F485899
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 925 | 398 | 925 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_236574_c1|nmdc:mga0k408_236574_c1_501_917 |
| Length | 138 |
| Sequence | LTRTTLAQPRGLDSIVPMVSTRGMTQRGSCHCGKVRFEAEGDIAQVIECNCSHCSRKGFLLWFVPRQALQLQTSPDELASYFFNKHVIEHRFCPTCGCQPFGLGTDPAGNAVAAINVRCLEDLDLGSLKRVAYDGRSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 229 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 231 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 232 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 233 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 242 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 244 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 245 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 250 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 251 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 252 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 276 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 280 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 281 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 282 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 285 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 286 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 287 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 288 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 289 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 290 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 291 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 294 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 295 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 296 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 300 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 301 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 302 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 303 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 304 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 305 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 306 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 307 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 340 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 341 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 344 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 345 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 348 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 349 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 370 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 373 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 388 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 390 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 391 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 394 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 398 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.3 |
| Nodule | 0 |
| Rhizoplane | 3.14 |
| Rhizosphere | 88.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_1762146 | 2162886012 | Bacteria | 1619 |
| 2 | JGI24736J21556_1073281 | 3300001904 | Bacteria | 535 |
| 3 | JGI24740J21852_10014053 | 3300001979 | Bacteria | 2966 |
| 4 | JGI24739J22299_10000118 | 3300001989 | Bacteria | 24899 |
| 5 | JGI24739J22299_10116781 | 3300001989 | Bacteria | 799 |
| 6 | JGI24739J22299_10237891 | 3300001989 | Bacteria | 533 |
| 7 | JGI24737J22298_10001221 | 3300001990 | Bacteria | 9059 |
| 8 | JGI24737J22298_10065931 | 3300001990 | Bacteria | 1085 |
| 9 | JGI24737J22298_10162999 | 3300001990 | Bacteria | 658 |
| 10 | JGI24735J21928_10002313 | 3300002067 | Bacteria | 6647 |
| 11 | JGI24735J21928_10030492 | 3300002067 | Bacteria | 1602 |
| 12 | JGI24735J21928_10048387 | 3300002067 | Bacteria | 1230 |
| 13 | JGI24749J21850_1068508 | 3300002076 | Bacteria | 546 |
| 14 | JGI24742J22300_10026297 | 3300002244 | Bacteria | 1007 |
| 15 | JGI25153J46596_10009725 | 3300003215 | Bacteria | 4424 |
| 16 | rootH1_10093510 | 3300003316 | Bacteria | 2465 |
| 17 | rootH2_10038319 | 3300003320 | Bacteria | 5196 |
| 18 | rootH2_10096305 | 3300003320 | Bacteria | 1290 |
| 19 | rootL2_10059667 | 3300003322 | Bacteria | 1454 |
| 20 | Ga0055533_1001946 | 3300003756 | Bacteria | 5081 |
| 21 | Ga0055527_1000306 | 3300003760 | Bacteria | 27466 |
| 22 | Ga0055542_1030945 | 3300003762 | Bacteria | 686 |
| 23 | Ga0055526_1002048 | 3300003771 | Bacteria | 13854 |
| 24 | Ga0055537_1000417 | 3300003773 | Bacteria | 27822 |
| 25 | Ga0055524_1004179 | 3300003775 | Bacteria | 6736 |
| 26 | Ga0055534_1000045 | 3300003784 | Bacteria | 98659 |
| 27 | Ga0055528_1000414 | 3300003790 | Bacteria | 34502 |
| 28 | Ga0065165_1005347 | 3300005262 | Bacteria | 7290 |
| 29 | Ga0065714_10148579 | 3300005288 | Bacteria | 1119 |
| 30 | Ga0065712_10095697 | 3300005290 | Bacteria | 2210 |
| 31 | Ga0065712_10239804 | 3300005290 | Bacteria | 982 |
| 32 | Ga0065715_10099278 | 3300005293 | Bacteria | 3433 |
| 33 | Ga0065715_10425647 | 3300005293 | Unclassified | 831 |
| 34 | Ga0065707_10605236 | 3300005295 | Bacteria | 662 |
| 35 | Ga0070658_10342428 | 3300005327 | Bacteria | 1279 |
| 36 | Ga0070676_10100375 | 3300005328 | Bacteria | 1787 |
| 37 | Ga0070676_10204936 | 3300005328 | Bacteria | 1295 |
| 38 | Ga0070676_10290973 | 3300005328 | Bacteria | 1104 |
| 39 | Ga0070683_100000987 | 3300005329 | Bacteria | 21253 |
| 40 | Ga0070683_101038849 | 3300005329 | Unclassified | 787 |
| 41 | Ga0070683_101651600 | 3300005329 | Bacteria | 616 |
| 42 | Ga0070690_100000516 | 3300005330 | Bacteria | 19334 |
| 43 | Ga0070690_100005509 | 3300005330 | Bacteria | 7118 |
| 44 | Ga0070670_100000438 | 3300005331 | Bacteria | 33972 |
| 45 | Ga0070670_100025505 | 3300005331 | Bacteria | 5085 |
| 46 | Ga0070670_100095595 | 3300005331 | Bacteria | 2556 |
| 47 | Ga0070670_100099796 | 3300005331 | Bacteria | 2498 |
| 48 | Ga0070670_100188547 | 3300005331 | Bacteria | 1791 |
| 49 | Ga0070670_100703209 | 3300005331 | Bacteria | 909 |
| 50 | Ga0070670_101249023 | 3300005331 | Bacteria | 679 |
| 51 | Ga0068869_100035109 | 3300005334 | Bacteria | 3552 |
| 52 | Ga0068869_100080243 | 3300005334 | Bacteria | 2434 |
| 53 | Ga0068869_100108259 | 3300005334 | Bacteria | 2111 |
| 54 | Ga0068869_100141030 | 3300005334 | Bacteria | 1861 |
| 55 | Ga0068869_100406162 | 3300005334 | Bacteria | 1121 |
| 56 | Ga0068869_100698905 | 3300005334 | Bacteria | 865 |
| 57 | Ga0070666_10035061 | 3300005335 | Bacteria | 3326 |
| 58 | Ga0070666_10046109 | 3300005335 | Bacteria | 2923 |
| 59 | Ga0070666_10317506 | 3300005335 | Bacteria | 1111 |
| 60 | Ga0070680_100030878 | 3300005336 | Bacteria | 4304 |
| 61 | Ga0070680_101449261 | 3300005336 | Bacteria | 595 |
| 62 | Ga0070682_100237130 | 3300005337 | Bacteria | 1308 |
| 63 | Ga0070682_101097940 | 3300005337 | Bacteria | 666 |
| 64 | Ga0068868_100001019 | 3300005338 | Bacteria | 19145 |
| 65 | Ga0068868_100041919 | 3300005338 | Bacteria | 3569 |
| 66 | Ga0068868_100063770 | 3300005338 | Bacteria | 2923 |
| 67 | Ga0068868_100515570 | 3300005338 | Bacteria | 1049 |
| 68 | Ga0068868_100578712 | 3300005338 | Bacteria | 992 |
| 69 | Ga0070660_100719656 | 3300005339 | Unclassified | 837 |
| 70 | Ga0070660_100783818 | 3300005339 | Bacteria | 801 |
| 71 | Ga0070689_100016977 | 3300005340 | Bacteria | 5339 |
| 72 | Ga0070689_100637764 | 3300005340 | Bacteria | 926 |
| 73 | Ga0070689_101585907 | 3300005340 | Bacteria | 594 |
| 74 | Ga0070691_10173109 | 3300005341 | Bacteria | 1120 |
| 75 | Ga0070691_10517802 | 3300005341 | Bacteria | 692 |
| 76 | Ga0070687_100010261 | 3300005343 | Bacteria | 4044 |
| 77 | Ga0070687_100070248 | 3300005343 | Bacteria | 1878 |
| 78 | Ga0070661_100002808 | 3300005344 | Bacteria | 11955 |
| 79 | Ga0070661_100009246 | 3300005344 | Bacteria | 6813 |
| 80 | Ga0070661_100016479 | 3300005344 | Bacteria | 5226 |
| 81 | Ga0070661_100291351 | 3300005344 | Bacteria | 1268 |
| 82 | Ga0070692_10062179 | 3300005345 | Bacteria | 1970 |
| 83 | Ga0070692_10192891 | 3300005345 | Bacteria | 1188 |
| 84 | Ga0070668_100001366 | 3300005347 | Bacteria | 17481 |
| 85 | Ga0070669_100006444 | 3300005353 | Bacteria | 8452 |
| 86 | Ga0070669_100597465 | 3300005353 | Unclassified | 924 |
| 87 | Ga0070669_100784311 | 3300005353 | Bacteria | 809 |
| 88 | Ga0070675_100001988 | 3300005354 | Bacteria | 15163 |
| 89 | Ga0070675_100003764 | 3300005354 | Bacteria | 11517 |
| 90 | Ga0070675_100433786 | 3300005354 | Bacteria | 1176 |
| 91 | Ga0070675_100486018 | 3300005354 | Bacteria | 1111 |
| 92 | Ga0070675_100762308 | 3300005354 | Unclassified | 883 |
| 93 | Ga0070671_100000543 | 3300005355 | Bacteria | 26642 |
| 94 | Ga0070671_100056470 | 3300005355 | Bacteria | 3266 |
| 95 | Ga0070671_100067512 | 3300005355 | Bacteria | 2982 |
| 96 | Ga0070671_100351237 | 3300005355 | Bacteria | 1258 |
| 97 | Ga0070674_100036363 | 3300005356 | Bacteria | 3305 |
| 98 | Ga0070674_100905329 | 3300005356 | Bacteria | 769 |
| 99 | Ga0070673_100005557 | 3300005364 | Bacteria | 8083 |
| 100 | Ga0070688_100000819 | 3300005365 | Bacteria | 15366 |
| 101 | Ga0070688_100002574 | 3300005365 | Bacteria | 9188 |
| 102 | Ga0070659_100000722 | 3300005366 | Bacteria | 23972 |
| 103 | Ga0070659_100247023 | 3300005366 | Bacteria | 1478 |
| 104 | Ga0070659_101568533 | 3300005366 | Unclassified | 587 |
| 105 | Ga0070709_10161812 | 3300005434 | Bacteria | 1557 |
| 106 | Ga0070713_100006824 | 3300005436 | Bacteria | 7955 |
| 107 | Ga0070713_100041905 | 3300005436 | Bacteria | 3733 |
| 108 | Ga0070701_10005063 | 3300005438 | Bacteria | 5411 |
| 109 | Ga0070701_10581168 | 3300005438 | Bacteria | 739 |
| 110 | Ga0070711_100154861 | 3300005439 | Bacteria | 1732 |
| 111 | Ga0070705_100014731 | 3300005440 | Bacteria | 4031 |
| 112 | Ga0070700_100476225 | 3300005441 | Bacteria | 955 |
| 113 | Ga0070700_100527537 | 3300005441 | Bacteria | 913 |
| 114 | Ga0070700_100948661 | 3300005441 | Bacteria | 704 |
| 115 | Ga0070694_100028547 | 3300005444 | Bacteria | 3632 |
| 116 | Ga0070694_100069896 | 3300005444 | Bacteria | 2416 |
| 117 | Ga0070708_100437186 | 3300005445 | Bacteria | 1234 |
| 118 | Ga0070708_100540870 | 3300005445 | Bacteria | 1099 |
| 119 | Ga0070708_101540465 | 3300005445 | Bacteria | 619 |
| 120 | Ga0070663_100126278 | 3300005455 | Bacteria | 1938 |
| 121 | Ga0070663_100239988 | 3300005455 | Bacteria | 1430 |
| 122 | Ga0070663_100241523 | 3300005455 | Bacteria | 1426 |
| 123 | Ga0070663_100310677 | 3300005455 | Bacteria | 1265 |
| 124 | Ga0070678_100001529 | 3300005456 | Bacteria | 12358 |
| 125 | Ga0070678_100006494 | 3300005456 | Bacteria | 6867 |
| 126 | Ga0070678_100050133 | 3300005456 | Bacteria | 3018 |
| 127 | Ga0070678_100260200 | 3300005456 | Bacteria | 1459 |
| 128 | Ga0070662_100007090 | 3300005457 | Bacteria | 7252 |
| 129 | Ga0070662_100009855 | 3300005457 | Bacteria | 6261 |
| 130 | Ga0070662_100011225 | 3300005457 | Bacteria | 5904 |
| 131 | Ga0070662_101093527 | 3300005457 | Bacteria | 684 |
| 132 | Ga0070662_101285701 | 3300005457 | Bacteria | 629 |
| 133 | Ga0070681_10104617 | 3300005458 | Bacteria | 2773 |
| 134 | Ga0070681_10175925 | 3300005458 | Bacteria | 2062 |
| 135 | Ga0068867_100007657 | 3300005459 | Bacteria | 7642 |
| 136 | Ga0068867_100007738 | 3300005459 | Bacteria | 7597 |
| 137 | Ga0068867_100022584 | 3300005459 | Bacteria | 4498 |
| 138 | Ga0068867_100205853 | 3300005459 | Bacteria | 1577 |
| 139 | Ga0068867_100318292 | 3300005459 | Bacteria | 1288 |
| 140 | Ga0070685_10354947 | 3300005466 | Bacteria | 1003 |
| 141 | Ga0070706_101704204 | 3300005467 | Bacteria | 574 |
| 142 | Ga0070706_102169828 | 3300005467 | Unclassified | 502 |
| 143 | Ga0070707_102249376 | 3300005468 | Bacteria | 513 |
| 144 | Ga0070698_100382235 | 3300005471 | Bacteria | 1341 |
| 145 | Ga0070698_101496825 | 3300005471 | Bacteria | 626 |
| 146 | Ga0070698_102205575 | 3300005471 | Bacteria | 504 |
| 147 | Ga0070699_100009392 | 3300005518 | Bacteria | 8473 |
| 148 | Ga0070699_100194651 | 3300005518 | Bacteria | 1802 |
| 149 | Ga0070699_100704599 | 3300005518 | Bacteria | 923 |
| 150 | Ga0070699_101406450 | 3300005518 | Bacteria | 640 |
| 151 | Ga0070699_102153019 | 3300005518 | Bacteria | 509 |
| 152 | Ga0070679_100023818 | 3300005530 | Bacteria | 5998 |
| 153 | Ga0070679_100929561 | 3300005530 | Bacteria | 813 |
| 154 | Ga0070697_100104369 | 3300005536 | Bacteria | 2357 |
| 155 | Ga0070697_102017291 | 3300005536 | Bacteria | 516 |
| 156 | Ga0068853_100785680 | 3300005539 | Bacteria | 911 |
| 157 | Ga0070672_100001939 | 3300005543 | Bacteria | 12991 |
| 158 | Ga0070672_100051268 | 3300005543 | Bacteria | 3217 |
| 159 | Ga0070672_100120261 | 3300005543 | Bacteria | 2149 |
| 160 | Ga0070672_101048781 | 3300005543 | Bacteria | 723 |
| 161 | Ga0070686_100510570 | 3300005544 | Bacteria | 934 |
| 162 | Ga0070695_100032437 | 3300005545 | Bacteria | 3265 |
| 163 | Ga0070695_100042415 | 3300005545 | Bacteria | 2888 |
| 164 | Ga0070696_100301698 | 3300005546 | Bacteria | 1227 |
| 165 | Ga0070696_100989906 | 3300005546 | Bacteria | 702 |
| 166 | Ga0070696_101388123 | 3300005546 | Bacteria | 599 |
| 167 | Ga0070693_100004136 | 3300005547 | Bacteria | 6839 |
| 168 | Ga0070693_100056167 | 3300005547 | Bacteria | 2271 |
| 169 | Ga0070693_100392534 | 3300005547 | Bacteria | 960 |
| 170 | Ga0070665_100005472 | 3300005548 | Bacteria | 13090 |
| 171 | Ga0070665_100038653 | 3300005548 | Bacteria | 4797 |
| 172 | Ga0070665_100479850 | 3300005548 | Bacteria | 1254 |
| 173 | Ga0070704_100236431 | 3300005549 | Bacteria | 1493 |
| 174 | Ga0070704_100256324 | 3300005549 | Bacteria | 1439 |
| 175 | Ga0070704_102061283 | 3300005549 | Bacteria | 530 |
| 176 | Ga0068855_100013790 | 3300005563 | Bacteria | 9743 |
| 177 | Ga0068855_100046572 | 3300005563 | Bacteria | 5125 |
| 178 | Ga0068855_101403691 | 3300005563 | Bacteria | 720 |
| 179 | Ga0070664_100005842 | 3300005564 | Bacteria | 9926 |
| 180 | Ga0070664_100006033 | 3300005564 | Bacteria | 9800 |
| 181 | Ga0070664_100018536 | 3300005564 | Bacteria | 5720 |
| 182 | Ga0070664_100283171 | 3300005564 | Unclassified | 1495 |
| 183 | Ga0068857_100000998 | 3300005577 | Bacteria | 21742 |
| 184 | Ga0068854_100001113 | 3300005578 | Bacteria | 16151 |
| 185 | Ga0068854_100001385 | 3300005578 | Bacteria | 14586 |
| 186 | Ga0068854_100024671 | 3300005578 | Bacteria | 4120 |
| 187 | Ga0068854_100049312 | 3300005578 | Bacteria | 3007 |
| 188 | Ga0068854_100108441 | 3300005578 | Bacteria | 2091 |
| 189 | Ga0068856_100085324 | 3300005614 | Bacteria | 3136 |
| 190 | Ga0068856_100595517 | 3300005614 | Bacteria | 1127 |
| 191 | Ga0068856_100637072 | 3300005614 | Bacteria | 1087 |
| 192 | Ga0068856_101662728 | 3300005614 | Bacteria | 651 |
| 193 | Ga0070702_100022630 | 3300005615 | Bacteria | 3327 |
| 194 | Ga0070702_100078612 | 3300005615 | Bacteria | 1969 |
| 195 | Ga0070702_100128052 | 3300005615 | Bacteria | 1599 |
| 196 | Ga0070702_100300407 | 3300005615 | Bacteria | 1110 |
| 197 | Ga0068852_100000272 | 3300005616 | Bacteria | 34507 |
| 198 | Ga0068852_100016620 | 3300005616 | Bacteria | 5747 |
| 199 | Ga0068852_100056945 | 3300005616 | Bacteria | 3381 |
| 200 | Ga0068852_100065603 | 3300005616 | Bacteria | 3168 |
| 201 | Ga0068852_100371510 | 3300005616 | Bacteria | 1401 |
| 202 | Ga0068852_101501235 | 3300005616 | Bacteria | 696 |
| 203 | Ga0068859_100010699 | 3300005617 | Bacteria | 9235 |
| 204 | Ga0068859_100183748 | 3300005617 | Bacteria | 2174 |
| 205 | Ga0068859_100226684 | 3300005617 | Bacteria | 1957 |
| 206 | Ga0068859_100245698 | 3300005617 | Bacteria | 1879 |
| 207 | Ga0068859_100264819 | 3300005617 | Bacteria | 1811 |
| 208 | Ga0068859_101172633 | 3300005617 | Bacteria | 846 |
| 209 | Ga0068859_102537814 | 3300005617 | Bacteria | 564 |
| 210 | Ga0068864_100004004 | 3300005618 | Bacteria | 12133 |
| 211 | Ga0068864_100005673 | 3300005618 | Bacteria | 10225 |
| 212 | Ga0068864_100031814 | 3300005618 | Bacteria | 4478 |
| 213 | Ga0068864_100111531 | 3300005618 | Bacteria | 2437 |
| 214 | Ga0068864_100832972 | 3300005618 | Bacteria | 908 |
| 215 | Ga0068866_10003214 | 3300005718 | Bacteria | 6738 |
| 216 | Ga0068866_10276973 | 3300005718 | Bacteria | 1038 |
| 217 | Ga0068866_10348817 | 3300005718 | Bacteria | 940 |
| 218 | Ga0068861_100004074 | 3300005719 | Bacteria | 9792 |
| 219 | Ga0068861_100095663 | 3300005719 | Bacteria | 2353 |
| 220 | Ga0068861_101156082 | 3300005719 | Bacteria | 746 |
| 221 | Ga0068851_10138531 | 3300005834 | Bacteria | 1322 |
| 222 | Ga0068851_10166654 | 3300005834 | Bacteria | 1213 |
| 223 | Ga0068851_10736139 | 3300005834 | Bacteria | 609 |
| 224 | Ga0068870_10011516 | 3300005840 | Bacteria | 4103 |
| 225 | Ga0068863_100001296 | 3300005841 | Bacteria | 24957 |
| 226 | Ga0068863_100003717 | 3300005841 | Bacteria | 15093 |
| 227 | Ga0068863_100232551 | 3300005841 | Bacteria | 1778 |
| 228 | Ga0068863_102601485 | 3300005841 | Bacteria | 515 |
| 229 | Ga0068858_100001929 | 3300005842 | Bacteria | 21132 |
| 230 | Ga0068858_100003142 | 3300005842 | Bacteria | 16534 |
| 231 | Ga0068858_100050925 | 3300005842 | Bacteria | 3832 |
| 232 | Ga0068858_100253137 | 3300005842 | Bacteria | 1673 |
| 233 | Ga0068858_102411885 | 3300005842 | Unclassified | 520 |
| 234 | Ga0068860_100018934 | 3300005843 | Bacteria | 6689 |
| 235 | Ga0068860_100019324 | 3300005843 | Bacteria | 6611 |
| 236 | Ga0068860_100174934 | 3300005843 | Bacteria | 2075 |
| 237 | Ga0068860_100290307 | 3300005843 | Bacteria | 1600 |
| 238 | Ga0068860_100667199 | 3300005843 | Bacteria | 1048 |
| 239 | Ga0068860_102335131 | 3300005843 | Bacteria | 555 |
| 240 | Ga0068862_100029895 | 3300005844 | Bacteria | 4590 |
| 241 | Ga0068862_100046498 | 3300005844 | Bacteria | 3703 |
| 242 | Ga0068862_100084369 | 3300005844 | Bacteria | 2760 |
| 243 | Ga0068862_102078417 | 3300005844 | Bacteria | 579 |
| 244 | Ga0070715_10001133 | 3300006163 | Bacteria | 7603 |
| 245 | Ga0070716_100014562 | 3300006173 | Bacteria | 4029 |
| 246 | Ga0070712_100032192 | 3300006175 | Bacteria | 3538 |
| 247 | Ga0070712_100075658 | 3300006175 | Bacteria | 2422 |
| 248 | Ga0075366_10014288 | 3300006195 | Bacteria | 4535 |
| 249 | Ga0075366_10376175 | 3300006195 | Bacteria | 873 |
| 250 | Ga0097621_100001769 | 3300006237 | Bacteria | 14833 |
| 251 | Ga0097621_100056483 | 3300006237 | Bacteria | 3207 |
| 252 | Ga0097621_100100725 | 3300006237 | Bacteria | 2430 |
| 253 | Ga0097621_100229527 | 3300006237 | Bacteria | 1620 |
| 254 | Ga0068871_100002631 | 3300006358 | Bacteria | 12259 |
| 255 | Ga0068871_100069402 | 3300006358 | Bacteria | 2894 |
| 256 | Ga0068871_100196195 | 3300006358 | Unclassified | 1741 |
| 257 | Ga0068871_100268418 | 3300006358 | Bacteria | 1490 |
| 258 | Ga0068871_100454587 | 3300006358 | Bacteria | 1148 |
| 259 | Ga0068871_100530586 | 3300006358 | Unclassified | 1064 |
| 260 | Ga0068871_101548022 | 3300006358 | Bacteria | 627 |
| 261 | Ga0075428_100009741 | 3300006844 | Bacteria | 10674 |
| 262 | Ga0075428_100259490 | 3300006844 | Bacteria | 1871 |
| 263 | Ga0075428_101502615 | 3300006844 | Bacteria | 706 |
| 264 | Ga0075430_100010623 | 3300006846 | Bacteria | 7800 |
| 265 | Ga0075430_100025571 | 3300006846 | Bacteria | 5024 |
| 266 | Ga0075430_100217121 | 3300006846 | Bacteria | 1587 |
| 267 | Ga0075430_100288860 | 3300006846 | Bacteria | 1357 |
| 268 | Ga0075430_100572120 | 3300006846 | Bacteria | 932 |
| 269 | Ga0075431_100041310 | 3300006847 | Bacteria | 4754 |
| 270 | Ga0075431_100225523 | 3300006847 | Bacteria | 1911 |
| 271 | Ga0075431_100424651 | 3300006847 | Bacteria | 1328 |
| 272 | Ga0075431_100458378 | 3300006847 | Bacteria | 1270 |
| 273 | Ga0075431_101774046 | 3300006847 | Bacteria | 573 |
| 274 | Ga0075433_10073283 | 3300006852 | Bacteria | 3011 |
| 275 | Ga0075433_10155677 | 3300006852 | Bacteria | 2033 |
| 276 | Ga0075433_10169033 | 3300006852 | Bacteria | 1946 |
| 277 | Ga0075433_10870778 | 3300006852 | Bacteria | 786 |
| 278 | Ga0075433_11166425 | 3300006852 | Bacteria | 669 |
| 279 | Ga0075433_11295840 | 3300006852 | Bacteria | 631 |
| 280 | Ga0075434_100007123 | 3300006871 | Bacteria | 10331 |
| 281 | Ga0075434_100052497 | 3300006871 | Bacteria | 4051 |
| 282 | Ga0075434_100059235 | 3300006871 | Bacteria | 3807 |
| 283 | Ga0075434_100167976 | 3300006871 | Bacteria | 2214 |
| 284 | Ga0075434_100954050 | 3300006871 | Viruses | 872 |
| 285 | Ga0075429_100016031 | 3300006880 | Bacteria | 6491 |
| 286 | Ga0075429_100587891 | 3300006880 | Bacteria | 975 |
| 287 | Ga0075429_101909447 | 3300006880 | Bacteria | 514 |
| 288 | Ga0068865_100033606 | 3300006881 | Bacteria | 3435 |
| 289 | Ga0068865_100073421 | 3300006881 | Bacteria | 2433 |
| 290 | Ga0075436_100109694 | 3300006914 | Unclassified | 1925 |
| 291 | Ga0075436_100214013 | 3300006914 | Bacteria | 1367 |
| 292 | Ga0075436_100835162 | 3300006914 | Bacteria | 687 |
| 293 | Ga0097620_100010699 | 3300006931 | Bacteria | 9235 |
| 294 | Ga0097620_100183747 | 3300006931 | Bacteria | 2174 |
| 295 | Ga0097620_100226690 | 3300006931 | Bacteria | 1957 |
| 296 | Ga0097620_100245694 | 3300006931 | Bacteria | 1879 |
| 297 | Ga0097620_100264804 | 3300006931 | Bacteria | 1811 |
| 298 | Ga0097620_101172505 | 3300006931 | Bacteria | 846 |
| 299 | Ga0097620_102537449 | 3300006931 | Bacteria | 564 |
| 300 | Ga0075435_100007891 | 3300007076 | Bacteria | 7617 |
| 301 | Ga0075435_100023266 | 3300007076 | Bacteria | 4789 |
| 302 | Ga0075435_100054962 | 3300007076 | Bacteria | 3214 |
| 303 | Ga0075435_100115820 | 3300007076 | Bacteria | 2232 |
| 304 | Ga0075435_100124764 | 3300007076 | Bacteria | 2151 |
| 305 | Ga0105240_10000359 | 3300009093 | Bacteria | 85874 |
| 306 | Ga0105240_10023357 | 3300009093 | Bacteria | 8180 |
| 307 | Ga0105240_10038461 | 3300009093 | Bacteria | 6137 |
| 308 | Ga0105240_10113171 | 3300009093 | Bacteria | 3279 |
| 309 | Ga0111539_10007338 | 3300009094 | Bacteria | 14118 |
| 310 | Ga0111539_10042479 | 3300009094 | Bacteria | 5459 |
| 311 | Ga0111539_10104577 | 3300009094 | Bacteria | 3322 |
| 312 | Ga0111539_10117917 | 3300009094 | Bacteria | 3111 |
| 313 | Ga0111539_10278365 | 3300009094 | Bacteria | 1947 |
| 314 | Ga0111539_11755420 | 3300009094 | Bacteria | 720 |
| 315 | Ga0111539_12845391 | 3300009094 | Bacteria | 560 |
| 316 | Ga0105245_10016068 | 3300009098 | Bacteria | 6521 |
| 317 | Ga0105245_10017096 | 3300009098 | Bacteria | 6330 |
| 318 | Ga0105245_10087047 | 3300009098 | Bacteria | 2867 |
| 319 | Ga0105245_10381573 | 3300009098 | Bacteria | 1403 |
| 320 | Ga0105245_10483212 | 3300009098 | Bacteria | 1252 |
| 321 | Ga0105247_10018198 | 3300009101 | Bacteria | 4214 |
| 322 | Ga0105247_10209005 | 3300009101 | Bacteria | 1315 |
| 323 | Ga0114129_10047118 | 3300009147 | Bacteria | 6058 |
| 324 | Ga0114129_10692500 | 3300009147 | Bacteria | 1311 |
| 325 | Ga0114129_10899346 | 3300009147 | Bacteria | 1122 |
| 326 | Ga0114129_11505430 | 3300009147 | Bacteria | 827 |
| 327 | Ga0105243_10072940 | 3300009148 | Bacteria | 2780 |
| 328 | Ga0105243_10077148 | 3300009148 | Bacteria | 2709 |
| 329 | Ga0105241_10003177 | 3300009174 | Bacteria | 12227 |
| 330 | Ga0105241_10038649 | 3300009174 | Bacteria | 3598 |
| 331 | Ga0105241_10183206 | 3300009174 | Bacteria | 1739 |
| 332 | Ga0105241_10427894 | 3300009174 | Unclassified | 1166 |
| 333 | Ga0105241_10439423 | 3300009174 | Bacteria | 1152 |
| 334 | Ga0105241_10834505 | 3300009174 | Bacteria | 851 |
| 335 | Ga0105242_10002472 | 3300009176 | Bacteria | 14501 |
| 336 | Ga0105248_10005132 | 3300009177 | Bacteria | 14449 |
| 337 | Ga0105248_10071443 | 3300009177 | Bacteria | 3899 |
| 338 | Ga0105248_10211174 | 3300009177 | Bacteria | 2187 |
| 339 | Ga0105248_10347752 | 3300009177 | Bacteria | 1669 |
| 340 | Ga0105248_11106372 | 3300009177 | Bacteria | 896 |
| 341 | Ga0105237_10000352 | 3300009545 | Bacteria | 64865 |
| 342 | Ga0105237_10024750 | 3300009545 | Bacteria | 6141 |
| 343 | Ga0105237_10047645 | 3300009545 | Bacteria | 4308 |
| 344 | Ga0105237_10071260 | 3300009545 | Bacteria | 3470 |
| 345 | Ga0105238_10001859 | 3300009551 | Bacteria | 21155 |
| 346 | Ga0105238_10146513 | 3300009551 | Bacteria | 2338 |
| 347 | Ga0105238_10343386 | 3300009551 | Bacteria | 1481 |
| 348 | Ga0105238_11546371 | 3300009551 | Bacteria | 693 |
| 349 | Ga0105249_10002479 | 3300009553 | Bacteria | 15985 |
| 350 | Ga0105249_10022793 | 3300009553 | Bacteria | 5613 |
| 351 | Ga0105249_10115152 | 3300009553 | Bacteria | 2547 |
| 352 | Ga0105239_10051215 | 3300010375 | Bacteria | 4526 |
| 353 | Ga0105239_10185391 | 3300010375 | Bacteria | 2329 |
| 354 | Ga0105239_10238872 | 3300010375 | Bacteria | 2039 |
| 355 | Ga0105239_10425075 | 3300010375 | Bacteria | 1505 |
| 356 | Ga0105239_10544030 | 3300010375 | Unclassified | 1322 |
| 357 | Ga0105239_12540532 | 3300010375 | Bacteria | 597 |
| 358 | Ga0105246_10069060 | 3300011119 | Bacteria | 2480 |
| 359 | Ga0105246_10176664 | 3300011119 | Bacteria | 1640 |
| 360 | Ga0105246_10316165 | 3300011119 | Unclassified | 1267 |
| 361 | Ga0105246_10585939 | 3300011119 | Bacteria | 961 |
| 362 | Ga0157314_1000067 | 3300012500 | Bacteria | 10972 |
| 363 | Ga0157373_10424097 | 3300013100 | Bacteria | 955 |
| 364 | Ga0157371_10204115 | 3300013102 | Bacteria | 1418 |
| 365 | Ga0157371_10347447 | 3300013102 | Bacteria | 1079 |
| 366 | Ga0157371_11281468 | 3300013102 | Bacteria | 567 |
| 367 | Ga0157370_10918498 | 3300013104 | Bacteria | 794 |
| 368 | Ga0157369_10077917 | 3300013105 | Bacteria | 3552 |
| 369 | Ga0157369_10107353 | 3300013105 | Bacteria | 2970 |
| 370 | Ga0157369_10310311 | 3300013105 | Bacteria | 1640 |
| 371 | Ga0157369_11836721 | 3300013105 | Bacteria | 615 |
| 372 | Ga0157374_10001826 | 3300013296 | Bacteria | 17955 |
| 373 | Ga0157374_10092035 | 3300013296 | Bacteria | 2892 |
| 374 | Ga0157374_10269036 | 3300013296 | Bacteria | 1680 |
| 375 | Ga0157378_10004007 | 3300013297 | Bacteria | 13016 |
| 376 | Ga0157378_10004796 | 3300013297 | Bacteria | 11852 |
| 377 | Ga0157378_10071616 | 3300013297 | Bacteria | 3113 |
| 378 | Ga0163162_10001742 | 3300013306 | Bacteria | 20414 |
| 379 | Ga0163162_10037794 | 3300013306 | Bacteria | 4819 |
| 380 | Ga0163162_10205427 | 3300013306 | Bacteria | 2099 |
| 381 | Ga0163162_10205439 | 3300013306 | Bacteria | 2099 |
| 382 | Ga0163162_10910649 | 3300013306 | Bacteria | 992 |
| 383 | Ga0163162_12146541 | 3300013306 | Bacteria | 641 |
| 384 | Ga0157372_10010513 | 3300013307 | Bacteria | 9851 |
| 385 | Ga0157372_10171724 | 3300013307 | Bacteria | 2508 |
| 386 | Ga0157372_10269587 | 3300013307 | Bacteria | 1978 |
| 387 | Ga0157372_11586917 | 3300013307 | Bacteria | 753 |
| 388 | Ga0157372_11622152 | 3300013307 | Bacteria | 744 |
| 389 | Ga0157375_10044913 | 3300013308 | Bacteria | 4298 |
| 390 | Ga0157375_10067542 | 3300013308 | Bacteria | 3573 |
| 391 | Ga0157375_10296097 | 3300013308 | Bacteria | 1781 |
| 392 | Ga0157375_10356914 | 3300013308 | Bacteria | 1628 |
| 393 | Ga0157375_11712547 | 3300013308 | Bacteria | 744 |
| 394 | Ga0157375_12167900 | 3300013308 | Bacteria | 662 |
| 395 | Ga0163163_10597959 | 3300014325 | Bacteria | 1166 |
| 396 | Ga0163163_10911200 | 3300014325 | Bacteria | 942 |
| 397 | Ga0163163_11191680 | 3300014325 | Unclassified | 824 |
| 398 | Ga0157377_10003883 | 3300014745 | Bacteria | 6810 |
| 399 | Ga0157377_10018007 | 3300014745 | Bacteria | 3665 |
| 400 | Ga0157377_11628062 | 3300014745 | Bacteria | 518 |
| 401 | Ga0157379_10068889 | 3300014968 | Bacteria | 3163 |
| 402 | Ga0157379_10245222 | 3300014968 | Bacteria | 1625 |
| 403 | Ga0157379_10849457 | 3300014968 | Bacteria | 864 |
| 404 | Ga0157376_10002651 | 3300014969 | Bacteria | 12174 |
| 405 | Ga0157376_10146509 | 3300014969 | Bacteria | 2124 |
| 406 | Ga0157376_10498383 | 3300014969 | Bacteria | 1196 |
| 407 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 408 | Ga0163161_11208459 | 3300017792 | Unclassified | 654 |
| 409 | Ga0163161_11254709 | 3300017792 | Bacteria | 643 |
| 410 | Ga0213873_10092600 | 3300021358 | Bacteria | 860 |
| 411 | Ga0213876_10173977 | 3300021384 | Bacteria | 1146 |
| 412 | Ga0213876_10370952 | 3300021384 | Bacteria | 761 |
| 413 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 414 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 415 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 416 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 417 | Ga0209258_101488 | 3300025242 | Bacteria | 8042 |
| 418 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 419 | Ga0209129_1009423 | 3300025258 | Bacteria | 2575 |
| 420 | Ga0209233_1001457 | 3300025261 | Bacteria | 9336 |
| 421 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 422 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 423 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 424 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 425 | Ga0209675_1032146 | 3300025291 | Bacteria | 1231 |
| 426 | Ga0209676_1037045 | 3300025292 | Bacteria | 1412 |
| 427 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 428 | Ga0209758_1000812 | 3300025297 | Bacteria | 43987 |
| 429 | Ga0209758_1024429 | 3300025297 | Bacteria | 2693 |
| 430 | Ga0209050_1004472 | 3300025298 | Bacteria | 9413 |
| 431 | Ga0209256_1000112 | 3300025299 | Bacteria | 178432 |
| 432 | Ga0207426_1149889 | 3300025302 | Bacteria | 545 |
| 433 | Ga0209051_1070245 | 3300025303 | Bacteria | 1057 |
| 434 | Ga0209257_1105659 | 3300025304 | Bacteria | 679 |
| 435 | Ga0207697_10045371 | 3300025315 | Bacteria | 1809 |
| 436 | Ga0207656_10016793 | 3300025321 | Bacteria | 2855 |
| 437 | Ga0207656_10120084 | 3300025321 | Bacteria | 1223 |
| 438 | Ga0207656_10325483 | 3300025321 | Bacteria | 764 |
| 439 | Ga0207692_10067923 | 3300025898 | Bacteria | 1867 |
| 440 | Ga0207642_10009036 | 3300025899 | Bacteria | 3449 |
| 441 | Ga0207642_10128445 | 3300025899 | Bacteria | 1319 |
| 442 | Ga0207642_10313475 | 3300025899 | Bacteria | 914 |
| 443 | Ga0207710_10144557 | 3300025900 | Unclassified | 1150 |
| 444 | Ga0207688_10014280 | 3300025901 | Bacteria | 4321 |
| 445 | Ga0207680_10010109 | 3300025903 | Bacteria | 4709 |
| 446 | Ga0207680_10261134 | 3300025903 | Bacteria | 1199 |
| 447 | Ga0207680_10416712 | 3300025903 | Bacteria | 951 |
| 448 | Ga0207647_10000066 | 3300025904 | Bacteria | 81782 |
| 449 | Ga0207647_10002628 | 3300025904 | Bacteria | 13590 |
| 450 | Ga0207647_10032756 | 3300025904 | Bacteria | 3334 |
| 451 | Ga0207647_10665441 | 3300025904 | Bacteria | 570 |
| 452 | Ga0207685_10057933 | 3300025905 | Bacteria | 1522 |
| 453 | Ga0207699_10143414 | 3300025906 | Bacteria | 1572 |
| 454 | Ga0207645_10135695 | 3300025907 | Bacteria | 1602 |
| 455 | Ga0207645_10793937 | 3300025907 | Bacteria | 644 |
| 456 | Ga0207645_11100688 | 3300025907 | Bacteria | 536 |
| 457 | Ga0207643_10098595 | 3300025908 | Bacteria | 1711 |
| 458 | Ga0207643_10405908 | 3300025908 | Bacteria | 862 |
| 459 | Ga0207705_10121180 | 3300025909 | Bacteria | 1941 |
| 460 | Ga0207705_10441365 | 3300025909 | Bacteria | 1009 |
| 461 | Ga0207654_10020051 | 3300025911 | Bacteria | 3538 |
| 462 | Ga0207654_10072548 | 3300025911 | Bacteria | 2050 |
| 463 | Ga0207654_10173309 | 3300025911 | Bacteria | 1402 |
| 464 | Ga0207654_10416425 | 3300025911 | Unclassified | 937 |
| 465 | Ga0207654_10498138 | 3300025911 | Unclassified | 860 |
| 466 | Ga0207707_10039511 | 3300025912 | Bacteria | 4124 |
| 467 | Ga0207707_10154075 | 3300025912 | Bacteria | 2009 |
| 468 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 469 | Ga0207695_10003135 | 3300025913 | Bacteria | 23618 |
| 470 | Ga0207695_10042600 | 3300025913 | Bacteria | 4845 |
| 471 | Ga0207695_10080322 | 3300025913 | Bacteria | 3303 |
| 472 | Ga0207695_10113233 | 3300025913 | Bacteria | 2690 |
| 473 | Ga0207671_10000021 | 3300025914 | Bacteria | 300409 |
| 474 | Ga0207671_10021309 | 3300025914 | Bacteria | 4918 |
| 475 | Ga0207671_10054020 | 3300025914 | Bacteria | 2977 |
| 476 | Ga0207671_10138304 | 3300025914 | Bacteria | 1874 |
| 477 | Ga0207693_10002141 | 3300025915 | Bacteria | 17224 |
| 478 | Ga0207663_10010953 | 3300025916 | Bacteria | 4846 |
| 479 | Ga0207663_10233619 | 3300025916 | Bacteria | 1345 |
| 480 | Ga0207660_10171876 | 3300025917 | Bacteria | 1678 |
| 481 | Ga0207662_10005004 | 3300025918 | Bacteria | 7017 |
| 482 | Ga0207662_10090177 | 3300025918 | Bacteria | 1884 |
| 483 | Ga0207649_10002856 | 3300025920 | Bacteria | 9533 |
| 484 | Ga0207649_10026219 | 3300025920 | Bacteria | 3407 |
| 485 | Ga0207649_10031191 | 3300025920 | Bacteria | 3166 |
| 486 | Ga0207652_10408876 | 3300025921 | Bacteria | 1224 |
| 487 | Ga0207652_10827822 | 3300025921 | Bacteria | 821 |
| 488 | Ga0207681_10005638 | 3300025923 | Bacteria | 7684 |
| 489 | Ga0207681_10382072 | 3300025923 | Bacteria | 1134 |
| 490 | Ga0207681_10778103 | 3300025923 | Bacteria | 799 |
| 491 | Ga0207694_10001117 | 3300025924 | Bacteria | 23231 |
| 492 | Ga0207694_10007223 | 3300025924 | Bacteria | 8433 |
| 493 | Ga0207694_10207344 | 3300025924 | Bacteria | 1596 |
| 494 | Ga0207650_10001147 | 3300025925 | Bacteria | 19462 |
| 495 | Ga0207650_10025553 | 3300025925 | Bacteria | 4208 |
| 496 | Ga0207650_10154662 | 3300025925 | Bacteria | 1813 |
| 497 | Ga0207650_10192856 | 3300025925 | Bacteria | 1628 |
| 498 | Ga0207650_10531716 | 3300025925 | Bacteria | 984 |
| 499 | Ga0207659_10000565 | 3300025926 | Bacteria | 22267 |
| 500 | Ga0207659_10212343 | 3300025926 | Bacteria | 1552 |
| 501 | Ga0207659_10387341 | 3300025926 | Bacteria | 1167 |
| 502 | Ga0207659_10859443 | 3300025926 | Unclassified | 780 |
| 503 | Ga0207659_11152020 | 3300025926 | Bacteria | 667 |
| 504 | Ga0207687_10000151 | 3300025927 | Bacteria | 46396 |
| 505 | Ga0207687_10036212 | 3300025927 | Bacteria | 3361 |
| 506 | Ga0207687_10220705 | 3300025927 | Bacteria | 1492 |
| 507 | Ga0207687_10273517 | 3300025927 | Bacteria | 1351 |
| 508 | Ga0207687_10274065 | 3300025927 | Bacteria | 1350 |
| 509 | Ga0207700_10132492 | 3300025928 | Bacteria | 2037 |
| 510 | Ga0207664_10591853 | 3300025929 | Unclassified | 996 |
| 511 | Ga0207664_11550136 | 3300025929 | Bacteria | 584 |
| 512 | Ga0207644_10001345 | 3300025931 | Bacteria | 15805 |
| 513 | Ga0207644_10018240 | 3300025931 | Bacteria | 4745 |
| 514 | Ga0207644_10039873 | 3300025931 | Bacteria | 3317 |
| 515 | Ga0207644_10377148 | 3300025931 | Bacteria | 1156 |
| 516 | Ga0207690_10017826 | 3300025932 | Bacteria | 4345 |
| 517 | Ga0207690_10294947 | 3300025932 | Bacteria | 1267 |
| 518 | Ga0207690_10407710 | 3300025932 | Bacteria | 1085 |
| 519 | Ga0207690_11417620 | 3300025932 | Bacteria | 581 |
| 520 | Ga0207690_11729732 | 3300025932 | Unclassified | 522 |
| 521 | Ga0207706_10006270 | 3300025933 | Bacteria | 11052 |
| 522 | Ga0207706_10010590 | 3300025933 | Bacteria | 8421 |
| 523 | Ga0207706_10013626 | 3300025933 | Bacteria | 7384 |
| 524 | Ga0207706_10027587 | 3300025933 | Bacteria | 5076 |
| 525 | Ga0207706_10037955 | 3300025933 | Bacteria | 4275 |
| 526 | Ga0207706_11325158 | 3300025933 | Unclassified | 594 |
| 527 | Ga0207686_10003571 | 3300025934 | Bacteria | 8345 |
| 528 | Ga0207686_10004666 | 3300025934 | Bacteria | 7343 |
| 529 | Ga0207686_10584076 | 3300025934 | Bacteria | 877 |
| 530 | Ga0207670_10017900 | 3300025936 | Bacteria | 4293 |
| 531 | Ga0207670_10188726 | 3300025936 | Bacteria | 1558 |
| 532 | Ga0207670_11470805 | 3300025936 | Bacteria | 579 |
| 533 | Ga0207669_10025492 | 3300025937 | Bacteria | 3198 |
| 534 | Ga0207704_10146095 | 3300025938 | Bacteria | 1661 |
| 535 | Ga0207704_10489492 | 3300025938 | Bacteria | 989 |
| 536 | Ga0207665_10035866 | 3300025939 | Bacteria | 3294 |
| 537 | Ga0207691_10001567 | 3300025940 | Bacteria | 22708 |
| 538 | Ga0207691_10046431 | 3300025940 | Bacteria | 3991 |
| 539 | Ga0207691_10048350 | 3300025940 | Bacteria | 3901 |
| 540 | Ga0207691_10886565 | 3300025940 | Bacteria | 747 |
| 541 | Ga0207711_10010889 | 3300025941 | Bacteria | 7559 |
| 542 | Ga0207711_10032060 | 3300025941 | Bacteria | 4441 |
| 543 | Ga0207711_10149157 | 3300025941 | Bacteria | 2109 |
| 544 | Ga0207711_10572967 | 3300025941 | Bacteria | 1053 |
| 545 | Ga0207711_10864028 | 3300025941 | Bacteria | 841 |
| 546 | Ga0207711_11657522 | 3300025941 | Bacteria | 583 |
| 547 | Ga0207689_10074927 | 3300025942 | Bacteria | 2781 |
| 548 | Ga0207689_10081879 | 3300025942 | Bacteria | 2654 |
| 549 | Ga0207689_10119161 | 3300025942 | Bacteria | 2171 |
| 550 | Ga0207689_10125012 | 3300025942 | Bacteria | 2116 |
| 551 | Ga0207689_10132403 | 3300025942 | Bacteria | 2052 |
| 552 | Ga0207661_10006434 | 3300025944 | Bacteria | 8306 |
| 553 | Ga0207661_10879566 | 3300025944 | Bacteria | 825 |
| 554 | Ga0207661_11217067 | 3300025944 | Unclassified | 693 |
| 555 | Ga0207679_10000325 | 3300025945 | Bacteria | 35612 |
| 556 | Ga0207679_10000882 | 3300025945 | Bacteria | 19152 |
| 557 | Ga0207679_10001337 | 3300025945 | Bacteria | 15592 |
| 558 | Ga0207679_10268198 | 3300025945 | Unclassified | 1459 |
| 559 | Ga0207667_10000737 | 3300025949 | Bacteria | 42563 |
| 560 | Ga0207667_10002458 | 3300025949 | Bacteria | 23165 |
| 561 | Ga0207667_11874370 | 3300025949 | Unclassified | 562 |
| 562 | Ga0207651_10009071 | 3300025960 | Bacteria | 5414 |
| 563 | Ga0207651_10031488 | 3300025960 | Bacteria | 3391 |
| 564 | Ga0207651_10158054 | 3300025960 | Bacteria | 1773 |
| 565 | Ga0207712_10000522 | 3300025961 | Bacteria | 31532 |
| 566 | Ga0207712_10005594 | 3300025961 | Bacteria | 7921 |
| 567 | Ga0207668_10272782 | 3300025972 | Bacteria | 1383 |
| 568 | Ga0207668_10944947 | 3300025972 | Bacteria | 769 |
| 569 | Ga0207640_10000095 | 3300025981 | Bacteria | 69753 |
| 570 | Ga0207640_10003159 | 3300025981 | Bacteria | 8866 |
| 571 | Ga0207640_10014742 | 3300025981 | Bacteria | 4507 |
| 572 | Ga0207640_10019570 | 3300025981 | Bacteria | 4003 |
| 573 | Ga0207640_10267681 | 3300025981 | Bacteria | 1335 |
| 574 | Ga0207658_10033457 | 3300025986 | Bacteria | 3667 |
| 575 | Ga0207658_10151570 | 3300025986 | Bacteria | 1889 |
| 576 | Ga0207677_10000593 | 3300026023 | Bacteria | 22456 |
| 577 | Ga0207677_10000724 | 3300026023 | Bacteria | 19329 |
| 578 | Ga0207677_10092834 | 3300026023 | Bacteria | 2199 |
| 579 | Ga0207677_10450732 | 3300026023 | Bacteria | 1102 |
| 580 | Ga0207677_10864923 | 3300026023 | Bacteria | 813 |
| 581 | Ga0207703_10013607 | 3300026035 | Bacteria | 6341 |
| 582 | Ga0207703_10018778 | 3300026035 | Bacteria | 5399 |
| 583 | Ga0207703_10089421 | 3300026035 | Bacteria | 2586 |
| 584 | Ga0207703_10457604 | 3300026035 | Bacteria | 1193 |
| 585 | Ga0207639_10000733 | 3300026041 | Bacteria | 22410 |
| 586 | Ga0207678_10000577 | 3300026067 | Bacteria | 33572 |
| 587 | Ga0207678_10111625 | 3300026067 | Bacteria | 2332 |
| 588 | Ga0207678_10145805 | 3300026067 | Bacteria | 2020 |
| 589 | Ga0207678_10146311 | 3300026067 | Bacteria | 2017 |
| 590 | Ga0207678_10272628 | 3300026067 | Bacteria | 1451 |
| 591 | Ga0207708_10082602 | 3300026075 | Bacteria | 2470 |
| 592 | Ga0207708_10551622 | 3300026075 | Bacteria | 972 |
| 593 | Ga0207702_10121946 | 3300026078 | Bacteria | 2334 |
| 594 | Ga0207702_10624867 | 3300026078 | Bacteria | 1058 |
| 595 | Ga0207641_10206474 | 3300026088 | Bacteria | 1814 |
| 596 | Ga0207641_10247050 | 3300026088 | Bacteria | 1665 |
| 597 | Ga0207641_10708959 | 3300026088 | Bacteria | 991 |
| 598 | Ga0207648_10007978 | 3300026089 | Bacteria | 10327 |
| 599 | Ga0207648_10012363 | 3300026089 | Bacteria | 7991 |
| 600 | Ga0207648_10081329 | 3300026089 | Bacteria | 2826 |
| 601 | Ga0207648_10346373 | 3300026089 | Bacteria | 1339 |
| 602 | Ga0207648_11047408 | 3300026089 | Bacteria | 764 |
| 603 | Ga0207648_11230574 | 3300026089 | Bacteria | 703 |
| 604 | Ga0207676_10003284 | 3300026095 | Bacteria | 11495 |
| 605 | Ga0207676_10007085 | 3300026095 | Bacteria | 7949 |
| 606 | Ga0207676_10052999 | 3300026095 | Bacteria | 3174 |
| 607 | Ga0207676_10429802 | 3300026095 | Bacteria | 1240 |
| 608 | Ga0207676_11097675 | 3300026095 | Bacteria | 786 |
| 609 | Ga0207674_10002447 | 3300026116 | Bacteria | 23450 |
| 610 | Ga0207674_10124212 | 3300026116 | Bacteria | 2547 |
| 611 | Ga0207674_10155679 | 3300026116 | Bacteria | 2241 |
| 612 | Ga0207675_100000354 | 3300026118 | Bacteria | 43858 |
| 613 | Ga0207675_100015382 | 3300026118 | Bacteria | 7136 |
| 614 | Ga0207675_100515472 | 3300026118 | Bacteria | 1192 |
| 615 | Ga0207675_100685933 | 3300026118 | Bacteria | 1032 |
| 616 | Ga0207675_102703056 | 3300026118 | Bacteria | 505 |
| 617 | Ga0207683_10000739 | 3300026121 | Bacteria | 29731 |
| 618 | Ga0207683_10001084 | 3300026121 | Bacteria | 24821 |
| 619 | Ga0207683_10449975 | 3300026121 | Bacteria | 1187 |
| 620 | Ga0207683_10475871 | 3300026121 | Bacteria | 1152 |
| 621 | Ga0207683_10697643 | 3300026121 | Bacteria | 941 |
| 622 | Ga0207698_10000375 | 3300026142 | Bacteria | 26073 |
| 623 | Ga0207698_10405676 | 3300026142 | Bacteria | 1304 |
| 624 | Ga0207698_10859865 | 3300026142 | Bacteria | 912 |
| 625 | Ga0207698_10891252 | 3300026142 | Bacteria | 896 |
| 626 | Ga0207698_10992343 | 3300026142 | Unclassified | 850 |
| 627 | Ga0207698_11233694 | 3300026142 | Bacteria | 762 |
| 628 | Ga0207428_10059015 | 3300027907 | Bacteria | 3043 |
| 629 | Ga0207428_10608199 | 3300027907 | Bacteria | 787 |
| 630 | Ga0268266_10015750 | 3300028379 | Bacteria | 6475 |
| 631 | Ga0268266_10420697 | 3300028379 | Bacteria | 1266 |
| 632 | Ga0268266_10433629 | 3300028379 | Bacteria | 1247 |
| 633 | Ga0268266_11560065 | 3300028379 | Bacteria | 636 |
| 634 | Ga0268265_10001830 | 3300028380 | Bacteria | 16975 |
| 635 | Ga0268265_10030100 | 3300028380 | Bacteria | 3905 |
| 636 | Ga0268265_10222728 | 3300028380 | Bacteria | 1652 |
| 637 | Ga0268264_10001344 | 3300028381 | Bacteria | 23085 |
| 638 | Ga0268264_10189775 | 3300028381 | Bacteria | 1872 |
| 639 | Ga0268264_10532258 | 3300028381 | Bacteria | 1150 |
| 640 | Ga0268264_10909345 | 3300028381 | Bacteria | 884 |
| 641 | Ga0268264_11489424 | 3300028381 | Bacteria | 687 |
| 642 | Ga0265318_10124756 | 3300028577 | Bacteria | 947 |
| 643 | Ga0265324_10054369 | 3300029957 | Bacteria | 1374 |
| 644 | Ga0316177_1136856 | 3300030731 | Bacteria | 1708 |
| 645 | Ga0316180_1120196 | 3300030736 | Bacteria | 2312 |
| 646 | Ga0316183_1091464 | 3300030742 | Bacteria | 2030 |
| 647 | Ga0316182_1072389 | 3300030745 | Bacteria | 1059 |
| 648 | Ga0265325_10023630 | 3300031241 | Bacteria | 3352 |
| 649 | Ga0265329_10110809 | 3300031242 | Bacteria | 877 |
| 650 | Ga0265339_10000995 | 3300031249 | Bacteria | 21726 |
| 651 | Ga0265339_10213815 | 3300031249 | Bacteria | 946 |
| 652 | Ga0265316_10001965 | 3300031344 | Bacteria | 21613 |
| 653 | Ga0307513_10000013 | 3300031456 | Bacteria | 325682 |
| 654 | Ga0307513_10091189 | 3300031456 | Bacteria | 3106 |
| 655 | Ga0307408_100038091 | 3300031548 | Bacteria | 3390 |
| 656 | Ga0307408_100684045 | 3300031548 | Bacteria | 920 |
| 657 | Ga0265314_10000011 | 3300031711 | Bacteria | 445050 |
| 658 | Ga0307516_10414595 | 3300031730 | Bacteria | 1005 |
| 659 | Ga0307405_10003810 | 3300031731 | Bacteria | 7012 |
| 660 | Ga0307413_10111755 | 3300031824 | Bacteria | 1830 |
| 661 | Ga0307413_10534828 | 3300031824 | Bacteria | 948 |
| 662 | Ga0307413_10750307 | 3300031824 | Bacteria | 816 |
| 663 | Ga0307413_11140838 | 3300031824 | Bacteria | 675 |
| 664 | Ga0307413_11161138 | 3300031824 | Bacteria | 670 |
| 665 | Ga0307410_10003663 | 3300031852 | Bacteria | 7760 |
| 666 | Ga0307410_10213049 | 3300031852 | Bacteria | 1481 |
| 667 | Ga0307410_10814665 | 3300031852 | Bacteria | 795 |
| 668 | Ga0307406_10003561 | 3300031901 | Bacteria | 8488 |
| 669 | Ga0307406_10712158 | 3300031901 | Bacteria | 839 |
| 670 | Ga0307412_10015536 | 3300031911 | Bacteria | 4517 |
| 671 | Ga0307409_100011302 | 3300031995 | Bacteria | 5617 |
| 672 | Ga0307409_101359949 | 3300031995 | Bacteria | 736 |
| 673 | Ga0307416_100037270 | 3300032002 | Bacteria | 3739 |
| 674 | Ga0307416_100080935 | 3300032002 | Bacteria | 2744 |
| 675 | Ga0307414_10039087 | 3300032004 | Bacteria | 3193 |
| 676 | Ga0307414_10112959 | 3300032004 | Bacteria | 2072 |
| 677 | Ga0307414_10116106 | 3300032004 | Bacteria | 2048 |
| 678 | Ga0307414_10386701 | 3300032004 | Bacteria | 1211 |
| 679 | Ga0307414_10499369 | 3300032004 | Bacteria | 1076 |
| 680 | Ga0307414_10814494 | 3300032004 | Bacteria | 852 |
| 681 | Ga0307414_11449133 | 3300032004 | Bacteria | 638 |
| 682 | Ga0307411_10007708 | 3300032005 | Bacteria | 5513 |
| 683 | Ga0307411_10061658 | 3300032005 | Bacteria | 2497 |
| 684 | Ga0307415_100003390 | 3300032126 | Bacteria | 8108 |
| 685 | Ga0307415_100251666 | 3300032126 | Bacteria | 1436 |
| 686 | Ga0307415_101307354 | 3300032126 | Bacteria | 687 |
| 687 | Ga0316593_10018520 | 3300032168 | Bacteria | 2141 |
| 688 | Ga0373926_0040057 | 3300035083 | Bacteria | 1671 |
| 689 | Ga0373952_0184317 | 3300035092 | Bacteria | 604 |
| 690 | Ga0373923_0043833 | 3300035111 | Bacteria | 1852 |
| 691 | Ga0373953_0028256 | 3300035117 | Bacteria | 2161 |
| 692 | Ga0373954_0014612 | 3300035118 | Bacteria | 3501 |
| 693 | Ga0373956_0004538 | 3300035119 | Bacteria | 5545 |
| 694 | Ga0373957_0016317 | 3300035120 | Bacteria | 2569 |
| 695 | Ga0373955_0033285 | 3300035172 | Bacteria | 2713 |
| 696 | Ga0373931_0705273 | 3300035691 | Bacteria | 667 |
| 697 | Ga0373935_0018663 | 3300035692 | Bacteria | 4224 |
| 698 | Ga0373927_0151188 | 3300035695 | Bacteria | 1520 |
| 699 | Ga0373927_0411123 | 3300035695 | Bacteria | 893 |
| 700 | Ga0373933_0013246 | 3300035724 | Bacteria | 4568 |
| 701 | Ga0373947_0096106 | 3300035725 | Bacteria | 1854 |
| 702 | Ga0373937_0092431 | 3300036401 | Bacteria | 2804 |
| 703 | Ga0373937_1905615 | 3300036401 | Bacteria | 541 |
| 704 | Ga0316582_0709899 | 3300036647 | Bacteria | 690 |
| 705 | Ga0373925_0022503 | 3300037068 | Bacteria | 4598 |
| 706 | Ga0373925_0038230 | 3300037068 | Bacteria | 3547 |
| 707 | Ga0373925_1687922 | 3300037068 | Unclassified | 517 |
| 708 | Ga0395899_0039616 | 3300037312 | Bacteria | 3526 |
| 709 | Ga0395899_0087793 | 3300037312 | Bacteria | 2256 |
| 710 | Ga0395899_0118570 | 3300037312 | Bacteria | 1897 |
| 711 | Ga0395900_0005718 | 3300037418 | Bacteria | 12995 |
| 712 | Ga0395900_0029162 | 3300037418 | Bacteria | 5659 |
| 713 | Ga0395900_0116834 | 3300037418 | Bacteria | 2737 |
| 714 | Ga0395900_1722809 | 3300037418 | Bacteria | 537 |
| 715 | Ga0395898_0013263 | 3300037466 | Bacteria | 8488 |
| 716 | Ga0395898_0035116 | 3300037466 | Bacteria | 4989 |
| 717 | Ga0395898_0448170 | 3300037466 | Bacteria | 1229 |
| 718 | Ga0395905_0191105 | 3300037471 | Bacteria | 1920 |
| 719 | Ga0395905_0367431 | 3300037471 | Bacteria | 1332 |
| 720 | Ga0395905_0507953 | 3300037471 | Bacteria | 1106 |
| 721 | Ga0436364_0462315 | 3300037853 | Bacteria | 1593 |
| 722 | Ga0395901_0002206 | 3300038443 | Bacteria | 19856 |
| 723 | Ga0395901_0021709 | 3300038443 | Bacteria | 6577 |
| 724 | Ga0395901_0085643 | 3300038443 | Bacteria | 3294 |
| 725 | Ga0237819_02800 | 3300038705 | Bacteria | 3329 |
| 726 | Ga0237816_01144 | 3300039145 | Bacteria | 2182 |
| 727 | Ga0436365_0215467 | 3300039437 | Unclassified | 1154 |
| 728 | Ga0436365_0825797 | 3300039437 | Unclassified | 854 |
| 729 | Ga0436365_1220357 | 3300039437 | Bacteria | 6280 |
| 730 | Ga0436360_1317327 | 3300039438 | Bacteria | 849 |
| 731 | Ga0436363_0196439 | 3300039450 | Bacteria | 1509 |
| 732 | Ga0436362_0697552 | 3300039453 | Bacteria | 1324 |
| 733 | Ga0439436_0007875 | 3300041404 | Bacteria | 3273 |
| 734 | Ga0451802_1212438 | 3300041460 | Unclassified | 718 |
| 735 | Ga0451807_0416150 | 3300041486 | Bacteria | 548 |
| 736 | Ga0451835_0617162 | 3300041492 | Bacteria | 797 |
| 737 | Ga0451837_1258601 | 3300041494 | Bacteria | 570 |
| 738 | Ga0451843_0469666 | 3300041509 | Bacteria | 561 |
| 739 | Ga0439448_0084631 | 3300042005 | Bacteria | 1068 |
| 740 | Ga0439432_016013 | 3300042006 | Bacteria | 2526 |
| 741 | Ga0439449_0012385 | 3300042007 | Bacteria | 3206 |
| 742 | Ga0439449_0113753 | 3300042007 | Bacteria | 1003 |
| 743 | Ga0439458_0040733 | 3300042157 | Bacteria | 1127 |
| 744 | Ga0439464_0013490 | 3300042439 | Bacteria | 2189 |
| 745 | Ga0466969_0000016 | 3300044656 | Bacteria | 106431 |
| 746 | Ga0466969_0024665 | 3300044656 | Bacteria | 3094 |
| 747 | Ga0466969_0136566 | 3300044656 | Bacteria | 1135 |
| 748 | Ga0466972_0002876 | 3300044658 | Bacteria | 8519 |
| 749 | Ga0466972_0084981 | 3300044658 | Bacteria | 1504 |
| 750 | Ga0466978_0247987 | 3300044671 | Bacteria | 1035 |
| 751 | Ga0466982_0000005 | 3300044672 | Bacteria | 364340 |
| 752 | Ga0466965_0012517 | 3300044683 | Bacteria | 3991 |
| 753 | Ga0466965_0091204 | 3300044683 | Bacteria | 1550 |
| 754 | Ga0466966_0002888 | 3300044684 | Bacteria | 11330 |
| 755 | Ga0466966_0014142 | 3300044684 | Bacteria | 5282 |
| 756 | Ga0466961_0054883 | 3300044693 | Bacteria | 2541 |
| 757 | Ga0466964_0007368 | 3300044706 | Bacteria | 4114 |
| 758 | Ga0466964_0106032 | 3300044706 | Bacteria | 1246 |
| 759 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 760 | Ga0466971_0009485 | 3300044719 | Bacteria | 4249 |
| 761 | Ga0466971_0325440 | 3300044719 | Bacteria | 741 |
| 762 | Ga0466970_0164782 | 3300044765 | Bacteria | 1227 |
| 763 | Ga0466970_0356365 | 3300044765 | Bacteria | 830 |
| 764 | Ga0466960_0000662 | 3300044901 | Bacteria | 11973 |
| 765 | Ga0466959_0190277 | 3300045049 | Bacteria | 1432 |
| 766 | Ga0466959_0437675 | 3300045049 | Bacteria | 887 |
| 767 | Ga0466958_0026487 | 3300045836 | Bacteria | 3427 |
| 768 | Ga0466967_0150058 | 3300045976 | Bacteria | 2178 |
| 769 | Ga0466967_0487057 | 3300045976 | Bacteria | 1209 |
| 770 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 771 | Ga0495638_0007666 | 3300046460 | Bacteria | 7716 |
| 772 | Ga0495580_0002914 | 3300046472 | Bacteria | 14695 |
| 773 | Ga0495580_0536049 | 3300046472 | Unclassified | 778 |
| 774 | Ga0495582_0646272 | 3300046473 | Bacteria | 612 |
| 775 | Ga0495639_0404709 | 3300046475 | Unclassified | 690 |
| 776 | Ga0495608_0383283 | 3300046511 | Unclassified | 862 |
| 777 | Ga0495616_0165040 | 3300046513 | Bacteria | 994 |
| 778 | Ga0495628_0385966 | 3300046516 | Unclassified | 1025 |
| 779 | Ga0495663_0095495 | 3300046525 | Bacteria | 973 |
| 780 | Ga0495663_0142139 | 3300046525 | Unclassified | 815 |
| 781 | Ga0495663_0154809 | 3300046525 | Bacteria | 784 |
| 782 | Ga0495642_0000863 | 3300046528 | Bacteria | 14341 |
| 783 | Ga0495665_0255471 | 3300046531 | Unclassified | 902 |
| 784 | Ga0495586_0516709 | 3300046535 | Unclassified | 689 |
| 785 | Ga0495587_0268647 | 3300046536 | Unclassified | 957 |
| 786 | Ga0495621_0036478 | 3300046539 | Unclassified | 1706 |
| 787 | Ga0495645_0206256 | 3300046543 | Unclassified | 1330 |
| 788 | Ga0495623_0073741 | 3300046679 | Bacteria | 2121 |
| 789 | Ga0495613_0100831 | 3300046689 | Bacteria | 2085 |
| 790 | Ga0495674_0115605 | 3300047319 | Bacteria | 2270 |
| 791 | Ga0495672_0060510 | 3300047320 | Bacteria | 2187 |
| 792 | Ga0495677_0095317 | 3300047445 | Bacteria | 1124 |
| 793 | Ga0495684_0133590 | 3300047471 | Bacteria | 1862 |
| 794 | Ga0496101_0086850 | 3300048904 | Bacteria | 2321 |
| 795 | Ga0496103_0208967 | 3300048906 | Bacteria | 1255 |
| 796 | Ga0496104_0027357 | 3300048907 | Bacteria | 5277 |
| 797 | Ga0496104_0570769 | 3300048907 | Bacteria | 1042 |
| 798 | Ga0496105_0017914 | 3300048908 | Bacteria | 5684 |
| 799 | Ga0496105_0275518 | 3300048908 | Bacteria | 1358 |
| 800 | Ga0496105_1009093 | 3300048908 | Bacteria | 622 |
| 801 | Ga0496106_0141909 | 3300048909 | Bacteria | 1890 |
| 802 | Ga0496106_0708483 | 3300048909 | Bacteria | 802 |
| 803 | Ga0496107_0114991 | 3300048910 | Bacteria | 1980 |
| 804 | Ga0496107_0532032 | 3300048910 | Bacteria | 871 |
| 805 | Ga0496108_0029478 | 3300048911 | Bacteria | 4545 |
| 806 | Ga0496108_0065794 | 3300048911 | Bacteria | 3056 |
| 807 | Ga0496108_0400781 | 3300048911 | Bacteria | 1198 |
| 808 | Ga0496109_0004582 | 3300048912 | Bacteria | 11540 |
| 809 | Ga0496109_0153437 | 3300048912 | Bacteria | 2157 |
| 810 | Ga0496109_0238027 | 3300048912 | Bacteria | 1713 |
| 811 | Ga0496110_0024184 | 3300048913 | Bacteria | 5174 |
| 812 | Ga0496110_0182458 | 3300048913 | Bacteria | 1906 |
| 813 | Ga0496110_1368705 | 3300048913 | Bacteria | 617 |
| 814 | Ga0496111_0005423 | 3300048914 | Bacteria | 8171 |
| 815 | Ga0496112_0068664 | 3300048915 | Bacteria | 3500 |
| 816 | Ga0496113_0259178 | 3300048916 | Bacteria | 1389 |
| 817 | Ga0496114_0049947 | 3300048917 | Bacteria | 3481 |
| 818 | Ga0496114_0653624 | 3300048917 | Bacteria | 924 |
| 819 | Ga0496115_0000039 | 3300048918 | Bacteria | 124044 |
| 820 | Ga0496115_0079680 | 3300048918 | Bacteria | 2666 |
| 821 | Ga0496118_0037307 | 3300048921 | Bacteria | 3914 |
| 822 | Ga0496118_0156509 | 3300048921 | Bacteria | 1416 |
| 823 | Ga0496121_0044528 | 3300048924 | Bacteria | 3826 |
| 824 | Ga0496122_0314574 | 3300048925 | Bacteria | 836 |
| 825 | Ga0496124_0098248 | 3300048927 | Bacteria | 2376 |
| 826 | Ga0496125_0000313 | 3300048928 | Bacteria | 95423 |
| 827 | Ga0496125_0000379 | 3300048928 | Bacteria | 83187 |
| 828 | Ga0496126_0117941 | 3300048929 | Bacteria | 2305 |
| 829 | Ga0496126_0449565 | 3300048929 | Bacteria | 1037 |
| 830 | Ga0501292_037832 | 3300049515 | Bacteria | 826 |
| 831 | Ga0501298_022270 | 3300049521 | Bacteria | 1193 |
| 832 | Ga0501300_017161 | 3300049523 | Bacteria | 1056 |
| 833 | Ga0501031_0180024 | 3300049568 | Bacteria | 1381 |
| 834 | Ga0501031_0418702 | 3300049568 | Bacteria | 866 |
| 835 | Ga0501031_0662385 | 3300049568 | Bacteria | 671 |
| 836 | Ga0501032_0018514 | 3300049569 | Bacteria | 4878 |
| 837 | Ga0501032_0070325 | 3300049569 | Bacteria | 2334 |
| 838 | Ga0501033_0021892 | 3300049570 | Bacteria | 4823 |
| 839 | Ga0501033_0622531 | 3300049570 | Bacteria | 739 |
| 840 | Ga0501034_0041124 | 3300049571 | Bacteria | 4677 |
| 841 | Ga0501036_0044682 | 3300049572 | Bacteria | 3753 |
| 842 | Ga0501037_0159568 | 3300049573 | Bacteria | 1608 |
| 843 | Ga0501037_0175526 | 3300049573 | Bacteria | 1522 |
| 844 | Ga0501038_0043484 | 3300049574 | Bacteria | 3906 |
| 845 | Ga0501038_0966537 | 3300049574 | Bacteria | 626 |
| 846 | Ga0501039_0611401 | 3300049575 | Bacteria | 854 |
| 847 | Ga0501042_0515194 | 3300049578 | Bacteria | 869 |
| 848 | Ga0501043_0063280 | 3300049579 | Bacteria | 2905 |
| 849 | Ga0501043_0084585 | 3300049579 | Bacteria | 2493 |
| 850 | Ga0501046_0052161 | 3300049580 | Bacteria | 3224 |
| 851 | Ga0501046_0538124 | 3300049580 | Bacteria | 834 |
| 852 | Ga0501047_0018745 | 3300049581 | Bacteria | 6636 |
| 853 | Ga0501047_0077036 | 3300049581 | Bacteria | 3209 |
| 854 | Ga0501047_0121904 | 3300049581 | Bacteria | 2489 |
| 855 | Ga0501047_0164607 | 3300049581 | Bacteria | 2089 |
| 856 | Ga0501048_0402658 | 3300049582 | Bacteria | 978 |
| 857 | Ga0501068_0201818 | 3300049584 | Unclassified | 1261 |
| 858 | Ga0501070_0067505 | 3300049586 | Bacteria | 2962 |
| 859 | Ga0501070_1179342 | 3300049586 | Unclassified | 588 |
| 860 | Ga0501073_0864999 | 3300049589 | Bacteria | 623 |
| 861 | Ga0501074_0815971 | 3300049590 | Unclassified | 657 |
| 862 | Ga0501075_0115308 | 3300049591 | Bacteria | 2043 |
| 863 | Ga0501076_0582437 | 3300049592 | Bacteria | 923 |
| 864 | Ga0501217_193713 | 3300049661 | Bacteria | 630 |
| 865 | Ga0501225_0106322 | 3300049705 | Bacteria | 824 |
| 866 | Ga0501080_0417701 | 3300049742 | Unclassified | 1205 |
| 867 | Ga0501274_001631 | 3300049771 | Bacteria | 1724 |
| 868 | Ga0501276_016181 | 3300049773 | Bacteria | 677 |
| 869 | Ga0501035_0028259 | 3300049822 | Bacteria | 5120 |
| 870 | Ga0501035_0379781 | 3300049822 | Bacteria | 1179 |
| 871 | Ga0501035_1484677 | 3300049822 | Bacteria | 517 |
| 872 | Ga0501044_0030714 | 3300049823 | Bacteria | 5660 |
| 873 | Ga0501044_0539350 | 3300049823 | Bacteria | 1065 |
| 874 | Ga0501044_0794683 | 3300049823 | Unclassified | 826 |
| 875 | nmdc:mga0k408_15007_c1 | 3300050493 | Bacteria | 4280 |
| 876 | nmdc:mga0k408_236574_c1 | 3300050493 | Bacteria | 1090 |
| 877 | nmdc:mga0k408_447972_c1 | 3300050493 | Bacteria | 767 |
| 878 | nmdc:mga05p37_1326941_c1 | 3300050507 | Bacteria | 731 |
| 879 | nmdc:mga05p37_181305_c1 | 3300050507 | Bacteria | 2562 |
| 880 | nmdc:mga05p37_584699_c1 | 3300050507 | Bacteria | 1264 |
| 881 | nmdc:mga05p37_850864_c1 | 3300050507 | Bacteria | 990 |
| 882 | nmdc:mga09592_409997_c1 | 3300050508 | Bacteria | 1171 |
| 883 | nmdc:mga09592_4687_c1 | 3300050508 | Bacteria | 11067 |
| 884 | nmdc:mga0qj67_152542_c1 | 3300050509 | Bacteria | 1874 |
| 885 | nmdc:mga0qj67_21452_c1 | 3300050509 | Bacteria | 4955 |
| 886 | nmdc:mga0qj67_26271_c1 | 3300050509 | Bacteria | 4507 |
| 887 | nmdc:mga0qj67_757157_c1 | 3300050509 | Bacteria | 770 |
| 888 | nmdc:mga0qj67_80814_c1 | 3300050509 | Bacteria | 2605 |
| 889 | nmdc:mga06r32_10201_c1 | 3300050510 | Bacteria | 8480 |
| 890 | nmdc:mga06r32_399223_c1 | 3300050510 | Bacteria | 1357 |
| 891 | nmdc:mga06r32_745001_c1 | 3300050510 | Bacteria | 943 |
| 892 | nmdc:mga08y16_1018896_c1 | 3300050511 | Bacteria | 807 |
| 893 | nmdc:mga08y16_136431_c1 | 3300050511 | Bacteria | 2550 |
| 894 | nmdc:mga08y16_61034_c1 | 3300050511 | Bacteria | 3937 |
| 895 | nmdc:mga0n895_155234_c1 | 3300050512 | Bacteria | 2319 |
| 896 | nmdc:mga0n895_250101_c1 | 3300050512 | Bacteria | 1799 |
| 897 | nmdc:mga0n895_27412_c1 | 3300050512 | Bacteria | 5413 |
| 898 | nmdc:mga0n895_49686_c1 | 3300050512 | Bacteria | 4110 |
| 899 | nmdc:mga0rr50_345452_c1 | 3300050513 | Bacteria | 1251 |
| 900 | nmdc:mga0rr50_51116_c1 | 3300050513 | Bacteria | 3065 |
| 901 | nmdc:mga0rr50_7612_c1 | 3300050513 | Bacteria | 6696 |
| 902 | nmdc:mga08x19_1251564_c1 | 3300050514 | Bacteria | 526 |
| 903 | nmdc:mga08x19_634227_c1 | 3300050514 | Bacteria | 758 |
| 904 | nmdc:mga0a205_1359193_c1 | 3300050515 | Bacteria | 558 |
| 905 | nmdc:mga0a205_14872_c3 | 3300050515 | Bacteria | 2053 |
| 906 | nmdc:mga0a205_73683_c1 | 3300050515 | Bacteria | 3299 |
| 907 | Ga0495612_0180537 | 3300053078 | Bacteria | 927 |
| 908 | Ga0495612_0244516 | 3300053078 | Unclassified | 797 |
| 909 | Ga0500643_000654 | 3300053087 | Bacteria | 23285 |
| 910 | Ga0500643_035304 | 3300053087 | Unclassified | 1500 |
| 911 | Ga0500643_040767 | 3300053087 | Unclassified | 1366 |
| 912 | Ga0500644_0037409 | 3300053088 | Bacteria | 1586 |
| 913 | Ga0500644_0117275 | 3300053088 | Bacteria | 1033 |
| 914 | Ga0500650_0237835 | 3300053098 | Bacteria | 820 |
| 915 | Ga0500652_384550 | 3300053131 | Bacteria | 523 |
| 916 | Ga0500658_0026201 | 3300053134 | Bacteria | 2245 |
| 917 | Ga0500568_0049201 | 3300053139 | Bacteria | 1664 |
| 918 | Ga0500568_0130691 | 3300053139 | Bacteria | 934 |
| 919 | Ga0500622_0007137 | 3300053156 | Bacteria | 6376 |
| 920 | Ga0500622_0147872 | 3300053156 | Bacteria | 1114 |
| 921 | Ga0501084_0095487 | 3300054114 | Bacteria | 2497 |
| 922 | Ga0590071_148334 | 3300059421 | Bacteria | 607 |
| 923 | Ga0501082_0116694 | 3300060353 | Bacteria | 2312 |
| 924 | Ga0466962_0003750 | 3300061719 | Bacteria | 7255 |
| 925 | Ga0530510_0175332 | 3300061734 | Bacteria | 1589 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025242 | Ga0209258_101488 | Ga0209258_1014889 | 95 |
| 2 | 3300013105 | Ga0157369_10107353 | Ga0157369_101073532 | 98 |
| 3 | 3300025904 | Ga0207647_10665441 | Ga0207647_106654412 | 98 |
| 4 | 3300005444 | Ga0070694_100028547 | Ga0070694_1000285472 | 112 |
| 5 | 3300005546 | Ga0070696_101388123 | Ga0070696_1013881231 | 112 |
| 6 | 3300031824 | Ga0307413_11140838 | Ga0307413_111408381 | 112 |
| 7 | 2162886012 | MBSR1b_contig_1762146 | MBSR1b_0342.00004570 | 113 |
| 8 | 3300001904 | JGI24736J21556_1073281 | JGI24736J21556_10732812 | 113 |
| 9 | 3300001979 | JGI24740J21852_10014053 | JGI24740J21852_100140532 | 113 |
| 10 | 3300001989 | JGI24739J22299_10000118 | JGI24739J22299_1000011832 | 113 |
| 11 | 3300001989 | JGI24739J22299_10116781 | JGI24739J22299_101167811 | 113 |
| 12 | 3300001989 | JGI24739J22299_10237891 | JGI24739J22299_102378911 | 113 |
| 13 | 3300001990 | JGI24737J22298_10001221 | JGI24737J22298_100012213 | 113 |
| 14 | 3300001990 | JGI24737J22298_10065931 | JGI24737J22298_100659313 | 113 |
| 15 | 3300001990 | JGI24737J22298_10162999 | JGI24737J22298_101629992 | 113 |
| 16 | 3300002067 | JGI24735J21928_10002313 | JGI24735J21928_100023138 | 113 |
| 17 | 3300002067 | JGI24735J21928_10030492 | JGI24735J21928_100304922 | 113 |
| 18 | 3300002067 | JGI24735J21928_10048387 | JGI24735J21928_100483873 | 113 |
| 19 | 3300002076 | JGI24749J21850_1068508 | JGI24749J21850_10685082 | 113 |
| 20 | 3300002244 | JGI24742J22300_10026297 | JGI24742J22300_100262972 | 113 |
| 21 | 3300003215 | JGI25153J46596_10009725 | JGI25153J46596_100097254 | 113 |
| 22 | 3300003316 | rootH1_10093510 | rootH1_100935103 | 113 |
| 23 | 3300003320 | rootH2_10038319 | rootH2_100383192 | 113 |
| 24 | 3300003320 | rootH2_10096305 | rootH2_100963053 | 113 |
| 25 | 3300003322 | rootL2_10059667 | rootL2_100596674 | 113 |
| 26 | 3300003756 | Ga0055533_1001946 | Ga0055533_10019463 | 113 |
| 27 | 3300003760 | Ga0055527_1000306 | Ga0055527_10003062 | 113 |
| 28 | 3300003762 | Ga0055542_1030945 | Ga0055542_10309451 | 113 |
| 29 | 3300003771 | Ga0055526_1002048 | Ga0055526_10020484 | 113 |
| 30 | 3300003773 | Ga0055537_1000417 | Ga0055537_10004171 | 113 |
| 31 | 3300003775 | Ga0055524_1004179 | Ga0055524_10041795 | 113 |
| 32 | 3300003784 | Ga0055534_1000045 | Ga0055534_100004550 | 113 |
| 33 | 3300003790 | Ga0055528_1000414 | Ga0055528_100041419 | 113 |
| 34 | 3300005262 | Ga0065165_1005347 | Ga0065165_10053472 | 113 |
| 35 | 3300005288 | Ga0065714_10148579 | Ga0065714_101485792 | 113 |
| 36 | 3300005290 | Ga0065712_10095697 | Ga0065712_100956972 | 113 |
| 37 | 3300005290 | Ga0065712_10239804 | Ga0065712_102398042 | 113 |
| 38 | 3300005293 | Ga0065715_10099278 | Ga0065715_100992782 | 113 |
| 39 | 3300005293 | Ga0065715_10425647 | Ga0065715_104256471 | 113 |
| 40 | 3300005295 | Ga0065707_10605236 | Ga0065707_106052362 | 113 |
| 41 | 3300005327 | Ga0070658_10342428 | Ga0070658_103424282 | 113 |
| 42 | 3300005328 | Ga0070676_10100375 | Ga0070676_101003751 | 113 |
| 43 | 3300005328 | Ga0070676_10204936 | Ga0070676_102049362 | 113 |
| 44 | 3300005328 | Ga0070676_10290973 | Ga0070676_102909732 | 113 |
| 45 | 3300005329 | Ga0070683_100000987 | Ga0070683_10000098711 | 113 |
| 46 | 3300005329 | Ga0070683_101038849 | Ga0070683_1010388491 | 113 |
| 47 | 3300005329 | Ga0070683_101651600 | Ga0070683_1016516002 | 113 |
| 48 | 3300005330 | Ga0070690_100000516 | Ga0070690_10000051623 | 113 |
| 49 | 3300005330 | Ga0070690_100005509 | Ga0070690_1000055095 | 113 |
| 50 | 3300005331 | Ga0070670_100000438 | Ga0070670_10000043824 | 113 |
| 51 | 3300005331 | Ga0070670_100025505 | Ga0070670_1000255052 | 113 |
| 52 | 3300005331 | Ga0070670_100095595 | Ga0070670_1000955954 | 113 |
| 53 | 3300005331 | Ga0070670_100099796 | Ga0070670_1000997964 | 113 |
| 54 | 3300005331 | Ga0070670_100188547 | Ga0070670_1001885471 | 113 |
| 55 | 3300005331 | Ga0070670_100703209 | Ga0070670_1007032091 | 113 |
| 56 | 3300005331 | Ga0070670_101249023 | Ga0070670_1012490232 | 113 |
| 57 | 3300005334 | Ga0068869_100035109 | Ga0068869_1000351095 | 113 |
| 58 | 3300005334 | Ga0068869_100080243 | Ga0068869_1000802432 | 113 |
| 59 | 3300005334 | Ga0068869_100108259 | Ga0068869_1001082592 | 113 |
| 60 | 3300005334 | Ga0068869_100141030 | Ga0068869_1001410302 | 113 |
| 61 | 3300005334 | Ga0068869_100406162 | Ga0068869_1004061622 | 113 |
| 62 | 3300005334 | Ga0068869_100698905 | Ga0068869_1006989052 | 113 |
| 63 | 3300005335 | Ga0070666_10035061 | Ga0070666_100350611 | 113 |
| 64 | 3300005335 | Ga0070666_10046109 | Ga0070666_100461092 | 113 |
| 65 | 3300005335 | Ga0070666_10317506 | Ga0070666_103175061 | 113 |
| 66 | 3300005336 | Ga0070680_100030878 | Ga0070680_1000308783 | 113 |
| 67 | 3300005336 | Ga0070680_101449261 | Ga0070680_1014492611 | 113 |
| 68 | 3300005337 | Ga0070682_100237130 | Ga0070682_1002371303 | 113 |
| 69 | 3300005337 | Ga0070682_101097940 | Ga0070682_1010979401 | 113 |
| 70 | 3300005338 | Ga0068868_100001019 | Ga0068868_1000010198 | 113 |
| 71 | 3300005338 | Ga0068868_100041919 | Ga0068868_1000419194 | 113 |
| 72 | 3300005338 | Ga0068868_100063770 | Ga0068868_1000637702 | 113 |
| 73 | 3300005338 | Ga0068868_100515570 | Ga0068868_1005155702 | 113 |
| 74 | 3300005338 | Ga0068868_100578712 | Ga0068868_1005787122 | 113 |
| 75 | 3300005339 | Ga0070660_100719656 | Ga0070660_1007196562 | 113 |
| 76 | 3300005339 | Ga0070660_100783818 | Ga0070660_1007838181 | 113 |
| 77 | 3300005340 | Ga0070689_100016977 | Ga0070689_1000169779 | 113 |
| 78 | 3300005340 | Ga0070689_100637764 | Ga0070689_1006377642 | 113 |
| 79 | 3300005340 | Ga0070689_101585907 | Ga0070689_1015859072 | 113 |
| 80 | 3300005341 | Ga0070691_10173109 | Ga0070691_101731092 | 113 |
| 81 | 3300005341 | Ga0070691_10517802 | Ga0070691_105178021 | 113 |
| 82 | 3300005343 | Ga0070687_100010261 | Ga0070687_1000102612 | 113 |
| 83 | 3300005343 | Ga0070687_100070248 | Ga0070687_1000702484 | 113 |
| 84 | 3300005344 | Ga0070661_100002808 | Ga0070661_1000028084 | 113 |
| 85 | 3300005344 | Ga0070661_100009246 | Ga0070661_1000092465 | 113 |
| 86 | 3300005344 | Ga0070661_100016479 | Ga0070661_1000164799 | 113 |
| 87 | 3300005344 | Ga0070661_100291351 | Ga0070661_1002913512 | 113 |
| 88 | 3300005345 | Ga0070692_10062179 | Ga0070692_100621792 | 113 |
| 89 | 3300005345 | Ga0070692_10192891 | Ga0070692_101928912 | 113 |
| 90 | 3300005347 | Ga0070668_100001366 | Ga0070668_10000136611 | 113 |
| 91 | 3300005353 | Ga0070669_100006444 | Ga0070669_10000644410 | 113 |
| 92 | 3300005353 | Ga0070669_100597465 | Ga0070669_1005974652 | 113 |
| 93 | 3300005353 | Ga0070669_100784311 | Ga0070669_1007843112 | 113 |
| 94 | 3300005354 | Ga0070675_100001988 | Ga0070675_1000019887 | 113 |
| 95 | 3300005354 | Ga0070675_100003764 | Ga0070675_10000376411 | 113 |
| 96 | 3300005354 | Ga0070675_100433786 | Ga0070675_1004337862 | 113 |
| 97 | 3300005354 | Ga0070675_100486018 | Ga0070675_1004860182 | 113 |
| 98 | 3300005354 | Ga0070675_100762308 | Ga0070675_1007623082 | 113 |
| 99 | 3300005355 | Ga0070671_100000543 | Ga0070671_10000054316 | 113 |
| 100 | 3300005355 | Ga0070671_100056470 | Ga0070671_1000564702 | 113 |
| 101 | 3300005355 | Ga0070671_100067512 | Ga0070671_1000675122 | 113 |
| 102 | 3300005355 | Ga0070671_100351237 | Ga0070671_1003512371 | 113 |
| 103 | 3300005356 | Ga0070674_100036363 | Ga0070674_1000363633 | 113 |
| 104 | 3300005356 | Ga0070674_100905329 | Ga0070674_1009053291 | 113 |
| 105 | 3300005364 | Ga0070673_100005557 | Ga0070673_1000055573 | 113 |
| 106 | 3300005365 | Ga0070688_100000819 | Ga0070688_10000081919 | 113 |
| 107 | 3300005365 | Ga0070688_100002574 | Ga0070688_1000025743 | 113 |
| 108 | 3300005366 | Ga0070659_100000722 | Ga0070659_10000072213 | 113 |
| 109 | 3300005366 | Ga0070659_100247023 | Ga0070659_1002470232 | 113 |
| 110 | 3300005366 | Ga0070659_101568533 | Ga0070659_1015685332 | 113 |
| 111 | 3300005434 | Ga0070709_10161812 | Ga0070709_101618122 | 113 |
| 112 | 3300005436 | Ga0070713_100006824 | Ga0070713_10000682410 | 113 |
| 113 | 3300005436 | Ga0070713_100041905 | Ga0070713_1000419053 | 113 |
| 114 | 3300005438 | Ga0070701_10005063 | Ga0070701_100050637 | 113 |
| 115 | 3300005438 | Ga0070701_10581168 | Ga0070701_105811682 | 113 |
| 116 | 3300005439 | Ga0070711_100154861 | Ga0070711_1001548611 | 113 |
| 117 | 3300005440 | Ga0070705_100014731 | Ga0070705_1000147314 | 113 |
| 118 | 3300005441 | Ga0070700_100476225 | Ga0070700_1004762252 | 113 |
| 119 | 3300005441 | Ga0070700_100527537 | Ga0070700_1005275372 | 113 |
| 120 | 3300005441 | Ga0070700_100948661 | Ga0070700_1009486612 | 113 |
| 121 | 3300005444 | Ga0070694_100069896 | Ga0070694_1000698963 | 113 |
| 122 | 3300005445 | Ga0070708_100437186 | Ga0070708_1004371862 | 113 |
| 123 | 3300005445 | Ga0070708_100540870 | Ga0070708_1005408702 | 113 |
| 124 | 3300005445 | Ga0070708_101540465 | Ga0070708_1015404651 | 113 |
| 125 | 3300005455 | Ga0070663_100126278 | Ga0070663_1001262781 | 113 |
| 126 | 3300005455 | Ga0070663_100239988 | Ga0070663_1002399882 | 113 |
| 127 | 3300005455 | Ga0070663_100241523 | Ga0070663_1002415232 | 113 |
| 128 | 3300005455 | Ga0070663_100310677 | Ga0070663_1003106772 | 113 |
| 129 | 3300005456 | Ga0070678_100001529 | Ga0070678_1000015294 | 113 |
| 130 | 3300005456 | Ga0070678_100006494 | Ga0070678_1000064942 | 113 |
| 131 | 3300005456 | Ga0070678_100050133 | Ga0070678_1000501331 | 113 |
| 132 | 3300005456 | Ga0070678_100260200 | Ga0070678_1002602003 | 113 |
| 133 | 3300005457 | Ga0070662_100007090 | Ga0070662_1000070904 | 113 |
| 134 | 3300005457 | Ga0070662_100009855 | Ga0070662_1000098554 | 113 |
| 135 | 3300005457 | Ga0070662_100011225 | Ga0070662_1000112254 | 113 |
| 136 | 3300005457 | Ga0070662_101093527 | Ga0070662_1010935272 | 113 |
| 137 | 3300005457 | Ga0070662_101285701 | Ga0070662_1012857012 | 113 |
| 138 | 3300005458 | Ga0070681_10104617 | Ga0070681_101046173 | 113 |
| 139 | 3300005458 | Ga0070681_10175925 | Ga0070681_101759253 | 113 |
| 140 | 3300005459 | Ga0068867_100007657 | Ga0068867_1000076574 | 113 |
| 141 | 3300005459 | Ga0068867_100007738 | Ga0068867_10000773811 | 113 |
| 142 | 3300005459 | Ga0068867_100022584 | Ga0068867_1000225844 | 113 |
| 143 | 3300005459 | Ga0068867_100205853 | Ga0068867_1002058531 | 113 |
| 144 | 3300005459 | Ga0068867_100318292 | Ga0068867_1003182922 | 113 |
| 145 | 3300005466 | Ga0070685_10354947 | Ga0070685_103549472 | 113 |
| 146 | 3300005467 | Ga0070706_101704204 | Ga0070706_1017042041 | 113 |
| 147 | 3300005467 | Ga0070706_102169828 | Ga0070706_1021698281 | 113 |
| 148 | 3300005468 | Ga0070707_102249376 | Ga0070707_1022493761 | 113 |
| 149 | 3300005471 | Ga0070698_100382235 | Ga0070698_1003822351 | 113 |
| 150 | 3300005471 | Ga0070698_101496825 | Ga0070698_1014968251 | 113 |
| 151 | 3300005471 | Ga0070698_102205575 | Ga0070698_1022055751 | 113 |
| 152 | 3300005518 | Ga0070699_100009392 | Ga0070699_1000093922 | 113 |
| 153 | 3300005518 | Ga0070699_100194651 | Ga0070699_1001946513 | 113 |
| 154 | 3300005518 | Ga0070699_100704599 | Ga0070699_1007045992 | 113 |
| 155 | 3300005518 | Ga0070699_101406450 | Ga0070699_1014064501 | 113 |
| 156 | 3300005518 | Ga0070699_102153019 | Ga0070699_1021530191 | 113 |
| 157 | 3300005530 | Ga0070679_100023818 | Ga0070679_1000238182 | 113 |
| 158 | 3300005530 | Ga0070679_100929561 | Ga0070679_1009295611 | 113 |
| 159 | 3300005536 | Ga0070697_100104369 | Ga0070697_1001043693 | 113 |
| 160 | 3300005536 | Ga0070697_102017291 | Ga0070697_1020172911 | 113 |
| 161 | 3300005539 | Ga0068853_100785680 | Ga0068853_1007856801 | 113 |
| 162 | 3300005543 | Ga0070672_100001939 | Ga0070672_1000019392 | 113 |
| 163 | 3300005543 | Ga0070672_100051268 | Ga0070672_1000512684 | 113 |
| 164 | 3300005543 | Ga0070672_100120261 | Ga0070672_1001202614 | 113 |
| 165 | 3300005543 | Ga0070672_101048781 | Ga0070672_1010487812 | 113 |
| 166 | 3300005544 | Ga0070686_100510570 | Ga0070686_1005105702 | 113 |
| 167 | 3300005545 | Ga0070695_100032437 | Ga0070695_1000324373 | 113 |
| 168 | 3300005545 | Ga0070695_100042415 | Ga0070695_1000424153 | 113 |
| 169 | 3300005546 | Ga0070696_100301698 | Ga0070696_1003016983 | 113 |
| 170 | 3300005546 | Ga0070696_100989906 | Ga0070696_1009899061 | 113 |
| 171 | 3300005547 | Ga0070693_100004136 | Ga0070693_10000413613 | 113 |
| 172 | 3300005547 | Ga0070693_100056167 | Ga0070693_1000561673 | 113 |
| 173 | 3300005547 | Ga0070693_100392534 | Ga0070693_1003925342 | 113 |
| 174 | 3300005548 | Ga0070665_100005472 | Ga0070665_10000547218 | 113 |
| 175 | 3300005548 | Ga0070665_100038653 | Ga0070665_1000386534 | 113 |
| 176 | 3300005548 | Ga0070665_100479850 | Ga0070665_1004798502 | 113 |
| 177 | 3300005549 | Ga0070704_100236431 | Ga0070704_1002364313 | 113 |
| 178 | 3300005549 | Ga0070704_100256324 | Ga0070704_1002563243 | 113 |
| 179 | 3300005549 | Ga0070704_102061283 | Ga0070704_1020612831 | 113 |
| 180 | 3300005563 | Ga0068855_100013790 | Ga0068855_1000137904 | 113 |
| 181 | 3300005563 | Ga0068855_100046572 | Ga0068855_1000465724 | 113 |
| 182 | 3300005563 | Ga0068855_101403691 | Ga0068855_1014036912 | 113 |
| 183 | 3300005564 | Ga0070664_100005842 | Ga0070664_1000058424 | 113 |
| 184 | 3300005564 | Ga0070664_100006033 | Ga0070664_1000060339 | 113 |
| 185 | 3300005564 | Ga0070664_100018536 | Ga0070664_1000185368 | 113 |
| 186 | 3300005564 | Ga0070664_100283171 | Ga0070664_1002831712 | 113 |
| 187 | 3300005577 | Ga0068857_100000998 | Ga0068857_1000009983 | 113 |
| 188 | 3300005578 | Ga0068854_100001113 | Ga0068854_1000011135 | 113 |
| 189 | 3300005578 | Ga0068854_100001385 | Ga0068854_1000013859 | 113 |
| 190 | 3300005578 | Ga0068854_100024671 | Ga0068854_1000246714 | 113 |
| 191 | 3300005578 | Ga0068854_100049312 | Ga0068854_1000493123 | 113 |
| 192 | 3300005578 | Ga0068854_100108441 | Ga0068854_1001084414 | 113 |
| 193 | 3300005614 | Ga0068856_100085324 | Ga0068856_1000853246 | 113 |
| 194 | 3300005614 | Ga0068856_100595517 | Ga0068856_1005955172 | 113 |
| 195 | 3300005614 | Ga0068856_100637072 | Ga0068856_1006370722 | 113 |
| 196 | 3300005614 | Ga0068856_101662728 | Ga0068856_1016627282 | 113 |
| 197 | 3300005615 | Ga0070702_100022630 | Ga0070702_1000226303 | 113 |
| 198 | 3300005615 | Ga0070702_100078612 | Ga0070702_1000786124 | 113 |
| 199 | 3300005615 | Ga0070702_100128052 | Ga0070702_1001280521 | 113 |
| 200 | 3300005615 | Ga0070702_100300407 | Ga0070702_1003004072 | 113 |
| 201 | 3300005616 | Ga0068852_100000272 | Ga0068852_10000027210 | 113 |
| 202 | 3300005616 | Ga0068852_100016620 | Ga0068852_1000166202 | 113 |
| 203 | 3300005616 | Ga0068852_100056945 | Ga0068852_1000569454 | 113 |
| 204 | 3300005616 | Ga0068852_100065603 | Ga0068852_1000656033 | 113 |
| 205 | 3300005616 | Ga0068852_100371510 | Ga0068852_1003715102 | 113 |
| 206 | 3300005616 | Ga0068852_101501235 | Ga0068852_1015012352 | 113 |
| 207 | 3300005617 | Ga0068859_100010699 | Ga0068859_10001069919 | 113 |
| 208 | 3300005617 | Ga0068859_100183748 | Ga0068859_1001837482 | 113 |
| 209 | 3300005617 | Ga0068859_100226684 | Ga0068859_1002266845 | 113 |
| 210 | 3300005617 | Ga0068859_100245698 | Ga0068859_1002456982 | 113 |
| 211 | 3300005617 | Ga0068859_100264819 | Ga0068859_1002648192 | 113 |
| 212 | 3300005617 | Ga0068859_101172633 | Ga0068859_1011726331 | 113 |
| 213 | 3300005617 | Ga0068859_102537814 | Ga0068859_1025378142 | 113 |
| 214 | 3300005618 | Ga0068864_100004004 | Ga0068864_10000400414 | 113 |
| 215 | 3300005618 | Ga0068864_100005673 | Ga0068864_1000056732 | 113 |
| 216 | 3300005618 | Ga0068864_100031814 | Ga0068864_1000318142 | 113 |
| 217 | 3300005618 | Ga0068864_100111531 | Ga0068864_1001115314 | 113 |
| 218 | 3300005618 | Ga0068864_100832972 | Ga0068864_1008329722 | 113 |
| 219 | 3300005718 | Ga0068866_10003214 | Ga0068866_100032142 | 113 |
| 220 | 3300005718 | Ga0068866_10276973 | Ga0068866_102769732 | 113 |
| 221 | 3300005718 | Ga0068866_10348817 | Ga0068866_103488172 | 113 |
| 222 | 3300005719 | Ga0068861_100004074 | Ga0068861_1000040749 | 113 |
| 223 | 3300005719 | Ga0068861_100095663 | Ga0068861_1000956633 | 113 |
| 224 | 3300005719 | Ga0068861_101156082 | Ga0068861_1011560822 | 113 |
| 225 | 3300005834 | Ga0068851_10138531 | Ga0068851_101385312 | 113 |
| 226 | 3300005834 | Ga0068851_10166654 | Ga0068851_101666542 | 113 |
| 227 | 3300005834 | Ga0068851_10736139 | Ga0068851_107361392 | 113 |
| 228 | 3300005840 | Ga0068870_10011516 | Ga0068870_100115168 | 113 |
| 229 | 3300005841 | Ga0068863_100001296 | Ga0068863_1000012962 | 113 |
| 230 | 3300005841 | Ga0068863_100003717 | Ga0068863_10000371716 | 113 |
| 231 | 3300005841 | Ga0068863_100232551 | Ga0068863_1002325512 | 113 |
| 232 | 3300005841 | Ga0068863_102601485 | Ga0068863_1026014851 | 113 |
| 233 | 3300005842 | Ga0068858_100001929 | Ga0068858_10000192918 | 113 |
| 234 | 3300005842 | Ga0068858_100003142 | Ga0068858_10000314212 | 113 |
| 235 | 3300005842 | Ga0068858_100050925 | Ga0068858_1000509255 | 113 |
| 236 | 3300005842 | Ga0068858_100253137 | Ga0068858_1002531372 | 113 |
| 237 | 3300005842 | Ga0068858_102411885 | Ga0068858_1024118852 | 113 |
| 238 | 3300005843 | Ga0068860_100018934 | Ga0068860_1000189345 | 113 |
| 239 | 3300005843 | Ga0068860_100019324 | Ga0068860_10001932413 | 113 |
| 240 | 3300005843 | Ga0068860_100174934 | Ga0068860_1001749344 | 113 |
| 241 | 3300005843 | Ga0068860_100290307 | Ga0068860_1002903071 | 113 |
| 242 | 3300005843 | Ga0068860_100667199 | Ga0068860_1006671992 | 113 |
| 243 | 3300005843 | Ga0068860_102335131 | Ga0068860_1023351312 | 113 |
| 244 | 3300005844 | Ga0068862_100029895 | Ga0068862_1000298954 | 113 |
| 245 | 3300005844 | Ga0068862_100046498 | Ga0068862_1000464983 | 113 |
| 246 | 3300005844 | Ga0068862_100084369 | Ga0068862_1000843694 | 113 |
| 247 | 3300005844 | Ga0068862_102078417 | Ga0068862_1020784171 | 113 |
| 248 | 3300006163 | Ga0070715_10001133 | Ga0070715_100011334 | 113 |
| 249 | 3300006173 | Ga0070716_100014562 | Ga0070716_1000145626 | 113 |
| 250 | 3300006175 | Ga0070712_100032192 | Ga0070712_1000321924 | 113 |
| 251 | 3300006175 | Ga0070712_100075658 | Ga0070712_1000756583 | 113 |
| 252 | 3300006195 | Ga0075366_10014288 | Ga0075366_100142885 | 113 |
| 253 | 3300006195 | Ga0075366_10376175 | Ga0075366_103761751 | 113 |
| 254 | 3300006237 | Ga0097621_100001769 | Ga0097621_10000176912 | 113 |
| 255 | 3300006237 | Ga0097621_100056483 | Ga0097621_1000564836 | 113 |
| 256 | 3300006237 | Ga0097621_100100725 | Ga0097621_1001007252 | 113 |
| 257 | 3300006237 | Ga0097621_100229527 | Ga0097621_1002295273 | 113 |
| 258 | 3300006358 | Ga0068871_100002631 | Ga0068871_10000263110 | 113 |
| 259 | 3300006358 | Ga0068871_100069402 | Ga0068871_1000694023 | 113 |
| 260 | 3300006358 | Ga0068871_100196195 | Ga0068871_1001961953 | 113 |
| 261 | 3300006358 | Ga0068871_100268418 | Ga0068871_1002684181 | 113 |
| 262 | 3300006358 | Ga0068871_100454587 | Ga0068871_1004545871 | 113 |
| 263 | 3300006358 | Ga0068871_100530586 | Ga0068871_1005305862 | 113 |
| 264 | 3300006358 | Ga0068871_101548022 | Ga0068871_1015480222 | 113 |
| 265 | 3300006844 | Ga0075428_100009741 | Ga0075428_1000097417 | 113 |
| 266 | 3300006844 | Ga0075428_100259490 | Ga0075428_1002594901 | 113 |
| 267 | 3300006844 | Ga0075428_101502615 | Ga0075428_1015026152 | 113 |
| 268 | 3300006846 | Ga0075430_100010623 | Ga0075430_1000106234 | 113 |
| 269 | 3300006846 | Ga0075430_100025571 | Ga0075430_1000255716 | 113 |
| 270 | 3300006846 | Ga0075430_100217121 | Ga0075430_1002171213 | 113 |
| 271 | 3300006846 | Ga0075430_100288860 | Ga0075430_1002888602 | 113 |
| 272 | 3300006846 | Ga0075430_100572120 | Ga0075430_1005721202 | 113 |
| 273 | 3300006847 | Ga0075431_100041310 | Ga0075431_1000413105 | 113 |
| 274 | 3300006847 | Ga0075431_100225523 | Ga0075431_1002255233 | 113 |
| 275 | 3300006847 | Ga0075431_100424651 | Ga0075431_1004246512 | 113 |
| 276 | 3300006847 | Ga0075431_100458378 | Ga0075431_1004583783 | 113 |
| 277 | 3300006847 | Ga0075431_101774046 | Ga0075431_1017740462 | 113 |
| 278 | 3300006852 | Ga0075433_10073283 | Ga0075433_100732833 | 113 |
| 279 | 3300006852 | Ga0075433_10155677 | Ga0075433_101556772 | 113 |
| 280 | 3300006852 | Ga0075433_10169033 | Ga0075433_101690332 | 113 |
| 281 | 3300006852 | Ga0075433_10870778 | Ga0075433_108707782 | 113 |
| 282 | 3300006852 | Ga0075433_11166425 | Ga0075433_111664252 | 113 |
| 283 | 3300006852 | Ga0075433_11295840 | Ga0075433_112958402 | 113 |
| 284 | 3300006871 | Ga0075434_100007123 | Ga0075434_1000071239 | 113 |
| 285 | 3300006871 | Ga0075434_100052497 | Ga0075434_1000524976 | 113 |
| 286 | 3300006871 | Ga0075434_100059235 | Ga0075434_1000592355 | 113 |
| 287 | 3300006871 | Ga0075434_100167976 | Ga0075434_1001679764 | 113 |
| 288 | 3300006871 | Ga0075434_100954050 | Ga0075434_1009540502 | 113 |
| 289 | 3300006880 | Ga0075429_100016031 | Ga0075429_1000160317 | 113 |
| 290 | 3300006880 | Ga0075429_100587891 | Ga0075429_1005878912 | 113 |
| 291 | 3300006880 | Ga0075429_101909447 | Ga0075429_1019094472 | 113 |
| 292 | 3300006881 | Ga0068865_100033606 | Ga0068865_1000336068 | 113 |
| 293 | 3300006881 | Ga0068865_100073421 | Ga0068865_1000734214 | 113 |
| 294 | 3300006914 | Ga0075436_100109694 | Ga0075436_1001096941 | 113 |
| 295 | 3300006914 | Ga0075436_100214013 | Ga0075436_1002140132 | 113 |
| 296 | 3300006914 | Ga0075436_100835162 | Ga0075436_1008351622 | 113 |
| 297 | 3300006931 | Ga0097620_100010699 | Ga0097620_10001069919 | 113 |
| 298 | 3300006931 | Ga0097620_100183747 | Ga0097620_1001837472 | 113 |
| 299 | 3300006931 | Ga0097620_100226690 | Ga0097620_1002266901 | 113 |
| 300 | 3300006931 | Ga0097620_100245694 | Ga0097620_1002456942 | 113 |
| 301 | 3300006931 | Ga0097620_100264804 | Ga0097620_1002648042 | 113 |
| 302 | 3300006931 | Ga0097620_101172505 | Ga0097620_1011725051 | 113 |
| 303 | 3300006931 | Ga0097620_102537449 | Ga0097620_1025374492 | 113 |
| 304 | 3300007076 | Ga0075435_100007891 | Ga0075435_1000078918 | 113 |
| 305 | 3300007076 | Ga0075435_100023266 | Ga0075435_1000232666 | 113 |
| 306 | 3300007076 | Ga0075435_100054962 | Ga0075435_1000549623 | 113 |
| 307 | 3300007076 | Ga0075435_100115820 | Ga0075435_1001158203 | 113 |
| 308 | 3300007076 | Ga0075435_100124764 | Ga0075435_1001247642 | 113 |
| 309 | 3300009093 | Ga0105240_10000359 | Ga0105240_1000035943 | 113 |
| 310 | 3300009093 | Ga0105240_10023357 | Ga0105240_100233576 | 113 |
| 311 | 3300009093 | Ga0105240_10038461 | Ga0105240_100384614 | 113 |
| 312 | 3300009093 | Ga0105240_10113171 | Ga0105240_101131713 | 113 |
| 313 | 3300009094 | Ga0111539_10007338 | Ga0111539_1000733812 | 113 |
| 314 | 3300009094 | Ga0111539_10042479 | Ga0111539_100424793 | 113 |
| 315 | 3300009094 | Ga0111539_10104577 | Ga0111539_101045777 | 113 |
| 316 | 3300009094 | Ga0111539_10117917 | Ga0111539_101179174 | 113 |
| 317 | 3300009094 | Ga0111539_10278365 | Ga0111539_102783652 | 113 |
| 318 | 3300009094 | Ga0111539_11755420 | Ga0111539_117554202 | 113 |
| 319 | 3300009094 | Ga0111539_12845391 | Ga0111539_128453911 | 113 |
| 320 | 3300009098 | Ga0105245_10016068 | Ga0105245_100160689 | 113 |
| 321 | 3300009098 | Ga0105245_10017096 | Ga0105245_100170964 | 113 |
| 322 | 3300009098 | Ga0105245_10087047 | Ga0105245_100870472 | 113 |
| 323 | 3300009098 | Ga0105245_10381573 | Ga0105245_103815732 | 113 |
| 324 | 3300009098 | Ga0105245_10483212 | Ga0105245_104832122 | 113 |
| 325 | 3300009101 | Ga0105247_10018198 | Ga0105247_100181985 | 113 |
| 326 | 3300009101 | Ga0105247_10209005 | Ga0105247_102090052 | 113 |
| 327 | 3300009147 | Ga0114129_10047118 | Ga0114129_100471187 | 113 |
| 328 | 3300009147 | Ga0114129_10692500 | Ga0114129_106925002 | 113 |
| 329 | 3300009147 | Ga0114129_10899346 | Ga0114129_108993463 | 113 |
| 330 | 3300009147 | Ga0114129_11505430 | Ga0114129_115054302 | 113 |
| 331 | 3300009148 | Ga0105243_10072940 | Ga0105243_100729403 | 113 |
| 332 | 3300009148 | Ga0105243_10077148 | Ga0105243_100771483 | 113 |
| 333 | 3300009174 | Ga0105241_10003177 | Ga0105241_1000317712 | 113 |
| 334 | 3300009174 | Ga0105241_10038649 | Ga0105241_100386494 | 113 |
| 335 | 3300009174 | Ga0105241_10183206 | Ga0105241_101832063 | 113 |
| 336 | 3300009174 | Ga0105241_10427894 | Ga0105241_104278942 | 113 |
| 337 | 3300009174 | Ga0105241_10439423 | Ga0105241_104394232 | 113 |
| 338 | 3300009174 | Ga0105241_10834505 | Ga0105241_108345051 | 113 |
| 339 | 3300009176 | Ga0105242_10002472 | Ga0105242_1000247219 | 113 |
| 340 | 3300009177 | Ga0105248_10005132 | Ga0105248_1000513210 | 113 |
| 341 | 3300009177 | Ga0105248_10071443 | Ga0105248_100714432 | 113 |
| 342 | 3300009177 | Ga0105248_10211174 | Ga0105248_102111743 | 113 |
| 343 | 3300009177 | Ga0105248_10347752 | Ga0105248_103477524 | 113 |
| 344 | 3300009177 | Ga0105248_11106372 | Ga0105248_111063722 | 113 |
| 345 | 3300009545 | Ga0105237_10000352 | Ga0105237_100003524 | 113 |
| 346 | 3300009545 | Ga0105237_10024750 | Ga0105237_100247504 | 113 |
| 347 | 3300009545 | Ga0105237_10047645 | Ga0105237_100476455 | 113 |
| 348 | 3300009545 | Ga0105237_10071260 | Ga0105237_100712603 | 113 |
| 349 | 3300009551 | Ga0105238_10001859 | Ga0105238_100018599 | 113 |
| 350 | 3300009551 | Ga0105238_10146513 | Ga0105238_101465132 | 113 |
| 351 | 3300009551 | Ga0105238_10343386 | Ga0105238_103433862 | 113 |
| 352 | 3300009551 | Ga0105238_11546371 | Ga0105238_115463711 | 113 |
| 353 | 3300009553 | Ga0105249_10002479 | Ga0105249_100024797 | 113 |
| 354 | 3300009553 | Ga0105249_10022793 | Ga0105249_100227933 | 113 |
| 355 | 3300009553 | Ga0105249_10115152 | Ga0105249_101151522 | 113 |
| 356 | 3300010375 | Ga0105239_10051215 | Ga0105239_100512152 | 113 |
| 357 | 3300010375 | Ga0105239_10185391 | Ga0105239_101853913 | 113 |
| 358 | 3300010375 | Ga0105239_10238872 | Ga0105239_102388722 | 113 |
| 359 | 3300010375 | Ga0105239_10425075 | Ga0105239_104250753 | 113 |
| 360 | 3300010375 | Ga0105239_10544030 | Ga0105239_105440302 | 113 |
| 361 | 3300010375 | Ga0105239_12540532 | Ga0105239_125405321 | 113 |
| 362 | 3300011119 | Ga0105246_10069060 | Ga0105246_100690605 | 113 |
| 363 | 3300011119 | Ga0105246_10176664 | Ga0105246_101766643 | 113 |
| 364 | 3300011119 | Ga0105246_10316165 | Ga0105246_103161652 | 113 |
| 365 | 3300011119 | Ga0105246_10585939 | Ga0105246_105859391 | 113 |
| 366 | 3300012500 | Ga0157314_1000067 | Ga0157314_10000675 | 113 |
| 367 | 3300013100 | Ga0157373_10424097 | Ga0157373_104240972 | 113 |
| 368 | 3300013102 | Ga0157371_10204115 | Ga0157371_102041154 | 113 |
| 369 | 3300013102 | Ga0157371_10347447 | Ga0157371_103474472 | 113 |
| 370 | 3300013102 | Ga0157371_11281468 | Ga0157371_112814681 | 113 |
| 371 | 3300013104 | Ga0157370_10918498 | Ga0157370_109184982 | 113 |
| 372 | 3300013105 | Ga0157369_10077917 | Ga0157369_100779175 | 113 |
| 373 | 3300013105 | Ga0157369_10310311 | Ga0157369_103103112 | 113 |
| 374 | 3300013105 | Ga0157369_11836721 | Ga0157369_118367211 | 113 |
| 375 | 3300013296 | Ga0157374_10001826 | Ga0157374_1000182616 | 113 |
| 376 | 3300013296 | Ga0157374_10092035 | Ga0157374_100920355 | 113 |
| 377 | 3300013296 | Ga0157374_10269036 | Ga0157374_102690362 | 113 |
| 378 | 3300013297 | Ga0157378_10004007 | Ga0157378_100040078 | 113 |
| 379 | 3300013297 | Ga0157378_10004796 | Ga0157378_1000479619 | 113 |
| 380 | 3300013297 | Ga0157378_10071616 | Ga0157378_100716165 | 113 |
| 381 | 3300013306 | Ga0163162_10001742 | Ga0163162_1000174213 | 113 |
| 382 | 3300013306 | Ga0163162_10037794 | Ga0163162_100377946 | 113 |
| 383 | 3300013306 | Ga0163162_10205427 | Ga0163162_102054274 | 113 |
| 384 | 3300013306 | Ga0163162_10205439 | Ga0163162_102054393 | 113 |
| 385 | 3300013306 | Ga0163162_10910649 | Ga0163162_109106493 | 113 |
| 386 | 3300013306 | Ga0163162_12146541 | Ga0163162_121465411 | 113 |
| 387 | 3300013307 | Ga0157372_10010513 | Ga0157372_100105136 | 113 |
| 388 | 3300013307 | Ga0157372_10171724 | Ga0157372_101717243 | 113 |
| 389 | 3300013307 | Ga0157372_10269587 | Ga0157372_102695872 | 113 |
| 390 | 3300013307 | Ga0157372_11586917 | Ga0157372_115869171 | 113 |
| 391 | 3300013307 | Ga0157372_11622152 | Ga0157372_116221522 | 113 |
| 392 | 3300013308 | Ga0157375_10044913 | Ga0157375_100449132 | 113 |
| 393 | 3300013308 | Ga0157375_10067542 | Ga0157375_100675425 | 113 |
| 394 | 3300013308 | Ga0157375_10296097 | Ga0157375_102960973 | 113 |
| 395 | 3300013308 | Ga0157375_10356914 | Ga0157375_103569142 | 113 |
| 396 | 3300013308 | Ga0157375_11712547 | Ga0157375_117125472 | 113 |
| 397 | 3300013308 | Ga0157375_12167900 | Ga0157375_121679002 | 113 |
| 398 | 3300014325 | Ga0163163_10597959 | Ga0163163_105979592 | 113 |
| 399 | 3300014325 | Ga0163163_10911200 | Ga0163163_109112001 | 113 |
| 400 | 3300014325 | Ga0163163_11191680 | Ga0163163_111916802 | 113 |
| 401 | 3300014745 | Ga0157377_10003883 | Ga0157377_100038839 | 113 |
| 402 | 3300014745 | Ga0157377_10018007 | Ga0157377_100180076 | 113 |
| 403 | 3300014745 | Ga0157377_11628062 | Ga0157377_116280621 | 113 |
| 404 | 3300014968 | Ga0157379_10068889 | Ga0157379_100688892 | 113 |
| 405 | 3300014968 | Ga0157379_10245222 | Ga0157379_102452221 | 113 |
| 406 | 3300014968 | Ga0157379_10849457 | Ga0157379_108494571 | 113 |
| 407 | 3300014969 | Ga0157376_10002651 | Ga0157376_1000265110 | 113 |
| 408 | 3300014969 | Ga0157376_10146509 | Ga0157376_101465093 | 113 |
| 409 | 3300014969 | Ga0157376_10498383 | Ga0157376_104983831 | 113 |
| 410 | 3300015687 | Ga0183368_1004 | Ga0183368_1004405 | 113 |
| 411 | 3300017792 | Ga0163161_11208459 | Ga0163161_112084592 | 113 |
| 412 | 3300017792 | Ga0163161_11254709 | Ga0163161_112547091 | 113 |
| 413 | 3300021358 | Ga0213873_10092600 | Ga0213873_100926002 | 113 |
| 414 | 3300021384 | Ga0213876_10173977 | Ga0213876_101739772 | 113 |
| 415 | 3300021384 | Ga0213876_10370952 | Ga0213876_103709522 | 113 |
| 416 | 3300025226 | Ga0209674_100016 | Ga0209674_100016227 | 113 |
| 417 | 3300025228 | Ga0209672_100005 | Ga0209672_100005385 | 113 |
| 418 | 3300025230 | Ga0209563_100023 | Ga0209563_10002341 | 113 |
| 419 | 3300025242 | Ga0209258_100006 | Ga0209258_100006385 | 113 |
| 420 | 3300025254 | Ga0209148_1000012 | Ga0209148_1000012385 | 113 |
| 421 | 3300025258 | Ga0209129_1009423 | Ga0209129_10094231 | 113 |
| 422 | 3300025261 | Ga0209233_1001457 | Ga0209233_10014573 | 113 |
| 423 | 3300025263 | Ga0209565_1000003 | Ga0209565_1000003476 | 113 |
| 424 | 3300025272 | Ga0209455_1000008 | Ga0209455_1000008385 | 113 |
| 425 | 3300025273 | Ga0209673_1000003 | Ga0209673_1000003362 | 113 |
| 426 | 3300025291 | Ga0209675_1000003 | Ga0209675_1000003562 | 113 |
| 427 | 3300025291 | Ga0209675_1032146 | Ga0209675_10321462 | 113 |
| 428 | 3300025292 | Ga0209676_1037045 | Ga0209676_10370451 | 113 |
| 429 | 3300025295 | Ga0209564_1000012 | Ga0209564_1000012370 | 113 |
| 430 | 3300025297 | Ga0209758_1000812 | Ga0209758_100081233 | 113 |
| 431 | 3300025297 | Ga0209758_1024429 | Ga0209758_10244293 | 113 |
| 432 | 3300025298 | Ga0209050_1004472 | Ga0209050_10044721 | 113 |
| 433 | 3300025299 | Ga0209256_1000112 | Ga0209256_100011217 | 113 |
| 434 | 3300025302 | Ga0207426_1149889 | Ga0207426_11498891 | 113 |
| 435 | 3300025303 | Ga0209051_1070245 | Ga0209051_10702453 | 113 |
| 436 | 3300025304 | Ga0209257_1105659 | Ga0209257_11056591 | 113 |
| 437 | 3300025315 | Ga0207697_10045371 | Ga0207697_100453714 | 113 |
| 438 | 3300025321 | Ga0207656_10016793 | Ga0207656_100167933 | 113 |
| 439 | 3300025321 | Ga0207656_10120084 | Ga0207656_101200842 | 113 |
| 440 | 3300025321 | Ga0207656_10325483 | Ga0207656_103254831 | 113 |
| 441 | 3300025898 | Ga0207692_10067923 | Ga0207692_100679231 | 113 |
| 442 | 3300025899 | Ga0207642_10009036 | Ga0207642_100090362 | 113 |
| 443 | 3300025899 | Ga0207642_10128445 | Ga0207642_101284453 | 113 |
| 444 | 3300025899 | Ga0207642_10313475 | Ga0207642_103134752 | 113 |
| 445 | 3300025900 | Ga0207710_10144557 | Ga0207710_101445572 | 113 |
| 446 | 3300025901 | Ga0207688_10014280 | Ga0207688_100142804 | 113 |
| 447 | 3300025903 | Ga0207680_10010109 | Ga0207680_100101094 | 113 |
| 448 | 3300025903 | Ga0207680_10261134 | Ga0207680_102611342 | 113 |
| 449 | 3300025903 | Ga0207680_10416712 | Ga0207680_104167122 | 113 |
| 450 | 3300025904 | Ga0207647_10000066 | Ga0207647_1000006626 | 113 |
| 451 | 3300025904 | Ga0207647_10002628 | Ga0207647_100026284 | 113 |
| 452 | 3300025904 | Ga0207647_10032756 | Ga0207647_100327562 | 113 |
| 453 | 3300025905 | Ga0207685_10057933 | Ga0207685_100579333 | 113 |
| 454 | 3300025906 | Ga0207699_10143414 | Ga0207699_101434142 | 113 |
| 455 | 3300025907 | Ga0207645_10135695 | Ga0207645_101356954 | 113 |
| 456 | 3300025907 | Ga0207645_10793937 | Ga0207645_107939372 | 113 |
| 457 | 3300025907 | Ga0207645_11100688 | Ga0207645_111006881 | 113 |
| 458 | 3300025908 | Ga0207643_10098595 | Ga0207643_100985951 | 113 |
| 459 | 3300025908 | Ga0207643_10405908 | Ga0207643_104059082 | 113 |
| 460 | 3300025909 | Ga0207705_10121180 | Ga0207705_101211802 | 113 |
| 461 | 3300025909 | Ga0207705_10441365 | Ga0207705_104413652 | 113 |
| 462 | 3300025911 | Ga0207654_10020051 | Ga0207654_100200515 | 113 |
| 463 | 3300025911 | Ga0207654_10072548 | Ga0207654_100725483 | 113 |
| 464 | 3300025911 | Ga0207654_10173309 | Ga0207654_101733092 | 113 |
| 465 | 3300025911 | Ga0207654_10416425 | Ga0207654_104164252 | 113 |
| 466 | 3300025911 | Ga0207654_10498138 | Ga0207654_104981382 | 113 |
| 467 | 3300025912 | Ga0207707_10039511 | Ga0207707_100395114 | 113 |
| 468 | 3300025912 | Ga0207707_10154075 | Ga0207707_101540753 | 113 |
| 469 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014496 | 113 |
| 470 | 3300025913 | Ga0207695_10003135 | Ga0207695_1000313516 | 113 |
| 471 | 3300025913 | Ga0207695_10042600 | Ga0207695_100426002 | 113 |
| 472 | 3300025913 | Ga0207695_10080322 | Ga0207695_100803222 | 113 |
| 473 | 3300025913 | Ga0207695_10113233 | Ga0207695_101132333 | 113 |
| 474 | 3300025914 | Ga0207671_10000021 | Ga0207671_1000002134 | 113 |
| 475 | 3300025914 | Ga0207671_10021309 | Ga0207671_100213095 | 113 |
| 476 | 3300025914 | Ga0207671_10054020 | Ga0207671_100540202 | 113 |
| 477 | 3300025914 | Ga0207671_10138304 | Ga0207671_101383041 | 113 |
| 478 | 3300025915 | Ga0207693_10002141 | Ga0207693_1000214116 | 113 |
| 479 | 3300025916 | Ga0207663_10010953 | Ga0207663_100109538 | 113 |
| 480 | 3300025916 | Ga0207663_10233619 | Ga0207663_102336192 | 113 |
| 481 | 3300025917 | Ga0207660_10171876 | Ga0207660_101718763 | 113 |
| 482 | 3300025918 | Ga0207662_10005004 | Ga0207662_100050049 | 113 |
| 483 | 3300025918 | Ga0207662_10090177 | Ga0207662_100901774 | 113 |
| 484 | 3300025920 | Ga0207649_10002856 | Ga0207649_100028566 | 113 |
| 485 | 3300025920 | Ga0207649_10026219 | Ga0207649_100262196 | 113 |
| 486 | 3300025920 | Ga0207649_10031191 | Ga0207649_100311912 | 113 |
| 487 | 3300025921 | Ga0207652_10408876 | Ga0207652_104088763 | 113 |
| 488 | 3300025921 | Ga0207652_10827822 | Ga0207652_108278222 | 113 |
| 489 | 3300025923 | Ga0207681_10005638 | Ga0207681_100056388 | 113 |
| 490 | 3300025923 | Ga0207681_10382072 | Ga0207681_103820722 | 113 |
| 491 | 3300025923 | Ga0207681_10778103 | Ga0207681_107781031 | 113 |
| 492 | 3300025924 | Ga0207694_10001117 | Ga0207694_100011179 | 113 |
| 493 | 3300025924 | Ga0207694_10007223 | Ga0207694_100072237 | 113 |
| 494 | 3300025924 | Ga0207694_10207344 | Ga0207694_102073443 | 113 |
| 495 | 3300025925 | Ga0207650_10001147 | Ga0207650_1000114712 | 113 |
| 496 | 3300025925 | Ga0207650_10025553 | Ga0207650_100255535 | 113 |
| 497 | 3300025925 | Ga0207650_10154662 | Ga0207650_101546621 | 113 |
| 498 | 3300025925 | Ga0207650_10192856 | Ga0207650_101928562 | 113 |
| 499 | 3300025925 | Ga0207650_10531716 | Ga0207650_105317162 | 113 |
| 500 | 3300025926 | Ga0207659_10000565 | Ga0207659_1000056511 | 113 |
| 501 | 3300025926 | Ga0207659_10212343 | Ga0207659_102123432 | 113 |
| 502 | 3300025926 | Ga0207659_10387341 | Ga0207659_103873412 | 113 |
| 503 | 3300025926 | Ga0207659_10859443 | Ga0207659_108594431 | 113 |
| 504 | 3300025926 | Ga0207659_11152020 | Ga0207659_111520202 | 113 |
| 505 | 3300025927 | Ga0207687_10000151 | Ga0207687_1000015110 | 113 |
| 506 | 3300025927 | Ga0207687_10036212 | Ga0207687_100362122 | 113 |
| 507 | 3300025927 | Ga0207687_10220705 | Ga0207687_102207052 | 113 |
| 508 | 3300025927 | Ga0207687_10273517 | Ga0207687_102735172 | 113 |
| 509 | 3300025927 | Ga0207687_10274065 | Ga0207687_102740652 | 113 |
| 510 | 3300025928 | Ga0207700_10132492 | Ga0207700_101324924 | 113 |
| 511 | 3300025929 | Ga0207664_10591853 | Ga0207664_105918531 | 113 |
| 512 | 3300025929 | Ga0207664_11550136 | Ga0207664_115501362 | 113 |
| 513 | 3300025931 | Ga0207644_10001345 | Ga0207644_100013457 | 113 |
| 514 | 3300025931 | Ga0207644_10018240 | Ga0207644_100182403 | 113 |
| 515 | 3300025931 | Ga0207644_10039873 | Ga0207644_100398734 | 113 |
| 516 | 3300025931 | Ga0207644_10377148 | Ga0207644_103771483 | 113 |
| 517 | 3300025932 | Ga0207690_10017826 | Ga0207690_100178265 | 113 |
| 518 | 3300025932 | Ga0207690_10294947 | Ga0207690_102949472 | 113 |
| 519 | 3300025932 | Ga0207690_10407710 | Ga0207690_104077102 | 113 |
| 520 | 3300025932 | Ga0207690_11417620 | Ga0207690_114176202 | 113 |
| 521 | 3300025932 | Ga0207690_11729732 | Ga0207690_117297322 | 113 |
| 522 | 3300025933 | Ga0207706_10006270 | Ga0207706_1000627011 | 113 |
| 523 | 3300025933 | Ga0207706_10010590 | Ga0207706_100105906 | 113 |
| 524 | 3300025933 | Ga0207706_10013626 | Ga0207706_100136269 | 113 |
| 525 | 3300025933 | Ga0207706_10027587 | Ga0207706_1002758710 | 113 |
| 526 | 3300025933 | Ga0207706_10037955 | Ga0207706_100379551 | 113 |
| 527 | 3300025933 | Ga0207706_11325158 | Ga0207706_113251581 | 113 |
| 528 | 3300025934 | Ga0207686_10003571 | Ga0207686_1000357112 | 113 |
| 529 | 3300025934 | Ga0207686_10004666 | Ga0207686_100046666 | 113 |
| 530 | 3300025934 | Ga0207686_10584076 | Ga0207686_105840762 | 113 |
| 531 | 3300025936 | Ga0207670_10017900 | Ga0207670_100179004 | 113 |
| 532 | 3300025936 | Ga0207670_10188726 | Ga0207670_101887261 | 113 |
| 533 | 3300025936 | Ga0207670_11470805 | Ga0207670_114708051 | 113 |
| 534 | 3300025937 | Ga0207669_10025492 | Ga0207669_100254922 | 113 |
| 535 | 3300025938 | Ga0207704_10146095 | Ga0207704_101460951 | 113 |
| 536 | 3300025938 | Ga0207704_10489492 | Ga0207704_104894922 | 113 |
| 537 | 3300025939 | Ga0207665_10035866 | Ga0207665_100358666 | 113 |
| 538 | 3300025940 | Ga0207691_10001567 | Ga0207691_1000156710 | 113 |
| 539 | 3300025940 | Ga0207691_10046431 | Ga0207691_100464312 | 113 |
| 540 | 3300025940 | Ga0207691_10048350 | Ga0207691_100483507 | 113 |
| 541 | 3300025940 | Ga0207691_10886565 | Ga0207691_108865651 | 113 |
| 542 | 3300025941 | Ga0207711_10010889 | Ga0207711_1001088914 | 113 |
| 543 | 3300025941 | Ga0207711_10032060 | Ga0207711_100320602 | 113 |
| 544 | 3300025941 | Ga0207711_10149157 | Ga0207711_101491572 | 113 |
| 545 | 3300025941 | Ga0207711_10572967 | Ga0207711_105729672 | 113 |
| 546 | 3300025941 | Ga0207711_10864028 | Ga0207711_108640281 | 113 |
| 547 | 3300025941 | Ga0207711_11657522 | Ga0207711_116575221 | 113 |
| 548 | 3300025942 | Ga0207689_10074927 | Ga0207689_100749272 | 113 |
| 549 | 3300025942 | Ga0207689_10081879 | Ga0207689_100818793 | 113 |
| 550 | 3300025942 | Ga0207689_10119161 | Ga0207689_101191612 | 113 |
| 551 | 3300025942 | Ga0207689_10125012 | Ga0207689_101250122 | 113 |
| 552 | 3300025942 | Ga0207689_10132403 | Ga0207689_101324035 | 113 |
| 553 | 3300025944 | Ga0207661_10006434 | Ga0207661_100064342 | 113 |
| 554 | 3300025944 | Ga0207661_10879566 | Ga0207661_108795662 | 113 |
| 555 | 3300025944 | Ga0207661_11217067 | Ga0207661_112170672 | 113 |
| 556 | 3300025945 | Ga0207679_10000325 | Ga0207679_1000032545 | 113 |
| 557 | 3300025945 | Ga0207679_10000882 | Ga0207679_1000088217 | 113 |
| 558 | 3300025945 | Ga0207679_10001337 | Ga0207679_100013373 | 113 |
| 559 | 3300025945 | Ga0207679_10268198 | Ga0207679_102681983 | 113 |
| 560 | 3300025949 | Ga0207667_10000737 | Ga0207667_1000073716 | 113 |
| 561 | 3300025949 | Ga0207667_10002458 | Ga0207667_100024588 | 113 |
| 562 | 3300025949 | Ga0207667_11874370 | Ga0207667_118743701 | 113 |
| 563 | 3300025960 | Ga0207651_10009071 | Ga0207651_100090715 | 113 |
| 564 | 3300025960 | Ga0207651_10031488 | Ga0207651_100314885 | 113 |
| 565 | 3300025960 | Ga0207651_10158054 | Ga0207651_101580542 | 113 |
| 566 | 3300025961 | Ga0207712_10000522 | Ga0207712_1000052219 | 113 |
| 567 | 3300025961 | Ga0207712_10005594 | Ga0207712_100055948 | 113 |
| 568 | 3300025972 | Ga0207668_10272782 | Ga0207668_102727822 | 113 |
| 569 | 3300025972 | Ga0207668_10944947 | Ga0207668_109449472 | 113 |
| 570 | 3300025981 | Ga0207640_10000095 | Ga0207640_1000009513 | 113 |
| 571 | 3300025981 | Ga0207640_10003159 | Ga0207640_100031598 | 113 |
| 572 | 3300025981 | Ga0207640_10014742 | Ga0207640_100147424 | 113 |
| 573 | 3300025981 | Ga0207640_10019570 | Ga0207640_100195703 | 113 |
| 574 | 3300025981 | Ga0207640_10267681 | Ga0207640_102676812 | 113 |
| 575 | 3300025986 | Ga0207658_10033457 | Ga0207658_100334572 | 113 |
| 576 | 3300025986 | Ga0207658_10151570 | Ga0207658_101515704 | 113 |
| 577 | 3300026023 | Ga0207677_10000593 | Ga0207677_100005934 | 113 |
| 578 | 3300026023 | Ga0207677_10000724 | Ga0207677_1000072410 | 113 |
| 579 | 3300026023 | Ga0207677_10092834 | Ga0207677_100928344 | 113 |
| 580 | 3300026023 | Ga0207677_10450732 | Ga0207677_104507322 | 113 |
| 581 | 3300026023 | Ga0207677_10864923 | Ga0207677_108649232 | 113 |
| 582 | 3300026035 | Ga0207703_10013607 | Ga0207703_100136074 | 113 |
| 583 | 3300026035 | Ga0207703_10018778 | Ga0207703_100187782 | 113 |
| 584 | 3300026035 | Ga0207703_10089421 | Ga0207703_100894212 | 113 |
| 585 | 3300026035 | Ga0207703_10457604 | Ga0207703_104576043 | 113 |
| 586 | 3300026041 | Ga0207639_10000733 | Ga0207639_1000073310 | 113 |
| 587 | 3300026067 | Ga0207678_10000577 | Ga0207678_1000057730 | 113 |
| 588 | 3300026067 | Ga0207678_10111625 | Ga0207678_101116254 | 113 |
| 589 | 3300026067 | Ga0207678_10145805 | Ga0207678_101458052 | 113 |
| 590 | 3300026067 | Ga0207678_10146311 | Ga0207678_101463112 | 113 |
| 591 | 3300026067 | Ga0207678_10272628 | Ga0207678_102726282 | 113 |
| 592 | 3300026075 | Ga0207708_10082602 | Ga0207708_100826022 | 113 |
| 593 | 3300026075 | Ga0207708_10551622 | Ga0207708_105516222 | 113 |
| 594 | 3300026078 | Ga0207702_10121946 | Ga0207702_101219464 | 113 |
| 595 | 3300026078 | Ga0207702_10624867 | Ga0207702_106248672 | 113 |
| 596 | 3300026088 | Ga0207641_10206474 | Ga0207641_102064744 | 113 |
| 597 | 3300026088 | Ga0207641_10247050 | Ga0207641_102470502 | 113 |
| 598 | 3300026088 | Ga0207641_10708959 | Ga0207641_107089592 | 113 |
| 599 | 3300026089 | Ga0207648_10007978 | Ga0207648_100079789 | 113 |
| 600 | 3300026089 | Ga0207648_10012363 | Ga0207648_100123635 | 113 |
| 601 | 3300026089 | Ga0207648_10081329 | Ga0207648_100813293 | 113 |
| 602 | 3300026089 | Ga0207648_10346373 | Ga0207648_103463732 | 113 |
| 603 | 3300026089 | Ga0207648_11047408 | Ga0207648_110474082 | 113 |
| 604 | 3300026089 | Ga0207648_11230574 | Ga0207648_112305742 | 113 |
| 605 | 3300026095 | Ga0207676_10003284 | Ga0207676_1000328411 | 113 |
| 606 | 3300026095 | Ga0207676_10007085 | Ga0207676_100070854 | 113 |
| 607 | 3300026095 | Ga0207676_10052999 | Ga0207676_100529995 | 113 |
| 608 | 3300026095 | Ga0207676_10429802 | Ga0207676_104298022 | 113 |
| 609 | 3300026095 | Ga0207676_11097675 | Ga0207676_110976752 | 113 |
| 610 | 3300026116 | Ga0207674_10002447 | Ga0207674_1000244715 | 113 |
| 611 | 3300026116 | Ga0207674_10124212 | Ga0207674_101242126 | 113 |
| 612 | 3300026116 | Ga0207674_10155679 | Ga0207674_101556792 | 113 |
| 613 | 3300026118 | Ga0207675_100000354 | Ga0207675_10000035418 | 113 |
| 614 | 3300026118 | Ga0207675_100015382 | Ga0207675_1000153829 | 113 |
| 615 | 3300026118 | Ga0207675_100515472 | Ga0207675_1005154721 | 113 |
| 616 | 3300026118 | Ga0207675_100685933 | Ga0207675_1006859331 | 113 |
| 617 | 3300026118 | Ga0207675_102703056 | Ga0207675_1027030561 | 113 |
| 618 | 3300026121 | Ga0207683_10000739 | Ga0207683_1000073913 | 113 |
| 619 | 3300026121 | Ga0207683_10001084 | Ga0207683_1000108431 | 113 |
| 620 | 3300026121 | Ga0207683_10449975 | Ga0207683_104499752 | 113 |
| 621 | 3300026121 | Ga0207683_10475871 | Ga0207683_104758713 | 113 |
| 622 | 3300026121 | Ga0207683_10697643 | Ga0207683_106976432 | 113 |
| 623 | 3300026142 | Ga0207698_10000375 | Ga0207698_1000037519 | 113 |
| 624 | 3300026142 | Ga0207698_10405676 | Ga0207698_104056762 | 113 |
| 625 | 3300026142 | Ga0207698_10859865 | Ga0207698_108598652 | 113 |
| 626 | 3300026142 | Ga0207698_10891252 | Ga0207698_108912522 | 113 |
| 627 | 3300026142 | Ga0207698_10992343 | Ga0207698_109923431 | 113 |
| 628 | 3300026142 | Ga0207698_11233694 | Ga0207698_112336942 | 113 |
| 629 | 3300027907 | Ga0207428_10059015 | Ga0207428_100590153 | 113 |
| 630 | 3300027907 | Ga0207428_10608199 | Ga0207428_106081992 | 113 |
| 631 | 3300028379 | Ga0268266_10015750 | Ga0268266_100157509 | 113 |
| 632 | 3300028379 | Ga0268266_10420697 | Ga0268266_104206972 | 113 |
| 633 | 3300028379 | Ga0268266_10433629 | Ga0268266_104336292 | 113 |
| 634 | 3300028379 | Ga0268266_11560065 | Ga0268266_115600651 | 113 |
| 635 | 3300028380 | Ga0268265_10001830 | Ga0268265_100018307 | 113 |
| 636 | 3300028380 | Ga0268265_10030100 | Ga0268265_100301007 | 113 |
| 637 | 3300028380 | Ga0268265_10222728 | Ga0268265_102227283 | 113 |
| 638 | 3300028381 | Ga0268264_10001344 | Ga0268264_1000134418 | 113 |
| 639 | 3300028381 | Ga0268264_10189775 | Ga0268264_101897753 | 113 |
| 640 | 3300028381 | Ga0268264_10532258 | Ga0268264_105322581 | 113 |
| 641 | 3300028381 | Ga0268264_10909345 | Ga0268264_109093451 | 113 |
| 642 | 3300028381 | Ga0268264_11489424 | Ga0268264_114894242 | 113 |
| 643 | 3300028577 | Ga0265318_10124756 | Ga0265318_101247562 | 113 |
| 644 | 3300029957 | Ga0265324_10054369 | Ga0265324_100543692 | 113 |
| 645 | 3300030731 | Ga0316177_1136856 | Ga0316177_11368562 | 113 |
| 646 | 3300030736 | Ga0316180_1120196 | Ga0316180_11201965 | 113 |
| 647 | 3300030742 | Ga0316183_1091464 | Ga0316183_10914643 | 113 |
| 648 | 3300030745 | Ga0316182_1072389 | Ga0316182_10723893 | 113 |
| 649 | 3300031241 | Ga0265325_10023630 | Ga0265325_100236304 | 113 |
| 650 | 3300031242 | Ga0265329_10110809 | Ga0265329_101108091 | 113 |
| 651 | 3300031249 | Ga0265339_10000995 | Ga0265339_100009954 | 113 |
| 652 | 3300031249 | Ga0265339_10213815 | Ga0265339_102138152 | 113 |
| 653 | 3300031344 | Ga0265316_10001965 | Ga0265316_100019659 | 113 |
| 654 | 3300031456 | Ga0307513_10000013 | Ga0307513_10000013294 | 113 |
| 655 | 3300031456 | Ga0307513_10091189 | Ga0307513_100911892 | 113 |
| 656 | 3300031548 | Ga0307408_100038091 | Ga0307408_1000380913 | 113 |
| 657 | 3300031548 | Ga0307408_100684045 | Ga0307408_1006840452 | 113 |
| 658 | 3300031711 | Ga0265314_10000011 | Ga0265314_10000011322 | 113 |
| 659 | 3300031730 | Ga0307516_10414595 | Ga0307516_104145952 | 113 |
| 660 | 3300031731 | Ga0307405_10003810 | Ga0307405_100038105 | 113 |
| 661 | 3300031824 | Ga0307413_10111755 | Ga0307413_101117552 | 113 |
| 662 | 3300031824 | Ga0307413_10534828 | Ga0307413_105348282 | 113 |
| 663 | 3300031824 | Ga0307413_10750307 | Ga0307413_107503072 | 113 |
| 664 | 3300031824 | Ga0307413_11161138 | Ga0307413_111611381 | 113 |
| 665 | 3300031852 | Ga0307410_10003663 | Ga0307410_100036637 | 113 |
| 666 | 3300031852 | Ga0307410_10213049 | Ga0307410_102130491 | 113 |
| 667 | 3300031852 | Ga0307410_10814665 | Ga0307410_108146652 | 113 |
| 668 | 3300031901 | Ga0307406_10003561 | Ga0307406_1000356113 | 113 |
| 669 | 3300031901 | Ga0307406_10712158 | Ga0307406_107121581 | 113 |
| 670 | 3300031911 | Ga0307412_10015536 | Ga0307412_100155365 | 113 |
| 671 | 3300031995 | Ga0307409_100011302 | Ga0307409_1000113022 | 113 |
| 672 | 3300031995 | Ga0307409_101359949 | Ga0307409_1013599491 | 113 |
| 673 | 3300032002 | Ga0307416_100037270 | Ga0307416_1000372705 | 113 |
| 674 | 3300032002 | Ga0307416_100080935 | Ga0307416_1000809355 | 113 |
| 675 | 3300032004 | Ga0307414_10039087 | Ga0307414_100390873 | 113 |
| 676 | 3300032004 | Ga0307414_10112959 | Ga0307414_101129592 | 113 |
| 677 | 3300032004 | Ga0307414_10116106 | Ga0307414_101161062 | 113 |
| 678 | 3300032004 | Ga0307414_10386701 | Ga0307414_103867012 | 113 |
| 679 | 3300032004 | Ga0307414_10499369 | Ga0307414_104993692 | 113 |
| 680 | 3300032004 | Ga0307414_10814494 | Ga0307414_108144942 | 113 |
| 681 | 3300032004 | Ga0307414_11449133 | Ga0307414_114491332 | 113 |
| 682 | 3300032005 | Ga0307411_10007708 | Ga0307411_100077085 | 113 |
| 683 | 3300032005 | Ga0307411_10061658 | Ga0307411_100616583 | 113 |
| 684 | 3300032126 | Ga0307415_100003390 | Ga0307415_10000339010 | 113 |
| 685 | 3300032126 | Ga0307415_100251666 | Ga0307415_1002516662 | 113 |
| 686 | 3300032126 | Ga0307415_101307354 | Ga0307415_1013073541 | 113 |
| 687 | 3300032168 | Ga0316593_10018520 | Ga0316593_100185203 | 113 |
| 688 | 3300035083 | Ga0373926_0040057 | Ga0373926_0040057_620_961 | 113 |
| 689 | 3300035092 | Ga0373952_0184317 | Ga0373952_0184317_24_368 | 113 |
| 690 | 3300035111 | Ga0373923_0043833 | Ga0373923_0043833_481_852 | 113 |
| 691 | 3300035117 | Ga0373953_0028256 | Ga0373953_0028256_1744_2115 | 113 |
| 692 | 3300035118 | Ga0373954_0014612 | Ga0373954_0014612_1021_1392 | 113 |
| 693 | 3300035119 | Ga0373956_0004538 | Ga0373956_0004538_4955_5296 | 113 |
| 694 | 3300035120 | Ga0373957_0016317 | Ga0373957_0016317_616_987 | 113 |
| 695 | 3300035172 | Ga0373955_0033285 | Ga0373955_0033285_233_604 | 113 |
| 696 | 3300035691 | Ga0373931_0705273 | Ga0373931_0705273_145_489 | 113 |
| 697 | 3300035692 | Ga0373935_0018663 | Ga0373935_0018663_3509_3850 | 113 |
| 698 | 3300035695 | Ga0373927_0151188 | Ga0373927_0151188_726_1097 | 113 |
| 699 | 3300035695 | Ga0373927_0411123 | Ga0373927_0411123_114_461 | 113 |
| 700 | 3300035724 | Ga0373933_0013246 | Ga0373933_0013246_1923_2294 | 113 |
| 701 | 3300035725 | Ga0373947_0096106 | Ga0373947_0096106_1113_1484 | 113 |
| 702 | 3300036401 | Ga0373937_0092431 | Ga0373937_0092431_1747_2118 | 113 |
| 703 | 3300036401 | Ga0373937_1905615 | Ga0373937_1905615_170_517 | 113 |
| 704 | 3300036647 | Ga0316582_0709899 | Ga0316582_0709899_83_430 | 113 |
| 705 | 3300037068 | Ga0373925_0022503 | Ga0373925_0022503_2255_2596 | 113 |
| 706 | 3300037068 | Ga0373925_0038230 | Ga0373925_0038230_1462_1803 | 113 |
| 707 | 3300037068 | Ga0373925_1687922 | Ga0373925_1687922_123_467 | 113 |
| 708 | 3300037312 | Ga0395899_0039616 | Ga0395899_0039616_135_482 | 113 |
| 709 | 3300037312 | Ga0395899_0087793 | Ga0395899_0087793_301_648 | 113 |
| 710 | 3300037312 | Ga0395899_0118570 | Ga0395899_0118570_86_433 | 113 |
| 711 | 3300037418 | Ga0395900_0005718 | Ga0395900_0005718_4533_4880 | 113 |
| 712 | 3300037418 | Ga0395900_0029162 | Ga0395900_0029162_5024_5371 | 113 |
| 713 | 3300037418 | Ga0395900_0116834 | Ga0395900_0116834_1437_1784 | 113 |
| 714 | 3300037418 | Ga0395900_1722809 | Ga0395900_1722809_82_426 | 113 |
| 715 | 3300037466 | Ga0395898_0013263 | Ga0395898_0013263_5346_5693 | 113 |
| 716 | 3300037466 | Ga0395898_0035116 | Ga0395898_0035116_4404_4751 | 113 |
| 717 | 3300037466 | Ga0395898_0448170 | Ga0395898_0448170_188_532 | 113 |
| 718 | 3300037471 | Ga0395905_0191105 | Ga0395905_0191105_1242_1589 | 113 |
| 719 | 3300037471 | Ga0395905_0367431 | Ga0395905_0367431_501_845 | 113 |
| 720 | 3300037471 | Ga0395905_0507953 | Ga0395905_0507953_83_430 | 113 |
| 721 | 3300037853 | Ga0436364_0462315 | Ga0436364_0462315_150_494 | 113 |
| 722 | 3300038443 | Ga0395901_0002206 | Ga0395901_0002206_1121_1468 | 113 |
| 723 | 3300038443 | Ga0395901_0021709 | Ga0395901_0021709_5985_6332 | 113 |
| 724 | 3300038443 | Ga0395901_0085643 | Ga0395901_0085643_616_963 | 113 |
| 725 | 3300038705 | Ga0237819_02800 | Ga0237819_02800_1352_1699 | 113 |
| 726 | 3300039145 | Ga0237816_01144 | Ga0237816_01144_830_1177 | 113 |
| 727 | 3300039437 | Ga0436365_0215467 | Ga0436365_0215467_675_1025 | 113 |
| 728 | 3300039437 | Ga0436365_0825797 | Ga0436365_0825797_397_741 | 113 |
| 729 | 3300039437 | Ga0436365_1220357 | Ga0436365_1220357_25_369 | 113 |
| 730 | 3300039438 | Ga0436360_1317327 | Ga0436360_1317327_79_423 | 113 |
| 731 | 3300039450 | Ga0436363_0196439 | Ga0436363_0196439_433_777 | 113 |
| 732 | 3300039453 | Ga0436362_0697552 | Ga0436362_0697552_477_821 | 113 |
| 733 | 3300041404 | Ga0439436_0007875 | Ga0439436_0007875_1959_2309 | 113 |
| 734 | 3300041460 | Ga0451802_1212438 | Ga0451802_1212438_163_504 | 113 |
| 735 | 3300041486 | Ga0451807_0416150 | Ga0451807_0416150_28_375 | 113 |
| 736 | 3300041492 | Ga0451835_0617162 | Ga0451835_0617162_264_611 | 113 |
| 737 | 3300041494 | Ga0451837_1258601 | Ga0451837_1258601_50_394 | 113 |
| 738 | 3300041509 | Ga0451843_0469666 | Ga0451843_0469666_158_502 | 113 |
| 739 | 3300042005 | Ga0439448_0084631 | Ga0439448_0084631_705_1052 | 113 |
| 740 | 3300042006 | Ga0439432_016013 | Ga0439432_016013_2065_2415 | 113 |
| 741 | 3300042007 | Ga0439449_0012385 | Ga0439449_0012385_1919_2269 | 113 |
| 742 | 3300042007 | Ga0439449_0113753 | Ga0439449_0113753_48_395 | 113 |
| 743 | 3300042157 | Ga0439458_0040733 | Ga0439458_0040733_222_572 | 113 |
| 744 | 3300042439 | Ga0439464_0013490 | Ga0439464_0013490_1058_1402 | 113 |
| 745 | 3300044656 | Ga0466969_0000016 | Ga0466969_0000016_5032_5376 | 113 |
| 746 | 3300044656 | Ga0466969_0024665 | Ga0466969_0024665_2100_2447 | 113 |
| 747 | 3300044656 | Ga0466969_0136566 | Ga0466969_0136566_77_424 | 113 |
| 748 | 3300044658 | Ga0466972_0002876 | Ga0466972_0002876_3678_4028 | 113 |
| 749 | 3300044658 | Ga0466972_0084981 | Ga0466972_0084981_155_502 | 113 |
| 750 | 3300044671 | Ga0466978_0247987 | Ga0466978_0247987_529_876 | 113 |
| 751 | 3300044672 | Ga0466982_0000005 | Ga0466982_0000005_81034_81381 | 113 |
| 752 | 3300044683 | Ga0466965_0012517 | Ga0466965_0012517_332_679 | 113 |
| 753 | 3300044683 | Ga0466965_0091204 | Ga0466965_0091204_785_1135 | 113 |
| 754 | 3300044684 | Ga0466966_0002888 | Ga0466966_0002888_5953_6300 | 113 |
| 755 | 3300044684 | Ga0466966_0014142 | Ga0466966_0014142_14_358 | 113 |
| 756 | 3300044693 | Ga0466961_0054883 | Ga0466961_0054883_1701_2045 | 113 |
| 757 | 3300044706 | Ga0466964_0007368 | Ga0466964_0007368_1092_1439 | 113 |
| 758 | 3300044706 | Ga0466964_0106032 | Ga0466964_0106032_742_1092 | 113 |
| 759 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_423420_423767 | 113 |
| 760 | 3300044719 | Ga0466971_0009485 | Ga0466971_0009485_2116_2463 | 113 |
| 761 | 3300044719 | Ga0466971_0325440 | Ga0466971_0325440_261_605 | 113 |
| 762 | 3300044765 | Ga0466970_0164782 | Ga0466970_0164782_145_489 | 113 |
| 763 | 3300044765 | Ga0466970_0356365 | Ga0466970_0356365_194_541 | 113 |
| 764 | 3300044901 | Ga0466960_0000662 | Ga0466960_0000662_4820_5167 | 113 |
| 765 | 3300045049 | Ga0466959_0190277 | Ga0466959_0190277_250_594 | 113 |
| 766 | 3300045049 | Ga0466959_0437675 | Ga0466959_0437675_73_420 | 113 |
| 767 | 3300045836 | Ga0466958_0026487 | Ga0466958_0026487_747_1094 | 113 |
| 768 | 3300045976 | Ga0466967_0150058 | Ga0466967_0150058_1640_1990 | 113 |
| 769 | 3300045976 | Ga0466967_0487057 | Ga0466967_0487057_422_769 | 113 |
| 770 | 3300046460 | Ga0495638_0000007 | Ga0495638_0000007_458328_458675 | 113 |
| 771 | 3300046460 | Ga0495638_0007666 | Ga0495638_0007666_7040_7387 | 113 |
| 772 | 3300046472 | Ga0495580_0002914 | Ga0495580_0002914_13417_13764 | 113 |
| 773 | 3300046472 | Ga0495580_0536049 | Ga0495580_0536049_40_381 | 113 |
| 774 | 3300046473 | Ga0495582_0646272 | Ga0495582_0646272_12_371 | 113 |
| 775 | 3300046475 | Ga0495639_0404709 | Ga0495639_0404709_169_510 | 113 |
| 776 | 3300046511 | Ga0495608_0383283 | Ga0495608_0383283_398_769 | 113 |
| 777 | 3300046513 | Ga0495616_0165040 | Ga0495616_0165040_218_565 | 113 |
| 778 | 3300046516 | Ga0495628_0385966 | Ga0495628_0385966_473_844 | 113 |
| 779 | 3300046525 | Ga0495663_0095495 | Ga0495663_0095495_510_854 | 113 |
| 780 | 3300046525 | Ga0495663_0142139 | Ga0495663_0142139_249_590 | 113 |
| 781 | 3300046525 | Ga0495663_0154809 | Ga0495663_0154809_390_737 | 113 |
| 782 | 3300046528 | Ga0495642_0000863 | Ga0495642_0000863_1117_1464 | 113 |
| 783 | 3300046531 | Ga0495665_0255471 | Ga0495665_0255471_490_861 | 113 |
| 784 | 3300046535 | Ga0495586_0516709 | Ga0495586_0516709_132_503 | 113 |
| 785 | 3300046536 | Ga0495587_0268647 | Ga0495587_0268647_100_441 | 113 |
| 786 | 3300046539 | Ga0495621_0036478 | Ga0495621_0036478_25_366 | 113 |
| 787 | 3300046543 | Ga0495645_0206256 | Ga0495645_0206256_600_971 | 113 |
| 788 | 3300046679 | Ga0495623_0073741 | Ga0495623_0073741_1307_1678 | 113 |
| 789 | 3300046689 | Ga0495613_0100831 | Ga0495613_0100831_887_1246 | 113 |
| 790 | 3300047319 | Ga0495674_0115605 | Ga0495674_0115605_1144_1485 | 113 |
| 791 | 3300047320 | Ga0495672_0060510 | Ga0495672_0060510_1726_2073 | 113 |
| 792 | 3300047445 | Ga0495677_0095317 | Ga0495677_0095317_649_996 | 113 |
| 793 | 3300047471 | Ga0495684_0133590 | Ga0495684_0133590_526_897 | 113 |
| 794 | 3300048904 | Ga0496101_0086850 | Ga0496101_0086850_1964_2305 | 113 |
| 795 | 3300048906 | Ga0496103_0208967 | Ga0496103_0208967_71_451 | 113 |
| 796 | 3300048907 | Ga0496104_0027357 | Ga0496104_0027357_2996_3337 | 113 |
| 797 | 3300048907 | Ga0496104_0570769 | Ga0496104_0570769_299_646 | 113 |
| 798 | 3300048908 | Ga0496105_0017914 | Ga0496105_0017914_4034_4375 | 113 |
| 799 | 3300048908 | Ga0496105_0275518 | Ga0496105_0275518_45_392 | 113 |
| 800 | 3300048908 | Ga0496105_1009093 | Ga0496105_1009093_163_519 | 113 |
| 801 | 3300048909 | Ga0496106_0141909 | Ga0496106_0141909_457_798 | 113 |
| 802 | 3300048909 | Ga0496106_0708483 | Ga0496106_0708483_181_525 | 113 |
| 803 | 3300048910 | Ga0496107_0114991 | Ga0496107_0114991_1196_1537 | 113 |
| 804 | 3300048910 | Ga0496107_0532032 | Ga0496107_0532032_57_401 | 113 |
| 805 | 3300048911 | Ga0496108_0029478 | Ga0496108_0029478_1203_1544 | 113 |
| 806 | 3300048911 | Ga0496108_0065794 | Ga0496108_0065794_1624_1968 | 113 |
| 807 | 3300048911 | Ga0496108_0400781 | Ga0496108_0400781_70_417 | 113 |
| 808 | 3300048912 | Ga0496109_0004582 | Ga0496109_0004582_683_1030 | 113 |
| 809 | 3300048912 | Ga0496109_0153437 | Ga0496109_0153437_1381_1722 | 113 |
| 810 | 3300048912 | Ga0496109_0238027 | Ga0496109_0238027_1117_1461 | 113 |
| 811 | 3300048913 | Ga0496110_0024184 | Ga0496110_0024184_3552_3899 | 113 |
| 812 | 3300048913 | Ga0496110_0182458 | Ga0496110_0182458_929_1273 | 113 |
| 813 | 3300048913 | Ga0496110_1368705 | Ga0496110_1368705_185_529 | 113 |
| 814 | 3300048914 | Ga0496111_0005423 | Ga0496111_0005423_6963_7310 | 113 |
| 815 | 3300048915 | Ga0496112_0068664 | Ga0496112_0068664_1993_2364 | 113 |
| 816 | 3300048916 | Ga0496113_0259178 | Ga0496113_0259178_482_826 | 113 |
| 817 | 3300048917 | Ga0496114_0049947 | Ga0496114_0049947_1716_2063 | 113 |
| 818 | 3300048917 | Ga0496114_0653624 | Ga0496114_0653624_255_602 | 113 |
| 819 | 3300048918 | Ga0496115_0000039 | Ga0496115_0000039_37485_37841 | 113 |
| 820 | 3300048918 | Ga0496115_0079680 | Ga0496115_0079680_713_1084 | 113 |
| 821 | 3300048921 | Ga0496118_0037307 | Ga0496118_0037307_1142_1522 | 113 |
| 822 | 3300048921 | Ga0496118_0156509 | Ga0496118_0156509_493_840 | 113 |
| 823 | 3300048924 | Ga0496121_0044528 | Ga0496121_0044528_2490_2837 | 113 |
| 824 | 3300048925 | Ga0496122_0314574 | Ga0496122_0314574_19_375 | 113 |
| 825 | 3300048927 | Ga0496124_0098248 | Ga0496124_0098248_1838_2182 | 113 |
| 826 | 3300048928 | Ga0496125_0000313 | Ga0496125_0000313_27272_27619 | 113 |
| 827 | 3300048928 | Ga0496125_0000379 | Ga0496125_0000379_62429_62776 | 113 |
| 828 | 3300048929 | Ga0496126_0117941 | Ga0496126_0117941_128_475 | 113 |
| 829 | 3300048929 | Ga0496126_0449565 | Ga0496126_0449565_152_499 | 113 |
| 830 | 3300049515 | Ga0501292_037832 | Ga0501292_037832_71_433 | 113 |
| 831 | 3300049521 | Ga0501298_022270 | Ga0501298_022270_367_729 | 113 |
| 832 | 3300049523 | Ga0501300_017161 | Ga0501300_017161_292_654 | 113 |
| 833 | 3300049568 | Ga0501031_0180024 | Ga0501031_0180024_672_1019 | 113 |
| 834 | 3300049568 | Ga0501031_0418702 | Ga0501031_0418702_75_419 | 113 |
| 835 | 3300049568 | Ga0501031_0662385 | Ga0501031_0662385_276_623 | 113 |
| 836 | 3300049569 | Ga0501032_0018514 | Ga0501032_0018514_1231_1575 | 113 |
| 837 | 3300049569 | Ga0501032_0070325 | Ga0501032_0070325_679_1026 | 113 |
| 838 | 3300049570 | Ga0501033_0021892 | Ga0501033_0021892_2716_3063 | 113 |
| 839 | 3300049570 | Ga0501033_0622531 | Ga0501033_0622531_66_410 | 113 |
| 840 | 3300049571 | Ga0501034_0041124 | Ga0501034_0041124_45_389 | 113 |
| 841 | 3300049572 | Ga0501036_0044682 | Ga0501036_0044682_1318_1665 | 113 |
| 842 | 3300049573 | Ga0501037_0159568 | Ga0501037_0159568_125_472 | 113 |
| 843 | 3300049573 | Ga0501037_0175526 | Ga0501037_0175526_383_733 | 113 |
| 844 | 3300049574 | Ga0501038_0043484 | Ga0501038_0043484_3520_3867 | 113 |
| 845 | 3300049574 | Ga0501038_0966537 | Ga0501038_0966537_26_373 | 113 |
| 846 | 3300049575 | Ga0501039_0611401 | Ga0501039_0611401_252_596 | 113 |
| 847 | 3300049578 | Ga0501042_0515194 | Ga0501042_0515194_292_639 | 113 |
| 848 | 3300049579 | Ga0501043_0063280 | Ga0501043_0063280_801_1145 | 113 |
| 849 | 3300049579 | Ga0501043_0084585 | Ga0501043_0084585_1816_2163 | 113 |
| 850 | 3300049580 | Ga0501046_0052161 | Ga0501046_0052161_1030_1374 | 113 |
| 851 | 3300049580 | Ga0501046_0538124 | Ga0501046_0538124_474_821 | 113 |
| 852 | 3300049581 | Ga0501047_0018745 | Ga0501047_0018745_2505_2852 | 113 |
| 853 | 3300049581 | Ga0501047_0077036 | Ga0501047_0077036_791_1135 | 113 |
| 854 | 3300049581 | Ga0501047_0121904 | Ga0501047_0121904_1577_1924 | 113 |
| 855 | 3300049581 | Ga0501047_0164607 | Ga0501047_0164607_72_419 | 113 |
| 856 | 3300049582 | Ga0501048_0402658 | Ga0501048_0402658_553_900 | 113 |
| 857 | 3300049584 | Ga0501068_0201818 | Ga0501068_0201818_821_1168 | 113 |
| 858 | 3300049586 | Ga0501070_0067505 | Ga0501070_0067505_1308_1655 | 113 |
| 859 | 3300049586 | Ga0501070_1179342 | Ga0501070_1179342_114_461 | 113 |
| 860 | 3300049589 | Ga0501073_0864999 | Ga0501073_0864999_187_534 | 113 |
| 861 | 3300049590 | Ga0501074_0815971 | Ga0501074_0815971_193_540 | 113 |
| 862 | 3300049591 | Ga0501075_0115308 | Ga0501075_0115308_217_564 | 113 |
| 863 | 3300049592 | Ga0501076_0582437 | Ga0501076_0582437_486_833 | 113 |
| 864 | 3300049661 | Ga0501217_193713 | Ga0501217_193713_238_588 | 113 |
| 865 | 3300049705 | Ga0501225_0106322 | Ga0501225_0106322_381_731 | 113 |
| 866 | 3300049742 | Ga0501080_0417701 | Ga0501080_0417701_780_1127 | 113 |
| 867 | 3300049771 | Ga0501274_001631 | Ga0501274_001631_1310_1654 | 113 |
| 868 | 3300049773 | Ga0501276_016181 | Ga0501276_016181_152_514 | 113 |
| 869 | 3300049822 | Ga0501035_0028259 | Ga0501035_0028259_880_1227 | 113 |
| 870 | 3300049822 | Ga0501035_0379781 | Ga0501035_0379781_814_1164 | 113 |
| 871 | 3300049822 | Ga0501035_1484677 | Ga0501035_1484677_56_403 | 113 |
| 872 | 3300049823 | Ga0501044_0030714 | Ga0501044_0030714_4280_4627 | 113 |
| 873 | 3300049823 | Ga0501044_0539350 | Ga0501044_0539350_57_404 | 113 |
| 874 | 3300049823 | Ga0501044_0794683 | Ga0501044_0794683_113_460 | 113 |
| 875 | 3300050493 | nmdc:mga0k408_15007_c1 | nmdc:mga0k408_15007_c1_3713_4060 | 113 |
| 876 | 3300050493 | nmdc:mga0k408_236574_c1 | nmdc:mga0k408_236574_c1_501_917 | 113 |
| 877 | 3300050493 | nmdc:mga0k408_447972_c1 | nmdc:mga0k408_447972_c1_337_684 | 113 |
| 878 | 3300050507 | nmdc:mga05p37_1326941_c1 | nmdc:mga05p37_1326941_c1_49_393 | 113 |
| 879 | 3300050507 | nmdc:mga05p37_181305_c1 | nmdc:mga05p37_181305_c1_2156_2500 | 113 |
| 880 | 3300050507 | nmdc:mga05p37_584699_c1 | nmdc:mga05p37_584699_c1_760_1107 | 113 |
| 881 | 3300050507 | nmdc:mga05p37_850864_c1 | nmdc:mga05p37_850864_c1_297_641 | 113 |
| 882 | 3300050508 | nmdc:mga09592_409997_c1 | nmdc:mga09592_409997_c1_466_810 | 113 |
| 883 | 3300050508 | nmdc:mga09592_4687_c1 | nmdc:mga09592_4687_c1_3469_3813 | 113 |
| 884 | 3300050509 | nmdc:mga0qj67_152542_c1 | nmdc:mga0qj67_152542_c1_1458_1805 | 113 |
| 885 | 3300050509 | nmdc:mga0qj67_21452_c1 | nmdc:mga0qj67_21452_c1_2028_2372 | 113 |
| 886 | 3300050509 | nmdc:mga0qj67_26271_c1 | nmdc:mga0qj67_26271_c1_1941_2285 | 113 |
| 887 | 3300050509 | nmdc:mga0qj67_757157_c1 | nmdc:mga0qj67_757157_c1_62_406 | 113 |
| 888 | 3300050509 | nmdc:mga0qj67_80814_c1 | nmdc:mga0qj67_80814_c1_1147_1491 | 113 |
| 889 | 3300050510 | nmdc:mga06r32_10201_c1 | nmdc:mga06r32_10201_c1_4792_5136 | 113 |
| 890 | 3300050510 | nmdc:mga06r32_399223_c1 | nmdc:mga06r32_399223_c1_800_1147 | 113 |
| 891 | 3300050510 | nmdc:mga06r32_745001_c1 | nmdc:mga06r32_745001_c1_297_641 | 113 |
| 892 | 3300050511 | nmdc:mga08y16_1018896_c1 | nmdc:mga08y16_1018896_c1_196_540 | 113 |
| 893 | 3300050511 | nmdc:mga08y16_136431_c1 | nmdc:mga08y16_136431_c1_1892_2239 | 113 |
| 894 | 3300050511 | nmdc:mga08y16_61034_c1 | nmdc:mga08y16_61034_c1_1896_2240 | 113 |
| 895 | 3300050512 | nmdc:mga0n895_155234_c1 | nmdc:mga0n895_155234_c1_1586_1933 | 113 |
| 896 | 3300050512 | nmdc:mga0n895_250101_c1 | nmdc:mga0n895_250101_c1_833_1180 | 113 |
| 897 | 3300050512 | nmdc:mga0n895_27412_c1 | nmdc:mga0n895_27412_c1_2241_2588 | 113 |
| 898 | 3300050512 | nmdc:mga0n895_49686_c1 | nmdc:mga0n895_49686_c1_2189_2530 | 113 |
| 899 | 3300050513 | nmdc:mga0rr50_345452_c1 | nmdc:mga0rr50_345452_c1_684_1031 | 113 |
| 900 | 3300050513 | nmdc:mga0rr50_51116_c1 | nmdc:mga0rr50_51116_c1_1648_1989 | 113 |
| 901 | 3300050513 | nmdc:mga0rr50_7612_c1 | nmdc:mga0rr50_7612_c1_1260_1607 | 113 |
| 902 | 3300050514 | nmdc:mga08x19_1251564_c1 | nmdc:mga08x19_1251564_c1_35_382 | 113 |
| 903 | 3300050514 | nmdc:mga08x19_634227_c1 | nmdc:mga08x19_634227_c1_187_534 | 113 |
| 904 | 3300050515 | nmdc:mga0a205_1359193_c1 | nmdc:mga0a205_1359193_c1_132_476 | 113 |
| 905 | 3300050515 | nmdc:mga0a205_14872_c3 | nmdc:mga0a205_14872_c3_1029_1376 | 113 |
| 906 | 3300050515 | nmdc:mga0a205_73683_c1 | nmdc:mga0a205_73683_c1_2599_2946 | 113 |
| 907 | 3300053078 | Ga0495612_0180537 | Ga0495612_0180537_360_707 | 113 |
| 908 | 3300053078 | Ga0495612_0244516 | Ga0495612_0244516_50_397 | 113 |
| 909 | 3300053087 | Ga0500643_000654 | Ga0500643_000654_20437_20784 | 113 |
| 910 | 3300053087 | Ga0500643_035304 | Ga0500643_035304_903_1250 | 113 |
| 911 | 3300053087 | Ga0500643_040767 | Ga0500643_040767_251_598 | 113 |
| 912 | 3300053088 | Ga0500644_0037409 | Ga0500644_0037409_601_948 | 113 |
| 913 | 3300053088 | Ga0500644_0117275 | Ga0500644_0117275_309_656 | 113 |
| 914 | 3300053098 | Ga0500650_0237835 | Ga0500650_0237835_24_371 | 113 |
| 915 | 3300053131 | Ga0500652_384550 | Ga0500652_384550_31_378 | 113 |
| 916 | 3300053134 | Ga0500658_0026201 | Ga0500658_0026201_123_470 | 113 |
| 917 | 3300053139 | Ga0500568_0049201 | Ga0500568_0049201_960_1307 | 113 |
| 918 | 3300053139 | Ga0500568_0130691 | Ga0500568_0130691_89_436 | 113 |
| 919 | 3300053156 | Ga0500622_0007137 | Ga0500622_0007137_153_500 | 113 |
| 920 | 3300053156 | Ga0500622_0147872 | Ga0500622_0147872_656_1000 | 113 |
| 921 | 3300054114 | Ga0501084_0095487 | Ga0501084_0095487_1267_1614 | 113 |
| 922 | 3300059421 | Ga0590071_148334 | Ga0590071_148334_198_545 | 113 |
| 923 | 3300060353 | Ga0501082_0116694 | Ga0501082_0116694_427_774 | 113 |
| 924 | 3300061719 | Ga0466962_0003750 | Ga0466962_0003750_2248_2595 | 113 |
| 925 | 3300061734 | Ga0530510_0175332 | Ga0530510_0175332_73_420 | 113 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.8602 | 3 | 108 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.8387 | 3 | 108 |
| 6sn1-assembly1.cif.gz_A | crystal structure of the human ints13-ints14 complex | 0.7917 | 64 | 91 |
| 1xa8-assembly1.cif.gz_A | crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) | 0.7657 | 3 | 104 |
| 1xa8-assembly1.cif.gz_A | crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) | 0.6934 | 3 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54VC9_11_133_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.9329 | 4 | 112 | 2.170.150.70 |
| af_Q54VC9_11_133_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.8937 | 4 | 112 | 2.170.150.70 |
| af_Q54X87_13_141_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.8797 | 3 | 110 | 2.170.150.70 |
| af_K7MPT9_9_124_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.8776 | 4 | 111 | 2.170.150.70 |
| 3facD00 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.861 | 3 | 107 | 2.170.150.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W7WMC8-F1-model_v4 | deleted | 0.9927 | 2 | 113 |
|
| AF-A0A4Q2J3M7-F1-model_v4 | GFA family protein | 0.9901 | 2 | 113 |
GO:0016846
GO:0046872 |
| AF-A0A1E4QPE3-F1-model_v4 | deleted | 0.9898 | 2 | 113 |
|
| AF-Q3JVS1-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9886 | 2 | 113 |
GO:0016846
GO:0046872 |
| AF-A0A154IPM1-F1-model_v4 | Aldehyde-activating protein | 0.9885 | 2 | 113 |
GO:0016846
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar