F485899

General Info

Members Datasets Scaffolds Average Seq Length
925 398 925 115

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_236574_c1|nmdc:mga0k408_236574_c1_501_917
Length 138
Sequence LTRTTLAQPRGLDSIVPMVSTRGMTQRGSCHCGKVRFEAEGDIAQVIECNCSHCSRKGFLLWFVPRQALQLQTSPDELASYFFNKHVIEHRFCPTCGCQPFGLGTDPAGNAVAAINVRCLEDLDLGSLKRVAYDGRSK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
229 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
230 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
231 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
232 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
233 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
251 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
252 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
255 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
276 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
282 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
283 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
284 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
285 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
286 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
287 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
288 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
289 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
290 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
291 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
294 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
295 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
300 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
303 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
306 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
320 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
325 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
340 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
341 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
345 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
348 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
349 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
366 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
367 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
368 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
369 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
370 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
373 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
387 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
388 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
389 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
390 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
391 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
397 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
398 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0
Rhizoplane 3.14
Rhizosphere 88.32
Stem 0
Stem Tuber 0
Unclassified 3.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1762146 2162886012 Bacteria 1619
2 JGI24736J21556_1073281 3300001904 Bacteria 535
3 JGI24740J21852_10014053 3300001979 Bacteria 2966
4 JGI24739J22299_10000118 3300001989 Bacteria 24899
5 JGI24739J22299_10116781 3300001989 Bacteria 799
6 JGI24739J22299_10237891 3300001989 Bacteria 533
7 JGI24737J22298_10001221 3300001990 Bacteria 9059
8 JGI24737J22298_10065931 3300001990 Bacteria 1085
9 JGI24737J22298_10162999 3300001990 Bacteria 658
10 JGI24735J21928_10002313 3300002067 Bacteria 6647
11 JGI24735J21928_10030492 3300002067 Bacteria 1602
12 JGI24735J21928_10048387 3300002067 Bacteria 1230
13 JGI24749J21850_1068508 3300002076 Bacteria 546
14 JGI24742J22300_10026297 3300002244 Bacteria 1007
15 JGI25153J46596_10009725 3300003215 Bacteria 4424
16 rootH1_10093510 3300003316 Bacteria 2465
17 rootH2_10038319 3300003320 Bacteria 5196
18 rootH2_10096305 3300003320 Bacteria 1290
19 rootL2_10059667 3300003322 Bacteria 1454
20 Ga0055533_1001946 3300003756 Bacteria 5081
21 Ga0055527_1000306 3300003760 Bacteria 27466
22 Ga0055542_1030945 3300003762 Bacteria 686
23 Ga0055526_1002048 3300003771 Bacteria 13854
24 Ga0055537_1000417 3300003773 Bacteria 27822
25 Ga0055524_1004179 3300003775 Bacteria 6736
26 Ga0055534_1000045 3300003784 Bacteria 98659
27 Ga0055528_1000414 3300003790 Bacteria 34502
28 Ga0065165_1005347 3300005262 Bacteria 7290
29 Ga0065714_10148579 3300005288 Bacteria 1119
30 Ga0065712_10095697 3300005290 Bacteria 2210
31 Ga0065712_10239804 3300005290 Bacteria 982
32 Ga0065715_10099278 3300005293 Bacteria 3433
33 Ga0065715_10425647 3300005293 Unclassified 831
34 Ga0065707_10605236 3300005295 Bacteria 662
35 Ga0070658_10342428 3300005327 Bacteria 1279
36 Ga0070676_10100375 3300005328 Bacteria 1787
37 Ga0070676_10204936 3300005328 Bacteria 1295
38 Ga0070676_10290973 3300005328 Bacteria 1104
39 Ga0070683_100000987 3300005329 Bacteria 21253
40 Ga0070683_101038849 3300005329 Unclassified 787
41 Ga0070683_101651600 3300005329 Bacteria 616
42 Ga0070690_100000516 3300005330 Bacteria 19334
43 Ga0070690_100005509 3300005330 Bacteria 7118
44 Ga0070670_100000438 3300005331 Bacteria 33972
45 Ga0070670_100025505 3300005331 Bacteria 5085
46 Ga0070670_100095595 3300005331 Bacteria 2556
47 Ga0070670_100099796 3300005331 Bacteria 2498
48 Ga0070670_100188547 3300005331 Bacteria 1791
49 Ga0070670_100703209 3300005331 Bacteria 909
50 Ga0070670_101249023 3300005331 Bacteria 679
51 Ga0068869_100035109 3300005334 Bacteria 3552
52 Ga0068869_100080243 3300005334 Bacteria 2434
53 Ga0068869_100108259 3300005334 Bacteria 2111
54 Ga0068869_100141030 3300005334 Bacteria 1861
55 Ga0068869_100406162 3300005334 Bacteria 1121
56 Ga0068869_100698905 3300005334 Bacteria 865
57 Ga0070666_10035061 3300005335 Bacteria 3326
58 Ga0070666_10046109 3300005335 Bacteria 2923
59 Ga0070666_10317506 3300005335 Bacteria 1111
60 Ga0070680_100030878 3300005336 Bacteria 4304
61 Ga0070680_101449261 3300005336 Bacteria 595
62 Ga0070682_100237130 3300005337 Bacteria 1308
63 Ga0070682_101097940 3300005337 Bacteria 666
64 Ga0068868_100001019 3300005338 Bacteria 19145
65 Ga0068868_100041919 3300005338 Bacteria 3569
66 Ga0068868_100063770 3300005338 Bacteria 2923
67 Ga0068868_100515570 3300005338 Bacteria 1049
68 Ga0068868_100578712 3300005338 Bacteria 992
69 Ga0070660_100719656 3300005339 Unclassified 837
70 Ga0070660_100783818 3300005339 Bacteria 801
71 Ga0070689_100016977 3300005340 Bacteria 5339
72 Ga0070689_100637764 3300005340 Bacteria 926
73 Ga0070689_101585907 3300005340 Bacteria 594
74 Ga0070691_10173109 3300005341 Bacteria 1120
75 Ga0070691_10517802 3300005341 Bacteria 692
76 Ga0070687_100010261 3300005343 Bacteria 4044
77 Ga0070687_100070248 3300005343 Bacteria 1878
78 Ga0070661_100002808 3300005344 Bacteria 11955
79 Ga0070661_100009246 3300005344 Bacteria 6813
80 Ga0070661_100016479 3300005344 Bacteria 5226
81 Ga0070661_100291351 3300005344 Bacteria 1268
82 Ga0070692_10062179 3300005345 Bacteria 1970
83 Ga0070692_10192891 3300005345 Bacteria 1188
84 Ga0070668_100001366 3300005347 Bacteria 17481
85 Ga0070669_100006444 3300005353 Bacteria 8452
86 Ga0070669_100597465 3300005353 Unclassified 924
87 Ga0070669_100784311 3300005353 Bacteria 809
88 Ga0070675_100001988 3300005354 Bacteria 15163
89 Ga0070675_100003764 3300005354 Bacteria 11517
90 Ga0070675_100433786 3300005354 Bacteria 1176
91 Ga0070675_100486018 3300005354 Bacteria 1111
92 Ga0070675_100762308 3300005354 Unclassified 883
93 Ga0070671_100000543 3300005355 Bacteria 26642
94 Ga0070671_100056470 3300005355 Bacteria 3266
95 Ga0070671_100067512 3300005355 Bacteria 2982
96 Ga0070671_100351237 3300005355 Bacteria 1258
97 Ga0070674_100036363 3300005356 Bacteria 3305
98 Ga0070674_100905329 3300005356 Bacteria 769
99 Ga0070673_100005557 3300005364 Bacteria 8083
100 Ga0070688_100000819 3300005365 Bacteria 15366
101 Ga0070688_100002574 3300005365 Bacteria 9188
102 Ga0070659_100000722 3300005366 Bacteria 23972
103 Ga0070659_100247023 3300005366 Bacteria 1478
104 Ga0070659_101568533 3300005366 Unclassified 587
105 Ga0070709_10161812 3300005434 Bacteria 1557
106 Ga0070713_100006824 3300005436 Bacteria 7955
107 Ga0070713_100041905 3300005436 Bacteria 3733
108 Ga0070701_10005063 3300005438 Bacteria 5411
109 Ga0070701_10581168 3300005438 Bacteria 739
110 Ga0070711_100154861 3300005439 Bacteria 1732
111 Ga0070705_100014731 3300005440 Bacteria 4031
112 Ga0070700_100476225 3300005441 Bacteria 955
113 Ga0070700_100527537 3300005441 Bacteria 913
114 Ga0070700_100948661 3300005441 Bacteria 704
115 Ga0070694_100028547 3300005444 Bacteria 3632
116 Ga0070694_100069896 3300005444 Bacteria 2416
117 Ga0070708_100437186 3300005445 Bacteria 1234
118 Ga0070708_100540870 3300005445 Bacteria 1099
119 Ga0070708_101540465 3300005445 Bacteria 619
120 Ga0070663_100126278 3300005455 Bacteria 1938
121 Ga0070663_100239988 3300005455 Bacteria 1430
122 Ga0070663_100241523 3300005455 Bacteria 1426
123 Ga0070663_100310677 3300005455 Bacteria 1265
124 Ga0070678_100001529 3300005456 Bacteria 12358
125 Ga0070678_100006494 3300005456 Bacteria 6867
126 Ga0070678_100050133 3300005456 Bacteria 3018
127 Ga0070678_100260200 3300005456 Bacteria 1459
128 Ga0070662_100007090 3300005457 Bacteria 7252
129 Ga0070662_100009855 3300005457 Bacteria 6261
130 Ga0070662_100011225 3300005457 Bacteria 5904
131 Ga0070662_101093527 3300005457 Bacteria 684
132 Ga0070662_101285701 3300005457 Bacteria 629
133 Ga0070681_10104617 3300005458 Bacteria 2773
134 Ga0070681_10175925 3300005458 Bacteria 2062
135 Ga0068867_100007657 3300005459 Bacteria 7642
136 Ga0068867_100007738 3300005459 Bacteria 7597
137 Ga0068867_100022584 3300005459 Bacteria 4498
138 Ga0068867_100205853 3300005459 Bacteria 1577
139 Ga0068867_100318292 3300005459 Bacteria 1288
140 Ga0070685_10354947 3300005466 Bacteria 1003
141 Ga0070706_101704204 3300005467 Bacteria 574
142 Ga0070706_102169828 3300005467 Unclassified 502
143 Ga0070707_102249376 3300005468 Bacteria 513
144 Ga0070698_100382235 3300005471 Bacteria 1341
145 Ga0070698_101496825 3300005471 Bacteria 626
146 Ga0070698_102205575 3300005471 Bacteria 504
147 Ga0070699_100009392 3300005518 Bacteria 8473
148 Ga0070699_100194651 3300005518 Bacteria 1802
149 Ga0070699_100704599 3300005518 Bacteria 923
150 Ga0070699_101406450 3300005518 Bacteria 640
151 Ga0070699_102153019 3300005518 Bacteria 509
152 Ga0070679_100023818 3300005530 Bacteria 5998
153 Ga0070679_100929561 3300005530 Bacteria 813
154 Ga0070697_100104369 3300005536 Bacteria 2357
155 Ga0070697_102017291 3300005536 Bacteria 516
156 Ga0068853_100785680 3300005539 Bacteria 911
157 Ga0070672_100001939 3300005543 Bacteria 12991
158 Ga0070672_100051268 3300005543 Bacteria 3217
159 Ga0070672_100120261 3300005543 Bacteria 2149
160 Ga0070672_101048781 3300005543 Bacteria 723
161 Ga0070686_100510570 3300005544 Bacteria 934
162 Ga0070695_100032437 3300005545 Bacteria 3265
163 Ga0070695_100042415 3300005545 Bacteria 2888
164 Ga0070696_100301698 3300005546 Bacteria 1227
165 Ga0070696_100989906 3300005546 Bacteria 702
166 Ga0070696_101388123 3300005546 Bacteria 599
167 Ga0070693_100004136 3300005547 Bacteria 6839
168 Ga0070693_100056167 3300005547 Bacteria 2271
169 Ga0070693_100392534 3300005547 Bacteria 960
170 Ga0070665_100005472 3300005548 Bacteria 13090
171 Ga0070665_100038653 3300005548 Bacteria 4797
172 Ga0070665_100479850 3300005548 Bacteria 1254
173 Ga0070704_100236431 3300005549 Bacteria 1493
174 Ga0070704_100256324 3300005549 Bacteria 1439
175 Ga0070704_102061283 3300005549 Bacteria 530
176 Ga0068855_100013790 3300005563 Bacteria 9743
177 Ga0068855_100046572 3300005563 Bacteria 5125
178 Ga0068855_101403691 3300005563 Bacteria 720
179 Ga0070664_100005842 3300005564 Bacteria 9926
180 Ga0070664_100006033 3300005564 Bacteria 9800
181 Ga0070664_100018536 3300005564 Bacteria 5720
182 Ga0070664_100283171 3300005564 Unclassified 1495
183 Ga0068857_100000998 3300005577 Bacteria 21742
184 Ga0068854_100001113 3300005578 Bacteria 16151
185 Ga0068854_100001385 3300005578 Bacteria 14586
186 Ga0068854_100024671 3300005578 Bacteria 4120
187 Ga0068854_100049312 3300005578 Bacteria 3007
188 Ga0068854_100108441 3300005578 Bacteria 2091
189 Ga0068856_100085324 3300005614 Bacteria 3136
190 Ga0068856_100595517 3300005614 Bacteria 1127
191 Ga0068856_100637072 3300005614 Bacteria 1087
192 Ga0068856_101662728 3300005614 Bacteria 651
193 Ga0070702_100022630 3300005615 Bacteria 3327
194 Ga0070702_100078612 3300005615 Bacteria 1969
195 Ga0070702_100128052 3300005615 Bacteria 1599
196 Ga0070702_100300407 3300005615 Bacteria 1110
197 Ga0068852_100000272 3300005616 Bacteria 34507
198 Ga0068852_100016620 3300005616 Bacteria 5747
199 Ga0068852_100056945 3300005616 Bacteria 3381
200 Ga0068852_100065603 3300005616 Bacteria 3168
201 Ga0068852_100371510 3300005616 Bacteria 1401
202 Ga0068852_101501235 3300005616 Bacteria 696
203 Ga0068859_100010699 3300005617 Bacteria 9235
204 Ga0068859_100183748 3300005617 Bacteria 2174
205 Ga0068859_100226684 3300005617 Bacteria 1957
206 Ga0068859_100245698 3300005617 Bacteria 1879
207 Ga0068859_100264819 3300005617 Bacteria 1811
208 Ga0068859_101172633 3300005617 Bacteria 846
209 Ga0068859_102537814 3300005617 Bacteria 564
210 Ga0068864_100004004 3300005618 Bacteria 12133
211 Ga0068864_100005673 3300005618 Bacteria 10225
212 Ga0068864_100031814 3300005618 Bacteria 4478
213 Ga0068864_100111531 3300005618 Bacteria 2437
214 Ga0068864_100832972 3300005618 Bacteria 908
215 Ga0068866_10003214 3300005718 Bacteria 6738
216 Ga0068866_10276973 3300005718 Bacteria 1038
217 Ga0068866_10348817 3300005718 Bacteria 940
218 Ga0068861_100004074 3300005719 Bacteria 9792
219 Ga0068861_100095663 3300005719 Bacteria 2353
220 Ga0068861_101156082 3300005719 Bacteria 746
221 Ga0068851_10138531 3300005834 Bacteria 1322
222 Ga0068851_10166654 3300005834 Bacteria 1213
223 Ga0068851_10736139 3300005834 Bacteria 609
224 Ga0068870_10011516 3300005840 Bacteria 4103
225 Ga0068863_100001296 3300005841 Bacteria 24957
226 Ga0068863_100003717 3300005841 Bacteria 15093
227 Ga0068863_100232551 3300005841 Bacteria 1778
228 Ga0068863_102601485 3300005841 Bacteria 515
229 Ga0068858_100001929 3300005842 Bacteria 21132
230 Ga0068858_100003142 3300005842 Bacteria 16534
231 Ga0068858_100050925 3300005842 Bacteria 3832
232 Ga0068858_100253137 3300005842 Bacteria 1673
233 Ga0068858_102411885 3300005842 Unclassified 520
234 Ga0068860_100018934 3300005843 Bacteria 6689
235 Ga0068860_100019324 3300005843 Bacteria 6611
236 Ga0068860_100174934 3300005843 Bacteria 2075
237 Ga0068860_100290307 3300005843 Bacteria 1600
238 Ga0068860_100667199 3300005843 Bacteria 1048
239 Ga0068860_102335131 3300005843 Bacteria 555
240 Ga0068862_100029895 3300005844 Bacteria 4590
241 Ga0068862_100046498 3300005844 Bacteria 3703
242 Ga0068862_100084369 3300005844 Bacteria 2760
243 Ga0068862_102078417 3300005844 Bacteria 579
244 Ga0070715_10001133 3300006163 Bacteria 7603
245 Ga0070716_100014562 3300006173 Bacteria 4029
246 Ga0070712_100032192 3300006175 Bacteria 3538
247 Ga0070712_100075658 3300006175 Bacteria 2422
248 Ga0075366_10014288 3300006195 Bacteria 4535
249 Ga0075366_10376175 3300006195 Bacteria 873
250 Ga0097621_100001769 3300006237 Bacteria 14833
251 Ga0097621_100056483 3300006237 Bacteria 3207
252 Ga0097621_100100725 3300006237 Bacteria 2430
253 Ga0097621_100229527 3300006237 Bacteria 1620
254 Ga0068871_100002631 3300006358 Bacteria 12259
255 Ga0068871_100069402 3300006358 Bacteria 2894
256 Ga0068871_100196195 3300006358 Unclassified 1741
257 Ga0068871_100268418 3300006358 Bacteria 1490
258 Ga0068871_100454587 3300006358 Bacteria 1148
259 Ga0068871_100530586 3300006358 Unclassified 1064
260 Ga0068871_101548022 3300006358 Bacteria 627
261 Ga0075428_100009741 3300006844 Bacteria 10674
262 Ga0075428_100259490 3300006844 Bacteria 1871
263 Ga0075428_101502615 3300006844 Bacteria 706
264 Ga0075430_100010623 3300006846 Bacteria 7800
265 Ga0075430_100025571 3300006846 Bacteria 5024
266 Ga0075430_100217121 3300006846 Bacteria 1587
267 Ga0075430_100288860 3300006846 Bacteria 1357
268 Ga0075430_100572120 3300006846 Bacteria 932
269 Ga0075431_100041310 3300006847 Bacteria 4754
270 Ga0075431_100225523 3300006847 Bacteria 1911
271 Ga0075431_100424651 3300006847 Bacteria 1328
272 Ga0075431_100458378 3300006847 Bacteria 1270
273 Ga0075431_101774046 3300006847 Bacteria 573
274 Ga0075433_10073283 3300006852 Bacteria 3011
275 Ga0075433_10155677 3300006852 Bacteria 2033
276 Ga0075433_10169033 3300006852 Bacteria 1946
277 Ga0075433_10870778 3300006852 Bacteria 786
278 Ga0075433_11166425 3300006852 Bacteria 669
279 Ga0075433_11295840 3300006852 Bacteria 631
280 Ga0075434_100007123 3300006871 Bacteria 10331
281 Ga0075434_100052497 3300006871 Bacteria 4051
282 Ga0075434_100059235 3300006871 Bacteria 3807
283 Ga0075434_100167976 3300006871 Bacteria 2214
284 Ga0075434_100954050 3300006871 Viruses 872
285 Ga0075429_100016031 3300006880 Bacteria 6491
286 Ga0075429_100587891 3300006880 Bacteria 975
287 Ga0075429_101909447 3300006880 Bacteria 514
288 Ga0068865_100033606 3300006881 Bacteria 3435
289 Ga0068865_100073421 3300006881 Bacteria 2433
290 Ga0075436_100109694 3300006914 Unclassified 1925
291 Ga0075436_100214013 3300006914 Bacteria 1367
292 Ga0075436_100835162 3300006914 Bacteria 687
293 Ga0097620_100010699 3300006931 Bacteria 9235
294 Ga0097620_100183747 3300006931 Bacteria 2174
295 Ga0097620_100226690 3300006931 Bacteria 1957
296 Ga0097620_100245694 3300006931 Bacteria 1879
297 Ga0097620_100264804 3300006931 Bacteria 1811
298 Ga0097620_101172505 3300006931 Bacteria 846
299 Ga0097620_102537449 3300006931 Bacteria 564
300 Ga0075435_100007891 3300007076 Bacteria 7617
301 Ga0075435_100023266 3300007076 Bacteria 4789
302 Ga0075435_100054962 3300007076 Bacteria 3214
303 Ga0075435_100115820 3300007076 Bacteria 2232
304 Ga0075435_100124764 3300007076 Bacteria 2151
305 Ga0105240_10000359 3300009093 Bacteria 85874
306 Ga0105240_10023357 3300009093 Bacteria 8180
307 Ga0105240_10038461 3300009093 Bacteria 6137
308 Ga0105240_10113171 3300009093 Bacteria 3279
309 Ga0111539_10007338 3300009094 Bacteria 14118
310 Ga0111539_10042479 3300009094 Bacteria 5459
311 Ga0111539_10104577 3300009094 Bacteria 3322
312 Ga0111539_10117917 3300009094 Bacteria 3111
313 Ga0111539_10278365 3300009094 Bacteria 1947
314 Ga0111539_11755420 3300009094 Bacteria 720
315 Ga0111539_12845391 3300009094 Bacteria 560
316 Ga0105245_10016068 3300009098 Bacteria 6521
317 Ga0105245_10017096 3300009098 Bacteria 6330
318 Ga0105245_10087047 3300009098 Bacteria 2867
319 Ga0105245_10381573 3300009098 Bacteria 1403
320 Ga0105245_10483212 3300009098 Bacteria 1252
321 Ga0105247_10018198 3300009101 Bacteria 4214
322 Ga0105247_10209005 3300009101 Bacteria 1315
323 Ga0114129_10047118 3300009147 Bacteria 6058
324 Ga0114129_10692500 3300009147 Bacteria 1311
325 Ga0114129_10899346 3300009147 Bacteria 1122
326 Ga0114129_11505430 3300009147 Bacteria 827
327 Ga0105243_10072940 3300009148 Bacteria 2780
328 Ga0105243_10077148 3300009148 Bacteria 2709
329 Ga0105241_10003177 3300009174 Bacteria 12227
330 Ga0105241_10038649 3300009174 Bacteria 3598
331 Ga0105241_10183206 3300009174 Bacteria 1739
332 Ga0105241_10427894 3300009174 Unclassified 1166
333 Ga0105241_10439423 3300009174 Bacteria 1152
334 Ga0105241_10834505 3300009174 Bacteria 851
335 Ga0105242_10002472 3300009176 Bacteria 14501
336 Ga0105248_10005132 3300009177 Bacteria 14449
337 Ga0105248_10071443 3300009177 Bacteria 3899
338 Ga0105248_10211174 3300009177 Bacteria 2187
339 Ga0105248_10347752 3300009177 Bacteria 1669
340 Ga0105248_11106372 3300009177 Bacteria 896
341 Ga0105237_10000352 3300009545 Bacteria 64865
342 Ga0105237_10024750 3300009545 Bacteria 6141
343 Ga0105237_10047645 3300009545 Bacteria 4308
344 Ga0105237_10071260 3300009545 Bacteria 3470
345 Ga0105238_10001859 3300009551 Bacteria 21155
346 Ga0105238_10146513 3300009551 Bacteria 2338
347 Ga0105238_10343386 3300009551 Bacteria 1481
348 Ga0105238_11546371 3300009551 Bacteria 693
349 Ga0105249_10002479 3300009553 Bacteria 15985
350 Ga0105249_10022793 3300009553 Bacteria 5613
351 Ga0105249_10115152 3300009553 Bacteria 2547
352 Ga0105239_10051215 3300010375 Bacteria 4526
353 Ga0105239_10185391 3300010375 Bacteria 2329
354 Ga0105239_10238872 3300010375 Bacteria 2039
355 Ga0105239_10425075 3300010375 Bacteria 1505
356 Ga0105239_10544030 3300010375 Unclassified 1322
357 Ga0105239_12540532 3300010375 Bacteria 597
358 Ga0105246_10069060 3300011119 Bacteria 2480
359 Ga0105246_10176664 3300011119 Bacteria 1640
360 Ga0105246_10316165 3300011119 Unclassified 1267
361 Ga0105246_10585939 3300011119 Bacteria 961
362 Ga0157314_1000067 3300012500 Bacteria 10972
363 Ga0157373_10424097 3300013100 Bacteria 955
364 Ga0157371_10204115 3300013102 Bacteria 1418
365 Ga0157371_10347447 3300013102 Bacteria 1079
366 Ga0157371_11281468 3300013102 Bacteria 567
367 Ga0157370_10918498 3300013104 Bacteria 794
368 Ga0157369_10077917 3300013105 Bacteria 3552
369 Ga0157369_10107353 3300013105 Bacteria 2970
370 Ga0157369_10310311 3300013105 Bacteria 1640
371 Ga0157369_11836721 3300013105 Bacteria 615
372 Ga0157374_10001826 3300013296 Bacteria 17955
373 Ga0157374_10092035 3300013296 Bacteria 2892
374 Ga0157374_10269036 3300013296 Bacteria 1680
375 Ga0157378_10004007 3300013297 Bacteria 13016
376 Ga0157378_10004796 3300013297 Bacteria 11852
377 Ga0157378_10071616 3300013297 Bacteria 3113
378 Ga0163162_10001742 3300013306 Bacteria 20414
379 Ga0163162_10037794 3300013306 Bacteria 4819
380 Ga0163162_10205427 3300013306 Bacteria 2099
381 Ga0163162_10205439 3300013306 Bacteria 2099
382 Ga0163162_10910649 3300013306 Bacteria 992
383 Ga0163162_12146541 3300013306 Bacteria 641
384 Ga0157372_10010513 3300013307 Bacteria 9851
385 Ga0157372_10171724 3300013307 Bacteria 2508
386 Ga0157372_10269587 3300013307 Bacteria 1978
387 Ga0157372_11586917 3300013307 Bacteria 753
388 Ga0157372_11622152 3300013307 Bacteria 744
389 Ga0157375_10044913 3300013308 Bacteria 4298
390 Ga0157375_10067542 3300013308 Bacteria 3573
391 Ga0157375_10296097 3300013308 Bacteria 1781
392 Ga0157375_10356914 3300013308 Bacteria 1628
393 Ga0157375_11712547 3300013308 Bacteria 744
394 Ga0157375_12167900 3300013308 Bacteria 662
395 Ga0163163_10597959 3300014325 Bacteria 1166
396 Ga0163163_10911200 3300014325 Bacteria 942
397 Ga0163163_11191680 3300014325 Unclassified 824
398 Ga0157377_10003883 3300014745 Bacteria 6810
399 Ga0157377_10018007 3300014745 Bacteria 3665
400 Ga0157377_11628062 3300014745 Bacteria 518
401 Ga0157379_10068889 3300014968 Bacteria 3163
402 Ga0157379_10245222 3300014968 Bacteria 1625
403 Ga0157379_10849457 3300014968 Bacteria 864
404 Ga0157376_10002651 3300014969 Bacteria 12174
405 Ga0157376_10146509 3300014969 Bacteria 2124
406 Ga0157376_10498383 3300014969 Bacteria 1196
407 Ga0183368_1004 3300015687 Bacteria 1211761
408 Ga0163161_11208459 3300017792 Unclassified 654
409 Ga0163161_11254709 3300017792 Bacteria 643
410 Ga0213873_10092600 3300021358 Bacteria 860
411 Ga0213876_10173977 3300021384 Bacteria 1146
412 Ga0213876_10370952 3300021384 Bacteria 761
413 Ga0209674_100016 3300025226 Bacteria 696756
414 Ga0209672_100005 3300025228 Bacteria 1069303
415 Ga0209563_100023 3300025230 Bacteria 636844
416 Ga0209258_100006 3300025242 Bacteria 1069303
417 Ga0209258_101488 3300025242 Bacteria 8042
418 Ga0209148_1000012 3300025254 Bacteria 1069303
419 Ga0209129_1009423 3300025258 Bacteria 2575
420 Ga0209233_1001457 3300025261 Bacteria 9336
421 Ga0209565_1000003 3300025263 Bacteria 1099648
422 Ga0209455_1000008 3300025272 Bacteria 1069303
423 Ga0209673_1000003 3300025273 Bacteria 980859
424 Ga0209675_1000003 3300025291 Bacteria 1003982
425 Ga0209675_1032146 3300025291 Bacteria 1231
426 Ga0209676_1037045 3300025292 Bacteria 1412
427 Ga0209564_1000012 3300025295 Bacteria 792078
428 Ga0209758_1000812 3300025297 Bacteria 43987
429 Ga0209758_1024429 3300025297 Bacteria 2693
430 Ga0209050_1004472 3300025298 Bacteria 9413
431 Ga0209256_1000112 3300025299 Bacteria 178432
432 Ga0207426_1149889 3300025302 Bacteria 545
433 Ga0209051_1070245 3300025303 Bacteria 1057
434 Ga0209257_1105659 3300025304 Bacteria 679
435 Ga0207697_10045371 3300025315 Bacteria 1809
436 Ga0207656_10016793 3300025321 Bacteria 2855
437 Ga0207656_10120084 3300025321 Bacteria 1223
438 Ga0207656_10325483 3300025321 Bacteria 764
439 Ga0207692_10067923 3300025898 Bacteria 1867
440 Ga0207642_10009036 3300025899 Bacteria 3449
441 Ga0207642_10128445 3300025899 Bacteria 1319
442 Ga0207642_10313475 3300025899 Bacteria 914
443 Ga0207710_10144557 3300025900 Unclassified 1150
444 Ga0207688_10014280 3300025901 Bacteria 4321
445 Ga0207680_10010109 3300025903 Bacteria 4709
446 Ga0207680_10261134 3300025903 Bacteria 1199
447 Ga0207680_10416712 3300025903 Bacteria 951
448 Ga0207647_10000066 3300025904 Bacteria 81782
449 Ga0207647_10002628 3300025904 Bacteria 13590
450 Ga0207647_10032756 3300025904 Bacteria 3334
451 Ga0207647_10665441 3300025904 Bacteria 570
452 Ga0207685_10057933 3300025905 Bacteria 1522
453 Ga0207699_10143414 3300025906 Bacteria 1572
454 Ga0207645_10135695 3300025907 Bacteria 1602
455 Ga0207645_10793937 3300025907 Bacteria 644
456 Ga0207645_11100688 3300025907 Bacteria 536
457 Ga0207643_10098595 3300025908 Bacteria 1711
458 Ga0207643_10405908 3300025908 Bacteria 862
459 Ga0207705_10121180 3300025909 Bacteria 1941
460 Ga0207705_10441365 3300025909 Bacteria 1009
461 Ga0207654_10020051 3300025911 Bacteria 3538
462 Ga0207654_10072548 3300025911 Bacteria 2050
463 Ga0207654_10173309 3300025911 Bacteria 1402
464 Ga0207654_10416425 3300025911 Unclassified 937
465 Ga0207654_10498138 3300025911 Unclassified 860
466 Ga0207707_10039511 3300025912 Bacteria 4124
467 Ga0207707_10154075 3300025912 Bacteria 2009
468 Ga0207695_10000014 3300025913 Bacteria 812599
469 Ga0207695_10003135 3300025913 Bacteria 23618
470 Ga0207695_10042600 3300025913 Bacteria 4845
471 Ga0207695_10080322 3300025913 Bacteria 3303
472 Ga0207695_10113233 3300025913 Bacteria 2690
473 Ga0207671_10000021 3300025914 Bacteria 300409
474 Ga0207671_10021309 3300025914 Bacteria 4918
475 Ga0207671_10054020 3300025914 Bacteria 2977
476 Ga0207671_10138304 3300025914 Bacteria 1874
477 Ga0207693_10002141 3300025915 Bacteria 17224
478 Ga0207663_10010953 3300025916 Bacteria 4846
479 Ga0207663_10233619 3300025916 Bacteria 1345
480 Ga0207660_10171876 3300025917 Bacteria 1678
481 Ga0207662_10005004 3300025918 Bacteria 7017
482 Ga0207662_10090177 3300025918 Bacteria 1884
483 Ga0207649_10002856 3300025920 Bacteria 9533
484 Ga0207649_10026219 3300025920 Bacteria 3407
485 Ga0207649_10031191 3300025920 Bacteria 3166
486 Ga0207652_10408876 3300025921 Bacteria 1224
487 Ga0207652_10827822 3300025921 Bacteria 821
488 Ga0207681_10005638 3300025923 Bacteria 7684
489 Ga0207681_10382072 3300025923 Bacteria 1134
490 Ga0207681_10778103 3300025923 Bacteria 799
491 Ga0207694_10001117 3300025924 Bacteria 23231
492 Ga0207694_10007223 3300025924 Bacteria 8433
493 Ga0207694_10207344 3300025924 Bacteria 1596
494 Ga0207650_10001147 3300025925 Bacteria 19462
495 Ga0207650_10025553 3300025925 Bacteria 4208
496 Ga0207650_10154662 3300025925 Bacteria 1813
497 Ga0207650_10192856 3300025925 Bacteria 1628
498 Ga0207650_10531716 3300025925 Bacteria 984
499 Ga0207659_10000565 3300025926 Bacteria 22267
500 Ga0207659_10212343 3300025926 Bacteria 1552
501 Ga0207659_10387341 3300025926 Bacteria 1167
502 Ga0207659_10859443 3300025926 Unclassified 780
503 Ga0207659_11152020 3300025926 Bacteria 667
504 Ga0207687_10000151 3300025927 Bacteria 46396
505 Ga0207687_10036212 3300025927 Bacteria 3361
506 Ga0207687_10220705 3300025927 Bacteria 1492
507 Ga0207687_10273517 3300025927 Bacteria 1351
508 Ga0207687_10274065 3300025927 Bacteria 1350
509 Ga0207700_10132492 3300025928 Bacteria 2037
510 Ga0207664_10591853 3300025929 Unclassified 996
511 Ga0207664_11550136 3300025929 Bacteria 584
512 Ga0207644_10001345 3300025931 Bacteria 15805
513 Ga0207644_10018240 3300025931 Bacteria 4745
514 Ga0207644_10039873 3300025931 Bacteria 3317
515 Ga0207644_10377148 3300025931 Bacteria 1156
516 Ga0207690_10017826 3300025932 Bacteria 4345
517 Ga0207690_10294947 3300025932 Bacteria 1267
518 Ga0207690_10407710 3300025932 Bacteria 1085
519 Ga0207690_11417620 3300025932 Bacteria 581
520 Ga0207690_11729732 3300025932 Unclassified 522
521 Ga0207706_10006270 3300025933 Bacteria 11052
522 Ga0207706_10010590 3300025933 Bacteria 8421
523 Ga0207706_10013626 3300025933 Bacteria 7384
524 Ga0207706_10027587 3300025933 Bacteria 5076
525 Ga0207706_10037955 3300025933 Bacteria 4275
526 Ga0207706_11325158 3300025933 Unclassified 594
527 Ga0207686_10003571 3300025934 Bacteria 8345
528 Ga0207686_10004666 3300025934 Bacteria 7343
529 Ga0207686_10584076 3300025934 Bacteria 877
530 Ga0207670_10017900 3300025936 Bacteria 4293
531 Ga0207670_10188726 3300025936 Bacteria 1558
532 Ga0207670_11470805 3300025936 Bacteria 579
533 Ga0207669_10025492 3300025937 Bacteria 3198
534 Ga0207704_10146095 3300025938 Bacteria 1661
535 Ga0207704_10489492 3300025938 Bacteria 989
536 Ga0207665_10035866 3300025939 Bacteria 3294
537 Ga0207691_10001567 3300025940 Bacteria 22708
538 Ga0207691_10046431 3300025940 Bacteria 3991
539 Ga0207691_10048350 3300025940 Bacteria 3901
540 Ga0207691_10886565 3300025940 Bacteria 747
541 Ga0207711_10010889 3300025941 Bacteria 7559
542 Ga0207711_10032060 3300025941 Bacteria 4441
543 Ga0207711_10149157 3300025941 Bacteria 2109
544 Ga0207711_10572967 3300025941 Bacteria 1053
545 Ga0207711_10864028 3300025941 Bacteria 841
546 Ga0207711_11657522 3300025941 Bacteria 583
547 Ga0207689_10074927 3300025942 Bacteria 2781
548 Ga0207689_10081879 3300025942 Bacteria 2654
549 Ga0207689_10119161 3300025942 Bacteria 2171
550 Ga0207689_10125012 3300025942 Bacteria 2116
551 Ga0207689_10132403 3300025942 Bacteria 2052
552 Ga0207661_10006434 3300025944 Bacteria 8306
553 Ga0207661_10879566 3300025944 Bacteria 825
554 Ga0207661_11217067 3300025944 Unclassified 693
555 Ga0207679_10000325 3300025945 Bacteria 35612
556 Ga0207679_10000882 3300025945 Bacteria 19152
557 Ga0207679_10001337 3300025945 Bacteria 15592
558 Ga0207679_10268198 3300025945 Unclassified 1459
559 Ga0207667_10000737 3300025949 Bacteria 42563
560 Ga0207667_10002458 3300025949 Bacteria 23165
561 Ga0207667_11874370 3300025949 Unclassified 562
562 Ga0207651_10009071 3300025960 Bacteria 5414
563 Ga0207651_10031488 3300025960 Bacteria 3391
564 Ga0207651_10158054 3300025960 Bacteria 1773
565 Ga0207712_10000522 3300025961 Bacteria 31532
566 Ga0207712_10005594 3300025961 Bacteria 7921
567 Ga0207668_10272782 3300025972 Bacteria 1383
568 Ga0207668_10944947 3300025972 Bacteria 769
569 Ga0207640_10000095 3300025981 Bacteria 69753
570 Ga0207640_10003159 3300025981 Bacteria 8866
571 Ga0207640_10014742 3300025981 Bacteria 4507
572 Ga0207640_10019570 3300025981 Bacteria 4003
573 Ga0207640_10267681 3300025981 Bacteria 1335
574 Ga0207658_10033457 3300025986 Bacteria 3667
575 Ga0207658_10151570 3300025986 Bacteria 1889
576 Ga0207677_10000593 3300026023 Bacteria 22456
577 Ga0207677_10000724 3300026023 Bacteria 19329
578 Ga0207677_10092834 3300026023 Bacteria 2199
579 Ga0207677_10450732 3300026023 Bacteria 1102
580 Ga0207677_10864923 3300026023 Bacteria 813
581 Ga0207703_10013607 3300026035 Bacteria 6341
582 Ga0207703_10018778 3300026035 Bacteria 5399
583 Ga0207703_10089421 3300026035 Bacteria 2586
584 Ga0207703_10457604 3300026035 Bacteria 1193
585 Ga0207639_10000733 3300026041 Bacteria 22410
586 Ga0207678_10000577 3300026067 Bacteria 33572
587 Ga0207678_10111625 3300026067 Bacteria 2332
588 Ga0207678_10145805 3300026067 Bacteria 2020
589 Ga0207678_10146311 3300026067 Bacteria 2017
590 Ga0207678_10272628 3300026067 Bacteria 1451
591 Ga0207708_10082602 3300026075 Bacteria 2470
592 Ga0207708_10551622 3300026075 Bacteria 972
593 Ga0207702_10121946 3300026078 Bacteria 2334
594 Ga0207702_10624867 3300026078 Bacteria 1058
595 Ga0207641_10206474 3300026088 Bacteria 1814
596 Ga0207641_10247050 3300026088 Bacteria 1665
597 Ga0207641_10708959 3300026088 Bacteria 991
598 Ga0207648_10007978 3300026089 Bacteria 10327
599 Ga0207648_10012363 3300026089 Bacteria 7991
600 Ga0207648_10081329 3300026089 Bacteria 2826
601 Ga0207648_10346373 3300026089 Bacteria 1339
602 Ga0207648_11047408 3300026089 Bacteria 764
603 Ga0207648_11230574 3300026089 Bacteria 703
604 Ga0207676_10003284 3300026095 Bacteria 11495
605 Ga0207676_10007085 3300026095 Bacteria 7949
606 Ga0207676_10052999 3300026095 Bacteria 3174
607 Ga0207676_10429802 3300026095 Bacteria 1240
608 Ga0207676_11097675 3300026095 Bacteria 786
609 Ga0207674_10002447 3300026116 Bacteria 23450
610 Ga0207674_10124212 3300026116 Bacteria 2547
611 Ga0207674_10155679 3300026116 Bacteria 2241
612 Ga0207675_100000354 3300026118 Bacteria 43858
613 Ga0207675_100015382 3300026118 Bacteria 7136
614 Ga0207675_100515472 3300026118 Bacteria 1192
615 Ga0207675_100685933 3300026118 Bacteria 1032
616 Ga0207675_102703056 3300026118 Bacteria 505
617 Ga0207683_10000739 3300026121 Bacteria 29731
618 Ga0207683_10001084 3300026121 Bacteria 24821
619 Ga0207683_10449975 3300026121 Bacteria 1187
620 Ga0207683_10475871 3300026121 Bacteria 1152
621 Ga0207683_10697643 3300026121 Bacteria 941
622 Ga0207698_10000375 3300026142 Bacteria 26073
623 Ga0207698_10405676 3300026142 Bacteria 1304
624 Ga0207698_10859865 3300026142 Bacteria 912
625 Ga0207698_10891252 3300026142 Bacteria 896
626 Ga0207698_10992343 3300026142 Unclassified 850
627 Ga0207698_11233694 3300026142 Bacteria 762
628 Ga0207428_10059015 3300027907 Bacteria 3043
629 Ga0207428_10608199 3300027907 Bacteria 787
630 Ga0268266_10015750 3300028379 Bacteria 6475
631 Ga0268266_10420697 3300028379 Bacteria 1266
632 Ga0268266_10433629 3300028379 Bacteria 1247
633 Ga0268266_11560065 3300028379 Bacteria 636
634 Ga0268265_10001830 3300028380 Bacteria 16975
635 Ga0268265_10030100 3300028380 Bacteria 3905
636 Ga0268265_10222728 3300028380 Bacteria 1652
637 Ga0268264_10001344 3300028381 Bacteria 23085
638 Ga0268264_10189775 3300028381 Bacteria 1872
639 Ga0268264_10532258 3300028381 Bacteria 1150
640 Ga0268264_10909345 3300028381 Bacteria 884
641 Ga0268264_11489424 3300028381 Bacteria 687
642 Ga0265318_10124756 3300028577 Bacteria 947
643 Ga0265324_10054369 3300029957 Bacteria 1374
644 Ga0316177_1136856 3300030731 Bacteria 1708
645 Ga0316180_1120196 3300030736 Bacteria 2312
646 Ga0316183_1091464 3300030742 Bacteria 2030
647 Ga0316182_1072389 3300030745 Bacteria 1059
648 Ga0265325_10023630 3300031241 Bacteria 3352
649 Ga0265329_10110809 3300031242 Bacteria 877
650 Ga0265339_10000995 3300031249 Bacteria 21726
651 Ga0265339_10213815 3300031249 Bacteria 946
652 Ga0265316_10001965 3300031344 Bacteria 21613
653 Ga0307513_10000013 3300031456 Bacteria 325682
654 Ga0307513_10091189 3300031456 Bacteria 3106
655 Ga0307408_100038091 3300031548 Bacteria 3390
656 Ga0307408_100684045 3300031548 Bacteria 920
657 Ga0265314_10000011 3300031711 Bacteria 445050
658 Ga0307516_10414595 3300031730 Bacteria 1005
659 Ga0307405_10003810 3300031731 Bacteria 7012
660 Ga0307413_10111755 3300031824 Bacteria 1830
661 Ga0307413_10534828 3300031824 Bacteria 948
662 Ga0307413_10750307 3300031824 Bacteria 816
663 Ga0307413_11140838 3300031824 Bacteria 675
664 Ga0307413_11161138 3300031824 Bacteria 670
665 Ga0307410_10003663 3300031852 Bacteria 7760
666 Ga0307410_10213049 3300031852 Bacteria 1481
667 Ga0307410_10814665 3300031852 Bacteria 795
668 Ga0307406_10003561 3300031901 Bacteria 8488
669 Ga0307406_10712158 3300031901 Bacteria 839
670 Ga0307412_10015536 3300031911 Bacteria 4517
671 Ga0307409_100011302 3300031995 Bacteria 5617
672 Ga0307409_101359949 3300031995 Bacteria 736
673 Ga0307416_100037270 3300032002 Bacteria 3739
674 Ga0307416_100080935 3300032002 Bacteria 2744
675 Ga0307414_10039087 3300032004 Bacteria 3193
676 Ga0307414_10112959 3300032004 Bacteria 2072
677 Ga0307414_10116106 3300032004 Bacteria 2048
678 Ga0307414_10386701 3300032004 Bacteria 1211
679 Ga0307414_10499369 3300032004 Bacteria 1076
680 Ga0307414_10814494 3300032004 Bacteria 852
681 Ga0307414_11449133 3300032004 Bacteria 638
682 Ga0307411_10007708 3300032005 Bacteria 5513
683 Ga0307411_10061658 3300032005 Bacteria 2497
684 Ga0307415_100003390 3300032126 Bacteria 8108
685 Ga0307415_100251666 3300032126 Bacteria 1436
686 Ga0307415_101307354 3300032126 Bacteria 687
687 Ga0316593_10018520 3300032168 Bacteria 2141
688 Ga0373926_0040057 3300035083 Bacteria 1671
689 Ga0373952_0184317 3300035092 Bacteria 604
690 Ga0373923_0043833 3300035111 Bacteria 1852
691 Ga0373953_0028256 3300035117 Bacteria 2161
692 Ga0373954_0014612 3300035118 Bacteria 3501
693 Ga0373956_0004538 3300035119 Bacteria 5545
694 Ga0373957_0016317 3300035120 Bacteria 2569
695 Ga0373955_0033285 3300035172 Bacteria 2713
696 Ga0373931_0705273 3300035691 Bacteria 667
697 Ga0373935_0018663 3300035692 Bacteria 4224
698 Ga0373927_0151188 3300035695 Bacteria 1520
699 Ga0373927_0411123 3300035695 Bacteria 893
700 Ga0373933_0013246 3300035724 Bacteria 4568
701 Ga0373947_0096106 3300035725 Bacteria 1854
702 Ga0373937_0092431 3300036401 Bacteria 2804
703 Ga0373937_1905615 3300036401 Bacteria 541
704 Ga0316582_0709899 3300036647 Bacteria 690
705 Ga0373925_0022503 3300037068 Bacteria 4598
706 Ga0373925_0038230 3300037068 Bacteria 3547
707 Ga0373925_1687922 3300037068 Unclassified 517
708 Ga0395899_0039616 3300037312 Bacteria 3526
709 Ga0395899_0087793 3300037312 Bacteria 2256
710 Ga0395899_0118570 3300037312 Bacteria 1897
711 Ga0395900_0005718 3300037418 Bacteria 12995
712 Ga0395900_0029162 3300037418 Bacteria 5659
713 Ga0395900_0116834 3300037418 Bacteria 2737
714 Ga0395900_1722809 3300037418 Bacteria 537
715 Ga0395898_0013263 3300037466 Bacteria 8488
716 Ga0395898_0035116 3300037466 Bacteria 4989
717 Ga0395898_0448170 3300037466 Bacteria 1229
718 Ga0395905_0191105 3300037471 Bacteria 1920
719 Ga0395905_0367431 3300037471 Bacteria 1332
720 Ga0395905_0507953 3300037471 Bacteria 1106
721 Ga0436364_0462315 3300037853 Bacteria 1593
722 Ga0395901_0002206 3300038443 Bacteria 19856
723 Ga0395901_0021709 3300038443 Bacteria 6577
724 Ga0395901_0085643 3300038443 Bacteria 3294
725 Ga0237819_02800 3300038705 Bacteria 3329
726 Ga0237816_01144 3300039145 Bacteria 2182
727 Ga0436365_0215467 3300039437 Unclassified 1154
728 Ga0436365_0825797 3300039437 Unclassified 854
729 Ga0436365_1220357 3300039437 Bacteria 6280
730 Ga0436360_1317327 3300039438 Bacteria 849
731 Ga0436363_0196439 3300039450 Bacteria 1509
732 Ga0436362_0697552 3300039453 Bacteria 1324
733 Ga0439436_0007875 3300041404 Bacteria 3273
734 Ga0451802_1212438 3300041460 Unclassified 718
735 Ga0451807_0416150 3300041486 Bacteria 548
736 Ga0451835_0617162 3300041492 Bacteria 797
737 Ga0451837_1258601 3300041494 Bacteria 570
738 Ga0451843_0469666 3300041509 Bacteria 561
739 Ga0439448_0084631 3300042005 Bacteria 1068
740 Ga0439432_016013 3300042006 Bacteria 2526
741 Ga0439449_0012385 3300042007 Bacteria 3206
742 Ga0439449_0113753 3300042007 Bacteria 1003
743 Ga0439458_0040733 3300042157 Bacteria 1127
744 Ga0439464_0013490 3300042439 Bacteria 2189
745 Ga0466969_0000016 3300044656 Bacteria 106431
746 Ga0466969_0024665 3300044656 Bacteria 3094
747 Ga0466969_0136566 3300044656 Bacteria 1135
748 Ga0466972_0002876 3300044658 Bacteria 8519
749 Ga0466972_0084981 3300044658 Bacteria 1504
750 Ga0466978_0247987 3300044671 Bacteria 1035
751 Ga0466982_0000005 3300044672 Bacteria 364340
752 Ga0466965_0012517 3300044683 Bacteria 3991
753 Ga0466965_0091204 3300044683 Bacteria 1550
754 Ga0466966_0002888 3300044684 Bacteria 11330
755 Ga0466966_0014142 3300044684 Bacteria 5282
756 Ga0466961_0054883 3300044693 Bacteria 2541
757 Ga0466964_0007368 3300044706 Bacteria 4114
758 Ga0466964_0106032 3300044706 Bacteria 1246
759 Ga0453684_0000020 3300044712 Bacteria 879938
760 Ga0466971_0009485 3300044719 Bacteria 4249
761 Ga0466971_0325440 3300044719 Bacteria 741
762 Ga0466970_0164782 3300044765 Bacteria 1227
763 Ga0466970_0356365 3300044765 Bacteria 830
764 Ga0466960_0000662 3300044901 Bacteria 11973
765 Ga0466959_0190277 3300045049 Bacteria 1432
766 Ga0466959_0437675 3300045049 Bacteria 887
767 Ga0466958_0026487 3300045836 Bacteria 3427
768 Ga0466967_0150058 3300045976 Bacteria 2178
769 Ga0466967_0487057 3300045976 Bacteria 1209
770 Ga0495638_0000007 3300046460 Bacteria 602783
771 Ga0495638_0007666 3300046460 Bacteria 7716
772 Ga0495580_0002914 3300046472 Bacteria 14695
773 Ga0495580_0536049 3300046472 Unclassified 778
774 Ga0495582_0646272 3300046473 Bacteria 612
775 Ga0495639_0404709 3300046475 Unclassified 690
776 Ga0495608_0383283 3300046511 Unclassified 862
777 Ga0495616_0165040 3300046513 Bacteria 994
778 Ga0495628_0385966 3300046516 Unclassified 1025
779 Ga0495663_0095495 3300046525 Bacteria 973
780 Ga0495663_0142139 3300046525 Unclassified 815
781 Ga0495663_0154809 3300046525 Bacteria 784
782 Ga0495642_0000863 3300046528 Bacteria 14341
783 Ga0495665_0255471 3300046531 Unclassified 902
784 Ga0495586_0516709 3300046535 Unclassified 689
785 Ga0495587_0268647 3300046536 Unclassified 957
786 Ga0495621_0036478 3300046539 Unclassified 1706
787 Ga0495645_0206256 3300046543 Unclassified 1330
788 Ga0495623_0073741 3300046679 Bacteria 2121
789 Ga0495613_0100831 3300046689 Bacteria 2085
790 Ga0495674_0115605 3300047319 Bacteria 2270
791 Ga0495672_0060510 3300047320 Bacteria 2187
792 Ga0495677_0095317 3300047445 Bacteria 1124
793 Ga0495684_0133590 3300047471 Bacteria 1862
794 Ga0496101_0086850 3300048904 Bacteria 2321
795 Ga0496103_0208967 3300048906 Bacteria 1255
796 Ga0496104_0027357 3300048907 Bacteria 5277
797 Ga0496104_0570769 3300048907 Bacteria 1042
798 Ga0496105_0017914 3300048908 Bacteria 5684
799 Ga0496105_0275518 3300048908 Bacteria 1358
800 Ga0496105_1009093 3300048908 Bacteria 622
801 Ga0496106_0141909 3300048909 Bacteria 1890
802 Ga0496106_0708483 3300048909 Bacteria 802
803 Ga0496107_0114991 3300048910 Bacteria 1980
804 Ga0496107_0532032 3300048910 Bacteria 871
805 Ga0496108_0029478 3300048911 Bacteria 4545
806 Ga0496108_0065794 3300048911 Bacteria 3056
807 Ga0496108_0400781 3300048911 Bacteria 1198
808 Ga0496109_0004582 3300048912 Bacteria 11540
809 Ga0496109_0153437 3300048912 Bacteria 2157
810 Ga0496109_0238027 3300048912 Bacteria 1713
811 Ga0496110_0024184 3300048913 Bacteria 5174
812 Ga0496110_0182458 3300048913 Bacteria 1906
813 Ga0496110_1368705 3300048913 Bacteria 617
814 Ga0496111_0005423 3300048914 Bacteria 8171
815 Ga0496112_0068664 3300048915 Bacteria 3500
816 Ga0496113_0259178 3300048916 Bacteria 1389
817 Ga0496114_0049947 3300048917 Bacteria 3481
818 Ga0496114_0653624 3300048917 Bacteria 924
819 Ga0496115_0000039 3300048918 Bacteria 124044
820 Ga0496115_0079680 3300048918 Bacteria 2666
821 Ga0496118_0037307 3300048921 Bacteria 3914
822 Ga0496118_0156509 3300048921 Bacteria 1416
823 Ga0496121_0044528 3300048924 Bacteria 3826
824 Ga0496122_0314574 3300048925 Bacteria 836
825 Ga0496124_0098248 3300048927 Bacteria 2376
826 Ga0496125_0000313 3300048928 Bacteria 95423
827 Ga0496125_0000379 3300048928 Bacteria 83187
828 Ga0496126_0117941 3300048929 Bacteria 2305
829 Ga0496126_0449565 3300048929 Bacteria 1037
830 Ga0501292_037832 3300049515 Bacteria 826
831 Ga0501298_022270 3300049521 Bacteria 1193
832 Ga0501300_017161 3300049523 Bacteria 1056
833 Ga0501031_0180024 3300049568 Bacteria 1381
834 Ga0501031_0418702 3300049568 Bacteria 866
835 Ga0501031_0662385 3300049568 Bacteria 671
836 Ga0501032_0018514 3300049569 Bacteria 4878
837 Ga0501032_0070325 3300049569 Bacteria 2334
838 Ga0501033_0021892 3300049570 Bacteria 4823
839 Ga0501033_0622531 3300049570 Bacteria 739
840 Ga0501034_0041124 3300049571 Bacteria 4677
841 Ga0501036_0044682 3300049572 Bacteria 3753
842 Ga0501037_0159568 3300049573 Bacteria 1608
843 Ga0501037_0175526 3300049573 Bacteria 1522
844 Ga0501038_0043484 3300049574 Bacteria 3906
845 Ga0501038_0966537 3300049574 Bacteria 626
846 Ga0501039_0611401 3300049575 Bacteria 854
847 Ga0501042_0515194 3300049578 Bacteria 869
848 Ga0501043_0063280 3300049579 Bacteria 2905
849 Ga0501043_0084585 3300049579 Bacteria 2493
850 Ga0501046_0052161 3300049580 Bacteria 3224
851 Ga0501046_0538124 3300049580 Bacteria 834
852 Ga0501047_0018745 3300049581 Bacteria 6636
853 Ga0501047_0077036 3300049581 Bacteria 3209
854 Ga0501047_0121904 3300049581 Bacteria 2489
855 Ga0501047_0164607 3300049581 Bacteria 2089
856 Ga0501048_0402658 3300049582 Bacteria 978
857 Ga0501068_0201818 3300049584 Unclassified 1261
858 Ga0501070_0067505 3300049586 Bacteria 2962
859 Ga0501070_1179342 3300049586 Unclassified 588
860 Ga0501073_0864999 3300049589 Bacteria 623
861 Ga0501074_0815971 3300049590 Unclassified 657
862 Ga0501075_0115308 3300049591 Bacteria 2043
863 Ga0501076_0582437 3300049592 Bacteria 923
864 Ga0501217_193713 3300049661 Bacteria 630
865 Ga0501225_0106322 3300049705 Bacteria 824
866 Ga0501080_0417701 3300049742 Unclassified 1205
867 Ga0501274_001631 3300049771 Bacteria 1724
868 Ga0501276_016181 3300049773 Bacteria 677
869 Ga0501035_0028259 3300049822 Bacteria 5120
870 Ga0501035_0379781 3300049822 Bacteria 1179
871 Ga0501035_1484677 3300049822 Bacteria 517
872 Ga0501044_0030714 3300049823 Bacteria 5660
873 Ga0501044_0539350 3300049823 Bacteria 1065
874 Ga0501044_0794683 3300049823 Unclassified 826
875 nmdc:mga0k408_15007_c1 3300050493 Bacteria 4280
876 nmdc:mga0k408_236574_c1 3300050493 Bacteria 1090
877 nmdc:mga0k408_447972_c1 3300050493 Bacteria 767
878 nmdc:mga05p37_1326941_c1 3300050507 Bacteria 731
879 nmdc:mga05p37_181305_c1 3300050507 Bacteria 2562
880 nmdc:mga05p37_584699_c1 3300050507 Bacteria 1264
881 nmdc:mga05p37_850864_c1 3300050507 Bacteria 990
882 nmdc:mga09592_409997_c1 3300050508 Bacteria 1171
883 nmdc:mga09592_4687_c1 3300050508 Bacteria 11067
884 nmdc:mga0qj67_152542_c1 3300050509 Bacteria 1874
885 nmdc:mga0qj67_21452_c1 3300050509 Bacteria 4955
886 nmdc:mga0qj67_26271_c1 3300050509 Bacteria 4507
887 nmdc:mga0qj67_757157_c1 3300050509 Bacteria 770
888 nmdc:mga0qj67_80814_c1 3300050509 Bacteria 2605
889 nmdc:mga06r32_10201_c1 3300050510 Bacteria 8480
890 nmdc:mga06r32_399223_c1 3300050510 Bacteria 1357
891 nmdc:mga06r32_745001_c1 3300050510 Bacteria 943
892 nmdc:mga08y16_1018896_c1 3300050511 Bacteria 807
893 nmdc:mga08y16_136431_c1 3300050511 Bacteria 2550
894 nmdc:mga08y16_61034_c1 3300050511 Bacteria 3937
895 nmdc:mga0n895_155234_c1 3300050512 Bacteria 2319
896 nmdc:mga0n895_250101_c1 3300050512 Bacteria 1799
897 nmdc:mga0n895_27412_c1 3300050512 Bacteria 5413
898 nmdc:mga0n895_49686_c1 3300050512 Bacteria 4110
899 nmdc:mga0rr50_345452_c1 3300050513 Bacteria 1251
900 nmdc:mga0rr50_51116_c1 3300050513 Bacteria 3065
901 nmdc:mga0rr50_7612_c1 3300050513 Bacteria 6696
902 nmdc:mga08x19_1251564_c1 3300050514 Bacteria 526
903 nmdc:mga08x19_634227_c1 3300050514 Bacteria 758
904 nmdc:mga0a205_1359193_c1 3300050515 Bacteria 558
905 nmdc:mga0a205_14872_c3 3300050515 Bacteria 2053
906 nmdc:mga0a205_73683_c1 3300050515 Bacteria 3299
907 Ga0495612_0180537 3300053078 Bacteria 927
908 Ga0495612_0244516 3300053078 Unclassified 797
909 Ga0500643_000654 3300053087 Bacteria 23285
910 Ga0500643_035304 3300053087 Unclassified 1500
911 Ga0500643_040767 3300053087 Unclassified 1366
912 Ga0500644_0037409 3300053088 Bacteria 1586
913 Ga0500644_0117275 3300053088 Bacteria 1033
914 Ga0500650_0237835 3300053098 Bacteria 820
915 Ga0500652_384550 3300053131 Bacteria 523
916 Ga0500658_0026201 3300053134 Bacteria 2245
917 Ga0500568_0049201 3300053139 Bacteria 1664
918 Ga0500568_0130691 3300053139 Bacteria 934
919 Ga0500622_0007137 3300053156 Bacteria 6376
920 Ga0500622_0147872 3300053156 Bacteria 1114
921 Ga0501084_0095487 3300054114 Bacteria 2497
922 Ga0590071_148334 3300059421 Bacteria 607
923 Ga0501082_0116694 3300060353 Bacteria 2312
924 Ga0466962_0003750 3300061719 Bacteria 7255
925 Ga0530510_0175332 3300061734 Bacteria 1589

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025242 Ga0209258_101488 Ga0209258_1014889 95
2 3300013105 Ga0157369_10107353 Ga0157369_101073532 98
3 3300025904 Ga0207647_10665441 Ga0207647_106654412 98
4 3300005444 Ga0070694_100028547 Ga0070694_1000285472 112
5 3300005546 Ga0070696_101388123 Ga0070696_1013881231 112
6 3300031824 Ga0307413_11140838 Ga0307413_111408381 112
7 2162886012 MBSR1b_contig_1762146 MBSR1b_0342.00004570 113
8 3300001904 JGI24736J21556_1073281 JGI24736J21556_10732812 113
9 3300001979 JGI24740J21852_10014053 JGI24740J21852_100140532 113
10 3300001989 JGI24739J22299_10000118 JGI24739J22299_1000011832 113
11 3300001989 JGI24739J22299_10116781 JGI24739J22299_101167811 113
12 3300001989 JGI24739J22299_10237891 JGI24739J22299_102378911 113
13 3300001990 JGI24737J22298_10001221 JGI24737J22298_100012213 113
14 3300001990 JGI24737J22298_10065931 JGI24737J22298_100659313 113
15 3300001990 JGI24737J22298_10162999 JGI24737J22298_101629992 113
16 3300002067 JGI24735J21928_10002313 JGI24735J21928_100023138 113
17 3300002067 JGI24735J21928_10030492 JGI24735J21928_100304922 113
18 3300002067 JGI24735J21928_10048387 JGI24735J21928_100483873 113
19 3300002076 JGI24749J21850_1068508 JGI24749J21850_10685082 113
20 3300002244 JGI24742J22300_10026297 JGI24742J22300_100262972 113
21 3300003215 JGI25153J46596_10009725 JGI25153J46596_100097254 113
22 3300003316 rootH1_10093510 rootH1_100935103 113
23 3300003320 rootH2_10038319 rootH2_100383192 113
24 3300003320 rootH2_10096305 rootH2_100963053 113
25 3300003322 rootL2_10059667 rootL2_100596674 113
26 3300003756 Ga0055533_1001946 Ga0055533_10019463 113
27 3300003760 Ga0055527_1000306 Ga0055527_10003062 113
28 3300003762 Ga0055542_1030945 Ga0055542_10309451 113
29 3300003771 Ga0055526_1002048 Ga0055526_10020484 113
30 3300003773 Ga0055537_1000417 Ga0055537_10004171 113
31 3300003775 Ga0055524_1004179 Ga0055524_10041795 113
32 3300003784 Ga0055534_1000045 Ga0055534_100004550 113
33 3300003790 Ga0055528_1000414 Ga0055528_100041419 113
34 3300005262 Ga0065165_1005347 Ga0065165_10053472 113
35 3300005288 Ga0065714_10148579 Ga0065714_101485792 113
36 3300005290 Ga0065712_10095697 Ga0065712_100956972 113
37 3300005290 Ga0065712_10239804 Ga0065712_102398042 113
38 3300005293 Ga0065715_10099278 Ga0065715_100992782 113
39 3300005293 Ga0065715_10425647 Ga0065715_104256471 113
40 3300005295 Ga0065707_10605236 Ga0065707_106052362 113
41 3300005327 Ga0070658_10342428 Ga0070658_103424282 113
42 3300005328 Ga0070676_10100375 Ga0070676_101003751 113
43 3300005328 Ga0070676_10204936 Ga0070676_102049362 113
44 3300005328 Ga0070676_10290973 Ga0070676_102909732 113
45 3300005329 Ga0070683_100000987 Ga0070683_10000098711 113
46 3300005329 Ga0070683_101038849 Ga0070683_1010388491 113
47 3300005329 Ga0070683_101651600 Ga0070683_1016516002 113
48 3300005330 Ga0070690_100000516 Ga0070690_10000051623 113
49 3300005330 Ga0070690_100005509 Ga0070690_1000055095 113
50 3300005331 Ga0070670_100000438 Ga0070670_10000043824 113
51 3300005331 Ga0070670_100025505 Ga0070670_1000255052 113
52 3300005331 Ga0070670_100095595 Ga0070670_1000955954 113
53 3300005331 Ga0070670_100099796 Ga0070670_1000997964 113
54 3300005331 Ga0070670_100188547 Ga0070670_1001885471 113
55 3300005331 Ga0070670_100703209 Ga0070670_1007032091 113
56 3300005331 Ga0070670_101249023 Ga0070670_1012490232 113
57 3300005334 Ga0068869_100035109 Ga0068869_1000351095 113
58 3300005334 Ga0068869_100080243 Ga0068869_1000802432 113
59 3300005334 Ga0068869_100108259 Ga0068869_1001082592 113
60 3300005334 Ga0068869_100141030 Ga0068869_1001410302 113
61 3300005334 Ga0068869_100406162 Ga0068869_1004061622 113
62 3300005334 Ga0068869_100698905 Ga0068869_1006989052 113
63 3300005335 Ga0070666_10035061 Ga0070666_100350611 113
64 3300005335 Ga0070666_10046109 Ga0070666_100461092 113
65 3300005335 Ga0070666_10317506 Ga0070666_103175061 113
66 3300005336 Ga0070680_100030878 Ga0070680_1000308783 113
67 3300005336 Ga0070680_101449261 Ga0070680_1014492611 113
68 3300005337 Ga0070682_100237130 Ga0070682_1002371303 113
69 3300005337 Ga0070682_101097940 Ga0070682_1010979401 113
70 3300005338 Ga0068868_100001019 Ga0068868_1000010198 113
71 3300005338 Ga0068868_100041919 Ga0068868_1000419194 113
72 3300005338 Ga0068868_100063770 Ga0068868_1000637702 113
73 3300005338 Ga0068868_100515570 Ga0068868_1005155702 113
74 3300005338 Ga0068868_100578712 Ga0068868_1005787122 113
75 3300005339 Ga0070660_100719656 Ga0070660_1007196562 113
76 3300005339 Ga0070660_100783818 Ga0070660_1007838181 113
77 3300005340 Ga0070689_100016977 Ga0070689_1000169779 113
78 3300005340 Ga0070689_100637764 Ga0070689_1006377642 113
79 3300005340 Ga0070689_101585907 Ga0070689_1015859072 113
80 3300005341 Ga0070691_10173109 Ga0070691_101731092 113
81 3300005341 Ga0070691_10517802 Ga0070691_105178021 113
82 3300005343 Ga0070687_100010261 Ga0070687_1000102612 113
83 3300005343 Ga0070687_100070248 Ga0070687_1000702484 113
84 3300005344 Ga0070661_100002808 Ga0070661_1000028084 113
85 3300005344 Ga0070661_100009246 Ga0070661_1000092465 113
86 3300005344 Ga0070661_100016479 Ga0070661_1000164799 113
87 3300005344 Ga0070661_100291351 Ga0070661_1002913512 113
88 3300005345 Ga0070692_10062179 Ga0070692_100621792 113
89 3300005345 Ga0070692_10192891 Ga0070692_101928912 113
90 3300005347 Ga0070668_100001366 Ga0070668_10000136611 113
91 3300005353 Ga0070669_100006444 Ga0070669_10000644410 113
92 3300005353 Ga0070669_100597465 Ga0070669_1005974652 113
93 3300005353 Ga0070669_100784311 Ga0070669_1007843112 113
94 3300005354 Ga0070675_100001988 Ga0070675_1000019887 113
95 3300005354 Ga0070675_100003764 Ga0070675_10000376411 113
96 3300005354 Ga0070675_100433786 Ga0070675_1004337862 113
97 3300005354 Ga0070675_100486018 Ga0070675_1004860182 113
98 3300005354 Ga0070675_100762308 Ga0070675_1007623082 113
99 3300005355 Ga0070671_100000543 Ga0070671_10000054316 113
100 3300005355 Ga0070671_100056470 Ga0070671_1000564702 113
101 3300005355 Ga0070671_100067512 Ga0070671_1000675122 113
102 3300005355 Ga0070671_100351237 Ga0070671_1003512371 113
103 3300005356 Ga0070674_100036363 Ga0070674_1000363633 113
104 3300005356 Ga0070674_100905329 Ga0070674_1009053291 113
105 3300005364 Ga0070673_100005557 Ga0070673_1000055573 113
106 3300005365 Ga0070688_100000819 Ga0070688_10000081919 113
107 3300005365 Ga0070688_100002574 Ga0070688_1000025743 113
108 3300005366 Ga0070659_100000722 Ga0070659_10000072213 113
109 3300005366 Ga0070659_100247023 Ga0070659_1002470232 113
110 3300005366 Ga0070659_101568533 Ga0070659_1015685332 113
111 3300005434 Ga0070709_10161812 Ga0070709_101618122 113
112 3300005436 Ga0070713_100006824 Ga0070713_10000682410 113
113 3300005436 Ga0070713_100041905 Ga0070713_1000419053 113
114 3300005438 Ga0070701_10005063 Ga0070701_100050637 113
115 3300005438 Ga0070701_10581168 Ga0070701_105811682 113
116 3300005439 Ga0070711_100154861 Ga0070711_1001548611 113
117 3300005440 Ga0070705_100014731 Ga0070705_1000147314 113
118 3300005441 Ga0070700_100476225 Ga0070700_1004762252 113
119 3300005441 Ga0070700_100527537 Ga0070700_1005275372 113
120 3300005441 Ga0070700_100948661 Ga0070700_1009486612 113
121 3300005444 Ga0070694_100069896 Ga0070694_1000698963 113
122 3300005445 Ga0070708_100437186 Ga0070708_1004371862 113
123 3300005445 Ga0070708_100540870 Ga0070708_1005408702 113
124 3300005445 Ga0070708_101540465 Ga0070708_1015404651 113
125 3300005455 Ga0070663_100126278 Ga0070663_1001262781 113
126 3300005455 Ga0070663_100239988 Ga0070663_1002399882 113
127 3300005455 Ga0070663_100241523 Ga0070663_1002415232 113
128 3300005455 Ga0070663_100310677 Ga0070663_1003106772 113
129 3300005456 Ga0070678_100001529 Ga0070678_1000015294 113
130 3300005456 Ga0070678_100006494 Ga0070678_1000064942 113
131 3300005456 Ga0070678_100050133 Ga0070678_1000501331 113
132 3300005456 Ga0070678_100260200 Ga0070678_1002602003 113
133 3300005457 Ga0070662_100007090 Ga0070662_1000070904 113
134 3300005457 Ga0070662_100009855 Ga0070662_1000098554 113
135 3300005457 Ga0070662_100011225 Ga0070662_1000112254 113
136 3300005457 Ga0070662_101093527 Ga0070662_1010935272 113
137 3300005457 Ga0070662_101285701 Ga0070662_1012857012 113
138 3300005458 Ga0070681_10104617 Ga0070681_101046173 113
139 3300005458 Ga0070681_10175925 Ga0070681_101759253 113
140 3300005459 Ga0068867_100007657 Ga0068867_1000076574 113
141 3300005459 Ga0068867_100007738 Ga0068867_10000773811 113
142 3300005459 Ga0068867_100022584 Ga0068867_1000225844 113
143 3300005459 Ga0068867_100205853 Ga0068867_1002058531 113
144 3300005459 Ga0068867_100318292 Ga0068867_1003182922 113
145 3300005466 Ga0070685_10354947 Ga0070685_103549472 113
146 3300005467 Ga0070706_101704204 Ga0070706_1017042041 113
147 3300005467 Ga0070706_102169828 Ga0070706_1021698281 113
148 3300005468 Ga0070707_102249376 Ga0070707_1022493761 113
149 3300005471 Ga0070698_100382235 Ga0070698_1003822351 113
150 3300005471 Ga0070698_101496825 Ga0070698_1014968251 113
151 3300005471 Ga0070698_102205575 Ga0070698_1022055751 113
152 3300005518 Ga0070699_100009392 Ga0070699_1000093922 113
153 3300005518 Ga0070699_100194651 Ga0070699_1001946513 113
154 3300005518 Ga0070699_100704599 Ga0070699_1007045992 113
155 3300005518 Ga0070699_101406450 Ga0070699_1014064501 113
156 3300005518 Ga0070699_102153019 Ga0070699_1021530191 113
157 3300005530 Ga0070679_100023818 Ga0070679_1000238182 113
158 3300005530 Ga0070679_100929561 Ga0070679_1009295611 113
159 3300005536 Ga0070697_100104369 Ga0070697_1001043693 113
160 3300005536 Ga0070697_102017291 Ga0070697_1020172911 113
161 3300005539 Ga0068853_100785680 Ga0068853_1007856801 113
162 3300005543 Ga0070672_100001939 Ga0070672_1000019392 113
163 3300005543 Ga0070672_100051268 Ga0070672_1000512684 113
164 3300005543 Ga0070672_100120261 Ga0070672_1001202614 113
165 3300005543 Ga0070672_101048781 Ga0070672_1010487812 113
166 3300005544 Ga0070686_100510570 Ga0070686_1005105702 113
167 3300005545 Ga0070695_100032437 Ga0070695_1000324373 113
168 3300005545 Ga0070695_100042415 Ga0070695_1000424153 113
169 3300005546 Ga0070696_100301698 Ga0070696_1003016983 113
170 3300005546 Ga0070696_100989906 Ga0070696_1009899061 113
171 3300005547 Ga0070693_100004136 Ga0070693_10000413613 113
172 3300005547 Ga0070693_100056167 Ga0070693_1000561673 113
173 3300005547 Ga0070693_100392534 Ga0070693_1003925342 113
174 3300005548 Ga0070665_100005472 Ga0070665_10000547218 113
175 3300005548 Ga0070665_100038653 Ga0070665_1000386534 113
176 3300005548 Ga0070665_100479850 Ga0070665_1004798502 113
177 3300005549 Ga0070704_100236431 Ga0070704_1002364313 113
178 3300005549 Ga0070704_100256324 Ga0070704_1002563243 113
179 3300005549 Ga0070704_102061283 Ga0070704_1020612831 113
180 3300005563 Ga0068855_100013790 Ga0068855_1000137904 113
181 3300005563 Ga0068855_100046572 Ga0068855_1000465724 113
182 3300005563 Ga0068855_101403691 Ga0068855_1014036912 113
183 3300005564 Ga0070664_100005842 Ga0070664_1000058424 113
184 3300005564 Ga0070664_100006033 Ga0070664_1000060339 113
185 3300005564 Ga0070664_100018536 Ga0070664_1000185368 113
186 3300005564 Ga0070664_100283171 Ga0070664_1002831712 113
187 3300005577 Ga0068857_100000998 Ga0068857_1000009983 113
188 3300005578 Ga0068854_100001113 Ga0068854_1000011135 113
189 3300005578 Ga0068854_100001385 Ga0068854_1000013859 113
190 3300005578 Ga0068854_100024671 Ga0068854_1000246714 113
191 3300005578 Ga0068854_100049312 Ga0068854_1000493123 113
192 3300005578 Ga0068854_100108441 Ga0068854_1001084414 113
193 3300005614 Ga0068856_100085324 Ga0068856_1000853246 113
194 3300005614 Ga0068856_100595517 Ga0068856_1005955172 113
195 3300005614 Ga0068856_100637072 Ga0068856_1006370722 113
196 3300005614 Ga0068856_101662728 Ga0068856_1016627282 113
197 3300005615 Ga0070702_100022630 Ga0070702_1000226303 113
198 3300005615 Ga0070702_100078612 Ga0070702_1000786124 113
199 3300005615 Ga0070702_100128052 Ga0070702_1001280521 113
200 3300005615 Ga0070702_100300407 Ga0070702_1003004072 113
201 3300005616 Ga0068852_100000272 Ga0068852_10000027210 113
202 3300005616 Ga0068852_100016620 Ga0068852_1000166202 113
203 3300005616 Ga0068852_100056945 Ga0068852_1000569454 113
204 3300005616 Ga0068852_100065603 Ga0068852_1000656033 113
205 3300005616 Ga0068852_100371510 Ga0068852_1003715102 113
206 3300005616 Ga0068852_101501235 Ga0068852_1015012352 113
207 3300005617 Ga0068859_100010699 Ga0068859_10001069919 113
208 3300005617 Ga0068859_100183748 Ga0068859_1001837482 113
209 3300005617 Ga0068859_100226684 Ga0068859_1002266845 113
210 3300005617 Ga0068859_100245698 Ga0068859_1002456982 113
211 3300005617 Ga0068859_100264819 Ga0068859_1002648192 113
212 3300005617 Ga0068859_101172633 Ga0068859_1011726331 113
213 3300005617 Ga0068859_102537814 Ga0068859_1025378142 113
214 3300005618 Ga0068864_100004004 Ga0068864_10000400414 113
215 3300005618 Ga0068864_100005673 Ga0068864_1000056732 113
216 3300005618 Ga0068864_100031814 Ga0068864_1000318142 113
217 3300005618 Ga0068864_100111531 Ga0068864_1001115314 113
218 3300005618 Ga0068864_100832972 Ga0068864_1008329722 113
219 3300005718 Ga0068866_10003214 Ga0068866_100032142 113
220 3300005718 Ga0068866_10276973 Ga0068866_102769732 113
221 3300005718 Ga0068866_10348817 Ga0068866_103488172 113
222 3300005719 Ga0068861_100004074 Ga0068861_1000040749 113
223 3300005719 Ga0068861_100095663 Ga0068861_1000956633 113
224 3300005719 Ga0068861_101156082 Ga0068861_1011560822 113
225 3300005834 Ga0068851_10138531 Ga0068851_101385312 113
226 3300005834 Ga0068851_10166654 Ga0068851_101666542 113
227 3300005834 Ga0068851_10736139 Ga0068851_107361392 113
228 3300005840 Ga0068870_10011516 Ga0068870_100115168 113
229 3300005841 Ga0068863_100001296 Ga0068863_1000012962 113
230 3300005841 Ga0068863_100003717 Ga0068863_10000371716 113
231 3300005841 Ga0068863_100232551 Ga0068863_1002325512 113
232 3300005841 Ga0068863_102601485 Ga0068863_1026014851 113
233 3300005842 Ga0068858_100001929 Ga0068858_10000192918 113
234 3300005842 Ga0068858_100003142 Ga0068858_10000314212 113
235 3300005842 Ga0068858_100050925 Ga0068858_1000509255 113
236 3300005842 Ga0068858_100253137 Ga0068858_1002531372 113
237 3300005842 Ga0068858_102411885 Ga0068858_1024118852 113
238 3300005843 Ga0068860_100018934 Ga0068860_1000189345 113
239 3300005843 Ga0068860_100019324 Ga0068860_10001932413 113
240 3300005843 Ga0068860_100174934 Ga0068860_1001749344 113
241 3300005843 Ga0068860_100290307 Ga0068860_1002903071 113
242 3300005843 Ga0068860_100667199 Ga0068860_1006671992 113
243 3300005843 Ga0068860_102335131 Ga0068860_1023351312 113
244 3300005844 Ga0068862_100029895 Ga0068862_1000298954 113
245 3300005844 Ga0068862_100046498 Ga0068862_1000464983 113
246 3300005844 Ga0068862_100084369 Ga0068862_1000843694 113
247 3300005844 Ga0068862_102078417 Ga0068862_1020784171 113
248 3300006163 Ga0070715_10001133 Ga0070715_100011334 113
249 3300006173 Ga0070716_100014562 Ga0070716_1000145626 113
250 3300006175 Ga0070712_100032192 Ga0070712_1000321924 113
251 3300006175 Ga0070712_100075658 Ga0070712_1000756583 113
252 3300006195 Ga0075366_10014288 Ga0075366_100142885 113
253 3300006195 Ga0075366_10376175 Ga0075366_103761751 113
254 3300006237 Ga0097621_100001769 Ga0097621_10000176912 113
255 3300006237 Ga0097621_100056483 Ga0097621_1000564836 113
256 3300006237 Ga0097621_100100725 Ga0097621_1001007252 113
257 3300006237 Ga0097621_100229527 Ga0097621_1002295273 113
258 3300006358 Ga0068871_100002631 Ga0068871_10000263110 113
259 3300006358 Ga0068871_100069402 Ga0068871_1000694023 113
260 3300006358 Ga0068871_100196195 Ga0068871_1001961953 113
261 3300006358 Ga0068871_100268418 Ga0068871_1002684181 113
262 3300006358 Ga0068871_100454587 Ga0068871_1004545871 113
263 3300006358 Ga0068871_100530586 Ga0068871_1005305862 113
264 3300006358 Ga0068871_101548022 Ga0068871_1015480222 113
265 3300006844 Ga0075428_100009741 Ga0075428_1000097417 113
266 3300006844 Ga0075428_100259490 Ga0075428_1002594901 113
267 3300006844 Ga0075428_101502615 Ga0075428_1015026152 113
268 3300006846 Ga0075430_100010623 Ga0075430_1000106234 113
269 3300006846 Ga0075430_100025571 Ga0075430_1000255716 113
270 3300006846 Ga0075430_100217121 Ga0075430_1002171213 113
271 3300006846 Ga0075430_100288860 Ga0075430_1002888602 113
272 3300006846 Ga0075430_100572120 Ga0075430_1005721202 113
273 3300006847 Ga0075431_100041310 Ga0075431_1000413105 113
274 3300006847 Ga0075431_100225523 Ga0075431_1002255233 113
275 3300006847 Ga0075431_100424651 Ga0075431_1004246512 113
276 3300006847 Ga0075431_100458378 Ga0075431_1004583783 113
277 3300006847 Ga0075431_101774046 Ga0075431_1017740462 113
278 3300006852 Ga0075433_10073283 Ga0075433_100732833 113
279 3300006852 Ga0075433_10155677 Ga0075433_101556772 113
280 3300006852 Ga0075433_10169033 Ga0075433_101690332 113
281 3300006852 Ga0075433_10870778 Ga0075433_108707782 113
282 3300006852 Ga0075433_11166425 Ga0075433_111664252 113
283 3300006852 Ga0075433_11295840 Ga0075433_112958402 113
284 3300006871 Ga0075434_100007123 Ga0075434_1000071239 113
285 3300006871 Ga0075434_100052497 Ga0075434_1000524976 113
286 3300006871 Ga0075434_100059235 Ga0075434_1000592355 113
287 3300006871 Ga0075434_100167976 Ga0075434_1001679764 113
288 3300006871 Ga0075434_100954050 Ga0075434_1009540502 113
289 3300006880 Ga0075429_100016031 Ga0075429_1000160317 113
290 3300006880 Ga0075429_100587891 Ga0075429_1005878912 113
291 3300006880 Ga0075429_101909447 Ga0075429_1019094472 113
292 3300006881 Ga0068865_100033606 Ga0068865_1000336068 113
293 3300006881 Ga0068865_100073421 Ga0068865_1000734214 113
294 3300006914 Ga0075436_100109694 Ga0075436_1001096941 113
295 3300006914 Ga0075436_100214013 Ga0075436_1002140132 113
296 3300006914 Ga0075436_100835162 Ga0075436_1008351622 113
297 3300006931 Ga0097620_100010699 Ga0097620_10001069919 113
298 3300006931 Ga0097620_100183747 Ga0097620_1001837472 113
299 3300006931 Ga0097620_100226690 Ga0097620_1002266901 113
300 3300006931 Ga0097620_100245694 Ga0097620_1002456942 113
301 3300006931 Ga0097620_100264804 Ga0097620_1002648042 113
302 3300006931 Ga0097620_101172505 Ga0097620_1011725051 113
303 3300006931 Ga0097620_102537449 Ga0097620_1025374492 113
304 3300007076 Ga0075435_100007891 Ga0075435_1000078918 113
305 3300007076 Ga0075435_100023266 Ga0075435_1000232666 113
306 3300007076 Ga0075435_100054962 Ga0075435_1000549623 113
307 3300007076 Ga0075435_100115820 Ga0075435_1001158203 113
308 3300007076 Ga0075435_100124764 Ga0075435_1001247642 113
309 3300009093 Ga0105240_10000359 Ga0105240_1000035943 113
310 3300009093 Ga0105240_10023357 Ga0105240_100233576 113
311 3300009093 Ga0105240_10038461 Ga0105240_100384614 113
312 3300009093 Ga0105240_10113171 Ga0105240_101131713 113
313 3300009094 Ga0111539_10007338 Ga0111539_1000733812 113
314 3300009094 Ga0111539_10042479 Ga0111539_100424793 113
315 3300009094 Ga0111539_10104577 Ga0111539_101045777 113
316 3300009094 Ga0111539_10117917 Ga0111539_101179174 113
317 3300009094 Ga0111539_10278365 Ga0111539_102783652 113
318 3300009094 Ga0111539_11755420 Ga0111539_117554202 113
319 3300009094 Ga0111539_12845391 Ga0111539_128453911 113
320 3300009098 Ga0105245_10016068 Ga0105245_100160689 113
321 3300009098 Ga0105245_10017096 Ga0105245_100170964 113
322 3300009098 Ga0105245_10087047 Ga0105245_100870472 113
323 3300009098 Ga0105245_10381573 Ga0105245_103815732 113
324 3300009098 Ga0105245_10483212 Ga0105245_104832122 113
325 3300009101 Ga0105247_10018198 Ga0105247_100181985 113
326 3300009101 Ga0105247_10209005 Ga0105247_102090052 113
327 3300009147 Ga0114129_10047118 Ga0114129_100471187 113
328 3300009147 Ga0114129_10692500 Ga0114129_106925002 113
329 3300009147 Ga0114129_10899346 Ga0114129_108993463 113
330 3300009147 Ga0114129_11505430 Ga0114129_115054302 113
331 3300009148 Ga0105243_10072940 Ga0105243_100729403 113
332 3300009148 Ga0105243_10077148 Ga0105243_100771483 113
333 3300009174 Ga0105241_10003177 Ga0105241_1000317712 113
334 3300009174 Ga0105241_10038649 Ga0105241_100386494 113
335 3300009174 Ga0105241_10183206 Ga0105241_101832063 113
336 3300009174 Ga0105241_10427894 Ga0105241_104278942 113
337 3300009174 Ga0105241_10439423 Ga0105241_104394232 113
338 3300009174 Ga0105241_10834505 Ga0105241_108345051 113
339 3300009176 Ga0105242_10002472 Ga0105242_1000247219 113
340 3300009177 Ga0105248_10005132 Ga0105248_1000513210 113
341 3300009177 Ga0105248_10071443 Ga0105248_100714432 113
342 3300009177 Ga0105248_10211174 Ga0105248_102111743 113
343 3300009177 Ga0105248_10347752 Ga0105248_103477524 113
344 3300009177 Ga0105248_11106372 Ga0105248_111063722 113
345 3300009545 Ga0105237_10000352 Ga0105237_100003524 113
346 3300009545 Ga0105237_10024750 Ga0105237_100247504 113
347 3300009545 Ga0105237_10047645 Ga0105237_100476455 113
348 3300009545 Ga0105237_10071260 Ga0105237_100712603 113
349 3300009551 Ga0105238_10001859 Ga0105238_100018599 113
350 3300009551 Ga0105238_10146513 Ga0105238_101465132 113
351 3300009551 Ga0105238_10343386 Ga0105238_103433862 113
352 3300009551 Ga0105238_11546371 Ga0105238_115463711 113
353 3300009553 Ga0105249_10002479 Ga0105249_100024797 113
354 3300009553 Ga0105249_10022793 Ga0105249_100227933 113
355 3300009553 Ga0105249_10115152 Ga0105249_101151522 113
356 3300010375 Ga0105239_10051215 Ga0105239_100512152 113
357 3300010375 Ga0105239_10185391 Ga0105239_101853913 113
358 3300010375 Ga0105239_10238872 Ga0105239_102388722 113
359 3300010375 Ga0105239_10425075 Ga0105239_104250753 113
360 3300010375 Ga0105239_10544030 Ga0105239_105440302 113
361 3300010375 Ga0105239_12540532 Ga0105239_125405321 113
362 3300011119 Ga0105246_10069060 Ga0105246_100690605 113
363 3300011119 Ga0105246_10176664 Ga0105246_101766643 113
364 3300011119 Ga0105246_10316165 Ga0105246_103161652 113
365 3300011119 Ga0105246_10585939 Ga0105246_105859391 113
366 3300012500 Ga0157314_1000067 Ga0157314_10000675 113
367 3300013100 Ga0157373_10424097 Ga0157373_104240972 113
368 3300013102 Ga0157371_10204115 Ga0157371_102041154 113
369 3300013102 Ga0157371_10347447 Ga0157371_103474472 113
370 3300013102 Ga0157371_11281468 Ga0157371_112814681 113
371 3300013104 Ga0157370_10918498 Ga0157370_109184982 113
372 3300013105 Ga0157369_10077917 Ga0157369_100779175 113
373 3300013105 Ga0157369_10310311 Ga0157369_103103112 113
374 3300013105 Ga0157369_11836721 Ga0157369_118367211 113
375 3300013296 Ga0157374_10001826 Ga0157374_1000182616 113
376 3300013296 Ga0157374_10092035 Ga0157374_100920355 113
377 3300013296 Ga0157374_10269036 Ga0157374_102690362 113
378 3300013297 Ga0157378_10004007 Ga0157378_100040078 113
379 3300013297 Ga0157378_10004796 Ga0157378_1000479619 113
380 3300013297 Ga0157378_10071616 Ga0157378_100716165 113
381 3300013306 Ga0163162_10001742 Ga0163162_1000174213 113
382 3300013306 Ga0163162_10037794 Ga0163162_100377946 113
383 3300013306 Ga0163162_10205427 Ga0163162_102054274 113
384 3300013306 Ga0163162_10205439 Ga0163162_102054393 113
385 3300013306 Ga0163162_10910649 Ga0163162_109106493 113
386 3300013306 Ga0163162_12146541 Ga0163162_121465411 113
387 3300013307 Ga0157372_10010513 Ga0157372_100105136 113
388 3300013307 Ga0157372_10171724 Ga0157372_101717243 113
389 3300013307 Ga0157372_10269587 Ga0157372_102695872 113
390 3300013307 Ga0157372_11586917 Ga0157372_115869171 113
391 3300013307 Ga0157372_11622152 Ga0157372_116221522 113
392 3300013308 Ga0157375_10044913 Ga0157375_100449132 113
393 3300013308 Ga0157375_10067542 Ga0157375_100675425 113
394 3300013308 Ga0157375_10296097 Ga0157375_102960973 113
395 3300013308 Ga0157375_10356914 Ga0157375_103569142 113
396 3300013308 Ga0157375_11712547 Ga0157375_117125472 113
397 3300013308 Ga0157375_12167900 Ga0157375_121679002 113
398 3300014325 Ga0163163_10597959 Ga0163163_105979592 113
399 3300014325 Ga0163163_10911200 Ga0163163_109112001 113
400 3300014325 Ga0163163_11191680 Ga0163163_111916802 113
401 3300014745 Ga0157377_10003883 Ga0157377_100038839 113
402 3300014745 Ga0157377_10018007 Ga0157377_100180076 113
403 3300014745 Ga0157377_11628062 Ga0157377_116280621 113
404 3300014968 Ga0157379_10068889 Ga0157379_100688892 113
405 3300014968 Ga0157379_10245222 Ga0157379_102452221 113
406 3300014968 Ga0157379_10849457 Ga0157379_108494571 113
407 3300014969 Ga0157376_10002651 Ga0157376_1000265110 113
408 3300014969 Ga0157376_10146509 Ga0157376_101465093 113
409 3300014969 Ga0157376_10498383 Ga0157376_104983831 113
410 3300015687 Ga0183368_1004 Ga0183368_1004405 113
411 3300017792 Ga0163161_11208459 Ga0163161_112084592 113
412 3300017792 Ga0163161_11254709 Ga0163161_112547091 113
413 3300021358 Ga0213873_10092600 Ga0213873_100926002 113
414 3300021384 Ga0213876_10173977 Ga0213876_101739772 113
415 3300021384 Ga0213876_10370952 Ga0213876_103709522 113
416 3300025226 Ga0209674_100016 Ga0209674_100016227 113
417 3300025228 Ga0209672_100005 Ga0209672_100005385 113
418 3300025230 Ga0209563_100023 Ga0209563_10002341 113
419 3300025242 Ga0209258_100006 Ga0209258_100006385 113
420 3300025254 Ga0209148_1000012 Ga0209148_1000012385 113
421 3300025258 Ga0209129_1009423 Ga0209129_10094231 113
422 3300025261 Ga0209233_1001457 Ga0209233_10014573 113
423 3300025263 Ga0209565_1000003 Ga0209565_1000003476 113
424 3300025272 Ga0209455_1000008 Ga0209455_1000008385 113
425 3300025273 Ga0209673_1000003 Ga0209673_1000003362 113
426 3300025291 Ga0209675_1000003 Ga0209675_1000003562 113
427 3300025291 Ga0209675_1032146 Ga0209675_10321462 113
428 3300025292 Ga0209676_1037045 Ga0209676_10370451 113
429 3300025295 Ga0209564_1000012 Ga0209564_1000012370 113
430 3300025297 Ga0209758_1000812 Ga0209758_100081233 113
431 3300025297 Ga0209758_1024429 Ga0209758_10244293 113
432 3300025298 Ga0209050_1004472 Ga0209050_10044721 113
433 3300025299 Ga0209256_1000112 Ga0209256_100011217 113
434 3300025302 Ga0207426_1149889 Ga0207426_11498891 113
435 3300025303 Ga0209051_1070245 Ga0209051_10702453 113
436 3300025304 Ga0209257_1105659 Ga0209257_11056591 113
437 3300025315 Ga0207697_10045371 Ga0207697_100453714 113
438 3300025321 Ga0207656_10016793 Ga0207656_100167933 113
439 3300025321 Ga0207656_10120084 Ga0207656_101200842 113
440 3300025321 Ga0207656_10325483 Ga0207656_103254831 113
441 3300025898 Ga0207692_10067923 Ga0207692_100679231 113
442 3300025899 Ga0207642_10009036 Ga0207642_100090362 113
443 3300025899 Ga0207642_10128445 Ga0207642_101284453 113
444 3300025899 Ga0207642_10313475 Ga0207642_103134752 113
445 3300025900 Ga0207710_10144557 Ga0207710_101445572 113
446 3300025901 Ga0207688_10014280 Ga0207688_100142804 113
447 3300025903 Ga0207680_10010109 Ga0207680_100101094 113
448 3300025903 Ga0207680_10261134 Ga0207680_102611342 113
449 3300025903 Ga0207680_10416712 Ga0207680_104167122 113
450 3300025904 Ga0207647_10000066 Ga0207647_1000006626 113
451 3300025904 Ga0207647_10002628 Ga0207647_100026284 113
452 3300025904 Ga0207647_10032756 Ga0207647_100327562 113
453 3300025905 Ga0207685_10057933 Ga0207685_100579333 113
454 3300025906 Ga0207699_10143414 Ga0207699_101434142 113
455 3300025907 Ga0207645_10135695 Ga0207645_101356954 113
456 3300025907 Ga0207645_10793937 Ga0207645_107939372 113
457 3300025907 Ga0207645_11100688 Ga0207645_111006881 113
458 3300025908 Ga0207643_10098595 Ga0207643_100985951 113
459 3300025908 Ga0207643_10405908 Ga0207643_104059082 113
460 3300025909 Ga0207705_10121180 Ga0207705_101211802 113
461 3300025909 Ga0207705_10441365 Ga0207705_104413652 113
462 3300025911 Ga0207654_10020051 Ga0207654_100200515 113
463 3300025911 Ga0207654_10072548 Ga0207654_100725483 113
464 3300025911 Ga0207654_10173309 Ga0207654_101733092 113
465 3300025911 Ga0207654_10416425 Ga0207654_104164252 113
466 3300025911 Ga0207654_10498138 Ga0207654_104981382 113
467 3300025912 Ga0207707_10039511 Ga0207707_100395114 113
468 3300025912 Ga0207707_10154075 Ga0207707_101540753 113
469 3300025913 Ga0207695_10000014 Ga0207695_10000014496 113
470 3300025913 Ga0207695_10003135 Ga0207695_1000313516 113
471 3300025913 Ga0207695_10042600 Ga0207695_100426002 113
472 3300025913 Ga0207695_10080322 Ga0207695_100803222 113
473 3300025913 Ga0207695_10113233 Ga0207695_101132333 113
474 3300025914 Ga0207671_10000021 Ga0207671_1000002134 113
475 3300025914 Ga0207671_10021309 Ga0207671_100213095 113
476 3300025914 Ga0207671_10054020 Ga0207671_100540202 113
477 3300025914 Ga0207671_10138304 Ga0207671_101383041 113
478 3300025915 Ga0207693_10002141 Ga0207693_1000214116 113
479 3300025916 Ga0207663_10010953 Ga0207663_100109538 113
480 3300025916 Ga0207663_10233619 Ga0207663_102336192 113
481 3300025917 Ga0207660_10171876 Ga0207660_101718763 113
482 3300025918 Ga0207662_10005004 Ga0207662_100050049 113
483 3300025918 Ga0207662_10090177 Ga0207662_100901774 113
484 3300025920 Ga0207649_10002856 Ga0207649_100028566 113
485 3300025920 Ga0207649_10026219 Ga0207649_100262196 113
486 3300025920 Ga0207649_10031191 Ga0207649_100311912 113
487 3300025921 Ga0207652_10408876 Ga0207652_104088763 113
488 3300025921 Ga0207652_10827822 Ga0207652_108278222 113
489 3300025923 Ga0207681_10005638 Ga0207681_100056388 113
490 3300025923 Ga0207681_10382072 Ga0207681_103820722 113
491 3300025923 Ga0207681_10778103 Ga0207681_107781031 113
492 3300025924 Ga0207694_10001117 Ga0207694_100011179 113
493 3300025924 Ga0207694_10007223 Ga0207694_100072237 113
494 3300025924 Ga0207694_10207344 Ga0207694_102073443 113
495 3300025925 Ga0207650_10001147 Ga0207650_1000114712 113
496 3300025925 Ga0207650_10025553 Ga0207650_100255535 113
497 3300025925 Ga0207650_10154662 Ga0207650_101546621 113
498 3300025925 Ga0207650_10192856 Ga0207650_101928562 113
499 3300025925 Ga0207650_10531716 Ga0207650_105317162 113
500 3300025926 Ga0207659_10000565 Ga0207659_1000056511 113
501 3300025926 Ga0207659_10212343 Ga0207659_102123432 113
502 3300025926 Ga0207659_10387341 Ga0207659_103873412 113
503 3300025926 Ga0207659_10859443 Ga0207659_108594431 113
504 3300025926 Ga0207659_11152020 Ga0207659_111520202 113
505 3300025927 Ga0207687_10000151 Ga0207687_1000015110 113
506 3300025927 Ga0207687_10036212 Ga0207687_100362122 113
507 3300025927 Ga0207687_10220705 Ga0207687_102207052 113
508 3300025927 Ga0207687_10273517 Ga0207687_102735172 113
509 3300025927 Ga0207687_10274065 Ga0207687_102740652 113
510 3300025928 Ga0207700_10132492 Ga0207700_101324924 113
511 3300025929 Ga0207664_10591853 Ga0207664_105918531 113
512 3300025929 Ga0207664_11550136 Ga0207664_115501362 113
513 3300025931 Ga0207644_10001345 Ga0207644_100013457 113
514 3300025931 Ga0207644_10018240 Ga0207644_100182403 113
515 3300025931 Ga0207644_10039873 Ga0207644_100398734 113
516 3300025931 Ga0207644_10377148 Ga0207644_103771483 113
517 3300025932 Ga0207690_10017826 Ga0207690_100178265 113
518 3300025932 Ga0207690_10294947 Ga0207690_102949472 113
519 3300025932 Ga0207690_10407710 Ga0207690_104077102 113
520 3300025932 Ga0207690_11417620 Ga0207690_114176202 113
521 3300025932 Ga0207690_11729732 Ga0207690_117297322 113
522 3300025933 Ga0207706_10006270 Ga0207706_1000627011 113
523 3300025933 Ga0207706_10010590 Ga0207706_100105906 113
524 3300025933 Ga0207706_10013626 Ga0207706_100136269 113
525 3300025933 Ga0207706_10027587 Ga0207706_1002758710 113
526 3300025933 Ga0207706_10037955 Ga0207706_100379551 113
527 3300025933 Ga0207706_11325158 Ga0207706_113251581 113
528 3300025934 Ga0207686_10003571 Ga0207686_1000357112 113
529 3300025934 Ga0207686_10004666 Ga0207686_100046666 113
530 3300025934 Ga0207686_10584076 Ga0207686_105840762 113
531 3300025936 Ga0207670_10017900 Ga0207670_100179004 113
532 3300025936 Ga0207670_10188726 Ga0207670_101887261 113
533 3300025936 Ga0207670_11470805 Ga0207670_114708051 113
534 3300025937 Ga0207669_10025492 Ga0207669_100254922 113
535 3300025938 Ga0207704_10146095 Ga0207704_101460951 113
536 3300025938 Ga0207704_10489492 Ga0207704_104894922 113
537 3300025939 Ga0207665_10035866 Ga0207665_100358666 113
538 3300025940 Ga0207691_10001567 Ga0207691_1000156710 113
539 3300025940 Ga0207691_10046431 Ga0207691_100464312 113
540 3300025940 Ga0207691_10048350 Ga0207691_100483507 113
541 3300025940 Ga0207691_10886565 Ga0207691_108865651 113
542 3300025941 Ga0207711_10010889 Ga0207711_1001088914 113
543 3300025941 Ga0207711_10032060 Ga0207711_100320602 113
544 3300025941 Ga0207711_10149157 Ga0207711_101491572 113
545 3300025941 Ga0207711_10572967 Ga0207711_105729672 113
546 3300025941 Ga0207711_10864028 Ga0207711_108640281 113
547 3300025941 Ga0207711_11657522 Ga0207711_116575221 113
548 3300025942 Ga0207689_10074927 Ga0207689_100749272 113
549 3300025942 Ga0207689_10081879 Ga0207689_100818793 113
550 3300025942 Ga0207689_10119161 Ga0207689_101191612 113
551 3300025942 Ga0207689_10125012 Ga0207689_101250122 113
552 3300025942 Ga0207689_10132403 Ga0207689_101324035 113
553 3300025944 Ga0207661_10006434 Ga0207661_100064342 113
554 3300025944 Ga0207661_10879566 Ga0207661_108795662 113
555 3300025944 Ga0207661_11217067 Ga0207661_112170672 113
556 3300025945 Ga0207679_10000325 Ga0207679_1000032545 113
557 3300025945 Ga0207679_10000882 Ga0207679_1000088217 113
558 3300025945 Ga0207679_10001337 Ga0207679_100013373 113
559 3300025945 Ga0207679_10268198 Ga0207679_102681983 113
560 3300025949 Ga0207667_10000737 Ga0207667_1000073716 113
561 3300025949 Ga0207667_10002458 Ga0207667_100024588 113
562 3300025949 Ga0207667_11874370 Ga0207667_118743701 113
563 3300025960 Ga0207651_10009071 Ga0207651_100090715 113
564 3300025960 Ga0207651_10031488 Ga0207651_100314885 113
565 3300025960 Ga0207651_10158054 Ga0207651_101580542 113
566 3300025961 Ga0207712_10000522 Ga0207712_1000052219 113
567 3300025961 Ga0207712_10005594 Ga0207712_100055948 113
568 3300025972 Ga0207668_10272782 Ga0207668_102727822 113
569 3300025972 Ga0207668_10944947 Ga0207668_109449472 113
570 3300025981 Ga0207640_10000095 Ga0207640_1000009513 113
571 3300025981 Ga0207640_10003159 Ga0207640_100031598 113
572 3300025981 Ga0207640_10014742 Ga0207640_100147424 113
573 3300025981 Ga0207640_10019570 Ga0207640_100195703 113
574 3300025981 Ga0207640_10267681 Ga0207640_102676812 113
575 3300025986 Ga0207658_10033457 Ga0207658_100334572 113
576 3300025986 Ga0207658_10151570 Ga0207658_101515704 113
577 3300026023 Ga0207677_10000593 Ga0207677_100005934 113
578 3300026023 Ga0207677_10000724 Ga0207677_1000072410 113
579 3300026023 Ga0207677_10092834 Ga0207677_100928344 113
580 3300026023 Ga0207677_10450732 Ga0207677_104507322 113
581 3300026023 Ga0207677_10864923 Ga0207677_108649232 113
582 3300026035 Ga0207703_10013607 Ga0207703_100136074 113
583 3300026035 Ga0207703_10018778 Ga0207703_100187782 113
584 3300026035 Ga0207703_10089421 Ga0207703_100894212 113
585 3300026035 Ga0207703_10457604 Ga0207703_104576043 113
586 3300026041 Ga0207639_10000733 Ga0207639_1000073310 113
587 3300026067 Ga0207678_10000577 Ga0207678_1000057730 113
588 3300026067 Ga0207678_10111625 Ga0207678_101116254 113
589 3300026067 Ga0207678_10145805 Ga0207678_101458052 113
590 3300026067 Ga0207678_10146311 Ga0207678_101463112 113
591 3300026067 Ga0207678_10272628 Ga0207678_102726282 113
592 3300026075 Ga0207708_10082602 Ga0207708_100826022 113
593 3300026075 Ga0207708_10551622 Ga0207708_105516222 113
594 3300026078 Ga0207702_10121946 Ga0207702_101219464 113
595 3300026078 Ga0207702_10624867 Ga0207702_106248672 113
596 3300026088 Ga0207641_10206474 Ga0207641_102064744 113
597 3300026088 Ga0207641_10247050 Ga0207641_102470502 113
598 3300026088 Ga0207641_10708959 Ga0207641_107089592 113
599 3300026089 Ga0207648_10007978 Ga0207648_100079789 113
600 3300026089 Ga0207648_10012363 Ga0207648_100123635 113
601 3300026089 Ga0207648_10081329 Ga0207648_100813293 113
602 3300026089 Ga0207648_10346373 Ga0207648_103463732 113
603 3300026089 Ga0207648_11047408 Ga0207648_110474082 113
604 3300026089 Ga0207648_11230574 Ga0207648_112305742 113
605 3300026095 Ga0207676_10003284 Ga0207676_1000328411 113
606 3300026095 Ga0207676_10007085 Ga0207676_100070854 113
607 3300026095 Ga0207676_10052999 Ga0207676_100529995 113
608 3300026095 Ga0207676_10429802 Ga0207676_104298022 113
609 3300026095 Ga0207676_11097675 Ga0207676_110976752 113
610 3300026116 Ga0207674_10002447 Ga0207674_1000244715 113
611 3300026116 Ga0207674_10124212 Ga0207674_101242126 113
612 3300026116 Ga0207674_10155679 Ga0207674_101556792 113
613 3300026118 Ga0207675_100000354 Ga0207675_10000035418 113
614 3300026118 Ga0207675_100015382 Ga0207675_1000153829 113
615 3300026118 Ga0207675_100515472 Ga0207675_1005154721 113
616 3300026118 Ga0207675_100685933 Ga0207675_1006859331 113
617 3300026118 Ga0207675_102703056 Ga0207675_1027030561 113
618 3300026121 Ga0207683_10000739 Ga0207683_1000073913 113
619 3300026121 Ga0207683_10001084 Ga0207683_1000108431 113
620 3300026121 Ga0207683_10449975 Ga0207683_104499752 113
621 3300026121 Ga0207683_10475871 Ga0207683_104758713 113
622 3300026121 Ga0207683_10697643 Ga0207683_106976432 113
623 3300026142 Ga0207698_10000375 Ga0207698_1000037519 113
624 3300026142 Ga0207698_10405676 Ga0207698_104056762 113
625 3300026142 Ga0207698_10859865 Ga0207698_108598652 113
626 3300026142 Ga0207698_10891252 Ga0207698_108912522 113
627 3300026142 Ga0207698_10992343 Ga0207698_109923431 113
628 3300026142 Ga0207698_11233694 Ga0207698_112336942 113
629 3300027907 Ga0207428_10059015 Ga0207428_100590153 113
630 3300027907 Ga0207428_10608199 Ga0207428_106081992 113
631 3300028379 Ga0268266_10015750 Ga0268266_100157509 113
632 3300028379 Ga0268266_10420697 Ga0268266_104206972 113
633 3300028379 Ga0268266_10433629 Ga0268266_104336292 113
634 3300028379 Ga0268266_11560065 Ga0268266_115600651 113
635 3300028380 Ga0268265_10001830 Ga0268265_100018307 113
636 3300028380 Ga0268265_10030100 Ga0268265_100301007 113
637 3300028380 Ga0268265_10222728 Ga0268265_102227283 113
638 3300028381 Ga0268264_10001344 Ga0268264_1000134418 113
639 3300028381 Ga0268264_10189775 Ga0268264_101897753 113
640 3300028381 Ga0268264_10532258 Ga0268264_105322581 113
641 3300028381 Ga0268264_10909345 Ga0268264_109093451 113
642 3300028381 Ga0268264_11489424 Ga0268264_114894242 113
643 3300028577 Ga0265318_10124756 Ga0265318_101247562 113
644 3300029957 Ga0265324_10054369 Ga0265324_100543692 113
645 3300030731 Ga0316177_1136856 Ga0316177_11368562 113
646 3300030736 Ga0316180_1120196 Ga0316180_11201965 113
647 3300030742 Ga0316183_1091464 Ga0316183_10914643 113
648 3300030745 Ga0316182_1072389 Ga0316182_10723893 113
649 3300031241 Ga0265325_10023630 Ga0265325_100236304 113
650 3300031242 Ga0265329_10110809 Ga0265329_101108091 113
651 3300031249 Ga0265339_10000995 Ga0265339_100009954 113
652 3300031249 Ga0265339_10213815 Ga0265339_102138152 113
653 3300031344 Ga0265316_10001965 Ga0265316_100019659 113
654 3300031456 Ga0307513_10000013 Ga0307513_10000013294 113
655 3300031456 Ga0307513_10091189 Ga0307513_100911892 113
656 3300031548 Ga0307408_100038091 Ga0307408_1000380913 113
657 3300031548 Ga0307408_100684045 Ga0307408_1006840452 113
658 3300031711 Ga0265314_10000011 Ga0265314_10000011322 113
659 3300031730 Ga0307516_10414595 Ga0307516_104145952 113
660 3300031731 Ga0307405_10003810 Ga0307405_100038105 113
661 3300031824 Ga0307413_10111755 Ga0307413_101117552 113
662 3300031824 Ga0307413_10534828 Ga0307413_105348282 113
663 3300031824 Ga0307413_10750307 Ga0307413_107503072 113
664 3300031824 Ga0307413_11161138 Ga0307413_111611381 113
665 3300031852 Ga0307410_10003663 Ga0307410_100036637 113
666 3300031852 Ga0307410_10213049 Ga0307410_102130491 113
667 3300031852 Ga0307410_10814665 Ga0307410_108146652 113
668 3300031901 Ga0307406_10003561 Ga0307406_1000356113 113
669 3300031901 Ga0307406_10712158 Ga0307406_107121581 113
670 3300031911 Ga0307412_10015536 Ga0307412_100155365 113
671 3300031995 Ga0307409_100011302 Ga0307409_1000113022 113
672 3300031995 Ga0307409_101359949 Ga0307409_1013599491 113
673 3300032002 Ga0307416_100037270 Ga0307416_1000372705 113
674 3300032002 Ga0307416_100080935 Ga0307416_1000809355 113
675 3300032004 Ga0307414_10039087 Ga0307414_100390873 113
676 3300032004 Ga0307414_10112959 Ga0307414_101129592 113
677 3300032004 Ga0307414_10116106 Ga0307414_101161062 113
678 3300032004 Ga0307414_10386701 Ga0307414_103867012 113
679 3300032004 Ga0307414_10499369 Ga0307414_104993692 113
680 3300032004 Ga0307414_10814494 Ga0307414_108144942 113
681 3300032004 Ga0307414_11449133 Ga0307414_114491332 113
682 3300032005 Ga0307411_10007708 Ga0307411_100077085 113
683 3300032005 Ga0307411_10061658 Ga0307411_100616583 113
684 3300032126 Ga0307415_100003390 Ga0307415_10000339010 113
685 3300032126 Ga0307415_100251666 Ga0307415_1002516662 113
686 3300032126 Ga0307415_101307354 Ga0307415_1013073541 113
687 3300032168 Ga0316593_10018520 Ga0316593_100185203 113
688 3300035083 Ga0373926_0040057 Ga0373926_0040057_620_961 113
689 3300035092 Ga0373952_0184317 Ga0373952_0184317_24_368 113
690 3300035111 Ga0373923_0043833 Ga0373923_0043833_481_852 113
691 3300035117 Ga0373953_0028256 Ga0373953_0028256_1744_2115 113
692 3300035118 Ga0373954_0014612 Ga0373954_0014612_1021_1392 113
693 3300035119 Ga0373956_0004538 Ga0373956_0004538_4955_5296 113
694 3300035120 Ga0373957_0016317 Ga0373957_0016317_616_987 113
695 3300035172 Ga0373955_0033285 Ga0373955_0033285_233_604 113
696 3300035691 Ga0373931_0705273 Ga0373931_0705273_145_489 113
697 3300035692 Ga0373935_0018663 Ga0373935_0018663_3509_3850 113
698 3300035695 Ga0373927_0151188 Ga0373927_0151188_726_1097 113
699 3300035695 Ga0373927_0411123 Ga0373927_0411123_114_461 113
700 3300035724 Ga0373933_0013246 Ga0373933_0013246_1923_2294 113
701 3300035725 Ga0373947_0096106 Ga0373947_0096106_1113_1484 113
702 3300036401 Ga0373937_0092431 Ga0373937_0092431_1747_2118 113
703 3300036401 Ga0373937_1905615 Ga0373937_1905615_170_517 113
704 3300036647 Ga0316582_0709899 Ga0316582_0709899_83_430 113
705 3300037068 Ga0373925_0022503 Ga0373925_0022503_2255_2596 113
706 3300037068 Ga0373925_0038230 Ga0373925_0038230_1462_1803 113
707 3300037068 Ga0373925_1687922 Ga0373925_1687922_123_467 113
708 3300037312 Ga0395899_0039616 Ga0395899_0039616_135_482 113
709 3300037312 Ga0395899_0087793 Ga0395899_0087793_301_648 113
710 3300037312 Ga0395899_0118570 Ga0395899_0118570_86_433 113
711 3300037418 Ga0395900_0005718 Ga0395900_0005718_4533_4880 113
712 3300037418 Ga0395900_0029162 Ga0395900_0029162_5024_5371 113
713 3300037418 Ga0395900_0116834 Ga0395900_0116834_1437_1784 113
714 3300037418 Ga0395900_1722809 Ga0395900_1722809_82_426 113
715 3300037466 Ga0395898_0013263 Ga0395898_0013263_5346_5693 113
716 3300037466 Ga0395898_0035116 Ga0395898_0035116_4404_4751 113
717 3300037466 Ga0395898_0448170 Ga0395898_0448170_188_532 113
718 3300037471 Ga0395905_0191105 Ga0395905_0191105_1242_1589 113
719 3300037471 Ga0395905_0367431 Ga0395905_0367431_501_845 113
720 3300037471 Ga0395905_0507953 Ga0395905_0507953_83_430 113
721 3300037853 Ga0436364_0462315 Ga0436364_0462315_150_494 113
722 3300038443 Ga0395901_0002206 Ga0395901_0002206_1121_1468 113
723 3300038443 Ga0395901_0021709 Ga0395901_0021709_5985_6332 113
724 3300038443 Ga0395901_0085643 Ga0395901_0085643_616_963 113
725 3300038705 Ga0237819_02800 Ga0237819_02800_1352_1699 113
726 3300039145 Ga0237816_01144 Ga0237816_01144_830_1177 113
727 3300039437 Ga0436365_0215467 Ga0436365_0215467_675_1025 113
728 3300039437 Ga0436365_0825797 Ga0436365_0825797_397_741 113
729 3300039437 Ga0436365_1220357 Ga0436365_1220357_25_369 113
730 3300039438 Ga0436360_1317327 Ga0436360_1317327_79_423 113
731 3300039450 Ga0436363_0196439 Ga0436363_0196439_433_777 113
732 3300039453 Ga0436362_0697552 Ga0436362_0697552_477_821 113
733 3300041404 Ga0439436_0007875 Ga0439436_0007875_1959_2309 113
734 3300041460 Ga0451802_1212438 Ga0451802_1212438_163_504 113
735 3300041486 Ga0451807_0416150 Ga0451807_0416150_28_375 113
736 3300041492 Ga0451835_0617162 Ga0451835_0617162_264_611 113
737 3300041494 Ga0451837_1258601 Ga0451837_1258601_50_394 113
738 3300041509 Ga0451843_0469666 Ga0451843_0469666_158_502 113
739 3300042005 Ga0439448_0084631 Ga0439448_0084631_705_1052 113
740 3300042006 Ga0439432_016013 Ga0439432_016013_2065_2415 113
741 3300042007 Ga0439449_0012385 Ga0439449_0012385_1919_2269 113
742 3300042007 Ga0439449_0113753 Ga0439449_0113753_48_395 113
743 3300042157 Ga0439458_0040733 Ga0439458_0040733_222_572 113
744 3300042439 Ga0439464_0013490 Ga0439464_0013490_1058_1402 113
745 3300044656 Ga0466969_0000016 Ga0466969_0000016_5032_5376 113
746 3300044656 Ga0466969_0024665 Ga0466969_0024665_2100_2447 113
747 3300044656 Ga0466969_0136566 Ga0466969_0136566_77_424 113
748 3300044658 Ga0466972_0002876 Ga0466972_0002876_3678_4028 113
749 3300044658 Ga0466972_0084981 Ga0466972_0084981_155_502 113
750 3300044671 Ga0466978_0247987 Ga0466978_0247987_529_876 113
751 3300044672 Ga0466982_0000005 Ga0466982_0000005_81034_81381 113
752 3300044683 Ga0466965_0012517 Ga0466965_0012517_332_679 113
753 3300044683 Ga0466965_0091204 Ga0466965_0091204_785_1135 113
754 3300044684 Ga0466966_0002888 Ga0466966_0002888_5953_6300 113
755 3300044684 Ga0466966_0014142 Ga0466966_0014142_14_358 113
756 3300044693 Ga0466961_0054883 Ga0466961_0054883_1701_2045 113
757 3300044706 Ga0466964_0007368 Ga0466964_0007368_1092_1439 113
758 3300044706 Ga0466964_0106032 Ga0466964_0106032_742_1092 113
759 3300044712 Ga0453684_0000020 Ga0453684_0000020_423420_423767 113
760 3300044719 Ga0466971_0009485 Ga0466971_0009485_2116_2463 113
761 3300044719 Ga0466971_0325440 Ga0466971_0325440_261_605 113
762 3300044765 Ga0466970_0164782 Ga0466970_0164782_145_489 113
763 3300044765 Ga0466970_0356365 Ga0466970_0356365_194_541 113
764 3300044901 Ga0466960_0000662 Ga0466960_0000662_4820_5167 113
765 3300045049 Ga0466959_0190277 Ga0466959_0190277_250_594 113
766 3300045049 Ga0466959_0437675 Ga0466959_0437675_73_420 113
767 3300045836 Ga0466958_0026487 Ga0466958_0026487_747_1094 113
768 3300045976 Ga0466967_0150058 Ga0466967_0150058_1640_1990 113
769 3300045976 Ga0466967_0487057 Ga0466967_0487057_422_769 113
770 3300046460 Ga0495638_0000007 Ga0495638_0000007_458328_458675 113
771 3300046460 Ga0495638_0007666 Ga0495638_0007666_7040_7387 113
772 3300046472 Ga0495580_0002914 Ga0495580_0002914_13417_13764 113
773 3300046472 Ga0495580_0536049 Ga0495580_0536049_40_381 113
774 3300046473 Ga0495582_0646272 Ga0495582_0646272_12_371 113
775 3300046475 Ga0495639_0404709 Ga0495639_0404709_169_510 113
776 3300046511 Ga0495608_0383283 Ga0495608_0383283_398_769 113
777 3300046513 Ga0495616_0165040 Ga0495616_0165040_218_565 113
778 3300046516 Ga0495628_0385966 Ga0495628_0385966_473_844 113
779 3300046525 Ga0495663_0095495 Ga0495663_0095495_510_854 113
780 3300046525 Ga0495663_0142139 Ga0495663_0142139_249_590 113
781 3300046525 Ga0495663_0154809 Ga0495663_0154809_390_737 113
782 3300046528 Ga0495642_0000863 Ga0495642_0000863_1117_1464 113
783 3300046531 Ga0495665_0255471 Ga0495665_0255471_490_861 113
784 3300046535 Ga0495586_0516709 Ga0495586_0516709_132_503 113
785 3300046536 Ga0495587_0268647 Ga0495587_0268647_100_441 113
786 3300046539 Ga0495621_0036478 Ga0495621_0036478_25_366 113
787 3300046543 Ga0495645_0206256 Ga0495645_0206256_600_971 113
788 3300046679 Ga0495623_0073741 Ga0495623_0073741_1307_1678 113
789 3300046689 Ga0495613_0100831 Ga0495613_0100831_887_1246 113
790 3300047319 Ga0495674_0115605 Ga0495674_0115605_1144_1485 113
791 3300047320 Ga0495672_0060510 Ga0495672_0060510_1726_2073 113
792 3300047445 Ga0495677_0095317 Ga0495677_0095317_649_996 113
793 3300047471 Ga0495684_0133590 Ga0495684_0133590_526_897 113
794 3300048904 Ga0496101_0086850 Ga0496101_0086850_1964_2305 113
795 3300048906 Ga0496103_0208967 Ga0496103_0208967_71_451 113
796 3300048907 Ga0496104_0027357 Ga0496104_0027357_2996_3337 113
797 3300048907 Ga0496104_0570769 Ga0496104_0570769_299_646 113
798 3300048908 Ga0496105_0017914 Ga0496105_0017914_4034_4375 113
799 3300048908 Ga0496105_0275518 Ga0496105_0275518_45_392 113
800 3300048908 Ga0496105_1009093 Ga0496105_1009093_163_519 113
801 3300048909 Ga0496106_0141909 Ga0496106_0141909_457_798 113
802 3300048909 Ga0496106_0708483 Ga0496106_0708483_181_525 113
803 3300048910 Ga0496107_0114991 Ga0496107_0114991_1196_1537 113
804 3300048910 Ga0496107_0532032 Ga0496107_0532032_57_401 113
805 3300048911 Ga0496108_0029478 Ga0496108_0029478_1203_1544 113
806 3300048911 Ga0496108_0065794 Ga0496108_0065794_1624_1968 113
807 3300048911 Ga0496108_0400781 Ga0496108_0400781_70_417 113
808 3300048912 Ga0496109_0004582 Ga0496109_0004582_683_1030 113
809 3300048912 Ga0496109_0153437 Ga0496109_0153437_1381_1722 113
810 3300048912 Ga0496109_0238027 Ga0496109_0238027_1117_1461 113
811 3300048913 Ga0496110_0024184 Ga0496110_0024184_3552_3899 113
812 3300048913 Ga0496110_0182458 Ga0496110_0182458_929_1273 113
813 3300048913 Ga0496110_1368705 Ga0496110_1368705_185_529 113
814 3300048914 Ga0496111_0005423 Ga0496111_0005423_6963_7310 113
815 3300048915 Ga0496112_0068664 Ga0496112_0068664_1993_2364 113
816 3300048916 Ga0496113_0259178 Ga0496113_0259178_482_826 113
817 3300048917 Ga0496114_0049947 Ga0496114_0049947_1716_2063 113
818 3300048917 Ga0496114_0653624 Ga0496114_0653624_255_602 113
819 3300048918 Ga0496115_0000039 Ga0496115_0000039_37485_37841 113
820 3300048918 Ga0496115_0079680 Ga0496115_0079680_713_1084 113
821 3300048921 Ga0496118_0037307 Ga0496118_0037307_1142_1522 113
822 3300048921 Ga0496118_0156509 Ga0496118_0156509_493_840 113
823 3300048924 Ga0496121_0044528 Ga0496121_0044528_2490_2837 113
824 3300048925 Ga0496122_0314574 Ga0496122_0314574_19_375 113
825 3300048927 Ga0496124_0098248 Ga0496124_0098248_1838_2182 113
826 3300048928 Ga0496125_0000313 Ga0496125_0000313_27272_27619 113
827 3300048928 Ga0496125_0000379 Ga0496125_0000379_62429_62776 113
828 3300048929 Ga0496126_0117941 Ga0496126_0117941_128_475 113
829 3300048929 Ga0496126_0449565 Ga0496126_0449565_152_499 113
830 3300049515 Ga0501292_037832 Ga0501292_037832_71_433 113
831 3300049521 Ga0501298_022270 Ga0501298_022270_367_729 113
832 3300049523 Ga0501300_017161 Ga0501300_017161_292_654 113
833 3300049568 Ga0501031_0180024 Ga0501031_0180024_672_1019 113
834 3300049568 Ga0501031_0418702 Ga0501031_0418702_75_419 113
835 3300049568 Ga0501031_0662385 Ga0501031_0662385_276_623 113
836 3300049569 Ga0501032_0018514 Ga0501032_0018514_1231_1575 113
837 3300049569 Ga0501032_0070325 Ga0501032_0070325_679_1026 113
838 3300049570 Ga0501033_0021892 Ga0501033_0021892_2716_3063 113
839 3300049570 Ga0501033_0622531 Ga0501033_0622531_66_410 113
840 3300049571 Ga0501034_0041124 Ga0501034_0041124_45_389 113
841 3300049572 Ga0501036_0044682 Ga0501036_0044682_1318_1665 113
842 3300049573 Ga0501037_0159568 Ga0501037_0159568_125_472 113
843 3300049573 Ga0501037_0175526 Ga0501037_0175526_383_733 113
844 3300049574 Ga0501038_0043484 Ga0501038_0043484_3520_3867 113
845 3300049574 Ga0501038_0966537 Ga0501038_0966537_26_373 113
846 3300049575 Ga0501039_0611401 Ga0501039_0611401_252_596 113
847 3300049578 Ga0501042_0515194 Ga0501042_0515194_292_639 113
848 3300049579 Ga0501043_0063280 Ga0501043_0063280_801_1145 113
849 3300049579 Ga0501043_0084585 Ga0501043_0084585_1816_2163 113
850 3300049580 Ga0501046_0052161 Ga0501046_0052161_1030_1374 113
851 3300049580 Ga0501046_0538124 Ga0501046_0538124_474_821 113
852 3300049581 Ga0501047_0018745 Ga0501047_0018745_2505_2852 113
853 3300049581 Ga0501047_0077036 Ga0501047_0077036_791_1135 113
854 3300049581 Ga0501047_0121904 Ga0501047_0121904_1577_1924 113
855 3300049581 Ga0501047_0164607 Ga0501047_0164607_72_419 113
856 3300049582 Ga0501048_0402658 Ga0501048_0402658_553_900 113
857 3300049584 Ga0501068_0201818 Ga0501068_0201818_821_1168 113
858 3300049586 Ga0501070_0067505 Ga0501070_0067505_1308_1655 113
859 3300049586 Ga0501070_1179342 Ga0501070_1179342_114_461 113
860 3300049589 Ga0501073_0864999 Ga0501073_0864999_187_534 113
861 3300049590 Ga0501074_0815971 Ga0501074_0815971_193_540 113
862 3300049591 Ga0501075_0115308 Ga0501075_0115308_217_564 113
863 3300049592 Ga0501076_0582437 Ga0501076_0582437_486_833 113
864 3300049661 Ga0501217_193713 Ga0501217_193713_238_588 113
865 3300049705 Ga0501225_0106322 Ga0501225_0106322_381_731 113
866 3300049742 Ga0501080_0417701 Ga0501080_0417701_780_1127 113
867 3300049771 Ga0501274_001631 Ga0501274_001631_1310_1654 113
868 3300049773 Ga0501276_016181 Ga0501276_016181_152_514 113
869 3300049822 Ga0501035_0028259 Ga0501035_0028259_880_1227 113
870 3300049822 Ga0501035_0379781 Ga0501035_0379781_814_1164 113
871 3300049822 Ga0501035_1484677 Ga0501035_1484677_56_403 113
872 3300049823 Ga0501044_0030714 Ga0501044_0030714_4280_4627 113
873 3300049823 Ga0501044_0539350 Ga0501044_0539350_57_404 113
874 3300049823 Ga0501044_0794683 Ga0501044_0794683_113_460 113
875 3300050493 nmdc:mga0k408_15007_c1 nmdc:mga0k408_15007_c1_3713_4060 113
876 3300050493 nmdc:mga0k408_236574_c1 nmdc:mga0k408_236574_c1_501_917 113
877 3300050493 nmdc:mga0k408_447972_c1 nmdc:mga0k408_447972_c1_337_684 113
878 3300050507 nmdc:mga05p37_1326941_c1 nmdc:mga05p37_1326941_c1_49_393 113
879 3300050507 nmdc:mga05p37_181305_c1 nmdc:mga05p37_181305_c1_2156_2500 113
880 3300050507 nmdc:mga05p37_584699_c1 nmdc:mga05p37_584699_c1_760_1107 113
881 3300050507 nmdc:mga05p37_850864_c1 nmdc:mga05p37_850864_c1_297_641 113
882 3300050508 nmdc:mga09592_409997_c1 nmdc:mga09592_409997_c1_466_810 113
883 3300050508 nmdc:mga09592_4687_c1 nmdc:mga09592_4687_c1_3469_3813 113
884 3300050509 nmdc:mga0qj67_152542_c1 nmdc:mga0qj67_152542_c1_1458_1805 113
885 3300050509 nmdc:mga0qj67_21452_c1 nmdc:mga0qj67_21452_c1_2028_2372 113
886 3300050509 nmdc:mga0qj67_26271_c1 nmdc:mga0qj67_26271_c1_1941_2285 113
887 3300050509 nmdc:mga0qj67_757157_c1 nmdc:mga0qj67_757157_c1_62_406 113
888 3300050509 nmdc:mga0qj67_80814_c1 nmdc:mga0qj67_80814_c1_1147_1491 113
889 3300050510 nmdc:mga06r32_10201_c1 nmdc:mga06r32_10201_c1_4792_5136 113
890 3300050510 nmdc:mga06r32_399223_c1 nmdc:mga06r32_399223_c1_800_1147 113
891 3300050510 nmdc:mga06r32_745001_c1 nmdc:mga06r32_745001_c1_297_641 113
892 3300050511 nmdc:mga08y16_1018896_c1 nmdc:mga08y16_1018896_c1_196_540 113
893 3300050511 nmdc:mga08y16_136431_c1 nmdc:mga08y16_136431_c1_1892_2239 113
894 3300050511 nmdc:mga08y16_61034_c1 nmdc:mga08y16_61034_c1_1896_2240 113
895 3300050512 nmdc:mga0n895_155234_c1 nmdc:mga0n895_155234_c1_1586_1933 113
896 3300050512 nmdc:mga0n895_250101_c1 nmdc:mga0n895_250101_c1_833_1180 113
897 3300050512 nmdc:mga0n895_27412_c1 nmdc:mga0n895_27412_c1_2241_2588 113
898 3300050512 nmdc:mga0n895_49686_c1 nmdc:mga0n895_49686_c1_2189_2530 113
899 3300050513 nmdc:mga0rr50_345452_c1 nmdc:mga0rr50_345452_c1_684_1031 113
900 3300050513 nmdc:mga0rr50_51116_c1 nmdc:mga0rr50_51116_c1_1648_1989 113
901 3300050513 nmdc:mga0rr50_7612_c1 nmdc:mga0rr50_7612_c1_1260_1607 113
902 3300050514 nmdc:mga08x19_1251564_c1 nmdc:mga08x19_1251564_c1_35_382 113
903 3300050514 nmdc:mga08x19_634227_c1 nmdc:mga08x19_634227_c1_187_534 113
904 3300050515 nmdc:mga0a205_1359193_c1 nmdc:mga0a205_1359193_c1_132_476 113
905 3300050515 nmdc:mga0a205_14872_c3 nmdc:mga0a205_14872_c3_1029_1376 113
906 3300050515 nmdc:mga0a205_73683_c1 nmdc:mga0a205_73683_c1_2599_2946 113
907 3300053078 Ga0495612_0180537 Ga0495612_0180537_360_707 113
908 3300053078 Ga0495612_0244516 Ga0495612_0244516_50_397 113
909 3300053087 Ga0500643_000654 Ga0500643_000654_20437_20784 113
910 3300053087 Ga0500643_035304 Ga0500643_035304_903_1250 113
911 3300053087 Ga0500643_040767 Ga0500643_040767_251_598 113
912 3300053088 Ga0500644_0037409 Ga0500644_0037409_601_948 113
913 3300053088 Ga0500644_0117275 Ga0500644_0117275_309_656 113
914 3300053098 Ga0500650_0237835 Ga0500650_0237835_24_371 113
915 3300053131 Ga0500652_384550 Ga0500652_384550_31_378 113
916 3300053134 Ga0500658_0026201 Ga0500658_0026201_123_470 113
917 3300053139 Ga0500568_0049201 Ga0500568_0049201_960_1307 113
918 3300053139 Ga0500568_0130691 Ga0500568_0130691_89_436 113
919 3300053156 Ga0500622_0007137 Ga0500622_0007137_153_500 113
920 3300053156 Ga0500622_0147872 Ga0500622_0147872_656_1000 113
921 3300054114 Ga0501084_0095487 Ga0501084_0095487_1267_1614 113
922 3300059421 Ga0590071_148334 Ga0590071_148334_198_545 113
923 3300060353 Ga0501082_0116694 Ga0501082_0116694_427_774 113
924 3300061719 Ga0466962_0003750 Ga0466962_0003750_2248_2595 113
925 3300061734 Ga0530510_0175332 Ga0530510_0175332_73_420 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

47

134

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8602 3 108
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8387 3 108
6sn1-assembly1.cif.gz_A crystal structure of the human ints13-ints14 complex 0.7917 64 91
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7657 3 104
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.6934 3 104
ID Description Score Start End Superfamily
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9329 4 112 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8937 4 112 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8797 3 110 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8776 4 111 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.861 3 107 2.170.150.70
ID Description Score Start End GO Terms
AF-W7WMC8-F1-model_v4 deleted 0.9927 2 113
AF-A0A4Q2J3M7-F1-model_v4 GFA family protein 0.9901 2 113 GO:0016846
GO:0046872
AF-A0A1E4QPE3-F1-model_v4 deleted 0.9898 2 113
AF-Q3JVS1-F1-model_v4 CENP-V/GFA domain-containing protein 0.9886 2 113 GO:0016846
GO:0046872
AF-A0A154IPM1-F1-model_v4 Aldehyde-activating protein 0.9885 2 113 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.86 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map