bacteria 1820
399 Ga0307408_100338341 3300031548 Bacteria 1273
400 Ga0316576_10000338 3300031727 Bacteria 21141
401 Ga0316578_10004402 3300031728 Bacteria 6649
402 Ga0307516_10031692 3300031730 Bacteria 5328
403 Ga0307405_10000670 3300031731 Bacteria 13228
404 Ga0307405_10028107 3300031731 Bacteria 3271
405 Ga0307405_10051186 3300031731 Bacteria 2561
406 Ga0307405_10216192 3300031731 Bacteria 1403
407 Ga0307405_10331756 3300031731 Bacteria 1166
408 Ga0307413_10026814 3300031824 Bacteria 3182
409 Ga0307413_10065723 3300031824 Bacteria 2259
410 Ga0307413_10069488 3300031824 Bacteria 2210
411 Ga0307413_10076444 3300031824 Bacteria 2128
412 Ga0307413_10087607 3300031824 Bacteria 2017
413 Ga0307413_10132126 3300031824 Bacteria 1711
414 Ga0307410_10000147 3300031852 Bacteria 25255
415 Ga0307410_10000824 3300031852 Bacteria 13170
416 Ga0307410_10005511 3300031852 Bacteria 6707
417 Ga0307410_10009969 3300031852 Bacteria 5359
418 Ga0307410_10057506 3300031852 Bacteria 2648
419 Ga0307410_10148596 3300031852 Bacteria 1742
420 Ga0307406_10000058 3300031901 Bacteria 61600
421 Ga0307406_10010406 3300031901 Bacteria 5244
422 Ga0307406_10021189 3300031901 Bacteria 3841
423 Ga0307406_10077071 3300031901 Bacteria 2204
424 Ga0307406_10198114 3300031901 Bacteria 1476
425 Ga0307406_10288143 3300031901 Bacteria 1256
426 Ga0307406_10384744 3300031901 Bacteria 1107
427 Ga0307407_10007658 3300031903 Bacteria 4902
428 Ga0307407_10030353 3300031903 Bacteria 2915
429 Ga0307407_10057468 3300031903 Bacteria 2257
430 Ga0307407_10116144 3300031903 Bacteria 1688
431 Ga0307407_10188812 3300031903 Bacteria 1372
432 Ga0307409_100000233 3300031995 Bacteria 22466
433 Ga0307409_100009628 3300031995 Bacteria 5950
434 Ga0307409_100016467 3300031995 Bacteria 4892
435 Ga0307409_100023078 3300031995 Bacteria 4303
436 Ga0307409_100027954 3300031995 Bacteria 4008
437 Ga0307409_100067504 3300031995 Bacteria 2824
438 Ga0307409_100083169 3300031995 Bacteria 2594
439 Ga0307409_100106606 3300031995 Bacteria 2339
440 Ga0307409_100137754 3300031995 Bacteria 2098
441 Ga0307409_100154693 3300031995 Bacteria 1996
442 Ga0307409_100325431 3300031995 Bacteria 1440
443 Ga0307416_100000063 3300032002 Bacteria 97632
444 Ga0307416_100002018 3300032002 Bacteria 11408
445 Ga0307416_100032531 3300032002 Bacteria 3942
446 Ga0307416_100036367 3300032002 Bacteria 3775
447 Ga0307416_100060718 3300032002 Bacteria 3081
448 Ga0307416_100122924 3300032002 Bacteria 2318
449 Ga0307416_100125375 3300032002 Bacteria 2299
450 Ga0307416_100171946 3300032002 Bacteria 2018
451 Ga0307416_100406118 3300032002 Bacteria 1401
452 Ga0307416_100645821 3300032002 Bacteria 1142
453 Ga0307414_10004969 3300032004 Bacteria 7270
454 Ga0307414_10036028 3300032004 Bacteria 3299
455 Ga0307414_10229635 3300032004 Bacteria 1529
456 Ga0307414_10289909 3300032004 Bacteria 1379
457 Ga0307411_10009346 3300032005 Bacteria 5149
458 Ga0307411_10098101 3300032005 Bacteria 2064
459 Ga0307411_10230658 3300032005 Bacteria 1443
460 Ga0307415_100000327 3300032126 Bacteria 20647
461 Ga0307415_100007592 3300032126 Bacteria 5942
462 Ga0307415_100012698 3300032126 Bacteria 4880
463 Ga0307415_100097799 3300032126 Bacteria 2143
464 Ga0307415_100140744 3300032126 Bacteria 1842
465 Ga0307415_100162745 3300032126 Bacteria 1731
466 Ga0307415_100192805 3300032126 Bacteria 1609
467 Ga0307415_100381815 3300032126 Bacteria 1196
468 Ga0307510_10032760 3300033180 Bacteria 5850
469 Ga0373926_0045688 3300035083 Unclassified 1570
470 Ga0373934_0077857 3300035086 Bacteria 1330
471 Ga0373951_0005964 3300035091 Bacteria 2809
472 Ga0373923_0005923 3300035111 Bacteria 4182
473 Ga0373923_0051439 3300035111 Unclassified 1728
474 Ga0373941_0017161 3300035115 Bacteria 1979
475 Ga0373945_0009746 3300035116 Bacteria 3152
476 Ga0373945_0034316 3300035116 Bacteria 1807
477 Ga0373956_0004182 3300035119 Bacteria 5785
478 Ga0373957_0025363 3300035120 Unclassified 2135
479 Ga0373960_0022650 3300035121 Bacteria 1685
480 Ga0373955_0042476 3300035172 Bacteria 2441
481 Ga0316574_0006476 3300035398 Bacteria 6331
482 Ga0373924_0055516 3300035410 Bacteria 1648
483 Ga0373931_0013954 3300035691 Bacteria 3920
484 Ga0373935_0147360 3300035692 Bacteria 1594
485 Ga0373927_0076563 3300035695 Bacteria 2166
486 Ga0373927_0094275 3300035695 Bacteria 1945
487 Ga0373933_0007691 3300035724 Bacteria 5886
488 Ga0373933_0186726 3300035724 Unclassified 1323
489 Ga0373947_0024089 3300035725 Bacteria 3544
490 Ga0373937_0013422 3300036401 Bacteria 7215
491 Ga0373937_0038316 3300036401 Bacteria 4368
492 Ga0373937_0061202 3300036401 Bacteria 3460
493 Ga0373937_0324678 3300036401 Bacteria 1456
494 Ga0316582_0008819 3300036647 Bacteria 5437
495 Ga0373925_0073967 3300037068 Bacteria 2580
496 Ga0373925_0148524 3300037068 Bacteria 1838
497 Ga0373925_0167526 3300037068 Bacteria 1733
498 Ga0395900_0015864 3300037418 Bacteria 7675
499 Ga0395900_0283115 3300037418 Bacteria 1649
500 Ga0395898_0097773 3300037466 Bacteria 2819
501 Ga0395898_0526001 3300037466 Bacteria 1124
502 Ga0395905_0072278 3300037471 Bacteria 3234
503 Ga0395905_0352875 3300037471 Bacteria 1363
504 Ga0395905_0385386 3300037471 Bacteria 1296
505 Ga0395901_0054966 3300038443 Bacteria 4139
506 Ga0395901_0077737 3300038443 Bacteria 3464
507 Ga0436365_0719229 3300039437 Bacteria 1083
508 Ga0436365_1837480 3300039437 Bacteria 3359
509 Ga0439448_0007876 3300042005 Bacteria 3100
510 Ga0439448_0008232 3300042005 Bacteria 3048
511 Ga0439455_0007675 3300042012 Bacteria 2290
512 Ga0450914_002455 3300042118 Bacteria 1326
513 Ga0450905_006766 3300042142 Bacteria 1554
514 Ga0439458_0016974 3300042157 Bacteria 1659
515 Ga0439464_0004085 3300042439 Bacteria 3712
516 Ga0439464_0011158 3300042439 Bacteria 2376
517 Ga0439464_0019438 3300042439 Bacteria 1854
518 Ga0439460_0005870 3300042461 Bacteria 3026
519 Ga0439440_0002861 3300042993 Bacteria 3283
520 Ga0495617_027151 3300046452 Unclassified 1927
521 Ga0495592_0020215 3300046454 Bacteria 5065
522 Ga0495592_0167023 3300046454 Bacteria 1509
523 Ga0495592_0269943 3300046454 Bacteria 1116
524 Ga0495603_0100912 3300046455 Unclassified 1684
525 Ga0495629_0100043 3300046459 Unclassified 2023
526 Ga0495629_0110235 3300046459 Bacteria 1919
527 Ga0495629_0124779 3300046459 Bacteria 1794
528 Ga0495629_0131648 3300046459 Unclassified 1742
529 Ga0495629_0134350 3300046459 Bacteria 1722
530 Ga0495641_0083293 3300046461 Bacteria 1433
531 Ga0495641_0098303 3300046461 Bacteria 1306
532 Ga0495651_0022494 3300046462 Bacteria 4899
533 Ga0495653_0005591 3300046463 Bacteria 10252
534 Ga0495653_0018111 3300046463 Bacteria 5726
535 Ga0495653_0043858 3300046463 Bacteria 3474
536 Ga0495653_0121063 3300046463 Bacteria 1865
537 Ga0495653_0193078 3300046463 Bacteria 1388
538 Ga0495580_0001173 3300046472 Bacteria 23050
539 Ga0495580_0185535 3300046472 Unclassified 1436
540 Ga0495582_0096835 3300046473 Bacteria 1650
541 Ga0495662_0020041 3300046476 Bacteria 3236
542 Ga0495664_0012948 3300046477 Bacteria 4728
543 Ga0495664_0015231 3300046477 Bacteria 4368
544 Ga0495584_0000005 3300046491 Bacteria 306957
545 Ga0495584_0072395 3300046491 Unclassified 1732
546 Ga0495584_0080331 3300046491 Bacteria 1641
547 Ga0495585_0024011 3300046492 Bacteria 3497
548 Ga0495594_0113172 3300046499 Unclassified 1531
549 Ga0495607_0019910 3300046501 Bacteria 4252
550 Ga0495606_0018041 3300046507 Bacteria 5308
551 Ga0495608_0023371 3300046511 Bacteria 4236
552 Ga0495608_0042656 3300046511 Unclassified 3033
553 Ga0495608_0042969 3300046511 Bacteria 3021
554 Ga0495608_0147267 3300046511 Bacteria 1501
555 Ga0495618_0002676 3300046514 Bacteria 11349
556 Ga0495618_0010917 3300046514 Bacteria 5501
557 Ga0495618_0025147 3300046514 Bacteria 3694
558 Ga0495628_0243256 3300046516 Bacteria 1345
559 Ga0495628_0289923 3300046516 Unclassified 1213
560 Ga0495630_0003589 3300046517 Bacteria 10804
561 Ga0495630_0029817 3300046517 Bacteria 4056
562 Ga0495630_0046616 3300046517 Plasmid 3240
563 Ga0495637_0102763 3300046520 Unclassified 1115
564 Ga0495644_0035871 3300046523 Unclassified 1871
565 Ga0495663_0015205 3300046525 Bacteria 2166
566 Ga0495666_0054396 3300046526 Bacteria 1919
567 Ga0495652_0019749 3300046529 Bacteria 5994
568 Ga0495652_0045718 3300046529 Bacteria 3761
569 Ga0495652_0187095 3300046529 Unclassified 1583
570 Ga0495640_0001188 3300046533 Bacteria 20367
571 Ga0495640_0011004 3300046533 Bacteria 6968
572 Ga0495640_0121859 3300046533 Bacteria 1694
573 Ga0495586_0045951 3300046535 Bacteria 2354
574 Ga0495586_0061151 3300046535 Bacteria 2049
575 Ga0495586_0113780 3300046535 Unclassified 1507
576 Ga0495587_0002769 3300046536 Bacteria 11699
577 Ga0495587_0019408 3300046536 Bacteria 4207
578 Ga0495598_0014740 3300046537 Unclassified 1959
579 Ga0495609_0089780 3300046538 Bacteria 1337
580 Ga0495645_0004016 3300046543 Bacteria 10048
581 Ga0495645_0013960 3300046543 Bacteria 5692
582 Ga0495645_0179292 3300046543 Unclassified 1453
583 Ga0495622_0077285 3300046557 Unclassified 1534
584 Ga0495633_0023749 3300046558 Bacteria 3035
585 Ga0495667_0002063 3300046559 Bacteria 13337
586 Ga0495667_0010593 3300046559 Bacteria 6237
587 Ga0495667_0086055 3300046559 Bacteria 2039
588 Ga0495667_0213930 3300046559 Bacteria 1231
589 Ga0495656_0029998 3300046615 Unclassified 2194
590 Ga0495656_0100810 3300046615 Bacteria 1335
591 Ga0495634_0033701 3300046642 Bacteria 3517
592 Ga0495634_0046446 3300046642 Bacteria 2931
593 Ga0495634_0073892 3300046642 Unclassified 2241
594 Ga0495611_0045768 3300046648 Unclassified 1960
595 Ga0495635_0069760 3300046663 Bacteria 2409
596 Ga0495635_0106290 3300046663 Bacteria 1917
597 Ga0495635_0175655 3300046663 Bacteria 1456
598 Ga0495635_0235425 3300046663 Bacteria 1236
599 Ga0495659_0014854 3300046664 Bacteria 2554
600 Ga0495661_0131618 3300046665 Unclassified 1370
601 Ga0495588_0024681 3300046674 Bacteria 2988
602 Ga0495588_0045188 3300046674 Bacteria 2257
603 Ga0495657_0029251 3300046675 Unclassified 3866
604 Ga0495599_0008532 3300046678 Bacteria 6235
605 Ga0495599_0029551 3300046678 Bacteria 3435
606 Ga0495623_0004038 3300046679 Bacteria 9663
607 Ga0495646_0108646 3300046680 Unclassified 1581
608 Ga0495647_0008477 3300046681 Unclassified 3457
609 Ga0495658_0002446 3300046683 Bacteria 9350
610 Ga0495658_0127736 3300046683 Bacteria 1544
611 Ga0495669_0058084 3300046684 Unclassified 1746
612 Ga0495613_0013468 3300046689 Bacteria 6073
613 Ga0495613_0042179 3300046689 Bacteria 3377
614 Ga0495613_0047429 3300046689 Bacteria 3173
615 Ga0495613_0062744 3300046689 Plasmid 2719
616 Ga0495613_0147310 3300046689 Bacteria 1680
617 Ga0495613_0217792 3300046689 Bacteria 1341
618 Ga0495624_0016059 3300046690 Bacteria 5040
619 Ga0495589_0074262 3300046794 Unclassified 1659
620 Ga0495600_0002596 3300046809 Bacteria 10412
621 Ga0495600_0005724 3300046809 Bacteria 7507
622 Ga0495600_0025218 3300046809 Bacteria 3831
623 Ga0495600_0123417 3300046809 Bacteria 1684
624 Ga0495581_0049407 3300047315 Bacteria 2428
625 Ga0495581_0096264 3300047315 Bacteria 1719
626 Ga0495604_0019876 3300047317 Bacteria 5373
627 Ga0495604_0038494 3300047317 Bacteria 3762
628 Ga0495604_0042140 3300047317 Unclassified 3578
629 Ga0495604_0162753 3300047317 Bacteria 1575
630 Ga0495604_0236908 3300047317 Bacteria 1250
631 Ga0495604_0308136 3300047317 Bacteria 1061
632 Ga0495674_0001467 3300047319 Bacteria 23112
633 Ga0495674_0018328 3300047319 Bacteria 6516
634 Ga0495674_0088391 3300047319 Bacteria 2650
635 Ga0495674_0151283 3300047319 Bacteria 1946
636 Ga0495674_0194645 3300047319 Bacteria 1684
637 Ga0495674_0321624 3300047319 Bacteria 1260
638 Ga0495672_0008285 3300047320 Bacteria 7699
639 Ga0495676_0086098 3300047321 Bacteria 2366
640 Ga0495680_0002298 3300047322 Bacteria 19632
641 Ga0495680_0002570 3300047322 Bacteria 18505
642 Ga0495680_0010629 3300047322 Bacteria 8207
643 Ga0495680_0013843 3300047322 Bacteria 7018
644 Ga0495680_0016453 3300047322 Bacteria 6351
645 Ga0495680_0018429 3300047322 Bacteria 5929
646 Ga0495680_0031972 3300047322 Bacteria 4277
647 Ga0495680_0102827 3300047322 Unclassified 2127
648 Ga0495675_0002616 3300047444 Bacteria 10790
649 Ga0495679_054652 3300047446 Unclassified 1188
650 Ga0495684_0009809 3300047471 Bacteria 7391
651 Ga0495684_0017859 3300047471 Bacteria 5465
652 Ga0495684_0030151 3300047471 Plasmid 4164
653 Ga0495684_0130828 3300047471 Bacteria 1885
654 Ga0495593_0009266 3300047673 Bacteria 5712
655 Ga0495593_0035745 3300047673 Unclassified 2696
656 Ga0495593_0158879 3300047673 Bacteria 1141
657 Ga0495602_0033049 3300048088 Bacteria 4860
658 Ga0495602_0072169 3300048088 Unclassified 2945
659 Ga0495614_0069554 3300048089 Bacteria 1516
660 Ga0496100_0036973 3300048903 Bacteria 3083
661 Ga0496100_0054431 3300048903 Bacteria 2610
662 Ga0496100_0277280 3300048903 Bacteria 1249
663 Ga0496101_0007471 3300048904 Bacteria 7084
664 Ga0496101_0010440 3300048904 Bacteria 6134
665 Ga0496101_0468543 3300048904 Bacteria 994
666 Ga0496102_0006178 3300048905 Bacteria 10212
667 Ga0496102_0145618 3300048905 Bacteria 2223
668 Ga0496102_0159734 3300048905 Bacteria 2120
669 Ga0496102_0332804 3300048905 Bacteria 1430
670 Ga0496102_0409027 3300048905 Bacteria 1275
671 Ga0496103_0111364 3300048906 Bacteria 1739
672 Ga0496104_0000757 3300048907 Bacteria 27662
673 Ga0496104_0004139 3300048907 Bacteria 12596
674 Ga0496104_0008974 3300048907 Bacteria 8891
675 Ga0496104_0093086 3300048907 Bacteria 2882
676 Ga0496104_0126726 3300048907 Bacteria 2452
677 Ga0496104_0203444 3300048907 Bacteria 1892
678 Ga0496104_0218736 3300048907 Bacteria 1817
679 Ga0496104_0261356 3300048907 Bacteria 1644
680 Ga0496105_0002226 3300048908 Bacteria 14052
681 Ga0496105_0046640 3300048908 Bacteria 3576
682 Ga0496105_0057070 3300048908 Bacteria 3224
683 Ga0496105_0093718 3300048908 Bacteria 2480
684 Ga0496105_0168551 3300048908 Bacteria 1796
685 Ga0496105_0273452 3300048908 Bacteria 1364
686 Ga0496105_0328148 3300048908 Bacteria 1225
687 Ga0496105_0417979 3300048908 Bacteria 1062
688 Ga0496106_0062560 3300048909 Bacteria 2826
689 Ga0496106_0083355 3300048909 Bacteria 2459
690 Ga0496106_0087736 3300048909 Bacteria 2397
691 Ga0496106_0120430 3300048909 Bacteria 2051
692 Ga0496106_0425655 3300048909 Bacteria 1067
693 Ga0496107_0008752 3300048910 Bacteria 7012
694 Ga0496107_0107688 3300048910 Bacteria 2047
695 Ga0496107_0220012 3300048910 Bacteria 1412
696 Ga0496108_0011231 3300048911 Bacteria 7275
697 Ga0496108_0093685 3300048911 Bacteria 2555
698 Ga0496108_0103414 3300048911 Bacteria 2430
699 Ga0496108_0146531 3300048911 Bacteria 2036
700 Ga0496108_0301565 3300048911 Bacteria 1395
701 Ga0496109_0005069 3300048912 Bacteria 11005
702 Ga0496109_0008339 3300048912 Bacteria 8801
703 Ga0496109_0047294 3300048912 Bacteria 3911
704 Ga0496109_0075921 3300048912 Bacteria 3090
705 Ga0496109_0090528 3300048912 Bacteria 2829
706 Ga0496109_0107352 3300048912 Bacteria 2593
707 Ga0496109_0254703 3300048912 Bacteria 1653
708 Ga0496109_0333176 3300048912 Bacteria 1433
709 Ga0496110_0001589 3300048913 Bacteria 16599
710 Ga0496110_0004299 3300048913 Bacteria 11023
711 Ga0496110_0025590 3300048913 Bacteria 5045
712 Ga0496110_0076484 3300048913 Bacteria 2976
713 Ga0496111_0001995 3300048914 Bacteria 12140
714 Ga0496111_0003435 3300048914 Bacteria 9801
715 Ga0496111_0011341 3300048914 Bacteria 6000
716 Ga0496111_0051811 3300048914 Bacteria 2963
717 Ga0496111_0208628 3300048914 Bacteria 1451
718 Ga0496111_0208863 3300048914 Bacteria 1450
719 Ga0496111_0251141 3300048914 Bacteria 1313
720 Ga0496111_0451696 3300048914 Bacteria 948
721 Ga0496112_0006723 3300048915 Bacteria 10127
722 Ga0496112_0006933 3300048915 Bacteria 10000
723 Ga0496113_0003729 3300048916 Bacteria 9188
724 Ga0496113_0241990 3300048916 Bacteria 1440
725 Ga0496114_0001139 3300048917 Bacteria 20090
726 Ga0496114_0002549 3300048917 Bacteria 13907
727 Ga0496114_0006052 3300048917 Bacteria 9520
728 Ga0496114_0017732 3300048917 Bacteria 5753
729 Ga0496114_0032819 3300048917 Bacteria 4276
730 Ga0496114_0037181 3300048917 Bacteria 4026
731 Ga0496114_0038768 3300048917 Bacteria 3942
732 Ga0496114_0076407 3300048917 Bacteria 2822
733 Ga0496114_0076849 3300048917 Bacteria 2814
734 Ga0496114_0083596 3300048917 Bacteria 2701
735 Ga0496115_0017884 3300048918 Bacteria 5429
736 Ga0496115_0032592 3300048918 Plasmid 4110
737 Ga0496115_0119854 3300048918 Bacteria 2164
738 Ga0496115_0181662 3300048918 Bacteria 1739
739 Ga0496115_0422934 3300048918 Bacteria 1079
740 Ga0496121_0000194 3300048924 Bacteria 136324
741 Ga0496121_0001789 3300048924 Bacteria 34756
742 Ga0496126_0009087 3300048929 Bacteria 10621
743 Ga0501031_0017507 3300049568 Bacteria 4658
744 Ga0501032_0024192 3300049569 Bacteria 4195
745 Ga0501032_0055741 3300049569 Bacteria 2659
746 Ga0501032_0166369 3300049569 Bacteria 1447
747 Ga0501033_0017964 3300049570 Bacteria 5340
748 Ga0501034_0189348 3300049571 Bacteria 2020
749 Ga0501036_0000024 3300049572 Bacteria 110026
750 Ga0501036_0019206 3300049572 Bacteria 5734
751 Ga0501038_0006128 3300049574 Bacteria 11130
752 Ga0501038_0015159 3300049574 Bacteria 7013
753 Ga0501038_0056352 3300049574 Bacteria 3375
754 Ga0501039_0000545 3300049575 Bacteria 27233
755 Ga0501039_0005795 3300049575 Bacteria 9357
756 Ga0501039_0005839 3300049575 Bacteria 9323
757 Ga0501040_0000548 3300049576 Bacteria 22755
758 Ga0501040_0002444 3300049576 Bacteria 11968
759 Ga0501040_0003752 3300049576 Bacteria 9849
760 Ga0501040_0005846 3300049576 Bacteria 7962
761 Ga0501040_0077744 3300049576 Bacteria 2295
762 Ga0501040_0269799 3300049576 Bacteria 1215
763 Ga0501041_0003287 3300049577 Bacteria 9297
764 Ga0501041_0005145 3300049577 Bacteria 7632
765 Ga0501041_0016957 3300049577 Bacteria 4333
766 Ga0501042_0000127 3300049578 Bacteria 32933
767 Ga0501042_0002659 3300049578 Bacteria 11000
768 Ga0501042_0020524 3300049578 Bacteria 4599
769 Ga0501042_0032831 3300049578 Bacteria 3677
770 Ga0501043_0018311 3300049579 Bacteria 5491
771 Ga0501043_0034336 3300049579 Bacteria 3989
772 Ga0501046_0002235 3300049580 Bacteria 18266
773 Ga0501046_0004821 3300049580 Bacteria 12160
774 Ga0501046_0064867 3300049580 Bacteria 2850
775 Ga0501047_0252291 3300049581 Bacteria 1613
776 Ga0501048_0005887 3300049582 Bacteria 9333
777 Ga0501048_0006439 3300049582 Bacteria 8924
778 Ga0501048_0015041 3300049582 Bacteria 5719
779 Ga0501048_0023235 3300049582 Unclassified 4534
780 Ga0501048_0082728 3300049582 Bacteria 2264
781 Ga0501068_0003313 3300049584 Bacteria 8634
782 Ga0501068_0217116 3300049584 Bacteria 1215
783 Ga0501069_0045790 3300049585 Bacteria 2424
784 Ga0501069_0052160 3300049585 Bacteria 2277
785 Ga0501070_0041191 3300049586 Bacteria 3848
786 Ga0501070_0111656 3300049586 Bacteria 2259
787 Ga0501071_0000240 3300049587 Bacteria 25237
788 Ga0501071_0021452 3300049587 Bacteria 4498
789 Ga0501071_0022642 3300049587 Bacteria 4381
790 Ga0501071_0046338 3300049587 Bacteria 3122
791 Ga0501071_0099615 3300049587 Bacteria 2141
792 Ga0501071_0251608 3300049587 Bacteria 1334
793 Ga0501071_0277901 3300049587 Bacteria 1267
794 Ga0501072_0000135 3300049588 Bacteria 55479
795 Ga0501072_0000860 3300049588 Bacteria 22296
796 Ga0501072_0004841 3300049588 Bacteria 10251
797 Ga0501072_0005557 3300049588 Bacteria 9589
798 Ga0501072_0009084 3300049588 Bacteria 7548
799 Ga0501074_0031894 3300049590 Bacteria 3819
800 Ga0501074_0036786 3300049590 Bacteria 3546
801 Ga0501075_0000252 3300049591 Bacteria 28970
802 Ga0501075_0001006 3300049591 Bacteria 18017
803 Ga0501075_0008589 3300049591 Bacteria 7121
804 Ga0501075_0009624 3300049591 Bacteria 6766
805 Ga0501075_0014224 3300049591 Archaea 5701
806 Ga0501076_0001183 3300049592 Bacteria 17272
807 Ga0501076_0002949 3300049592 Bacteria 11792
808 Ga0501076_0002969 3300049592 Bacteria 11767
809 Ga0501076_0047177 3300049592 Bacteria 3405
810 Ga0501076_0096008 3300049592 Unclassified 2387
811 Ga0501076_0196746 3300049592 Bacteria 1645
812 Ga0501077_0001426 3300049593 Bacteria 14343
813 Ga0501077_0003333 3300049593 Bacteria 9664
814 Ga0501077_0011109 3300049593 Bacteria 5617
815 Ga0501077_0072059 3300049593 Bacteria 2189
816 Ga0501079_0000135 3300049741 Bacteria 39988
817 Ga0501079_0007821 3300049741 Archaea 8095
818 Ga0501079_0037086 3300049741 Bacteria 3756
819 Ga0501079_0181029 3300049741 Bacteria 1644
820 Ga0501080_0024649 3300049742 Bacteria 5579
821 Ga0501080_0335111 3300049742 Bacteria 1368
822 Ga0501081_0000233 3300049743 Bacteria 28110
823 Ga0501081_0006069 3300049743 Bacteria 7830
824 Ga0501081_0014471 3300049743 Bacteria 5203
825 Ga0501081_0015776 3300049743 Bacteria 4987
826 Ga0501081_0021674 3300049743 Bacteria 4289
827 Ga0501083_0007199 3300049744 Bacteria 7900
828 Ga0501035_0019343 3300049822 Bacteria 6264
829 Ga0501035_0022998 3300049822 Bacteria 5721
830 Ga0501035_0072175 3300049822 Bacteria 3056
831 Ga0501045_0003184 3300049824 Bacteria 11225
832 Ga0501045_0003585 3300049824 Bacteria 10661
833 Ga0501045_0036826 3300049824 Bacteria 3554
834 Ga0501045_0160825 3300049824 Bacteria 1671
835 nmdc:mga05p37_165440_c1 3300050507 Bacteria 2700
836 nmdc:mga05p37_21883_c1 3300050507 Bacteria 7747
837 nmdc:mga05p37_219602_c1 3300050507 Bacteria 2294
838 nmdc:mga05p37_27954_c1 3300050507 Bacteria 6871
839 nmdc:mga05p37_3524_c1 3300050507 Bacteria 18277
840 nmdc:mga05p37_42960_c1 3300050507 Bacteria 5557
841 nmdc:mga05p37_460825_c1 3300050507 Bacteria 1469
842 nmdc:mga05p37_9378_c1 3300050507 Bacteria 11584
843 nmdc:mga09592_17151_c1 3300050508 Bacteria 5930
844 nmdc:mga0qj67_2071_c1 3300050509 Bacteria 14316
845 nmdc:mga0qj67_56364_c1 3300050509 Bacteria 3115
846 nmdc:mga0qj67_84568_c1 3300050509 Bacteria 2544
847 nmdc:mga06r32_15098_c1 3300050510 Bacteria 7013
848 nmdc:mga06r32_391429_c1 3300050510 Bacteria 1372
849 nmdc:mga08y16_130735_c1 3300050511 Bacteria 2611
850 nmdc:mga08y16_13240_c1 3300050511 Bacteria 8674
851 nmdc:mga08y16_18582_c1 3300050511 Bacteria 7325
852 nmdc:mga08y16_240503_c1 3300050511 Unclassified 1871
853 nmdc:mga08y16_366142_c1 3300050511 Bacteria 1479
854 nmdc:mga08y16_733_c1 3300050511 Bacteria 31115
855 nmdc:mga08y16_98879_c1 3300050511 Bacteria 3038
856 nmdc:mga0n895_106342_c1 3300050512 Bacteria 2819
857 nmdc:mga0n895_16208_c1 3300050512 Bacteria 6832
858 nmdc:mga0n895_179723_c1 3300050512 Bacteria 2147
859 nmdc:mga0n895_2119_c1 3300050512 Bacteria 15321
860 nmdc:mga0rr50_19047_c1 3300050513 Bacteria 4623
861 nmdc:mga0rr50_5888_c1 3300050513 Bacteria 7377
862 nmdc:mga08x19_24796_c1 3300050514 Bacteria 3731
863 nmdc:mga0a205_20798_c1 3300050515 Bacteria 6200
864 nmdc:mga0a205_4323_c1 3300050515 Bacteria 12736
865 nmdc:mga0a205_95348_c1 3300050515 Bacteria 2874
866 Ga0495601_0001360 3300053077 Bacteria 13452
867 Ga0495601_0002663 3300053077 Bacteria 10125
868 Ga0495601_0012892 3300053077 Bacteria 5018
869 Ga0495601_0041357 3300053077 Bacteria 2889
870 Ga0495612_0002589 3300053078 Bacteria 7457
871 Ga0495612_0005738 3300053078 Bacteria 5128
872 Ga0495595_0047764 3300053084 Bacteria 1975
873 Ga0495595_0050572 3300053084 Bacteria 1925
874 Ga0495595_0126832 3300053084 Unclassified 1245
875 Ga0495619_0046463 3300053085 Bacteria 2855
876 Ga0495619_0069480 3300053085 Bacteria 2354
877 Ga0495619_0144408 3300053085 Bacteria 1640
878 Ga0500568_0015668 3300053139 Bacteria 3390
879 Ga0500600_0084144 3300053149 Bacteria 1713
880 Ga0501084_0000583 3300054114 Bacteria 27895
881 Ga0501084_0000970 3300054114 Bacteria 22234
882 Ga0501084_0005641 3300054114 Bacteria 10275
883 Ga0501082_0002881 3300060353 Bacteria 14996
884 Ga0501082_0005193 3300060353 Bacteria 11323
885 Ga0501082_0016883 3300060353 Bacteria 6286
886 Ga0501082_0023386 3300060353 Bacteria 5330
887 Ga0501082_0059567 3300060353 Bacteria 3291
888 Ga0530510_0000013 3300061734 Bacteria 110065
889 Ga0530510_0000632 3300061734 Bacteria 22653
890 Ga0530510_0000696 3300061734 Bacteria 21768
891 Ga0530510_0010498 3300061734 Bacteria 6492
892 Ga0530510_0277731 3300061734 Bacteria 1251

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10052907 Ga0163163_100529072 266
2 3300048914 Ga0496111_0451696 Ga0496111_0451696_15_863 269
3 3300025942 Ga0207689_10066420 Ga0207689_100664202 279
4 3300050507 nmdc:mga05p37_21883_c1 nmdc:mga05p37_21883_c1_2791_3771 286
5 3300006846 Ga0075430_100021693 Ga0075430_1000216935 288
6 3300006847 Ga0075431_100007887 Ga0075431_10000788712 288
7 3300009094 Ga0111539_10059966 Ga0111539_100599662 288
8 3300009147 Ga0114129_10026801 Ga0114129_100268012 288
9 3300050509 nmdc:mga0qj67_84568_c1 nmdc:mga0qj67_84568_c1_455_1462 288
10 3300026023 Ga0207677_10238547 Ga0207677_102385472 291
11 3300042118 Ga0450914_002455 Ga0450914_002455_340_1248 293
12 3300049569 Ga0501032_0166369 Ga0501032_0166369_299_1219 293
13 3300049572 Ga0501036_0019206 Ga0501036_0019206_1357_2277 293
14 3300049574 Ga0501038_0056352 Ga0501038_0056352_2151_3071 293
15 3300049576 Ga0501040_0002444 Ga0501040_0002444_3461_4381 293
16 3300049580 Ga0501046_0064867 Ga0501046_0064867_596_1516 293
17 3300049582 Ga0501048_0006439 Ga0501048_0006439_2806_3726 293
18 3300049587 Ga0501071_0021452 Ga0501071_0021452_2245_3165 293
19 3300049588 Ga0501072_0009084 Ga0501072_0009084_492_1412 293
20 3300049591 Ga0501075_0009624 Ga0501075_0009624_4960_5880 293
21 3300049592 Ga0501076_0047177 Ga0501076_0047177_2305_3225 293
22 3300060353 Ga0501082_0023386 Ga0501082_0023386_1780_2700 293
23 3300046491 Ga0495584_0080331 Ga0495584_0080331_39_1022 294
24 3300046664 Ga0495659_0014854 Ga0495659_0014854_1561_2544 294
25 3300042012 Ga0439455_0007675 Ga0439455_0007675_479_1387 295
26 3300005436 Ga0070713_100273355 Ga0070713_1002733552 296
27 3300009094 Ga0111539_10000164 Ga0111539_1000016424 296
28 3300026095 Ga0207676_10441340 Ga0207676_104413402 296
29 3300036401 Ga0373937_0324678 Ga0373937_0324678_67_1026 296
30 3300049576 Ga0501040_0269799 Ga0501040_0269799_40_981 296
31 3300049587 Ga0501071_0251608 Ga0501071_0251608_331_1272 296
32 3300049742 Ga0501080_0335111 Ga0501080_0335111_376_1317 296
33 3300050511 nmdc:mga08y16_733_c1 nmdc:mga08y16_733_c1_12604_13533 296
34 3300005366 Ga0070659_100040250 Ga0070659_1000402502 297
35 3300005439 Ga0070711_100153506 Ga0070711_1001535062 297
36 3300005457 Ga0070662_100001886 Ga0070662_1000018867 297
37 3300006844 Ga0075428_100011053 Ga0075428_1000110538 297
38 3300009094 Ga0111539_10005251 Ga0111539_1000525115 297
39 3300025915 Ga0207693_10141736 Ga0207693_101417361 297
40 3300025932 Ga0207690_10035249 Ga0207690_100352492 297
41 3300027907 Ga0207428_10009996 Ga0207428_100099963 297
42 3300028381 Ga0268264_10339688 Ga0268264_103396882 297
43 3300046538 Ga0495609_0089780 Ga0495609_0089780_155_1228 297
44 3300049569 Ga0501032_0024192 Ga0501032_0024192_2554_3495 297
45 3300049571 Ga0501034_0189348 Ga0501034_0189348_192_1133 297
46 3300050507 nmdc:mga05p37_460825_c1 nmdc:mga05p37_460825_c1_403_1407 297
47 3300050511 nmdc:mga08y16_13240_c1 nmdc:mga08y16_13240_c1_3510_4505 297
48 3300006846 Ga0075430_100025130 Ga0075430_1000251303 298
49 3300006847 Ga0075431_100001516 Ga0075431_10000151614 298
50 3300006871 Ga0075434_100248517 Ga0075434_1002485172 298
51 3300009147 Ga0114129_10446343 Ga0114129_104463432 298
52 3300009553 Ga0105249_10115320 Ga0105249_101153202 298
53 3300025961 Ga0207712_10241943 Ga0207712_102419432 298
54 3300027512 Ga0209179_1001588 Ga0209179_10015882 298
55 3300027907 Ga0207428_10013268 Ga0207428_100132686 298
56 3300031507 Ga0307509_10191332 Ga0307509_101913322 298
57 3300031727 Ga0316576_10000338 Ga0316576_100003389 298
58 3300031728 Ga0316578_10004402 Ga0316578_100044022 298
59 3300035398 Ga0316574_0006476 Ga0316574_0006476_2669_3697 298
60 3300036647 Ga0316582_0008819 Ga0316582_0008819_3495_4523 298
61 3300048908 Ga0496105_0168551 Ga0496105_0168551_560_1495 298
62 3300050509 nmdc:mga0qj67_56364_c1 nmdc:mga0qj67_56364_c1_1131_2216 298
63 3300053077 Ga0495601_0041357 Ga0495601_0041357_869_1921 298
64 3300053084 Ga0495595_0050572 Ga0495595_0050572_187_1239 298
65 3300046459 Ga0495629_0131648 Ga0495629_0131648_246_1235 299
66 3300046472 Ga0495580_0001173 Ga0495580_0001173_6511_7539 299
67 3300046491 Ga0495584_0000005 Ga0495584_0000005_207394_208422 299
68 3300046507 Ga0495606_0018041 Ga0495606_0018041_1209_2237 299
69 3300046678 Ga0495599_0008532 Ga0495599_0008532_1723_2751 299
70 3300046683 Ga0495658_0127736 Ga0495658_0127736_40_1140 299
71 3300046689 Ga0495613_0217792 Ga0495613_0217792_293_1282 299
72 3300047320 Ga0495672_0008285 Ga0495672_0008285_3022_3942 299
73 3300047322 Ga0495680_0102827 Ga0495680_0102827_152_1141 299
74 3300048088 Ga0495602_0033049 Ga0495602_0033049_1643_2671 299
75 3300048914 Ga0496111_0251141 Ga0496111_0251141_202_1152 299
76 iso_pu_bacteria 2941531003 2941538213 299
77 3300005364 Ga0070673_100039134 Ga0070673_1000391342 300
78 3300005365 Ga0070688_100000851 Ga0070688_10000085128 300
79 3300005366 Ga0070659_100222707 Ga0070659_1002227072 300
80 3300005466 Ga0070685_10008294 Ga0070685_100082943 300
81 3300005564 Ga0070664_100085440 Ga0070664_1000854402 300
82 3300009148 Ga0105243_10041016 Ga0105243_100410162 300
83 3300009177 Ga0105248_10157208 Ga0105248_101572082 300
84 3300010375 Ga0105239_10108509 Ga0105239_101085092 300
85 3300025901 Ga0207688_10011591 Ga0207688_100115912 300
86 3300025945 Ga0207679_10174625 Ga0207679_101746252 300
87 3300025960 Ga0207651_10031128 Ga0207651_100311283 300
88 3300037471 Ga0395905_0352875 Ga0395905_0352875_303_1313 300
89 3300042439 Ga0439464_0019438 Ga0439464_0019438_703_1611 300
90 3300048912 Ga0496109_0047294 Ga0496109_0047294_2420_3328 300
91 3300048917 Ga0496114_0038768 Ga0496114_0038768_2714_3622 300
92 iso_pu_bacteria 2513237098 2513670827 300
93 iso_pu_bacteria 2885383462 2885386868 300
94 iso_pu_bacteria 2903768456 2903769063 300
95 3300005353 Ga0070669_100169127 Ga0070669_1001691271 301
96 3300005367 Ga0070667_100262191 Ga0070667_1002621911 301
97 3300005434 Ga0070709_10230513 Ga0070709_102305132 301
98 3300005437 Ga0070710_10084035 Ga0070710_100840352 301
99 3300005548 Ga0070665_100004780 Ga0070665_1000047805 301
100 3300005937 Ga0081455_10002826 Ga0081455_1000282617 301
101 3300005983 Ga0081540_1069182 Ga0081540_10691821 301
102 3300006038 Ga0075365_10007515 Ga0075365_100075156 301
103 3300006175 Ga0070712_100061217 Ga0070712_1000612175 301
104 3300009148 Ga0105243_10445690 Ga0105243_104456901 301
105 3300009177 Ga0105248_10382060 Ga0105248_103820601 301
106 3300009551 Ga0105238_10005657 Ga0105238_100056576 301
107 3300009551 Ga0105238_10124752 Ga0105238_101247522 301
108 3300010375 Ga0105239_10515830 Ga0105239_105158301 301
109 3300013308 Ga0157375_10109686 Ga0157375_101096863 301
110 3300014969 Ga0157376_10152912 Ga0157376_101529121 301
111 3300025898 Ga0207692_10099733 Ga0207692_100997332 301
112 3300025906 Ga0207699_10100289 Ga0207699_101002892 301
113 3300025915 Ga0207693_10041075 Ga0207693_100410755 301
114 3300025916 Ga0207663_10136442 Ga0207663_101364422 301
115 3300025924 Ga0207694_10209344 Ga0207694_102093442 301
116 3300025925 Ga0207650_10179450 Ga0207650_101794502 301
117 3300026067 Ga0207678_10217604 Ga0207678_102176042 301
118 3300028379 Ga0268266_10001206 Ga0268266_100012066 301
119 3300028380 Ga0268265_10127667 Ga0268265_101276672 301
120 3300033180 Ga0307510_10032760 Ga0307510_100327603 301
121 3300035083 Ga0373926_0045688 Ga0373926_0045688_487_1506 301
122 3300035111 Ga0373923_0005923 Ga0373923_0005923_1223_2242 301
123 3300035111 Ga0373923_0051439 Ga0373923_0051439_124_1191 301
124 3300035116 Ga0373945_0034316 Ga0373945_0034316_238_1257 301
125 3300035119 Ga0373956_0004182 Ga0373956_0004182_1928_2995 301
126 3300035120 Ga0373957_0025363 Ga0373957_0025363_206_1273 301
127 3300035172 Ga0373955_0042476 Ga0373955_0042476_777_1796 301
128 3300035410 Ga0373924_0055516 Ga0373924_0055516_489_1508 301
129 3300035692 Ga0373935_0147360 Ga0373935_0147360_340_1359 301
130 3300035695 Ga0373927_0076563 Ga0373927_0076563_316_1335 301
131 3300035724 Ga0373933_0007691 Ga0373933_0007691_4408_5475 301
132 3300035724 Ga0373933_0186726 Ga0373933_0186726_240_1259 301
133 3300036401 Ga0373937_0013422 Ga0373937_0013422_6176_7189 301
134 3300036401 Ga0373937_0038316 Ga0373937_0038316_1201_2220 301
135 3300037068 Ga0373925_0148524 Ga0373925_0148524_480_1499 301
136 3300042439 Ga0439464_0011158 Ga0439464_0011158_568_1584 301
137 3300046452 Ga0495617_027151 Ga0495617_027151_425_1444 301
138 3300046454 Ga0495592_0020215 Ga0495592_0020215_3197_4264 301
139 3300046454 Ga0495592_0167023 Ga0495592_0167023_195_1214 301
140 3300046455 Ga0495603_0100912 Ga0495603_0100912_642_1661 301
141 3300046459 Ga0495629_0100043 Ga0495629_0100043_84_1151 301
142 3300046459 Ga0495629_0134350 Ga0495629_0134350_282_1301 301
143 3300046462 Ga0495651_0022494 Ga0495651_0022494_3127_4146 301
144 3300046463 Ga0495653_0005591 Ga0495653_0005591_6697_7764 301
145 3300046463 Ga0495653_0043858 Ga0495653_0043858_2098_3117 301
146 3300046472 Ga0495580_0185535 Ga0495580_0185535_185_1249 301
147 3300046476 Ga0495662_0020041 Ga0495662_0020041_171_1190 301
148 3300046477 Ga0495664_0015231 Ga0495664_0015231_1415_2434 301
149 3300046491 Ga0495584_0072395 Ga0495584_0072395_462_1481 301
150 3300046492 Ga0495585_0024011 Ga0495585_0024011_267_1286 301
151 3300046499 Ga0495594_0113172 Ga0495594_0113172_234_1301 301
152 3300046501 Ga0495607_0019910 Ga0495607_0019910_265_1284 301
153 3300046511 Ga0495608_0042656 Ga0495608_0042656_38_1105 301
154 3300046514 Ga0495618_0002676 Ga0495618_0002676_7694_8761 301
155 3300046514 Ga0495618_0010917 Ga0495618_0010917_119_1138 301
156 3300046516 Ga0495628_0289923 Ga0495628_0289923_24_1043 301
157 3300046517 Ga0495630_0003589 Ga0495630_0003589_690_1709 301
158 3300046517 Ga0495630_0046616 Ga0495630_0046616_63_1130 301
159 3300046520 Ga0495637_0102763 Ga0495637_0102763_73_1092 301
160 3300046523 Ga0495644_0035871 Ga0495644_0035871_629_1648 301
161 3300046525 Ga0495663_0015205 Ga0495663_0015205_718_1776 301
162 3300046526 Ga0495666_0054396 Ga0495666_0054396_588_1607 301
163 3300046529 Ga0495652_0019749 Ga0495652_0019749_2572_3591 301
164 3300046529 Ga0495652_0187095 Ga0495652_0187095_544_1557 301
165 3300046533 Ga0495640_0011004 Ga0495640_0011004_3974_5041 301
166 3300046535 Ga0495586_0045951 Ga0495586_0045951_635_1654 301
167 3300046535 Ga0495586_0113780 Ga0495586_0113780_206_1273 301
168 3300046536 Ga0495587_0002769 Ga0495587_0002769_4897_5964 301
169 3300046537 Ga0495598_0014740 Ga0495598_0014740_369_1385 301
170 3300046543 Ga0495645_0004016 Ga0495645_0004016_5954_7021 301
171 3300046543 Ga0495645_0179292 Ga0495645_0179292_205_1224 301
172 3300046557 Ga0495622_0077285 Ga0495622_0077285_438_1457 301
173 3300046558 Ga0495633_0023749 Ga0495633_0023749_1065_2084 301
174 3300046559 Ga0495667_0002063 Ga0495667_0002063_9999_11018 301
175 3300046559 Ga0495667_0010593 Ga0495667_0010593_2844_3911 301
176 3300046615 Ga0495656_0029998 Ga0495656_0029998_379_1398 301
177 3300046642 Ga0495634_0073892 Ga0495634_0073892_13_1080 301
178 3300046648 Ga0495611_0045768 Ga0495611_0045768_379_1398 301
179 3300046663 Ga0495635_0069760 Ga0495635_0069760_1303_2370 301
180 3300046665 Ga0495661_0131618 Ga0495661_0131618_254_1273 301
181 3300046674 Ga0495588_0045188 Ga0495588_0045188_642_1661 301
182 3300046675 Ga0495657_0029251 Ga0495657_0029251_206_1273 301
183 3300046679 Ga0495623_0004038 Ga0495623_0004038_2474_3541 301
184 3300046680 Ga0495646_0108646 Ga0495646_0108646_49_1068 301
185 3300046681 Ga0495647_0008477 Ga0495647_0008477_1939_2958 301
186 3300046683 Ga0495658_0002446 Ga0495658_0002446_44_1063 301
187 3300046684 Ga0495669_0058084 Ga0495669_0058084_542_1561 301
188 3300046689 Ga0495613_0013468 Ga0495613_0013468_2428_3447 301
189 3300046689 Ga0495613_0062744 Ga0495613_0062744_474_1541 301
190 3300046690 Ga0495624_0016059 Ga0495624_0016059_3190_4209 301
191 3300046794 Ga0495589_0074262 Ga0495589_0074262_232_1251 301
192 3300046809 Ga0495600_0002596 Ga0495600_0002596_5569_6636 301
193 3300046809 Ga0495600_0005724 Ga0495600_0005724_522_1541 301
194 3300047317 Ga0495604_0019876 Ga0495604_0019876_855_1874 301
195 3300047317 Ga0495604_0042140 Ga0495604_0042140_392_1459 301
196 3300047322 Ga0495680_0002298 Ga0495680_0002298_15594_16613 301
197 3300047322 Ga0495680_0013843 Ga0495680_0013843_214_1281 301
198 3300047444 Ga0495675_0002616 Ga0495675_0002616_2117_3184 301
199 3300047446 Ga0495679_054652 Ga0495679_054652_142_1161 301
200 3300047471 Ga0495684_0030151 Ga0495684_0030151_1433_2500 301
201 3300047673 Ga0495593_0009266 Ga0495593_0009266_4356_5375 301
202 3300047673 Ga0495593_0035745 Ga0495593_0035745_1087_2154 301
203 3300048088 Ga0495602_0072169 Ga0495602_0072169_1600_2667 301
204 3300048089 Ga0495614_0069554 Ga0495614_0069554_21_1040 301
205 3300048903 Ga0496100_0277280 Ga0496100_0277280_177_1235 301
206 3300048905 Ga0496102_0409027 Ga0496102_0409027_134_1192 301
207 3300048907 Ga0496104_0261356 Ga0496104_0261356_119_1177 301
208 3300048909 Ga0496106_0062560 Ga0496106_0062560_1708_2739 301
209 3300048909 Ga0496106_0120430 Ga0496106_0120430_49_1107 301
210 3300048914 Ga0496111_0208628 Ga0496111_0208628_369_1430 301
211 3300048918 Ga0496115_0032592 Ga0496115_0032592_2194_3261 301
212 3300048918 Ga0496115_0422934 Ga0496115_0422934_41_952 301
213 3300048924 Ga0496121_0000194 Ga0496121_0000194_62939_63997 301
214 3300048924 Ga0496121_0001789 Ga0496121_0001789_20663_21721 301
215 3300048929 Ga0496126_0009087 Ga0496126_0009087_7787_8845 301
216 3300053077 Ga0495601_0001360 Ga0495601_0001360_12012_13031 301
217 3300053078 Ga0495612_0002589 Ga0495612_0002589_6406_7425 301
218 3300053084 Ga0495595_0126832 Ga0495595_0126832_27_1040 301
219 iso_pu_bacteria 2824661429 2824669013 301
220 iso_pu_bacteria 2932784394 2932788977 301
221 iso_pu_bacteria 2932828146 2932834544 301
222 iso_pu_bacteria 2935616580 2935624526 301
223 iso_pu_bacteria 2935638405 2935645916 301
224 iso_pu_bacteria 2935665750 2935673483 301
225 iso_pu_bacteria 2935675223 2935682660 301
226 iso_pu_bacteria 2935684952 2935693536 301
227 iso_pu_bacteria 2935694250 2935701595 301
228 iso_pu_bacteria 2935703347 2935710431 301
229 iso_pu_bacteria 2935801545 2935806128 301
230 iso_pu_bacteria 2935810662 2935816893 301
231 iso_pu_bacteria 2935827899 2935835183 301
232 iso_pu_bacteria 2935837841 2935841436 301
233 iso_pu_bacteria 2935855204 2935862997 301
234 iso_pu_bacteria 2935864058 2935871807 301
235 iso_pu_bacteria 2935873716 2935882302 301
236 iso_pu_bacteria 2935992306 2936000127 301
237 iso_pu_bacteria 2936002035 2936010041 301
238 iso_pu_bacteria 2936037263 2936043884 301
239 iso_pu_bacteria 2941538514 2941543662 301
240 iso_pu_bacteria 8016511872 8016517825 301
241 iso_pu_bacteria 8017057580 8017058805 301
242 iso_pu_bacteria 8019576017 8019576852 301
243 iso_pu_bacteria 8019586578 8019594901 301
244 iso_pu_bacteria 8019608314 8019611675 301
245 3300005338 Ga0068868_100043185 Ga0068868_1000431853 302
246 3300005354 Ga0070675_100035588 Ga0070675_1000355883 302
247 3300005365 Ga0070688_100064309 Ga0070688_1000643092 302
248 3300005437 Ga0070710_10156626 Ga0070710_101566262 302
249 3300005456 Ga0070678_100021755 Ga0070678_1000217554 302
250 3300005549 Ga0070704_100038038 Ga0070704_1000380383 302
251 3300005564 Ga0070664_100056116 Ga0070664_1000561164 302
252 3300005614 Ga0068856_100069184 Ga0068856_1000691842 302
253 3300005617 Ga0068859_100388711 Ga0068859_1003887112 302
254 3300005618 Ga0068864_100006902 Ga0068864_1000069026 302
255 3300005841 Ga0068863_100256446 Ga0068863_1002564462 302
256 3300005937 Ga0081455_10000949 Ga0081455_1000094935 302
257 3300006931 Ga0097620_100388637 Ga0097620_1003886372 302
258 3300009094 Ga0111539_10324273 Ga0111539_103242732 302
259 3300009098 Ga0105245_10053297 Ga0105245_100532972 302
260 3300009148 Ga0105243_10060504 Ga0105243_100605042 302
261 3300009177 Ga0105248_10055105 Ga0105248_100551052 302
262 3300011119 Ga0105246_10092722 Ga0105246_100927222 302
263 3300013296 Ga0157374_10012881 Ga0157374_100128813 302
264 3300013307 Ga0157372_10310406 Ga0157372_103104062 302
265 3300013308 Ga0157375_10115108 Ga0157375_101151082 302
266 3300014325 Ga0163163_10395601 Ga0163163_103956012 302
267 3300025908 Ga0207643_10152440 Ga0207643_101524401 302
268 3300025944 Ga0207661_10022062 Ga0207661_100220623 302
269 3300025945 Ga0207679_10027170 Ga0207679_100271702 302
270 3300026067 Ga0207678_10014744 Ga0207678_100147445 302
271 3300026075 Ga0207708_10018339 Ga0207708_100183394 302
272 3300026088 Ga0207641_10253681 Ga0207641_102536812 302
273 3300026095 Ga0207676_10066841 Ga0207676_100668413 302
274 3300028800 Ga0265338_10031037 Ga0265338_100310373 302
275 3300046615 Ga0495656_0100810 Ga0495656_0100810_378_1292 302
276 3300047322 Ga0495680_0010629 Ga0495680_0010629_315_1238 302
277 3300047471 Ga0495684_0130828 Ga0495684_0130828_743_1666 302
278 3300048904 Ga0496101_0010440 Ga0496101_0010440_790_1704 302
279 3300048907 Ga0496104_0008974 Ga0496104_0008974_1924_2838 302
280 3300048908 Ga0496105_0417979 Ga0496105_0417979_57_971 302
281 3300048911 Ga0496108_0011231 Ga0496108_0011231_4145_5059 302
282 3300048912 Ga0496109_0090528 Ga0496109_0090528_1077_1991 302
283 3300048913 Ga0496110_0076484 Ga0496110_0076484_1168_2082 302
284 iso_pu_bacteria 2939657138 2939660606 302
285 3300005355 Ga0070671_100410209 Ga0070671_1004102092 303
286 3300005367 Ga0070667_100110329 Ga0070667_1001103292 303
287 3300005466 Ga0070685_10121091 Ga0070685_101210911 303
288 3300005535 Ga0070684_100302479 Ga0070684_1003024792 303
289 3300006881 Ga0068865_100068637 Ga0068865_1000686372 303
290 3300009094 Ga0111539_10558400 Ga0111539_105584002 303
291 3300009147 Ga0114129_10267198 Ga0114129_102671982 303
292 3300009148 Ga0105243_10003664 Ga0105243_1000366411 303
293 3300013306 Ga0163162_10253056 Ga0163162_102530563 303
294 3300014326 Ga0157380_10087027 Ga0157380_100870273 303
295 3300014969 Ga0157376_10181951 Ga0157376_101819512 303
296 3300017792 Ga0163161_10264549 Ga0163161_102645492 303
297 3300025927 Ga0207687_10082177 Ga0207687_100821773 303
298 3300025944 Ga0207661_10433024 Ga0207661_104330242 303
299 3300031901 Ga0307406_10288143 Ga0307406_102881432 303
300 3300032005 Ga0307411_10230658 Ga0307411_102306582 303
301 3300032126 Ga0307415_100097799 Ga0307415_1000977992 303
302 3300037466 Ga0395898_0526001 Ga0395898_0526001_26_952 303
303 3300048907 Ga0496104_0218736 Ga0496104_0218736_141_1073 303
304 3300049575 Ga0501039_0005795 Ga0501039_0005795_6460_7377 303
305 3300049576 Ga0501040_0077744 Ga0501040_0077744_321_1241 303
306 3300049577 Ga0501041_0016957 Ga0501041_0016957_3025_3945 303
307 3300049578 Ga0501042_0002659 Ga0501042_0002659_2162_3082 303
308 3300049579 Ga0501043_0018311 Ga0501043_0018311_1675_2595 303
309 3300049581 Ga0501047_0252291 Ga0501047_0252291_236_1156 303
310 3300049582 Ga0501048_0015041 Ga0501048_0015041_289_1209 303
311 3300049582 Ga0501048_0082728 Ga0501048_0082728_446_1363 303
312 3300049584 Ga0501068_0003313 Ga0501068_0003313_5555_6475 303
313 3300049587 Ga0501071_0022642 Ga0501071_0022642_241_1161 303
314 3300049587 Ga0501071_0099615 Ga0501071_0099615_1178_2095 303
315 3300049588 Ga0501072_0000860 Ga0501072_0000860_17833_18750 303
316 3300049590 Ga0501074_0031894 Ga0501074_0031894_2889_3806 303
317 3300049591 Ga0501075_0008589 Ga0501075_0008589_3151_4068 303
318 3300049592 Ga0501076_0002969 Ga0501076_0002969_8744_9661 303
319 3300049592 Ga0501076_0196746 Ga0501076_0196746_404_1324 303
320 3300049593 Ga0501077_0011109 Ga0501077_0011109_3188_4108 303
321 3300049593 Ga0501077_0072059 Ga0501077_0072059_883_1800 303
322 3300049741 Ga0501079_0037086 Ga0501079_0037086_375_1292 303
323 3300049741 Ga0501079_0181029 Ga0501079_0181029_321_1241 303
324 3300049743 Ga0501081_0014471 Ga0501081_0014471_1147_2064 303
325 3300049743 Ga0501081_0015776 Ga0501081_0015776_3664_4584 303
326 3300049744 Ga0501083_0007199 Ga0501083_0007199_3550_4470 303
327 3300049822 Ga0501035_0019343 Ga0501035_0019343_229_1149 303
328 3300049822 Ga0501035_0072175 Ga0501035_0072175_888_1805 303
329 3300049824 Ga0501045_0003184 Ga0501045_0003184_102_1019 303
330 3300050507 nmdc:mga05p37_219602_c1 nmdc:mga05p37_219602_c1_1262_2179 303
331 3300050511 nmdc:mga08y16_366142_c1 nmdc:mga08y16_366142_c1_97_1014 303
332 3300054114 Ga0501084_0005641 Ga0501084_0005641_8146_9063 303
333 3300060353 Ga0501082_0016883 Ga0501082_0016883_1798_2715 303
334 3300060353 Ga0501082_0059567 Ga0501082_0059567_1239_2159 303
335 3300061734 Ga0530510_0000696 Ga0530510_0000696_18603_19520 303
336 3300005842 Ga0068858_100113135 Ga0068858_1001131353 304
337 3300006844 Ga0075428_100000974 Ga0075428_10000097415 304
338 3300006846 Ga0075430_100039143 Ga0075430_1000391433 304
339 3300006847 Ga0075431_100001616 Ga0075431_10000161611 304
340 3300006880 Ga0075429_100001011 Ga0075429_10000101110 304
341 3300009098 Ga0105245_10419749 Ga0105245_104197492 304
342 3300009147 Ga0114129_10001975 Ga0114129_1000197510 304
343 3300009177 Ga0105248_10191101 Ga0105248_101911012 304
344 3300013307 Ga0157372_10501017 Ga0157372_105010172 304
345 3300013308 Ga0157375_10146736 Ga0157375_101467362 304
346 3300026067 Ga0207678_10403110 Ga0207678_104031102 304
347 3300031852 Ga0307410_10148596 Ga0307410_101485961 304
348 3300031995 Ga0307409_100027954 Ga0307409_1000279544 304
349 3300031995 Ga0307409_100137754 Ga0307409_1001377542 304
350 3300032002 Ga0307416_100125375 Ga0307416_1001253751 304
351 3300032126 Ga0307415_100192805 Ga0307415_1001928051 304
352 3300046463 Ga0495653_0193078 Ga0495653_0193078_200_1126 304
353 3300046473 Ga0495582_0096835 Ga0495582_0096835_156_1076 304
354 3300048904 Ga0496101_0468543 Ga0496101_0468543_26_970 304
355 3300050507 nmdc:mga05p37_3524_c1 nmdc:mga05p37_3524_c1_12823_13764 304
356 3300050508 nmdc:mga09592_17151_c1 nmdc:mga09592_17151_c1_3610_4551 304
357 3300050509 nmdc:mga0qj67_2071_c1 nmdc:mga0qj67_2071_c1_2728_3669 304
358 3300047322 Ga0495680_0002570 Ga0495680_0002570_6906_7829 305
359 3300005329 Ga0070683_100001559 Ga0070683_10000155917 306
360 3300005337 Ga0070682_100039364 Ga0070682_1000393644 306
361 3300005341 Ga0070691_10094643 Ga0070691_100946432 306
362 3300005366 Ga0070659_100361252 Ga0070659_1003612522 306
363 3300005455 Ga0070663_100209428 Ga0070663_1002094282 306
364 3300005458 Ga0070681_10002312 Ga0070681_100023129 306
365 3300005547 Ga0070693_100023508 Ga0070693_1000235083 306
366 3300005614 Ga0068856_100011064 Ga0068856_10001106411 306
367 3300006881 Ga0068865_100260418 Ga0068865_1002604182 306
368 3300009098 Ga0105245_10016616 Ga0105245_100166165 306
369 3300025912 Ga0207707_10010628 Ga0207707_100106282 306
370 3300025921 Ga0207652_10008278 Ga0207652_100082785 306
371 3300025927 Ga0207687_10054649 Ga0207687_100546492 306
372 3300025931 Ga0207644_10199196 Ga0207644_101991962 306
373 3300025934 Ga0207686_10164984 Ga0207686_101649843 306
374 3300025944 Ga0207661_10023870 Ga0207661_100238704 306
375 3300026078 Ga0207702_10027837 Ga0207702_100278373 306
376 3300026078 Ga0207702_10034645 Ga0207702_100346452 306
377 3300031730 Ga0307516_10031692 Ga0307516_100316924 306
378 3300037068 Ga0373925_0167526 Ga0373925_0167526_563_1489 306
379 3300048903 Ga0496100_0054431 Ga0496100_0054431_227_1153 306
380 3300048905 Ga0496102_0006178 Ga0496102_0006178_4735_5661 306
381 3300048906 Ga0496103_0111364 Ga0496103_0111364_759_1685 306
382 3300048907 Ga0496104_0000757 Ga0496104_0000757_26193_27119 306
383 3300048907 Ga0496104_0004139 Ga0496104_0004139_6062_6988 306
384 3300048908 Ga0496105_0002226 Ga0496105_0002226_1467_2393 306
385 3300048909 Ga0496106_0087736 Ga0496106_0087736_1073_1999 306
386 3300048910 Ga0496107_0107688 Ga0496107_0107688_178_1104 306
387 3300048912 Ga0496109_0008339 Ga0496109_0008339_939_1865 306
388 3300048913 Ga0496110_0001589 Ga0496110_0001589_1425_2351 306
389 3300048914 Ga0496111_0001995 Ga0496111_0001995_10292_11218 306
390 3300048914 Ga0496111_0208863 Ga0496111_0208863_281_1207 306
391 3300048917 Ga0496114_0001139 Ga0496114_0001139_17626_18552 306
392 3300048917 Ga0496114_0037181 Ga0496114_0037181_2913_3839 306
393 3300048918 Ga0496115_0119854 Ga0496115_0119854_907_1833 306
394 3300049585 Ga0501069_0045790 Ga0501069_0045790_908_1843 306
395 3300053149 Ga0500600_0084144 Ga0500600_0084144_339_1268 306
396 3300006058 Ga0075432_10000401 Ga0075432_100004019 307
397 3300006847 Ga0075431_100048484 Ga0075431_1000484844 307
398 3300007076 Ga0075435_100022118 Ga0075435_1000221182 307
399 3300009551 Ga0105238_10261711 Ga0105238_102617112 307
400 3300026075 Ga0207708_10191654 Ga0207708_101916542 307
401 3300027907 Ga0207428_10002628 Ga0207428_100026288 307
402 3300031548 Ga0307408_100338341 Ga0307408_1003383412 307
403 3300031995 Ga0307409_100106606 Ga0307409_1001066062 307
404 3300032002 Ga0307416_100171946 Ga0307416_1001719462 307
405 3300032126 Ga0307415_100381815 Ga0307415_1003818152 307
406 3300035086 Ga0373934_0077857 Ga0373934_0077857_17_949 307
407 3300035116 Ga0373945_0009746 Ga0373945_0009746_1910_2842 307
408 3300035725 Ga0373947_0024089 Ga0373947_0024089_140_1072 307
409 3300036401 Ga0373937_0061202 Ga0373937_0061202_2498_3430 307
410 3300037068 Ga0373925_0073967 Ga0373925_0073967_16_948 307
411 3300046454 Ga0495592_0269943 Ga0495592_0269943_156_1091 307
412 3300046463 Ga0495653_0018111 Ga0495653_0018111_4377_5312 307
413 3300046463 Ga0495653_0121063 Ga0495653_0121063_903_1832 307
414 3300046511 Ga0495608_0042969 Ga0495608_0042969_839_1771 307
415 3300046511 Ga0495608_0147267 Ga0495608_0147267_155_1090 307
416 3300046514 Ga0495618_0025147 Ga0495618_0025147_866_1798 307
417 3300046516 Ga0495628_0243256 Ga0495628_0243256_272_1207 307
418 3300046517 Ga0495630_0029817 Ga0495630_0029817_2289_3218 307
419 3300046529 Ga0495652_0045718 Ga0495652_0045718_394_1329 307
420 3300046533 Ga0495640_0001188 Ga0495640_0001188_7654_8583 307
421 3300046533 Ga0495640_0121859 Ga0495640_0121859_739_1671 307
422 3300046536 Ga0495587_0019408 Ga0495587_0019408_389_1324 307
423 3300046543 Ga0495645_0013960 Ga0495645_0013960_1783_2718 307
424 3300046559 Ga0495667_0086055 Ga0495667_0086055_1030_1959 307
425 3300046642 Ga0495634_0033701 Ga0495634_0033701_1300_2232 307
426 3300046642 Ga0495634_0046446 Ga0495634_0046446_1151_2080 307
427 3300046663 Ga0495635_0106290 Ga0495635_0106290_438_1367 307
428 3300046663 Ga0495635_0175655 Ga0495635_0175655_95_1030 307
429 3300046678 Ga0495599_0029551 Ga0495599_0029551_403_1338 307
430 3300046689 Ga0495613_0042179 Ga0495613_0042179_2154_3083 307
431 3300046689 Ga0495613_0047429 Ga0495613_0047429_1286_2218 307
432 3300046809 Ga0495600_0123417 Ga0495600_0123417_164_1099 307
433 3300047315 Ga0495581_0049407 Ga0495581_0049407_396_1328 307
434 3300047317 Ga0495604_0162753 Ga0495604_0162753_189_1121 307
435 3300047317 Ga0495604_0308136 Ga0495604_0308136_107_1036 307
436 3300047319 Ga0495674_0001467 Ga0495674_0001467_7589_8518 307
437 3300047319 Ga0495674_0088391 Ga0495674_0088391_568_1500 307
438 3300047319 Ga0495674_0321624 Ga0495674_0321624_313_1248 307
439 3300047322 Ga0495680_0016453 Ga0495680_0016453_4563_5498 307
440 3300047322 Ga0495680_0018429 Ga0495680_0018429_4479_5414 307
441 3300047471 Ga0495684_0009809 Ga0495684_0009809_2383_3312 307
442 3300047673 Ga0495593_0158879 Ga0495593_0158879_184_1116 307
443 3300048912 Ga0496109_0107352 Ga0496109_0107352_1576_2508 307
444 3300049574 Ga0501038_0015159 Ga0501038_0015159_3164_4093 307
445 3300049575 Ga0501039_0005839 Ga0501039_0005839_2036_2965 307
446 3300049576 Ga0501040_0005846 Ga0501040_0005846_2474_3403 307
447 3300049577 Ga0501041_0005145 Ga0501041_0005145_3762_4691 307
448 3300049578 Ga0501042_0020524 Ga0501042_0020524_945_1874 307
449 3300049582 Ga0501048_0023235 Ga0501048_0023235_638_1567 307
450 3300049584 Ga0501068_0217116 Ga0501068_0217116_87_1025 307
451 3300049586 Ga0501070_0041191 Ga0501070_0041191_2558_3487 307
452 3300049587 Ga0501071_0046338 Ga0501071_0046338_196_1125 307
453 3300049588 Ga0501072_0005557 Ga0501072_0005557_6080_7009 307
454 3300049591 Ga0501075_0014224 Ga0501075_0014224_4559_5488 307
455 3300049592 Ga0501076_0096008 Ga0501076_0096008_1301_2230 307
456 3300049741 Ga0501079_0007821 Ga0501079_0007821_5042_5971 307
457 3300049743 Ga0501081_0006069 Ga0501081_0006069_2073_3002 307
458 3300049824 Ga0501045_0036826 Ga0501045_0036826_2440_3369 307
459 3300050507 nmdc:mga05p37_9378_c1 nmdc:mga05p37_9378_c1_7859_8788 307
460 3300050511 nmdc:mga08y16_18582_c1 nmdc:mga08y16_18582_c1_6279_7208 307
461 3300050513 nmdc:mga0rr50_19047_c1 nmdc:mga0rr50_19047_c1_446_1375 307
462 3300050515 nmdc:mga0a205_20798_c1 nmdc:mga0a205_20798_c1_3697_4626 307
463 3300053085 Ga0495619_0144408 Ga0495619_0144408_198_1127 307
464 3300054114 Ga0501084_0000970 Ga0501084_0000970_16198_17127 307
465 3300060353 Ga0501082_0002881 Ga0501082_0002881_12276_13205 307
466 3300061734 Ga0530510_0277731 Ga0530510_0277731_104_1033 307
467 iso_pu_bacteria 2919713450 2919715167 307
468 3300003373 JGI25407J50210_10017012 JGI25407J50210_100170122 308
469 3300005329 Ga0070683_100151132 Ga0070683_1001511322 308
470 3300005441 Ga0070700_100124059 Ga0070700_1001240592 308
471 3300005457 Ga0070662_100105553 Ga0070662_1001055532 308
472 3300005535 Ga0070684_100380466 Ga0070684_1003804662 308
473 3300005618 Ga0068864_100000682 Ga0068864_1000006826 308
474 3300005719 Ga0068861_100079131 Ga0068861_1000791314 308
475 3300005937 Ga0081455_10006017 Ga0081455_100060172 308
476 3300005981 Ga0081538_10001529 Ga0081538_1000152924 308
477 3300005983 Ga0081540_1000467 Ga0081540_100046731 308
478 3300006028 Ga0070717_10054332 Ga0070717_100543321 308
479 3300006852 Ga0075433_10016389 Ga0075433_100163894 308
480 3300006871 Ga0075434_100015794 Ga0075434_1000157943 308
481 3300009094 Ga0111539_10003119 Ga0111539_1000311919 308
482 3300009094 Ga0111539_10073120 Ga0111539_100731203 308
483 3300009147 Ga0114129_10060297 Ga0114129_100602972 308
484 3300009147 Ga0114129_10090489 Ga0114129_100904893 308
485 3300009147 Ga0114129_10332899 Ga0114129_103328991 308
486 3300009147 Ga0114129_10630845 Ga0114129_106308451 308
487 3300011119 Ga0105246_10151560 Ga0105246_101515602 308
488 3300013308 Ga0157375_10273909 Ga0157375_102739091 308
489 3300014325 Ga0163163_10419216 Ga0163163_104192162 308
490 3300014969 Ga0157376_10076137 Ga0157376_100761372 308
491 3300025926 Ga0207659_10365390 Ga0207659_103653901 308
492 3300025934 Ga0207686_10198539 Ga0207686_101985392 308
493 3300025940 Ga0207691_10270129 Ga0207691_102701292 308
494 3300025944 Ga0207661_10144910 Ga0207661_101449102 308
495 3300026075 Ga0207708_10090855 Ga0207708_100908553 308
496 3300026095 Ga0207676_10013407 Ga0207676_100134077 308
497 3300026116 Ga0207674_10008192 Ga0207674_100081929 308
498 3300026118 Ga0207675_100389575 Ga0207675_1003895751 308
499 3300031548 Ga0307408_100007383 Ga0307408_1000073837 308
500 3300031548 Ga0307408_100109824 Ga0307408_1001098242 308
501 3300031731 Ga0307405_10051186 Ga0307405_100511864 308
502 3300031731 Ga0307405_10331756 Ga0307405_103317561 308
503 3300031824 Ga0307413_10132126 Ga0307413_101321262 308
504 3300031852 Ga0307410_10000147 Ga0307410_1000014715 308
505 3300031852 Ga0307410_10009969 Ga0307410_100099696 308
506 3300031901 Ga0307406_10000058 Ga0307406_1000005855 308
507 3300031901 Ga0307406_10077071 Ga0307406_100770712 308
508 3300031995 Ga0307409_100009628 Ga0307409_1000096287 308
509 3300032002 Ga0307416_100000063 Ga0307416_10000006310 308
510 3300032002 Ga0307416_100036367 Ga0307416_1000363673 308
511 3300032002 Ga0307416_100406118 Ga0307416_1004061182 308
512 3300032004 Ga0307414_10036028 Ga0307414_100360282 308
513 3300032126 Ga0307415_100140744 Ga0307415_1001407442 308
514 3300037418 Ga0395900_0283115 Ga0395900_0283115_572_1555 308
515 3300037471 Ga0395905_0385386 Ga0395905_0385386_12_995 308
516 3300038443 Ga0395901_0077737 Ga0395901_0077737_934_1917 308
517 3300042993 Ga0439440_0002861 Ga0439440_0002861_2273_3256 308
518 3300046459 Ga0495629_0110235 Ga0495629_0110235_405_1340 308
519 3300046459 Ga0495629_0124779 Ga0495629_0124779_82_1014 308
520 3300046461 Ga0495641_0098303 Ga0495641_0098303_173_1108 308
521 3300047315 Ga0495581_0096264 Ga0495581_0096264_764_1699 308
522 3300047317 Ga0495604_0236908 Ga0495604_0236908_238_1176 308
523 3300047321 Ga0495676_0086098 Ga0495676_0086098_300_1235 308
524 3300048905 Ga0496102_0332804 Ga0496102_0332804_167_1102 308
525 3300048907 Ga0496104_0093086 Ga0496104_0093086_1423_2355 308
526 3300048908 Ga0496105_0057070 Ga0496105_0057070_680_1612 308
527 3300048908 Ga0496105_0093718 Ga0496105_0093718_1366_2298 308
528 3300048909 Ga0496106_0083355 Ga0496106_0083355_948_1883 308
529 3300048909 Ga0496106_0425655 Ga0496106_0425655_68_1000 308
530 3300048911 Ga0496108_0103414 Ga0496108_0103414_1378_2310 308
531 3300048912 Ga0496109_0005069 Ga0496109_0005069_6857_7789 308
532 3300048912 Ga0496109_0254703 Ga0496109_0254703_146_1081 308
533 3300048912 Ga0496109_0333176 Ga0496109_0333176_346_1278 308
534 3300048913 Ga0496110_0025590 Ga0496110_0025590_1389_2321 308
535 3300048914 Ga0496111_0011341 Ga0496111_0011341_1247_2179 308
536 3300048915 Ga0496112_0006933 Ga0496112_0006933_9006_9938 308
537 3300048916 Ga0496113_0003729 Ga0496113_0003729_1640_2572 308
538 3300048916 Ga0496113_0241990 Ga0496113_0241990_81_1016 308
539 3300048917 Ga0496114_0076407 Ga0496114_0076407_1244_2206 308
540 3300048917 Ga0496114_0083596 Ga0496114_0083596_1248_2183 308
541 3300048918 Ga0496115_0181662 Ga0496115_0181662_565_1497 308
542 3300049576 Ga0501040_0003752 Ga0501040_0003752_783_1745 308
543 3300049578 Ga0501042_0032831 Ga0501042_0032831_172_1134 308
544 3300049580 Ga0501046_0004821 Ga0501046_0004821_8268_9230 308
545 3300049587 Ga0501071_0277901 Ga0501071_0277901_234_1184 308
546 3300049588 Ga0501072_0004841 Ga0501072_0004841_9189_10151 308
547 3300049591 Ga0501075_0001006 Ga0501075_0001006_10208_11170 308
548 3300049592 Ga0501076_0002949 Ga0501076_0002949_8849_9811 308
549 3300049593 Ga0501077_0001426 Ga0501077_0001426_10658_11620 308
550 3300049743 Ga0501081_0021674 Ga0501081_0021674_527_1489 308
551 3300049824 Ga0501045_0160825 Ga0501045_0160825_440_1402 308
552 3300050507 nmdc:mga05p37_27954_c1 nmdc:mga05p37_27954_c1_2189_3172 308
553 3300050507 nmdc:mga05p37_42960_c1 nmdc:mga05p37_42960_c1_4185_5165 308
554 3300050511 nmdc:mga08y16_98879_c1 nmdc:mga08y16_98879_c1_1300_2280 308
555 3300050512 nmdc:mga0n895_16208_c1 nmdc:mga0n895_16208_c1_2224_3207 308
556 3300050512 nmdc:mga0n895_2119_c1 nmdc:mga0n895_2119_c1_13125_14060 308
557 3300050513 nmdc:mga0rr50_5888_c1 nmdc:mga0rr50_5888_c1_1230_2165 308
558 3300050514 nmdc:mga08x19_24796_c1 nmdc:mga08x19_24796_c1_1408_2343 308
559 3300050515 nmdc:mga0a205_4323_c1 nmdc:mga0a205_4323_c1_2106_3041 308
560 3300061734 Ga0530510_0000632 Ga0530510_0000632_7162_8124 308
561 3300061734 Ga0530510_0010498 Ga0530510_0010498_3570_4511 308
562 3300005333 Ga0070677_10086337 Ga0070677_100863372 309
563 3300005334 Ga0068869_100025995 Ga0068869_1000259956 309
564 3300005335 Ga0070666_10034735 Ga0070666_100347352 309
565 3300005335 Ga0070666_10063153 Ga0070666_100631531 309
566 3300005336 Ga0070680_100092341 Ga0070680_1000923413 309
567 3300005336 Ga0070680_100097269 Ga0070680_1000972692 309
568 3300005337 Ga0070682_100341295 Ga0070682_1003412952 309
569 3300005339 Ga0070660_100019890 Ga0070660_1000198903 309
570 3300005347 Ga0070668_100115231 Ga0070668_1001152312 309
571 3300005347 Ga0070668_100412954 Ga0070668_1004129541 309
572 3300005354 Ga0070675_100001430 Ga0070675_1000014304 309
573 3300005354 Ga0070675_100003184 Ga0070675_1000031844 309
574 3300005355 Ga0070671_100032512 Ga0070671_1000325123 309
575 3300005355 Ga0070671_100207550 Ga0070671_1002075502 309
576 3300005355 Ga0070671_100253987 Ga0070671_1002539871 309
577 3300005356 Ga0070674_100000263 Ga0070674_10000026324 309
578 3300005356 Ga0070674_100062824 Ga0070674_1000628241 309
579 3300005364 Ga0070673_100113924 Ga0070673_1001139242 309
580 3300005364 Ga0070673_100218736 Ga0070673_1002187362 309
581 3300005364 Ga0070673_100266611 Ga0070673_1002666112 309
582 3300005365 Ga0070688_100015231 Ga0070688_1000152314 309
583 3300005366 Ga0070659_100062092 Ga0070659_1000620922 309
584 3300005366 Ga0070659_100114974 Ga0070659_1001149742 309
585 3300005367 Ga0070667_100010285 Ga0070667_1000102854 309
586 3300005367 Ga0070667_100055334 Ga0070667_1000553341 309
587 3300005435 Ga0070714_100168347 Ga0070714_1001683472 309
588 3300005438 Ga0070701_10011014 Ga0070701_100110143 309
589 3300005440 Ga0070705_100024914 Ga0070705_1000249142 309
590 3300005440 Ga0070705_100109695 Ga0070705_1001096953 309
591 3300005444 Ga0070694_100011625 Ga0070694_1000116252 309
592 3300005456 Ga0070678_100181643 Ga0070678_1001816432 309
593 3300005456 Ga0070678_100187495 Ga0070678_1001874952 309
594 3300005457 Ga0070662_100003441 Ga0070662_1000034419 309
595 3300005459 Ga0068867_100004528 Ga0068867_1000045282 309
596 3300005466 Ga0070685_10010416 Ga0070685_100104164 309
597 3300005466 Ga0070685_10149147 Ga0070685_101491471 309
598 3300005468 Ga0070707_100390456 Ga0070707_1003904562 309
599 3300005539 Ga0068853_100052396 Ga0068853_1000523962 309
600 3300005543 Ga0070672_100062994 Ga0070672_1000629942 309
601 3300005543 Ga0070672_100092950 Ga0070672_1000929502 309
602 3300005544 Ga0070686_100014934 Ga0070686_1000149343 309
603 3300005544 Ga0070686_100086753 Ga0070686_1000867532 309
604 3300005544 Ga0070686_100255566 Ga0070686_1002555661 309
605 3300005546 Ga0070696_100083959 Ga0070696_1000839592 309
606 3300005546 Ga0070696_100273590 Ga0070696_1002735902 309
607 3300005548 Ga0070665_100066585 Ga0070665_1000665853 309
608 3300005563 Ga0068855_100178450 Ga0068855_1001784502 309
609 3300005564 Ga0070664_100017677 Ga0070664_1000176775 309
610 3300005564 Ga0070664_100063892 Ga0070664_1000638924 309
611 3300005577 Ga0068857_100130578 Ga0068857_1001305784 309
612 3300005578 Ga0068854_100006428 Ga0068854_1000064285 309
613 3300005615 Ga0070702_100067915 Ga0070702_1000679152 309
614 3300005617 Ga0068859_100001255 Ga0068859_1000012557 309
615 3300005617 Ga0068859_100003183 Ga0068859_10000318312 309
616 3300005718 Ga0068866_10001635 Ga0068866_100016359 309
617 3300005719 Ga0068861_100008513 Ga0068861_1000085134 309
618 3300005841 Ga0068863_100004645 Ga0068863_10000464510 309
619 3300005841 Ga0068863_100540856 Ga0068863_1005408562 309
620 3300005842 Ga0068858_100030123 Ga0068858_1000301233 309
621 3300005842 Ga0068858_100121950 Ga0068858_1001219502 309
622 3300005843 Ga0068860_100003074 Ga0068860_10000307416 309
623 3300005844 Ga0068862_100155996 Ga0068862_1001559962 309
624 3300005937 Ga0081455_10002610 Ga0081455_100026105 309
625 3300005937 Ga0081455_10004215 Ga0081455_100042153 309
626 3300005983 Ga0081540_1000278 Ga0081540_100027813 309
627 3300006237 Ga0097621_100010095 Ga0097621_1000100953 309
628 3300006237 Ga0097621_100029164 Ga0097621_1000291642 309
629 3300006237 Ga0097621_100266877 Ga0097621_1002668772 309
630 3300006358 Ga0068871_100005312 Ga0068871_1000053122 309
631 3300006358 Ga0068871_100035019 Ga0068871_1000350192 309
632 3300006852 Ga0075433_10000223 Ga0075433_1000022325 309
633 3300006871 Ga0075434_100000419 Ga0075434_10000041928 309
634 3300006871 Ga0075434_100085028 Ga0075434_1000850282 309
635 3300006881 Ga0068865_100004144 Ga0068865_1000041444 309
636 3300006881 Ga0068865_100005141 Ga0068865_1000051417 309
637 3300006881 Ga0068865_100009098 Ga0068865_1000090986 309
638 3300006881 Ga0068865_100014592 Ga0068865_1000145924 309
639 3300006914 Ga0075436_100004817 Ga0075436_1000048173 309
640 3300006931 Ga0097620_100001255 Ga0097620_1000012557 309
641 3300006931 Ga0097620_100003183 Ga0097620_1000031838 309
642 3300007076 Ga0075435_100013474 Ga0075435_1000134742 309
643 3300009093 Ga0105240_10066698 Ga0105240_100666984 309
644 3300009094 Ga0111539_10150236 Ga0111539_101502363 309
645 3300009094 Ga0111539_10265214 Ga0111539_102652142 309
646 3300009098 Ga0105245_10034003 Ga0105245_100340034 309
647 3300009098 Ga0105245_10266363 Ga0105245_102663632 309
648 3300009098 Ga0105245_10277933 Ga0105245_102779332 309
649 3300009101 Ga0105247_10078426 Ga0105247_100784262 309
650 3300009101 Ga0105247_10144276 Ga0105247_101442762 309
651 3300009148 Ga0105243_10006906 Ga0105243_100069066 309
652 3300009148 Ga0105243_10009290 Ga0105243_100092909 309
653 3300009148 Ga0105243_10034486 Ga0105243_100344862 309
654 3300009148 Ga0105243_10069591 Ga0105243_100695914 309
655 3300009176 Ga0105242_10000297 Ga0105242_1000029724 309
656 3300009176 Ga0105242_10053758 Ga0105242_100537584 309
657 3300009176 Ga0105242_10496598 Ga0105242_104965982 309
658 3300009177 Ga0105248_10000630 Ga0105248_1000063030 309
659 3300009177 Ga0105248_10010673 Ga0105248_100106733 309
660 3300009177 Ga0105248_10038207 Ga0105248_100382076 309
661 3300009177 Ga0105248_10299218 Ga0105248_102992182 309
662 3300009177 Ga0105248_10364462 Ga0105248_103644621 309
663 3300009553 Ga0105249_10162184 Ga0105249_101621842 309
664 3300010375 Ga0105239_10004153 Ga0105239_1000415311 309
665 3300011119 Ga0105246_10031281 Ga0105246_100312812 309
666 3300012515 Ga0157338_1000636 Ga0157338_10006363 309
667 3300013100 Ga0157373_10028612 Ga0157373_100286122 309
668 3300013102 Ga0157371_10029425 Ga0157371_100294253 309
669 3300013297 Ga0157378_10000780 Ga0157378_1000078022 309
670 3300013297 Ga0157378_10354040 Ga0157378_103540401 309
671 3300013306 Ga0163162_10011679 Ga0163162_100116793 309
672 3300013306 Ga0163162_10074587 Ga0163162_100745872 309
673 3300013307 Ga0157372_10046853 Ga0157372_100468535 309
674 3300013308 Ga0157375_10002770 Ga0157375_100027709 309
675 3300013308 Ga0157375_10264716 Ga0157375_102647162 309
676 3300013308 Ga0157375_10387162 Ga0157375_103871622 309
677 3300014325 Ga0163163_10025119 Ga0163163_100251195 309
678 3300014325 Ga0163163_10029108 Ga0163163_100291084 309
679 3300014326 Ga0157380_10069332 Ga0157380_100693324 309
680 3300014745 Ga0157377_10215609 Ga0157377_102156091 309
681 3300014968 Ga0157379_10004195 Ga0157379_100041955 309
682 3300014968 Ga0157379_10019662 Ga0157379_100196622 309
683 3300014969 Ga0157376_10024352 Ga0157376_100243521 309
684 3300014969 Ga0157376_10053083 Ga0157376_100530833 309
685 3300014969 Ga0157376_10181504 Ga0157376_101815043 309
686 3300020070 Ga0206356_11443902 Ga0206356_114439022 309
687 3300020081 Ga0206354_11259363 Ga0206354_112593634 309
688 3300025885 Ga0207653_10001129 Ga0207653_100011297 309
689 3300025899 Ga0207642_10000270 Ga0207642_1000027012 309
690 3300025901 Ga0207688_10004267 Ga0207688_100042675 309
691 3300025903 Ga0207680_10041617 Ga0207680_100416172 309
692 3300025904 Ga0207647_10145771 Ga0207647_101457711 309
693 3300025906 Ga0207699_10045154 Ga0207699_100451542 309
694 3300025907 Ga0207645_10001002 Ga0207645_1000100225 309
695 3300025907 Ga0207645_10066791 Ga0207645_100667914 309
696 3300025908 Ga0207643_10012769 Ga0207643_100127693 309
697 3300025909 Ga0207705_10234860 Ga0207705_102348603 309
698 3300025914 Ga0207671_10263910 Ga0207671_102639103 309
699 3300025915 Ga0207693_10016810 Ga0207693_100168102 309
700 3300025915 Ga0207693_10232183 Ga0207693_102321831 309
701 3300025917 Ga0207660_10077349 Ga0207660_100773492 309
702 3300025920 Ga0207649_10190318 Ga0207649_101903182 309
703 3300025923 Ga0207681_10170215 Ga0207681_101702151 309
704 3300025925 Ga0207650_10037891 Ga0207650_100378913 309
705 3300025926 Ga0207659_10010403 Ga0207659_100104033 309
706 3300025926 Ga0207659_10273965 Ga0207659_102739651 309
707 3300025927 Ga0207687_10195500 Ga0207687_101955002 309
708 3300025928 Ga0207700_10004883 Ga0207700_100048832 309
709 3300025931 Ga0207644_10017805 Ga0207644_100178052 309
710 3300025931 Ga0207644_10085166 Ga0207644_100851662 309
711 3300025932 Ga0207690_10248543 Ga0207690_102485432 309
712 3300025933 Ga0207706_10000065 Ga0207706_1000006568 309
713 3300025934 Ga0207686_10000390 Ga0207686_1000039023 309
714 3300025934 Ga0207686_10289639 Ga0207686_102896392 309
715 3300025935 Ga0207709_10041254 Ga0207709_100412542 309
716 3300025935 Ga0207709_10169204 Ga0207709_101692042 309
717 3300025935 Ga0207709_10205953 Ga0207709_102059532 309
718 3300025937 Ga0207669_10002903 Ga0207669_100029034 309
719 3300025937 Ga0207669_10070246 Ga0207669_100702462 309
720 3300025938 Ga0207704_10003859 Ga0207704_100038595 309
721 3300025938 Ga0207704_10158764 Ga0207704_101587641 309
722 3300025939 Ga0207665_10010913 Ga0207665_100109133 309
723 3300025940 Ga0207691_10019700 Ga0207691_100197006 309
724 3300025940 Ga0207691_10240200 Ga0207691_102402002 309
725 3300025941 Ga0207711_10003997 Ga0207711_1000399711 309
726 3300025941 Ga0207711_10017179 Ga0207711_100171795 309
727 3300025942 Ga0207689_10015253 Ga0207689_100152533 309
728 3300025944 Ga0207661_10264500 Ga0207661_102645002 309
729 3300025949 Ga0207667_10201493 Ga0207667_102014932 309
730 3300025960 Ga0207651_10036814 Ga0207651_100368142 309
731 3300025961 Ga0207712_10160591 Ga0207712_101605911 309
732 3300025972 Ga0207668_10109281 Ga0207668_101092812 309
733 3300025981 Ga0207640_10020688 Ga0207640_100206882 309
734 3300025986 Ga0207658_10027328 Ga0207658_100273285 309
735 3300026035 Ga0207703_10020144 Ga0207703_100201444 309
736 3300026035 Ga0207703_10047263 Ga0207703_100472633 309
737 3300026041 Ga0207639_10180107 Ga0207639_101801072 309
738 3300026067 Ga0207678_10007041 Ga0207678_1000704110 309
739 3300026088 Ga0207641_10011879 Ga0207641_100118796 309
740 3300026089 Ga0207648_10000211 Ga0207648_1000021142 309
741 3300026095 Ga0207676_10271700 Ga0207676_102717002 309
742 3300026116 Ga0207674_10020587 Ga0207674_100205875 309
743 3300026118 Ga0207675_100062532 Ga0207675_1000625323 309
744 3300026121 Ga0207683_10262286 Ga0207683_102622862 309
745 3300026142 Ga0207698_10193980 Ga0207698_101939801 309
746 3300027907 Ga0207428_10000696 Ga0207428_1000069638 309
747 3300028380 Ga0268265_10081705 Ga0268265_100817054 309
748 3300028381 Ga0268264_10006781 Ga0268264_100067813 309
749 3300028381 Ga0268264_10011848 Ga0268264_100118485 309
750 3300028800 Ga0265338_10016076 Ga0265338_100160763 309
751 3300031731 Ga0307405_10028107 Ga0307405_100281075 309
752 3300031824 Ga0307413_10065723 Ga0307413_100657232 309
753 3300031824 Ga0307413_10076444 Ga0307413_100764442 309
754 3300031852 Ga0307410_10005511 Ga0307410_100055112 309
755 3300031852 Ga0307410_10057506 Ga0307410_100575063 309
756 3300031901 Ga0307406_10384744 Ga0307406_103847442 309
757 3300031903 Ga0307407_10030353 Ga0307407_100303532 309
758 3300031903 Ga0307407_10188812 Ga0307407_101888122 309
759 3300031995 Ga0307409_100067504 Ga0307409_1000675042 309
760 3300031995 Ga0307409_100083169 Ga0307409_1000831692 309
761 3300031995 Ga0307409_100154693 Ga0307409_1001546932 309
762 3300032002 Ga0307416_100032531 Ga0307416_1000325312 309
763 3300032002 Ga0307416_100645821 Ga0307416_1006458211 309
764 3300032005 Ga0307411_10009346 Ga0307411_100093465 309
765 3300032005 Ga0307411_10098101 Ga0307411_100981012 309
766 3300032126 Ga0307415_100162745 Ga0307415_1001627452 309
767 3300035091 Ga0373951_0005964 Ga0373951_0005964_1179_2120 309
768 3300035115 Ga0373941_0017161 Ga0373941_0017161_891_1832 309
769 3300035121 Ga0373960_0022650 Ga0373960_0022650_118_1059 309
770 3300035691 Ga0373931_0013954 Ga0373931_0013954_1952_2893 309
771 3300037418 Ga0395900_0015864 Ga0395900_0015864_2124_3065 309
772 3300037466 Ga0395898_0097773 Ga0395898_0097773_886_1827 309
773 3300037471 Ga0395905_0072278 Ga0395905_0072278_2233_3174 309
774 3300038443 Ga0395901_0054966 Ga0395901_0054966_952_1893 309
775 3300039437 Ga0436365_0719229 Ga0436365_0719229_14_952 309
776 3300039437 Ga0436365_1837480 Ga0436365_1837480_144_1121 309
777 3300042461 Ga0439460_0005870 Ga0439460_0005870_837_1775 309
778 3300046477 Ga0495664_0012948 Ga0495664_0012948_1879_2928 309
779 3300046511 Ga0495608_0023371 Ga0495608_0023371_27_968 309
780 3300046535 Ga0495586_0061151 Ga0495586_0061151_622_1560 309
781 3300046559 Ga0495667_0213930 Ga0495667_0213930_186_1127 309
782 3300046663 Ga0495635_0235425 Ga0495635_0235425_25_966 309
783 3300046674 Ga0495588_0024681 Ga0495588_0024681_1701_2750 309
784 3300046689 Ga0495613_0147310 Ga0495613_0147310_268_1206 309
785 3300046809 Ga0495600_0025218 Ga0495600_0025218_741_1682 309
786 3300047317 Ga0495604_0038494 Ga0495604_0038494_440_1381 309
787 3300047319 Ga0495674_0018328 Ga0495674_0018328_1167_2216 309
788 3300047319 Ga0495674_0151283 Ga0495674_0151283_877_1818 309
789 3300047319 Ga0495674_0194645 Ga0495674_0194645_611_1549 309
790 3300047322 Ga0495680_0031972 Ga0495680_0031972_3039_3980 309
791 3300047471 Ga0495684_0017859 Ga0495684_0017859_1155_2096 309
792 3300048903 Ga0496100_0036973 Ga0496100_0036973_1210_2148 309
793 3300048904 Ga0496101_0007471 Ga0496101_0007471_3753_4691 309
794 3300048905 Ga0496102_0145618 Ga0496102_0145618_833_1771 309
795 3300048907 Ga0496104_0126726 Ga0496104_0126726_546_1481 309
796 3300048907 Ga0496104_0203444 Ga0496104_0203444_847_1785 309
797 3300048908 Ga0496105_0046640 Ga0496105_0046640_2397_3338 309
798 3300048908 Ga0496105_0273452 Ga0496105_0273452_223_1161 309
799 3300048908 Ga0496105_0328148 Ga0496105_0328148_125_1066 309
800 3300048910 Ga0496107_0008752 Ga0496107_0008752_3578_4516 309
801 3300048910 Ga0496107_0220012 Ga0496107_0220012_235_1176 309
802 3300048911 Ga0496108_0301565 Ga0496108_0301565_244_1185 309
803 3300048912 Ga0496109_0075921 Ga0496109_0075921_1374_2309 309
804 3300048914 Ga0496111_0051811 Ga0496111_0051811_1189_2130 309
805 3300048917 Ga0496114_0006052 Ga0496114_0006052_7743_8681 309
806 3300048917 Ga0496114_0017732 Ga0496114_0017732_3925_4866 309
807 3300048917 Ga0496114_0032819 Ga0496114_0032819_1321_2256 309
808 3300048917 Ga0496114_0076849 Ga0496114_0076849_1600_2643 309
809 3300048918 Ga0496115_0017884 Ga0496115_0017884_2709_3650 309
810 3300050510 nmdc:mga06r32_391429_c1 nmdc:mga06r32_391429_c1_269_1207 309
811 3300050511 nmdc:mga08y16_240503_c1 nmdc:mga08y16_240503_c1_465_1439 309
812 3300050512 nmdc:mga0n895_179723_c1 nmdc:mga0n895_179723_c1_867_1808 309
813 3300053077 Ga0495601_0002663 Ga0495601_0002663_5745_6794 309
814 3300053077 Ga0495601_0012892 Ga0495601_0012892_1192_2136 309
815 3300053078 Ga0495612_0005738 Ga0495612_0005738_1512_2561 309
816 3300053084 Ga0495595_0047764 Ga0495595_0047764_758_1699 309
817 3300053085 Ga0495619_0046463 Ga0495619_0046463_1447_2388 309
818 3300053085 Ga0495619_0069480 Ga0495619_0069480_33_1082 309
819 3300053139 Ga0500568_0015668 Ga0500568_0015668_604_1548 309
820 3300005578 Ga0068854_100177441 Ga0068854_1001774412 310
821 3300005615 Ga0070702_100001102 Ga0070702_1000011025 310
822 3300005618 Ga0068864_100205776 Ga0068864_1002057762 310
823 3300009148 Ga0105243_10028174 Ga0105243_100281742 310
824 3300011119 Ga0105246_10096432 Ga0105246_100964322 310
825 3300025938 Ga0207704_10106457 Ga0207704_101064572 310
826 3300025981 Ga0207640_10322933 Ga0207640_103229331 310
827 3300031548 Ga0307408_100153573 Ga0307408_1001535732 310
828 3300031824 Ga0307413_10069488 Ga0307413_100694881 310
829 3300031824 Ga0307413_10087607 Ga0307413_100876072 310
830 3300031901 Ga0307406_10021189 Ga0307406_100211893 310
831 3300031903 Ga0307407_10116144 Ga0307407_101161442 310
832 3300031995 Ga0307409_100023078 Ga0307409_1000230782 310
833 3300032002 Ga0307416_100060718 Ga0307416_1000607182 310
834 3300032002 Ga0307416_100122924 Ga0307416_1001229241 310
835 3300032004 Ga0307414_10289909 Ga0307414_102899091 310
836 3300032126 Ga0307415_100007592 Ga0307415_1000075926 310
837 3300042142 Ga0450905_006766 Ga0450905_006766_199_1146 310
838 3300042439 Ga0439464_0004085 Ga0439464_0004085_1830_2777 310
839 iso_pu_bacteria 2738541308 2738890538 310
840 3300003373 JGI25407J50210_10013614 JGI25407J50210_100136142 311
841 3300005458 Ga0070681_10147739 Ga0070681_101477392 311
842 3300005535 Ga0070684_100123078 Ga0070684_1001230782 311
843 3300005937 Ga0081455_10017049 Ga0081455_100170495 311
844 3300005981 Ga0081538_10000738 Ga0081538_1000073828 311
845 3300005983 Ga0081540_1002683 Ga0081540_10026838 311
846 3300005985 Ga0081539_10021607 Ga0081539_100216072 311
847 3300006846 Ga0075430_100028490 Ga0075430_1000284905 311
848 3300006852 Ga0075433_10155044 Ga0075433_101550441 311
849 3300006871 Ga0075434_100533583 Ga0075434_1005335832 311
850 3300009094 Ga0111539_10054098 Ga0111539_100540983 311
851 3300009098 Ga0105245_10029247 Ga0105245_100292471 311
852 3300009098 Ga0105245_10058164 Ga0105245_100581642 311
853 3300009147 Ga0114129_10110255 Ga0114129_101102553 311
854 3300013306 Ga0163162_10136701 Ga0163162_101367012 311
855 3300013308 Ga0157375_10047524 Ga0157375_100475242 311
856 3300014497 Ga0182008_10137369 Ga0182008_101373691 311
857 3300025921 Ga0207652_10200759 Ga0207652_102007592 311
858 3300025927 Ga0207687_10061789 Ga0207687_100617892 311
859 3300025933 Ga0207706_10032813 Ga0207706_100328134 311
860 3300025941 Ga0207711_10274591 Ga0207711_102745912 311
861 3300025944 Ga0207661_10021776 Ga0207661_100217763 311
862 3300027907 Ga0207428_10057368 Ga0207428_100573682 311
863 3300031456 Ga0307513_10246227 Ga0307513_102462272 311
864 3300031548 Ga0307408_100020650 Ga0307408_1000206503 311
865 3300031731 Ga0307405_10000670 Ga0307405_100006707 311
866 3300031731 Ga0307405_10216192 Ga0307405_102161922 311
867 3300031824 Ga0307413_10026814 Ga0307413_100268144 311
868 3300031852 Ga0307410_10000824 Ga0307410_100008247 311
869 3300031901 Ga0307406_10010406 Ga0307406_100104065 311
870 3300031901 Ga0307406_10198114 Ga0307406_101981142 311
871 3300031903 Ga0307407_10007658 Ga0307407_100076581 311
872 3300031903 Ga0307407_10057468 Ga0307407_100574682 311
873 3300031995 Ga0307409_100000233 Ga0307409_10000023323 311
874 3300031995 Ga0307409_100016467 Ga0307409_1000164673 311
875 3300031995 Ga0307409_100325431 Ga0307409_1003254311 311
876 3300032002 Ga0307416_100002018 Ga0307416_10000201810 311
877 3300032004 Ga0307414_10004969 Ga0307414_100049696 311
878 3300032004 Ga0307414_10229635 Ga0307414_102296352 311
879 3300032126 Ga0307415_100000327 Ga0307415_10000032720 311
880 3300032126 Ga0307415_100012698 Ga0307415_1000126982 311
881 3300035695 Ga0373927_0094275 Ga0373927_0094275_921_1865 311
882 3300042005 Ga0439448_0007876 Ga0439448_0007876_1785_2720 311
883 3300042005 Ga0439448_0008232 Ga0439448_0008232_160_1122 311
884 3300042157 Ga0439458_0016974 Ga0439458_0016974_87_1049 311
885 3300046461 Ga0495641_0083293 Ga0495641_0083293_71_1057 311
886 3300048905 Ga0496102_0159734 Ga0496102_0159734_735_1703 311
887 3300048911 Ga0496108_0093685 Ga0496108_0093685_1500_2468 311
888 3300048911 Ga0496108_0146531 Ga0496108_0146531_375_1361 311
889 3300048913 Ga0496110_0004299 Ga0496110_0004299_908_1876 311
890 3300048914 Ga0496111_0003435 Ga0496111_0003435_3484_4452 311
891 3300048915 Ga0496112_0006723 Ga0496112_0006723_1264_2232 311
892 3300048917 Ga0496114_0002549 Ga0496114_0002549_8482_9450 311
893 3300049568 Ga0501031_0017507 Ga0501031_0017507_3454_4431 311
894 3300049569 Ga0501032_0055741 Ga0501032_0055741_1144_2121 311
895 3300049570 Ga0501033_0017964 Ga0501033_0017964_2192_3169 311
896 3300049572 Ga0501036_0000024 Ga0501036_0000024_48641_49618 311
897 3300049574 Ga0501038_0006128 Ga0501038_0006128_1870_2847 311
898 3300049575 Ga0501039_0000545 Ga0501039_0000545_10121_11098 311
899 3300049576 Ga0501040_0000548 Ga0501040_0000548_15245_16222 311
900 3300049577 Ga0501041_0003287 Ga0501041_0003287_2245_3222 311
901 3300049578 Ga0501042_0000127 Ga0501042_0000127_19616_20593 311
902 3300049579 Ga0501043_0034336 Ga0501043_0034336_2256_3233 311
903 3300049580 Ga0501046_0002235 Ga0501046_0002235_8240_9217 311
904 3300049582 Ga0501048_0005887 Ga0501048_0005887_8236_9213 311
905 3300049585 Ga0501069_0052160 Ga0501069_0052160_543_1520 311
906 3300049586 Ga0501070_0111656 Ga0501070_0111656_529_1506 311
907 3300049587 Ga0501071_0000240 Ga0501071_0000240_8446_9423 311
908 3300049588 Ga0501072_0000135 Ga0501072_0000135_21101_22078 311
909 3300049590 Ga0501074_0036786 Ga0501074_0036786_2224_3201 311
910 3300049591 Ga0501075_0000252 Ga0501075_0000252_21072_22049 311
911 3300049592 Ga0501076_0001183 Ga0501076_0001183_14055_15032 311
912 3300049593 Ga0501077_0003333 Ga0501077_0003333_8442_9419 311
913 3300049741 Ga0501079_0000135 Ga0501079_0000135_30557_31534 311
914 3300049742 Ga0501080_0024649 Ga0501080_0024649_2259_3236 311
915 3300049743 Ga0501081_0000233 Ga0501081_0000233_21052_22029 311
916 3300049822 Ga0501035_0022998 Ga0501035_0022998_430_1407 311
917 3300049824 Ga0501045_0003585 Ga0501045_0003585_1265_2242 311
918 3300050507 nmdc:mga05p37_165440_c1 nmdc:mga05p37_165440_c1_645_1607 311
919 3300050510 nmdc:mga06r32_15098_c1 nmdc:mga06r32_15098_c1_3340_4359 311
920 3300050511 nmdc:mga08y16_130735_c1 nmdc:mga08y16_130735_c1_893_1879 311
921 3300050512 nmdc:mga0n895_106342_c1 nmdc:mga0n895_106342_c1_1141_2103 311
922 3300050515 nmdc:mga0a205_95348_c1 nmdc:mga0a205_95348_c1_1125_2087 311
923 3300054114 Ga0501084_0000583 Ga0501084_0000583_18483_19460 311
924 3300060353 Ga0501082_0005193 Ga0501082_0005193_1927_2904 311
925 3300061734 Ga0530510_0000013 Ga0530510_0000013_60464_61441 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12710

HAD

haloacid dehalogenase-like hydrolase

59

273

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ovy-assembly1.cif.gz_A-2 crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 0.9282 3 310
4ovy-assembly1.cif.gz_A-2 crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 0.9223 3 310
6iuy-assembly1.cif.gz_B structure of dsgpdh of dunaliella salina 0.7066 148 267
6ki2-assembly1.cif.gz_B the stas domain of cyanobacteria bicarbonate transporter bica 0.6609 153 194
4as3-assembly2.cif.gz_D pseudomonas aeruginosa phosphorylcholine phosphatase. orthorhombic form 0.6504 4 301
ID Description Score Start End Superfamily
4umvA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.74 154 267 3.40.50.1000
af_Q58378_3_256_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.739 148 269 3.40.50.1000
af_Q21394_33_251_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6792 154 195 3.40.50.410
4as3C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6568 10 301 3.40.50.1000
2hi0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6434 157 298 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1T5CNZ1-F1-model_v4 Uncharacterized protein 0.9943 223 307
AF-A0A2S8M9F1-F1-model_v4 deleted 0.9863 120 308
AF-A0A1H4FAA4-F1-model_v4 deleted 0.986 5 309
AF-A0A7I7XL95-F1-model_v4 Haloacid dehalogenase 0.9846 5 309
AF-A0A806S843-F1-model_v4 deleted 0.9831 1 310

Feature Viewer

pLDDT pTM Quality
91.8 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map