F485986

General Info

Members Datasets Scaffolds Average Seq Length
928 329 928 166

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_1182606_c1|nmdc:mga08y16_1182606_c1_102_572
Length 156
Sequence VKRLIDGYHRLLTWLMVGTVAVLIVPVTLQIISRYTALIPSWIWTEELSRFLFIWMVMLGAMIGIREGTHFEVDVWPKATALLRIASNLCVLVFALVFVWYGIAFVRFGWDQLSELAELPMPYIFMAWPLAGATWVLFLGESFVTNWRILRGEPAR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
209 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
210 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
211 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
259 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
284 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
288 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 4.53
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1007538 3300001977 Bacteria 1661
2 JGI24737J22298_10008941 3300001990 Bacteria 3342
3 JGI24743J22301_10004728 3300001991 Bacteria 2236
4 JGI24750J21931_1001145 3300002070 Bacteria 3409
5 JGI24750J21931_1002899 3300002070 Bacteria 2056
6 JGI24745J21846_1001070 3300002073 Bacteria 2585
7 JGI24748J21848_1003000 3300002074 Bacteria 1921
8 JGI24738J21930_10007173 3300002075 Bacteria 2583
9 JGI24749J21850_1004565 3300002076 Bacteria 1937
10 JGI24749J21850_1010562 3300002076 Bacteria 1295
11 JGI24744J21845_10003130 3300002077 Bacteria 3395
12 JGI24034J26672_10008728 3300002239 Bacteria 1484
13 JGI24742J22300_10001923 3300002244 Bacteria 3303
14 JGI24742J22300_10052258 3300002244 Bacteria 742
15 JGI24751J29686_10007565 3300002459 Bacteria 2220
16 JGI25406J46586_10084736 3300003203 Bacteria 965
17 JGI25404J52841_10002936 3300003659 Bacteria 3306
18 JGI25405J52794_10033093 3300003911 Bacteria 1078
19 Ga0065715_10151111 3300005293 Bacteria 1721
20 Ga0065707_10127695 3300005295 Bacteria 1979
21 Ga0065707_10551226 3300005295 Bacteria 721
22 Ga0070676_10024314 3300005328 Bacteria 3411
23 Ga0070676_10034571 3300005328 Bacteria 2902
24 Ga0070676_10330762 3300005328 Bacteria 1042
25 Ga0070683_100012422 3300005329 Bacteria 7401
26 Ga0070690_100059351 3300005330 Bacteria 2459
27 Ga0070690_100169041 3300005330 Bacteria 1503
28 Ga0070690_101234006 3300005330 Bacteria 597
29 Ga0070670_100458365 3300005331 Bacteria 1130
30 Ga0070670_100585832 3300005331 Bacteria 997
31 Ga0070670_100771741 3300005331 Bacteria 867
32 Ga0070677_10007692 3300005333 Bacteria 3607
33 Ga0068869_100000121 3300005334 Bacteria 37550
34 Ga0068869_100060152 3300005334 Bacteria 2783
35 Ga0068869_100411894 3300005334 Bacteria 1114
36 Ga0068869_100600098 3300005334 Bacteria 930
37 Ga0070666_10130452 3300005335 Bacteria 1746
38 Ga0070666_10562763 3300005335 Bacteria 830
39 Ga0068868_100056124 3300005338 Bacteria 3109
40 Ga0068868_100057215 3300005338 Bacteria 3080
41 Ga0068868_100514721 3300005338 Bacteria 1050
42 Ga0070660_100021749 3300005339 Bacteria 4734
43 Ga0070660_100046924 3300005339 Bacteria 3312
44 Ga0070660_100181458 3300005339 Bacteria 1703
45 Ga0070660_100510308 3300005339 Bacteria 1001
46 Ga0070689_100008395 3300005340 Bacteria 7275
47 Ga0070689_100430933 3300005340 Bacteria 1119
48 Ga0070689_100504486 3300005340 Bacteria 1037
49 Ga0070691_10017562 3300005341 Bacteria 3292
50 Ga0070687_100023503 3300005343 Bacteria 2931
51 Ga0070687_100088315 3300005343 Bacteria 1709
52 Ga0070687_100213709 3300005343 Bacteria 1177
53 Ga0070687_100286619 3300005343 Bacteria 1039
54 Ga0070661_100029653 3300005344 Bacteria 3949
55 Ga0070661_100064222 3300005344 Bacteria 2698
56 Ga0070661_100072461 3300005344 Bacteria 2535
57 Ga0070661_100101319 3300005344 Bacteria 2142
58 Ga0070692_10210751 3300005345 Bacteria 1143
59 Ga0070692_10453001 3300005345 Bacteria 822
60 Ga0070692_10614419 3300005345 Bacteria 721
61 Ga0070668_100005467 3300005347 Bacteria 9431
62 Ga0070668_100036090 3300005347 Bacteria 3772
63 Ga0070668_100186204 3300005347 Bacteria 1698
64 Ga0070668_100191117 3300005347 Bacteria 1677
65 Ga0070668_100263534 3300005347 Bacteria 1434
66 Ga0070668_100324770 3300005347 Bacteria 1296
67 Ga0070669_100072739 3300005353 Bacteria 2546
68 Ga0070669_100109601 3300005353 Bacteria 2093
69 Ga0070669_100293109 3300005353 Bacteria 1307
70 Ga0070669_100574881 3300005353 Bacteria 942
71 Ga0070669_101046567 3300005353 Bacteria 701
72 Ga0070675_100054743 3300005354 Bacteria 3283
73 Ga0070675_100232834 3300005354 Bacteria 1607
74 Ga0070675_100353504 3300005354 Bacteria 1303
75 Ga0070675_100393837 3300005354 Bacteria 1235
76 Ga0070675_100484506 3300005354 Bacteria 1113
77 Ga0070675_101260687 3300005354 Bacteria 681
78 Ga0070671_100022108 3300005355 Bacteria 5196
79 Ga0070671_100227394 3300005355 Bacteria 1583
80 Ga0070671_100440027 3300005355 Bacteria 1118
81 Ga0070674_100016494 3300005356 Bacteria 4631
82 Ga0070674_100323903 3300005356 Bacteria 1236
83 Ga0070674_100726742 3300005356 Bacteria 851
84 Ga0070673_100006060 3300005364 Bacteria 7831
85 Ga0070673_100026639 3300005364 Bacteria 4273
86 Ga0070673_100181773 3300005364 Bacteria 1801
87 Ga0070673_100231696 3300005364 Bacteria 1602
88 Ga0070673_100868938 3300005364 Bacteria 835
89 Ga0070688_100016172 3300005365 Bacteria 4260
90 Ga0070688_100027208 3300005365 Bacteria 3405
91 Ga0070688_100687700 3300005365 Bacteria 791
92 Ga0070659_100044765 3300005366 Bacteria 3466
93 Ga0070659_100052481 3300005366 Bacteria 3207
94 Ga0070659_100079603 3300005366 Bacteria 2615
95 Ga0070659_100104112 3300005366 Bacteria 2286
96 Ga0070667_100005519 3300005367 Bacteria 10563
97 Ga0070667_100033447 3300005367 Bacteria 4297
98 Ga0070667_100108241 3300005367 Bacteria 2408
99 Ga0070667_100309381 3300005367 Bacteria 1424
100 Ga0070667_100406708 3300005367 Bacteria 1239
101 Ga0070667_100867169 3300005367 Bacteria 840
102 Ga0070703_10366535 3300005406 Bacteria 619
103 Ga0070709_10222392 3300005434 Bacteria 1347
104 Ga0070714_100250794 3300005435 Bacteria 1636
105 Ga0070713_100091210 3300005436 Bacteria 2621
106 Ga0070710_10052339 3300005437 Bacteria 2296
107 Ga0070701_10154102 3300005438 Bacteria 1326
108 Ga0070701_10222376 3300005438 Bacteria 1126
109 Ga0070701_10979191 3300005438 Bacteria 589
110 Ga0070711_100064921 3300005439 Bacteria 2552
111 Ga0070705_100212060 3300005440 Bacteria 1335
112 Ga0070705_100346408 3300005440 Bacteria 1082
113 Ga0070705_100413023 3300005440 Bacteria 1003
114 Ga0070705_100563794 3300005440 Bacteria 875
115 Ga0070700_100009952 3300005441 Bacteria 5233
116 Ga0070700_100014920 3300005441 Bacteria 4394
117 Ga0070700_100061194 3300005441 Bacteria 2375
118 Ga0070700_100301833 3300005441 Bacteria 1169
119 Ga0070700_101655445 3300005441 Bacteria 548
120 Ga0070694_100040772 3300005444 Bacteria 3096
121 Ga0070694_100128820 3300005444 Bacteria 1826
122 Ga0070694_100386472 3300005444 Bacteria 1093
123 Ga0070694_100397214 3300005444 Bacteria 1079
124 Ga0070694_100416469 3300005444 Bacteria 1055
125 Ga0070694_100478149 3300005444 Bacteria 988
126 Ga0070694_101718905 3300005444 Bacteria 534
127 Ga0070708_100027191 3300005445 Bacteria 4906
128 Ga0070663_100002260 3300005455 Bacteria 10792
129 Ga0070663_100016989 3300005455 Bacteria 4738
130 Ga0070663_100121476 3300005455 Bacteria 1974
131 Ga0070663_100611225 3300005455 Bacteria 918
132 Ga0070678_100025772 3300005456 Bacteria 3963
133 Ga0070678_100097419 3300005456 Bacteria 2271
134 Ga0070678_100460881 3300005456 Bacteria 1115
135 Ga0070678_100710795 3300005456 Bacteria 906
136 Ga0070678_101747043 3300005456 Bacteria 586
137 Ga0070662_100001034 3300005457 Bacteria 16987
138 Ga0070662_100009501 3300005457 Bacteria 6360
139 Ga0070662_100296879 3300005457 Bacteria 1311
140 Ga0070662_100310912 3300005457 Bacteria 1283
141 Ga0070662_100361714 3300005457 Bacteria 1191
142 Ga0070662_100462122 3300005457 Bacteria 1055
143 Ga0070662_100551789 3300005457 Bacteria 966
144 Ga0070681_10581690 3300005458 Bacteria 1034
145 Ga0070681_11151117 3300005458 Unclassified 697
146 Ga0070681_11240135 3300005458 Unclassified 668
147 Ga0068867_100028941 3300005459 Bacteria 3989
148 Ga0068867_100146695 3300005459 Bacteria 1850
149 Ga0068867_100280670 3300005459 Bacteria 1366
150 Ga0068867_100458383 3300005459 Bacteria 1088
151 Ga0068867_101331371 3300005459 Bacteria 664
152 Ga0070685_10008603 3300005466 Bacteria 5252
153 Ga0070685_10010997 3300005466 Bacteria 4721
154 Ga0070706_100044678 3300005467 Bacteria 4092
155 Ga0070706_101013378 3300005467 Bacteria 765
156 Ga0070706_101099066 3300005467 Bacteria 732
157 Ga0070707_100043684 3300005468 Bacteria 4288
158 Ga0070707_100723204 3300005468 Bacteria 958
159 Ga0070707_101071414 3300005468 Bacteria 772
160 Ga0070698_100116477 3300005471 Bacteria 2635
161 Ga0070698_100267332 3300005471 Bacteria 1642
162 Ga0070699_100076537 3300005518 Bacteria 2913
163 Ga0070699_100185457 3300005518 Bacteria 1847
164 Ga0070699_100418673 3300005518 Bacteria 1212
165 Ga0070699_100441456 3300005518 Bacteria 1179
166 Ga0070699_100583473 3300005518 Bacteria 1019
167 Ga0070699_100652296 3300005518 Bacteria 961
168 Ga0070684_100157462 3300005535 Bacteria 2060
169 Ga0070697_100109319 3300005536 Bacteria 2302
170 Ga0070697_100180588 3300005536 Bacteria 1789
171 Ga0070697_100779023 3300005536 Bacteria 846
172 Ga0068853_100009533 3300005539 Bacteria 7824
173 Ga0068853_100045484 3300005539 Bacteria 3760
174 Ga0068853_100071205 3300005539 Bacteria 3027
175 Ga0068853_100206358 3300005539 Bacteria 1790
176 Ga0068853_100216264 3300005539 Bacteria 1748
177 Ga0068853_100829906 3300005539 Bacteria 886
178 Ga0070672_100122602 3300005543 Bacteria 2129
179 Ga0070672_100155192 3300005543 Bacteria 1896
180 Ga0070672_100160692 3300005543 Bacteria 1864
181 Ga0070672_100664402 3300005543 Bacteria 911
182 Ga0070686_100034473 3300005544 Bacteria 3119
183 Ga0070695_100038140 3300005545 Bacteria 3030
184 Ga0070695_100064454 3300005545 Bacteria 2384
185 Ga0070695_100075160 3300005545 Bacteria 2222
186 Ga0070695_100147589 3300005545 Bacteria 1638
187 Ga0070695_100332598 3300005545 Bacteria 1133
188 Ga0070695_100788146 3300005545 Bacteria 761
189 Ga0070696_100200764 3300005546 Bacteria 1489
190 Ga0070696_100227051 3300005546 Bacteria 1403
191 Ga0070696_100228650 3300005546 Bacteria 1398
192 Ga0070696_100262180 3300005546 Bacteria 1311
193 Ga0070696_100272852 3300005546 Bacteria 1286
194 Ga0070696_100638813 3300005546 Bacteria 862
195 Ga0070693_100325824 3300005547 Bacteria 1044
196 Ga0070693_100857133 3300005547 Bacteria 678
197 Ga0070665_100054890 3300005548 Bacteria 3995
198 Ga0070665_100055967 3300005548 Bacteria 3955
199 Ga0070665_100269983 3300005548 Bacteria 1703
200 Ga0070665_101828731 3300005548 Bacteria 614
201 Ga0070704_100069481 3300005549 Bacteria 2552
202 Ga0070704_100109411 3300005549 Bacteria 2100
203 Ga0070704_100334228 3300005549 Bacteria 1274
204 Ga0070704_100407145 3300005549 Bacteria 1162
205 Ga0070704_100856297 3300005549 Bacteria 815
206 Ga0070704_101027017 3300005549 Bacteria 746
207 Ga0070704_101290530 3300005549 Bacteria 668
208 Ga0070704_101298941 3300005549 Bacteria 666
209 Ga0068855_100000618 3300005563 Bacteria 43673
210 Ga0068855_100469692 3300005563 Bacteria 1371
211 Ga0068855_100657493 3300005563 Bacteria 1125
212 Ga0068855_101043969 3300005563 Bacteria 857
213 Ga0068855_101155850 3300005563 Bacteria 807
214 Ga0070664_100003070 3300005564 Bacteria 13501
215 Ga0070664_100010816 3300005564 Bacteria 7400
216 Ga0070664_100051886 3300005564 Bacteria 3473
217 Ga0070664_100080557 3300005564 Bacteria 2805
218 Ga0070664_100105200 3300005564 Bacteria 2458
219 Ga0070664_100515261 3300005564 Bacteria 1103
220 Ga0070664_100865294 3300005564 Bacteria 847
221 Ga0068857_100014463 3300005577 Bacteria 6885
222 Ga0068857_100016325 3300005577 Bacteria 6506
223 Ga0068857_100311755 3300005577 Bacteria 1452
224 Ga0068854_100045035 3300005578 Bacteria 3135
225 Ga0068854_100107882 3300005578 Bacteria 2096
226 Ga0068854_100178633 3300005578 Bacteria 1657
227 Ga0068856_100000093 3300005614 Bacteria 84752
228 Ga0068856_100028254 3300005614 Bacteria 5476
229 Ga0068856_100047839 3300005614 Bacteria 4214
230 Ga0068856_100110886 3300005614 Bacteria 2741
231 Ga0068856_100201564 3300005614 Bacteria 2004
232 Ga0068856_100629619 3300005614 Bacteria 1093
233 Ga0068856_101141795 3300005614 Unclassified 796
234 Ga0070702_100016321 3300005615 Bacteria 3807
235 Ga0070702_100025445 3300005615 Bacteria 3171
236 Ga0070702_100232526 3300005615 Bacteria 1239
237 Ga0068852_100044168 3300005616 Bacteria 3783
238 Ga0068852_100471214 3300005616 Bacteria 1246
239 Ga0068852_101106465 3300005616 Bacteria 812
240 Ga0068859_100018237 3300005617 Bacteria 7057
241 Ga0068859_100027447 3300005617 Bacteria 5709
242 Ga0068859_100029782 3300005617 Bacteria 5477
243 Ga0068859_100044053 3300005617 Bacteria 4485
244 Ga0068859_100119044 3300005617 Bacteria 2707
245 Ga0068859_100143080 3300005617 Bacteria 2465
246 Ga0068859_100265389 3300005617 Bacteria 1809
247 Ga0068859_100599532 3300005617 Bacteria 1195
248 Ga0068859_100844812 3300005617 Bacteria 1002
249 Ga0068859_101274479 3300005617 Bacteria 810
250 Ga0068864_100013289 3300005618 Bacteria 6819
251 Ga0068864_100033901 3300005618 Bacteria 4341
252 Ga0068864_100058563 3300005618 Bacteria 3330
253 Ga0068864_100129300 3300005618 Bacteria 2267
254 Ga0068866_10007073 3300005718 Bacteria 4691
255 Ga0068866_10015832 3300005718 Bacteria 3359
256 Ga0068866_10239285 3300005718 Bacteria 1105
257 Ga0068861_100016323 3300005719 Bacteria 5252
258 Ga0068861_100788100 3300005719 Bacteria 891
259 Ga0068851_10003290 3300005834 Bacteria 7174
260 Ga0068851_10025362 3300005834 Bacteria 2908
261 Ga0068851_10324163 3300005834 Bacteria 891
262 Ga0068851_10426881 3300005834 Bacteria 784
263 Ga0068851_10594890 3300005834 Bacteria 673
264 Ga0068870_10005949 3300005840 Bacteria 5360
265 Ga0068870_10013761 3300005840 Bacteria 3809
266 Ga0068870_10226700 3300005840 Bacteria 1147
267 Ga0068863_100006688 3300005841 Bacteria 11317
268 Ga0068863_100019022 3300005841 Bacteria 6573
269 Ga0068863_100071537 3300005841 Bacteria 3281
270 Ga0068863_100161972 3300005841 Bacteria 2143
271 Ga0068863_100208625 3300005841 Bacteria 1881
272 Ga0068863_101315847 3300005841 Bacteria 730
273 Ga0068863_101585438 3300005841 Bacteria 664
274 Ga0068858_100011753 3300005842 Bacteria 8258
275 Ga0068858_100028984 3300005842 Bacteria 5140
276 Ga0068858_100052318 3300005842 Bacteria 3778
277 Ga0068858_100086576 3300005842 Bacteria 2914
278 Ga0068858_100325860 3300005842 Bacteria 1469
279 Ga0068858_100331789 3300005842 Bacteria 1455
280 Ga0068858_101605849 3300005842 Unclassified 642
281 Ga0068860_100010410 3300005843 Bacteria 9198
282 Ga0068860_100029566 3300005843 Bacteria 5272
283 Ga0068860_100051826 3300005843 Bacteria 3904
284 Ga0068860_100188108 3300005843 Bacteria 1997
285 Ga0068860_100318595 3300005843 Bacteria 1526
286 Ga0068860_100329346 3300005843 Bacteria 1500
287 Ga0068860_101103367 3300005843 Bacteria 813
288 Ga0068862_100015627 3300005844 Bacteria 6304
289 Ga0068862_100033422 3300005844 Bacteria 4348
290 Ga0068862_100036439 3300005844 Bacteria 4169
291 Ga0068862_100045278 3300005844 Bacteria 3754
292 Ga0068862_101029311 3300005844 Bacteria 816
293 Ga0068862_101628756 3300005844 Bacteria 653
294 Ga0081455_10015181 3300005937 Bacteria 7494
295 Ga0081455_10019463 3300005937 Bacteria 6422
296 Ga0081455_10026378 3300005937 Bacteria 5345
297 Ga0081455_10091775 3300005937 Bacteria 2459
298 Ga0081538_10032628 3300005981 Bacteria 3484
299 Ga0081540_1000045 3300005983 Bacteria 134124
300 Ga0081540_1010997 3300005983 Bacteria 6076
301 Ga0081540_1015520 3300005983 Bacteria 4820
302 Ga0081539_10000226 3300005985 Bacteria 132618
303 Ga0075365_10007399 3300006038 Bacteria 6144
304 Ga0075365_10109544 3300006038 Bacteria 1897
305 Ga0075365_10147347 3300006038 Bacteria 1636
306 Ga0075365_10553399 3300006038 Bacteria 814
307 Ga0075364_10164759 3300006051 Bacteria 1497
308 Ga0070715_10006868 3300006163 Bacteria 3889
309 Ga0070716_100259573 3300006173 Bacteria 1188
310 Ga0070716_100263819 3300006173 Bacteria 1180
311 Ga0070716_100477648 3300006173 Bacteria 915
312 Ga0070716_100486644 3300006173 Bacteria 907
313 Ga0070712_100123209 3300006175 Bacteria 1954
314 Ga0097621_100013107 3300006237 Bacteria 6165
315 Ga0097621_100136204 3300006237 Bacteria 2095
316 Ga0097621_100313650 3300006237 Bacteria 1388
317 Ga0068871_100026948 3300006358 Bacteria 4490
318 Ga0075428_100003992 3300006844 Bacteria 16191
319 Ga0075428_100066145 3300006844 Bacteria 3958
320 Ga0075428_100076532 3300006844 Bacteria 3653
321 Ga0075428_100143936 3300006844 Bacteria 2591
322 Ga0075428_100144235 3300006844 Bacteria 2588
323 Ga0075428_100443634 3300006844 Bacteria 1390
324 Ga0075428_101029908 3300006844 Bacteria 871
325 Ga0075430_100013974 3300006846 Bacteria 6843
326 Ga0075430_100194624 3300006846 Bacteria 1685
327 Ga0075430_100484203 3300006846 Bacteria 1021
328 Ga0075431_100007554 3300006847 Bacteria 10825
329 Ga0075431_100062520 3300006847 Bacteria 3841
330 Ga0075431_100081933 3300006847 Bacteria 3331
331 Ga0075431_100122616 3300006847 Bacteria 2682
332 Ga0075433_10070333 3300006852 Bacteria 3075
333 Ga0075433_10097309 3300006852 Bacteria 2605
334 Ga0075433_10275651 3300006852 Bacteria 1491
335 Ga0075433_10364213 3300006852 Bacteria 1277
336 Ga0075433_10469237 3300006852 Bacteria 1109
337 Ga0075433_10506724 3300006852 Bacteria 1062
338 Ga0075433_10628635 3300006852 Bacteria 942
339 Ga0075434_100000003 3300006871 Bacteria 134839
340 Ga0075434_100043038 3300006871 Bacteria 4477
341 Ga0075434_100235304 3300006871 Bacteria 1852
342 Ga0075434_100259125 3300006871 Bacteria 1758
343 Ga0075434_100342726 3300006871 Bacteria 1515
344 Ga0075434_101744822 3300006871 Bacteria 630
345 Ga0075429_100001249 3300006880 Bacteria 20643
346 Ga0075429_100032190 3300006880 Bacteria 4557
347 Ga0075429_100132177 3300006880 Bacteria 2183
348 Ga0068865_100014498 3300006881 Bacteria 5009
349 Ga0068865_100210486 3300006881 Bacteria 1515
350 Ga0068865_100902599 3300006881 Bacteria 768
351 Ga0075436_100173396 3300006914 Bacteria 1523
352 Ga0075436_100681482 3300006914 Bacteria 761
353 Ga0097620_100018234 3300006931 Bacteria 7057
354 Ga0097620_100027450 3300006931 Bacteria 5709
355 Ga0097620_100029780 3300006931 Bacteria 5477
356 Ga0097620_100044054 3300006931 Bacteria 4485
357 Ga0097620_100119044 3300006931 Bacteria 2707
358 Ga0097620_100143078 3300006931 Bacteria 2465
359 Ga0097620_100265406 3300006931 Bacteria 1809
360 Ga0097620_100599517 3300006931 Bacteria 1195
361 Ga0097620_100844709 3300006931 Bacteria 1002
362 Ga0097620_101226692 3300006931 Bacteria 826
363 Ga0097620_101274412 3300006931 Bacteria 810
364 Ga0075435_100010435 3300007076 Bacteria 6796
365 Ga0075435_100391440 3300007076 Bacteria 1194
366 Ga0075435_100561743 3300007076 Bacteria 989
367 Ga0075435_100561763 3300007076 Bacteria 989
368 Ga0099794_10049733 3300007265 Bacteria 2015
369 Ga0099794_10067629 3300007265 Bacteria 1745
370 Ga0105244_10147439 3300009036 Bacteria 1129
371 Ga0111539_10075511 3300009094 Bacteria 3970
372 Ga0111539_10232272 3300009094 Bacteria 2148
373 Ga0111539_10293738 3300009094 Bacteria 1891
374 Ga0111539_10353417 3300009094 Bacteria 1710
375 Ga0111539_10817592 3300009094 Bacteria 1084
376 Ga0111539_11371738 3300009094 Bacteria 820
377 Ga0105245_10031117 3300009098 Bacteria 4721
378 Ga0105245_10063641 3300009098 Bacteria 3331
379 Ga0105245_10352820 3300009098 Bacteria 1458
380 Ga0105245_10381765 3300009098 Bacteria 1403
381 Ga0105245_10477409 3300009098 Bacteria 1259
382 Ga0105245_10649630 3300009098 Bacteria 1085
383 Ga0105245_11365551 3300009098 Bacteria 758
384 Ga0105247_10009818 3300009101 Bacteria 5798
385 Ga0105247_10235644 3300009101 Bacteria 1245
386 Ga0114129_10007594 3300009147 Bacteria 15436
387 Ga0114129_10038987 3300009147 Bacteria 6697
388 Ga0114129_10179118 3300009147 Bacteria 2886
389 Ga0114129_10225321 3300009147 Bacteria 2527
390 Ga0114129_10427625 3300009147 Bacteria 1740
391 Ga0114129_10805977 3300009147 Bacteria 1197
392 Ga0114129_10986247 3300009147 Bacteria 1062
393 Ga0114129_11106653 3300009147 Bacteria 991
394 Ga0105243_10010928 3300009148 Bacteria 6868
395 Ga0105243_10148592 3300009148 Bacteria 2008
396 Ga0105243_10269406 3300009148 Bacteria 1528
397 Ga0105243_10310641 3300009148 Bacteria 1432
398 Ga0105243_10430274 3300009148 Bacteria 1233
399 Ga0105243_10516587 3300009148 Bacteria 1135
400 Ga0105243_10585557 3300009148 Bacteria 1072
401 Ga0105243_11236442 3300009148 Bacteria 761
402 Ga0105241_11167514 3300009174 Bacteria 728
403 Ga0105241_12210451 3300009174 Unclassified 546
404 Ga0105242_10000568 3300009176 Bacteria 29246
405 Ga0105242_10019555 3300009176 Bacteria 5308
406 Ga0105242_10067481 3300009176 Bacteria 2957
407 Ga0105242_10189508 3300009176 Bacteria 1820
408 Ga0105242_10372033 3300009176 Bacteria 1326
409 Ga0105242_10429748 3300009176 Bacteria 1240
410 Ga0105248_10022908 3300009177 Bacteria 6935
411 Ga0105248_10034839 3300009177 Bacteria 5633
412 Ga0105248_10045402 3300009177 Bacteria 4927
413 Ga0105248_11610904 3300009177 Bacteria 735
414 Ga0105248_11809235 3300009177 Bacteria 693
415 Ga0105237_10077461 3300009545 Bacteria 3314
416 Ga0105249_10042946 3300009553 Bacteria 4112
417 Ga0105249_10055161 3300009553 Bacteria 3634
418 Ga0105249_10357942 3300009553 Bacteria 1480
419 Ga0105249_10403971 3300009553 Bacteria 1397
420 Ga0105249_10477036 3300009553 Bacteria 1290
421 Ga0105249_10749924 3300009553 Bacteria 1038
422 Ga0105249_10853931 3300009553 Bacteria 976
423 Ga0105249_11226629 3300009553 Bacteria 821
424 Ga0105249_11263693 3300009553 Bacteria 810
425 Ga0099796_10028001 3300010159 Bacteria 1805
426 Ga0105239_10019473 3300010375 Bacteria 7492
427 Ga0105239_10220103 3300010375 Bacteria 2129
428 Ga0105239_10755654 3300010375 Bacteria 1113
429 Ga0105239_10816159 3300010375 Bacteria 1069
430 Ga0105246_10023998 3300011119 Bacteria 3954
431 Ga0105246_11167382 3300011119 Bacteria 707
432 Ga0157324_1005539 3300012506 Bacteria 918
433 Ga0157373_10000777 3300013100 Bacteria 24608
434 Ga0157371_10021903 3300013102 Bacteria 4690
435 Ga0157371_10146182 3300013102 Bacteria 1685
436 Ga0157371_10829294 3300013102 Unclassified 698
437 Ga0157371_10914553 3300013102 Bacteria 666
438 Ga0157369_10120606 3300013105 Bacteria 2783
439 Ga0157369_10151570 3300013105 Bacteria 2450
440 Ga0157369_10442618 3300013105 Bacteria 1346
441 Ga0157369_11425375 3300013105 Unclassified 705
442 Ga0157374_10031839 3300013296 Bacteria 4797
443 Ga0157374_10031850 3300013296 Bacteria 4796
444 Ga0157374_10232468 3300013296 Bacteria 1811
445 Ga0157374_10248219 3300013296 Bacteria 1751
446 Ga0157378_10015919 3300013297 Bacteria 6585
447 Ga0157378_10030596 3300013297 Bacteria 4757
448 Ga0157378_10034657 3300013297 Bacteria 4464
449 Ga0157378_10281292 3300013297 Bacteria 1604
450 Ga0157378_10337207 3300013297 Bacteria 1469
451 Ga0157378_10650113 3300013297 Bacteria 1070
452 Ga0157378_10791165 3300013297 Bacteria 974
453 Ga0157378_11520223 3300013297 Bacteria 714
454 Ga0163162_10080829 3300013306 Bacteria 3319
455 Ga0163162_10114123 3300013306 Bacteria 2801
456 Ga0163162_10235849 3300013306 Bacteria 1960
457 Ga0163162_10335641 3300013306 Bacteria 1644
458 Ga0163162_10921298 3300013306 Bacteria 986
459 Ga0157372_10000852 3300013307 Bacteria 33078
460 Ga0157372_10225815 3300013307 Bacteria 2171
461 Ga0157372_11669910 3300013307 Bacteria 733
462 Ga0157372_12254589 3300013307 Bacteria 625
463 Ga0157375_10014053 3300013308 Bacteria 7140
464 Ga0157375_10052520 3300013308 Bacteria 4007
465 Ga0157375_10130292 3300013308 Bacteria 2634
466 Ga0157375_10983839 3300013308 Bacteria 984
467 Ga0157375_11450011 3300013308 Bacteria 809
468 Ga0157375_11734466 3300013308 Bacteria 740
469 Ga0157375_12764363 3300013308 Bacteria 587
470 Ga0163163_10023951 3300014325 Bacteria 5805
471 Ga0163163_10620223 3300014325 Bacteria 1145
472 Ga0163163_10644346 3300014325 Bacteria 1123
473 Ga0163163_11694634 3300014325 Unclassified 693
474 Ga0163163_12711951 3300014325 Bacteria 552
475 Ga0157380_10040596 3300014326 Bacteria 3625
476 Ga0157380_10094023 3300014326 Bacteria 2480
477 Ga0157380_11096280 3300014326 Bacteria 835
478 Ga0157380_11174751 3300014326 Bacteria 810
479 Ga0157380_11392164 3300014326 Bacteria 751
480 Ga0157380_11878770 3300014326 Bacteria 659
481 Ga0157379_10009926 3300014968 Bacteria 8291
482 Ga0157379_10012304 3300014968 Bacteria 7474
483 Ga0157376_10410029 3300014969 Bacteria 1312
484 Ga0157376_11110261 3300014969 Bacteria 817
485 Ga0163161_10008687 3300017792 Bacteria 7025
486 Ga0163161_10018498 3300017792 Bacteria 4882
487 Ga0163161_10390944 3300017792 Bacteria 1113
488 Ga0207697_10000241 3300025315 Bacteria 29902
489 Ga0207656_10118384 3300025321 Bacteria 1231
490 Ga0207655_1099185 3300025728 Bacteria 1007
491 Ga0207653_10120778 3300025885 Bacteria 943
492 Ga0207682_10009064 3300025893 Bacteria 3930
493 Ga0207642_10007601 3300025899 Bacteria 3669
494 Ga0207642_10031218 3300025899 Bacteria 2229
495 Ga0207642_10031542 3300025899 Bacteria 2221
496 Ga0207710_10015280 3300025900 Bacteria 3242
497 Ga0207688_10003121 3300025901 Bacteria 9045
498 Ga0207688_10016163 3300025901 Bacteria 4046
499 Ga0207680_10012357 3300025903 Bacteria 4346
500 Ga0207680_10075604 3300025903 Bacteria 2101
501 Ga0207647_10076912 3300025904 Bacteria 2007
502 Ga0207647_10255734 3300025904 Bacteria 1004
503 Ga0207645_10010667 3300025907 Bacteria 6303
504 Ga0207645_10029673 3300025907 Bacteria 3525
505 Ga0207645_10104549 3300025907 Bacteria 1829
506 Ga0207645_10250292 3300025907 Bacteria 1172
507 Ga0207643_10003471 3300025908 Bacteria 8483
508 Ga0207643_10010768 3300025908 Bacteria 4931
509 Ga0207643_10153008 3300025908 Bacteria 1384
510 Ga0207684_10013079 3300025910 Bacteria 7183
511 Ga0207684_10104925 3300025910 Bacteria 2417
512 Ga0207684_11003844 3300025910 Bacteria 698
513 Ga0207707_10451478 3300025912 Bacteria 1100
514 Ga0207671_10071930 3300025914 Bacteria 2580
515 Ga0207693_10227356 3300025915 Bacteria 1465
516 Ga0207663_10018657 3300025916 Bacteria 3893
517 Ga0207660_10760133 3300025917 Bacteria 791
518 Ga0207662_10003440 3300025918 Bacteria 8146
519 Ga0207662_10021711 3300025918 Bacteria 3673
520 Ga0207662_10148147 3300025918 Bacteria 1491
521 Ga0207657_10002844 3300025919 Bacteria 18599
522 Ga0207657_10025055 3300025919 Bacteria 5510
523 Ga0207657_10127363 3300025919 Bacteria 2090
524 Ga0207649_10016438 3300025920 Bacteria 4173
525 Ga0207649_10037862 3300025920 Bacteria 2917
526 Ga0207649_10046789 3300025920 Bacteria 2660
527 Ga0207646_10008428 3300025922 Bacteria 10338
528 Ga0207646_10015712 3300025922 Bacteria 7134
529 Ga0207646_10047615 3300025922 Bacteria 3845
530 Ga0207646_10761524 3300025922 Bacteria 864
531 Ga0207646_10887180 3300025922 Bacteria 792
532 Ga0207681_10086779 3300025923 Bacteria 2224
533 Ga0207681_10134459 3300025923 Bacteria 1833
534 Ga0207681_10212121 3300025923 Bacteria 1493
535 Ga0207650_10001318 3300025925 Bacteria 17984
536 Ga0207650_10009995 3300025925 Bacteria 6496
537 Ga0207650_10022994 3300025925 Bacteria 4417
538 Ga0207650_10078058 3300025925 Bacteria 2504
539 Ga0207650_10281478 3300025925 Bacteria 1354
540 Ga0207659_10002890 3300025926 Bacteria 10218
541 Ga0207659_10056090 3300025926 Bacteria 2820
542 Ga0207659_10278749 3300025926 Bacteria 1366
543 Ga0207659_10443449 3300025926 Bacteria 1092
544 Ga0207687_10033199 3300025927 Bacteria 3500
545 Ga0207687_10319635 3300025927 Bacteria 1256
546 Ga0207700_10021540 3300025928 Bacteria 4404
547 Ga0207664_11103878 3300025929 Bacteria 709
548 Ga0207644_10012275 3300025931 Bacteria 5686
549 Ga0207644_10042016 3300025931 Bacteria 3237
550 Ga0207644_10046582 3300025931 Bacteria 3090
551 Ga0207644_10455581 3300025931 Bacteria 1051
552 Ga0207644_10466636 3300025931 Bacteria 1038
553 Ga0207644_10833555 3300025931 Unclassified 772
554 Ga0207690_10000422 3300025932 Bacteria 27626
555 Ga0207690_10019200 3300025932 Bacteria 4203
556 Ga0207690_10698156 3300025932 Bacteria 834
557 Ga0207706_10000014 3300025933 Bacteria 177082
558 Ga0207706_10018672 3300025933 Bacteria 6239
559 Ga0207706_10057573 3300025933 Bacteria 3424
560 Ga0207706_10108159 3300025933 Bacteria 2447
561 Ga0207706_10201838 3300025933 Bacteria 1744
562 Ga0207706_10228299 3300025933 Bacteria 1629
563 Ga0207706_10478795 3300025933 Bacteria 1076
564 Ga0207706_10810948 3300025933 Bacteria 795
565 Ga0207686_10022390 3300025934 Bacteria 3639
566 Ga0207686_10133913 3300025934 Bacteria 1703
567 Ga0207686_10632129 3300025934 Bacteria 845
568 Ga0207686_10713687 3300025934 Bacteria 798
569 Ga0207686_11167315 3300025934 Bacteria 629
570 Ga0207709_10011594 3300025935 Bacteria 4861
571 Ga0207709_10559390 3300025935 Bacteria 900
572 Ga0207670_10004340 3300025936 Bacteria 7620
573 Ga0207670_10190784 3300025936 Bacteria 1551
574 Ga0207670_10312115 3300025936 Bacteria 1235
575 Ga0207670_10349022 3300025936 Bacteria 1171
576 Ga0207670_10367049 3300025936 Bacteria 1143
577 Ga0207669_10068170 3300025937 Bacteria 2220
578 Ga0207669_10085458 3300025937 Bacteria 2037
579 Ga0207669_10280850 3300025937 Bacteria 1256
580 Ga0207669_10485132 3300025937 Bacteria 986
581 Ga0207704_10092771 3300025938 Bacteria 1988
582 Ga0207704_10142197 3300025938 Bacteria 1680
583 Ga0207665_10030040 3300025939 Bacteria 3591
584 Ga0207665_10185164 3300025939 Bacteria 1510
585 Ga0207665_10249352 3300025939 Bacteria 1311
586 Ga0207665_10733427 3300025939 Bacteria 778
587 Ga0207691_10001791 3300025940 Bacteria 21133
588 Ga0207691_10008767 3300025940 Bacteria 9702
589 Ga0207691_10015083 3300025940 Bacteria 7353
590 Ga0207691_10025235 3300025940 Bacteria 5581
591 Ga0207691_10078851 3300025940 Bacteria 2964
592 Ga0207691_10437769 3300025940 Bacteria 1113
593 Ga0207711_10005602 3300025941 Bacteria 10615
594 Ga0207711_10044888 3300025941 Bacteria 3775
595 Ga0207711_10098361 3300025941 Bacteria 2585
596 Ga0207711_10131131 3300025941 Bacteria 2248
597 Ga0207711_10400993 3300025941 Bacteria 1274
598 Ga0207711_10636046 3300025941 Bacteria 995
599 Ga0207711_10643782 3300025941 Bacteria 989
600 Ga0207689_10001355 3300025942 Bacteria 23517
601 Ga0207689_10002469 3300025942 Bacteria 17219
602 Ga0207689_10030920 3300025942 Bacteria 4460
603 Ga0207661_10029165 3300025944 Bacteria 4235
604 Ga0207661_10078036 3300025944 Bacteria 2725
605 Ga0207679_10013364 3300025945 Bacteria 5380
606 Ga0207679_10028372 3300025945 Bacteria 3883
607 Ga0207679_10082701 3300025945 Bacteria 2459
608 Ga0207679_10089333 3300025945 Bacteria 2378
609 Ga0207679_10105567 3300025945 Bacteria 2212
610 Ga0207679_10251962 3300025945 Bacteria 1501
611 Ga0207667_10006720 3300025949 Bacteria 13895
612 Ga0207667_10652415 3300025949 Bacteria 1058
613 Ga0207667_10823036 3300025949 Bacteria 924
614 Ga0207667_10969981 3300025949 Bacteria 839
615 Ga0207651_10012974 3300025960 Bacteria 4745
616 Ga0207651_10043524 3300025960 Bacteria 2997
617 Ga0207651_10119984 3300025960 Bacteria 1992
618 Ga0207712_10032002 3300025961 Bacteria 3547
619 Ga0207712_10034073 3300025961 Bacteria 3448
620 Ga0207712_10368640 3300025961 Bacteria 1198
621 Ga0207712_10775586 3300025961 Bacteria 841
622 Ga0207668_10004599 3300025972 Bacteria 8114
623 Ga0207668_10028780 3300025972 Bacteria 3636
624 Ga0207668_10038565 3300025972 Bacteria 3208
625 Ga0207668_10183904 3300025972 Bacteria 1651
626 Ga0207668_10216349 3300025972 Bacteria 1535
627 Ga0207668_10397628 3300025972 Bacteria 1164
628 Ga0207640_10078297 3300025981 Bacteria 2250
629 Ga0207640_10134385 3300025981 Bacteria 1793
630 Ga0207658_10036497 3300025986 Bacteria 3524
631 Ga0207658_10077918 3300025986 Bacteria 2530
632 Ga0207677_10028439 3300026023 Bacteria 3535
633 Ga0207677_10499760 3300026023 Bacteria 1051
634 Ga0207677_10593832 3300026023 Bacteria 971
635 Ga0207703_10023707 3300026035 Bacteria 4826
636 Ga0207703_10046670 3300026035 Bacteria 3490
637 Ga0207703_10051633 3300026035 Bacteria 3333
638 Ga0207703_10125680 3300026035 Bacteria 2207
639 Ga0207703_10177081 3300026035 Bacteria 1880
640 Ga0207703_11041040 3300026035 Bacteria 786
641 Ga0207639_10066575 3300026041 Bacteria 2800
642 Ga0207678_10002409 3300026067 Bacteria 16996
643 Ga0207678_10037506 3300026067 Bacteria 4215
644 Ga0207678_10038603 3300026067 Bacteria 4148
645 Ga0207708_10029947 3300026075 Bacteria 4127
646 Ga0207708_10031440 3300026075 Bacteria 4028
647 Ga0207708_10105184 3300026075 Bacteria 2187
648 Ga0207708_10151294 3300026075 Bacteria 1827
649 Ga0207708_10601844 3300026075 Bacteria 931
650 Ga0207702_10045825 3300026078 Bacteria 3679
651 Ga0207702_10049706 3300026078 Bacteria 3539
652 Ga0207702_10096192 3300026078 Bacteria 2604
653 Ga0207702_10284966 3300026078 Bacteria 1563
654 Ga0207702_10836874 3300026078 Bacteria 910
655 Ga0207641_10009600 3300026088 Bacteria 7974
656 Ga0207641_10046594 3300026088 Bacteria 3654
657 Ga0207641_10124352 3300026088 Bacteria 2307
658 Ga0207641_10173782 3300026088 Bacteria 1968
659 Ga0207641_10211681 3300026088 Bacteria 1793
660 Ga0207648_10066269 3300026089 Bacteria 3149
661 Ga0207648_10194933 3300026089 Bacteria 1796
662 Ga0207648_10549127 3300026089 Bacteria 1061
663 Ga0207676_10029818 3300026095 Bacteria 4088
664 Ga0207676_10044164 3300026095 Bacteria 3436
665 Ga0207676_10054461 3300026095 Bacteria 3135
666 Ga0207676_10347619 3300026095 Bacteria 1370
667 Ga0207674_10007870 3300026116 Bacteria 12387
668 Ga0207674_10031295 3300026116 Bacteria 5590
669 Ga0207674_10601975 3300026116 Bacteria 1062
670 Ga0207675_100003797 3300026118 Bacteria 14713
671 Ga0207675_100005624 3300026118 Bacteria 12000
672 Ga0207675_100013865 3300026118 Bacteria 7517
673 Ga0207675_100605105 3300026118 Bacteria 1099
674 Ga0207675_101093436 3300026118 Bacteria 817
675 Ga0207683_10020959 3300026121 Bacteria 5594
676 Ga0207683_10048856 3300026121 Bacteria 3702
677 Ga0207683_10292508 3300026121 Bacteria 1489
678 Ga0207698_10104548 3300026142 Bacteria 2356
679 Ga0207698_10128498 3300026142 Bacteria 2161
680 Ga0207698_10134136 3300026142 Bacteria 2121
681 Ga0209588_1104444 3300027671 Bacteria 911
682 Ga0209971_1005118 3300027682 Bacteria 3113
683 Ga0207428_10006862 3300027907 Bacteria 10435
684 Ga0268266_10057021 3300028379 Bacteria 3360
685 Ga0268266_10083385 3300028379 Bacteria 2790
686 Ga0268265_10018486 3300028380 Bacteria 4831
687 Ga0268265_10031527 3300028380 Bacteria 3828
688 Ga0268265_10099316 3300028380 Bacteria 2346
689 Ga0268265_10120568 3300028380 Bacteria 2160
690 Ga0268265_10276228 3300028380 Bacteria 1501
691 Ga0268265_10372507 3300028380 Bacteria 1311
692 Ga0268264_10028039 3300028381 Bacteria 4605
693 Ga0268264_10046400 3300028381 Bacteria 3608
694 Ga0268264_10102997 3300028381 Bacteria 2485
695 Ga0268264_10129806 3300028381 Bacteria 2232
696 Ga0268264_10153784 3300028381 Bacteria 2065
697 Ga0268264_10229182 3300028381 Bacteria 1715
698 Ga0268264_10968013 3300028381 Bacteria 857
699 Ga0307412_10290404 3300031911 Bacteria 1288
700 Ga0307416_100353038 3300032002 Bacteria 1489
701 Ga0307416_100710268 3300032002 Bacteria 1095
702 Ga0307416_101445039 3300032002 Bacteria 793
703 Ga0373930_0000969 3300034816 Bacteria 4114
704 Ga0373948_0003976 3300034817 Bacteria 2311
705 Ga0373950_0004481 3300034818 Bacteria 2048
706 Ga0373950_0025365 3300034818 Bacteria 1071
707 Ga0373958_0010777 3300034819 Bacteria 1531
708 Ga0373926_0034021 3300035083 Bacteria 1803
709 Ga0373928_0004471 3300035084 Bacteria 2665
710 Ga0373928_0156111 3300035084 Bacteria 635
711 Ga0373940_0000777 3300035088 Bacteria 5241
712 Ga0373949_0003420 3300035090 Bacteria 3784
713 Ga0373952_0002029 3300035092 Bacteria 3655
714 Ga0373932_0002149 3300035112 Bacteria 5113
715 Ga0373939_0001716 3300035114 Bacteria 5275
716 Ga0373939_0034212 3300035114 Bacteria 1490
717 Ga0373941_0031559 3300035115 Bacteria 1579
718 Ga0373945_0033095 3300035116 Bacteria 1835
719 Ga0373954_0000003 3300035118 Bacteria 137757
720 Ga0373956_0066709 3300035119 Bacteria 1637
721 Ga0373956_0136367 3300035119 Bacteria 1151
722 Ga0373943_0007817 3300035170 Bacteria 4803
723 Ga0373943_0140182 3300035170 Bacteria 1302
724 Ga0373946_0012143 3300035171 Bacteria 3221
725 Ga0373946_0400638 3300035171 Bacteria 693
726 Ga0373962_0002148 3300035242 Bacteria 4703
727 Ga0373924_0011224 3300035410 Bacteria 3322
728 Ga0373931_0000252 3300035691 Bacteria 22764
729 Ga0373931_0965794 3300035691 Unclassified 575
730 Ga0373935_0018563 3300035692 Bacteria 4233
731 Ga0373927_0019884 3300035695 Bacteria 4403
732 Ga0373927_0043108 3300035695 Bacteria 2922
733 Ga0373927_0109375 3300035695 Bacteria 1801
734 Ga0373933_0001870 3300035724 Bacteria 12159
735 Ga0373947_0162305 3300035725 Bacteria 1446
736 Ga0373947_0270947 3300035725 Bacteria 1127
737 Ga0373947_0562024 3300035725 Bacteria 777
738 Ga0373937_0000131 3300036401 Bacteria 72767
739 Ga0373937_0100352 3300036401 Bacteria 2686
740 Ga0373937_0173246 3300036401 Bacteria 2025
741 Ga0373925_0037265 3300037068 Bacteria 3589
742 Ga0373925_0123636 3300037068 Bacteria 2011
743 Ga0395900_0379098 3300037418 Bacteria 1383
744 Ga0395898_0135055 3300037466 Bacteria 2362
745 Ga0395898_0497397 3300037466 Bacteria 1160
746 Ga0395898_1023672 3300037466 Bacteria 761
747 Ga0395901_0352270 3300038443 Bacteria 1519
748 Ga0439460_0125926 3300042461 Bacteria 841
749 Ga0451577_0059863 3300042876 Bacteria 3395
750 Ga0451577_0298204 3300042876 Bacteria 1461
751 Ga0451577_0518524 3300042876 Bacteria 1082
752 Ga0453684_1317033 3300044712 Bacteria 753
753 Ga0466960_0243811 3300044901 Bacteria 996
754 Ga0451576_0001874 3300045051 Bacteria 33900
755 Ga0451576_0029355 3300045051 Bacteria 5885
756 Ga0451576_0354367 3300045051 Bacteria 1536
757 Ga0451576_2305649 3300045051 Bacteria 552
758 Ga0495617_007146 3300046452 Bacteria 3891
759 Ga0495627_029326 3300046453 Bacteria 1752
760 Ga0495638_0189467 3300046460 Bacteria 1168
761 Ga0495641_0007792 3300046461 Bacteria 6631
762 Ga0495580_0029530 3300046472 Bacteria 3978
763 Ga0495605_0022593 3300046474 Bacteria 3320
764 Ga0495639_0008736 3300046475 Bacteria 4346
765 Ga0495584_0022072 3300046491 Bacteria 3230
766 Ga0495584_0115405 3300046491 Bacteria 1359
767 Ga0495584_0333569 3300046491 Bacteria 770
768 Ga0495585_0040880 3300046492 Bacteria 2602
769 Ga0495596_0043015 3300046500 Bacteria 1780
770 Ga0495607_0042179 3300046501 Bacteria 2706
771 Ga0495616_0096061 3300046513 Bacteria 1396
772 Ga0495630_0118647 3300046517 Bacteria 2007
773 Ga0495631_0033286 3300046518 Bacteria 2316
774 Ga0495637_0016835 3300046520 Bacteria 3414
775 Ga0495644_0006521 3300046523 Bacteria 4518
776 Ga0495663_0025547 3300046525 Bacteria 1723
777 Ga0495642_0366361 3300046528 Bacteria 634
778 Ga0495654_0128448 3300046530 Bacteria 1140
779 Ga0495598_0003609 3300046537 Bacteria 3299
780 Ga0495621_0005773 3300046539 Bacteria 3578
781 Ga0495621_0113868 3300046539 Bacteria 1040
782 Ga0495633_0015892 3300046558 Bacteria 3896
783 Ga0495656_0008616 3300046615 Bacteria 3646
784 Ga0495634_0121091 3300046642 Bacteria 1676
785 Ga0495611_0048255 3300046648 Bacteria 1913
786 Ga0495659_0006305 3300046664 Bacteria 3748
787 Ga0495661_0055083 3300046665 Bacteria 2385
788 Ga0495588_0212462 3300046674 Bacteria 1021
789 Ga0495657_0182286 3300046675 Bacteria 1288
790 Ga0495658_0253005 3300046683 Bacteria 1108
791 Ga0495669_0011126 3300046684 Bacteria 3813
792 Ga0495624_0007311 3300046690 Bacteria 7759
793 Ga0495670_0012390 3300046691 Bacteria 4193
794 Ga0495670_0458367 3300046691 Bacteria 691
795 Ga0495671_0019231 3300046692 Bacteria 3614
796 Ga0495649_0157747 3300046694 Bacteria 1190
797 Ga0495589_0014599 3300046794 Bacteria 4042
798 Ga0495660_0156692 3300046810 Bacteria 1120
799 Ga0495636_0126456 3300047318 Bacteria 1134
800 Ga0495672_0154397 3300047320 Bacteria 1187
801 Ga0495676_0012327 3300047321 Bacteria 7700
802 Ga0495675_0224271 3300047444 Bacteria 1136
803 Ga0495677_0090822 3300047445 Bacteria 1150
804 Ga0495679_017138 3300047446 Bacteria 2601
805 Ga0495681_0039442 3300047470 Bacteria 2306
806 Ga0495686_0309787 3300047472 Bacteria 869
807 Ga0495615_0050250 3300048090 Bacteria 1071
808 Ga0495626_0110144 3300048091 Bacteria 1193
809 Ga0496100_0008018 3300048903 Bacteria 5868
810 Ga0496101_0043209 3300048904 Bacteria 3220
811 Ga0496101_0088272 3300048904 Bacteria 2303
812 Ga0496101_0129028 3300048904 Bacteria 1918
813 Ga0496102_0081656 3300048905 Bacteria 2980
814 Ga0496102_0119340 3300048905 Bacteria 2462
815 Ga0496102_0364720 3300048905 Bacteria 1360
816 Ga0496102_0594091 3300048905 Bacteria 1030
817 Ga0496102_1177639 3300048905 Unclassified 686
818 Ga0496103_0007794 3300048906 Bacteria 6365
819 Ga0496103_0061716 3300048906 Bacteria 2332
820 Ga0496103_0078809 3300048906 Bacteria 2069
821 Ga0496103_0489675 3300048906 Bacteria 787
822 Ga0496105_0034883 3300048908 Bacteria 4139
823 Ga0496106_0002288 3300048909 Bacteria 14290
824 Ga0496106_0043948 3300048909 Bacteria 3354
825 Ga0496106_0070437 3300048909 Bacteria 2670
826 Ga0496106_0089845 3300048909 Bacteria 2369
827 Ga0496107_0007023 3300048910 Bacteria 7756
828 Ga0496107_0086240 3300048910 Bacteria 2291
829 Ga0496107_0125164 3300048910 Bacteria 1895
830 Ga0496107_0254090 3300048910 Bacteria 1308
831 Ga0496107_0333309 3300048910 Bacteria 1129
832 Ga0496108_0001781 3300048911 Bacteria 17169
833 Ga0496108_0033453 3300048911 Bacteria 4271
834 Ga0496108_0160748 3300048911 Bacteria 1941
835 Ga0496109_0012801 3300048912 Bacteria 7252
836 Ga0496109_0396933 3300048912 Bacteria 1303
837 Ga0496110_0030304 3300048913 Bacteria 4662
838 Ga0496110_0115280 3300048913 Bacteria 2418
839 Ga0496110_0534304 3300048913 Bacteria 1066
840 Ga0496110_0623708 3300048913 Bacteria 977
841 Ga0496110_0899450 3300048913 Bacteria 791
842 Ga0496110_0914738 3300048913 Bacteria 783
843 Ga0496111_0007385 3300048914 Bacteria 7197
844 Ga0496111_0093896 3300048914 Bacteria 2200
845 Ga0496112_0649363 3300048915 Bacteria 985
846 Ga0496113_0467104 3300048916 Bacteria 1014
847 Ga0496113_0953590 3300048916 Unclassified 677
848 Ga0496114_0004981 3300048917 Bacteria 10361
849 Ga0496114_0390371 3300048917 Bacteria 1232
850 Ga0496115_0003424 3300048918 Bacteria 11397
851 Ga0501299_027222 3300049522 Bacteria 1084
852 Ga0501299_163270 3300049522 Bacteria 571
853 Ga0501034_0000999 3300049571 Bacteria 40516
854 Ga0501034_0016435 3300049571 Bacteria 7595
855 Ga0501068_0414176 3300049584 Bacteria 870
856 Ga0501068_0608253 3300049584 Bacteria 712
857 Ga0501069_0152552 3300049585 Bacteria 1328
858 Ga0501070_0113151 3300049586 Bacteria 2243
859 Ga0501072_0000575 3300049588 Bacteria 26469
860 Ga0501073_0336758 3300049589 Bacteria 1041
861 Ga0501249_164221 3300049679 Bacteria 566
862 Ga0501080_0282431 3300049742 Bacteria 1509
863 Ga0501083_0023476 3300049744 Bacteria 4276
864 nmdc:mga00v17_22927_c1 3300050491 Bacteria 3608
865 nmdc:mga0yw44_188395_c1 3300050492 Bacteria 1360
866 nmdc:mga0yw44_30749_c1 3300050492 Bacteria 3116
867 nmdc:mga0yw44_91804_c1 3300050492 Bacteria 1921
868 nmdc:mga0k408_324023_c1 3300050493 Bacteria 919
869 nmdc:mga05p37_1652_c1 3300050507 Bacteria 25883
870 nmdc:mga05p37_266159_c1 3300050507 Bacteria 2050
871 nmdc:mga05p37_35745_c1 3300050507 Bacteria 6093
872 nmdc:mga05p37_51418_c1 3300050507 Bacteria 5067
873 nmdc:mga05p37_86744_c1 3300050507 Bacteria 3858
874 nmdc:mga05p37_985858_c1 3300050507 Bacteria 897
875 nmdc:mga09592_183221_c1 3300050508 Bacteria 1812
876 nmdc:mga09592_32067_c1 3300050508 Bacteria 4379
877 nmdc:mga09592_5035_c1 3300050508 Bacteria 10721
878 nmdc:mga09592_82888_c1 3300050508 Bacteria 2733
879 nmdc:mga0qj67_137040_c1 3300050509 Bacteria 1983
880 nmdc:mga0qj67_31116_c1 3300050509 Bacteria 4156
881 nmdc:mga06r32_103867_c1 3300050510 Bacteria 2790
882 nmdc:mga06r32_163560_c1 3300050510 Bacteria 2208
883 nmdc:mga06r32_47586_c1 3300050510 Bacteria 4097
884 nmdc:mga08y16_1182606_c1 3300050511 Unclassified 736
885 nmdc:mga08y16_135212_c1 3300050511 Bacteria 2562
886 nmdc:mga08y16_209149_c1 3300050511 Bacteria 2021
887 nmdc:mga08y16_269622_c2 3300050511 Bacteria 1341
888 nmdc:mga08y16_29453_c1 3300050511 Bacteria 5785
889 nmdc:mga08y16_343026_c1 3300050511 Bacteria 1535
890 nmdc:mga08y16_355235_c1 3300050511 Bacteria 1505
891 nmdc:mga08y16_53126_c1 3300050511 Bacteria 4238
892 nmdc:mga08y16_63895_c1 3300050511 Bacteria 3845
893 nmdc:mga0n895_1319762_c1 3300050512 Bacteria 692
894 nmdc:mga0n895_1778071_c1 3300050512 Bacteria 577
895 nmdc:mga0n895_214018_c1 3300050512 Bacteria 1957
896 nmdc:mga0n895_218874_c1 3300050512 Bacteria 1933
897 nmdc:mga0n895_247163_c1 3300050512 Bacteria 1810
898 nmdc:mga0n895_283374_c1 3300050512 Bacteria 1680
899 nmdc:mga0n895_347152_c1 3300050512 Bacteria 1503
900 nmdc:mga0n895_559825_c1 3300050512 Bacteria 1148
901 nmdc:mga0n895_6765_c1 3300050512 Bacteria 9780
902 nmdc:mga0n895_977418_c1 3300050512 Bacteria 829
903 nmdc:mga0rr50_139090_c1 3300050513 Bacteria 1952
904 nmdc:mga0rr50_2920_c1 3300050513 Bacteria 9758
905 nmdc:mga0rr50_311577_c1 3300050513 Bacteria 1318
906 nmdc:mga0rr50_538502_c1 3300050513 Bacteria 994
907 nmdc:mga0rr50_58574_c1 3300050513 Bacteria 2887
908 nmdc:mga0rr50_925135_c1 3300050513 Bacteria 743
909 nmdc:mga08x19_124615_c1 3300050514 Bacteria 1729
910 nmdc:mga08x19_204568_c1 3300050514 Bacteria 1354
911 nmdc:mga08x19_22737_c1 3300050514 Bacteria 3884
912 nmdc:mga08x19_23840_c1 3300050514 Bacteria 3798
913 nmdc:mga08x19_34351_c1 3300050514 Bacteria 3204
914 nmdc:mga08x19_41242_c1 3300050514 Bacteria 2939
915 nmdc:mga08x19_502964_c1 3300050514 Bacteria 856
916 nmdc:mga08x19_94217_c1 3300050514 Bacteria 1980
917 nmdc:mga0a205_12629_c1 3300050515 Bacteria 7819
918 nmdc:mga0a205_141771_c1 3300050515 Bacteria 2303
919 nmdc:mga0a205_181007_c1 3300050515 Bacteria 2002
920 nmdc:mga0a205_215294_c1 3300050515 Bacteria 1808
921 nmdc:mga0a205_470887_c1 3300050515 Bacteria 1115
922 nmdc:mga0a205_614228_c1 3300050515 Bacteria 940
923 Ga0495655_0001127 3300053083 Bacteria 4130
924 Ga0495619_0158424 3300053085 Bacteria 1563
925 Ga0501084_0965646 3300054114 Unclassified 716
926 Ga0501082_0133550 3300060353 Bacteria 2153
927 Ga0501082_0288553 3300060353 Bacteria 1429
928 Ga0501082_0944182 3300060353 Unclassified 754

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100657493 Ga0068855_1006574932 155
2 3300005564 Ga0070664_100080557 Ga0070664_1000805572 155
3 3300005614 Ga0068856_100047839 Ga0068856_1000478395 155
4 3300005841 Ga0068863_101585438 Ga0068863_1015854381 155
5 3300025945 Ga0207679_10028372 Ga0207679_100283724 155
6 3300025981 Ga0207640_10134385 Ga0207640_101343852 155
7 3300026078 Ga0207702_10049706 Ga0207702_100497063 155
8 3300003203 JGI25406J46586_10084736 JGI25406J46586_100847361 156
9 3300005435 Ga0070714_100250794 Ga0070714_1002507941 156
10 3300005444 Ga0070694_100040772 Ga0070694_1000407723 156
11 3300005444 Ga0070694_100397214 Ga0070694_1003972141 156
12 3300005444 Ga0070694_100416469 Ga0070694_1004164692 156
13 3300005467 Ga0070706_101099066 Ga0070706_1010990662 156
14 3300005468 Ga0070707_100043684 Ga0070707_1000436843 156
15 3300005518 Ga0070699_100418673 Ga0070699_1004186731 156
16 3300005518 Ga0070699_100583473 Ga0070699_1005834731 156
17 3300005536 Ga0070697_100109319 Ga0070697_1001093192 156
18 3300005536 Ga0070697_100180588 Ga0070697_1001805881 156
19 3300005536 Ga0070697_100779023 Ga0070697_1007790231 156
20 3300005545 Ga0070695_100038140 Ga0070695_1000381403 156
21 3300005545 Ga0070695_100147589 Ga0070695_1001475892 156
22 3300005546 Ga0070696_100200764 Ga0070696_1002007642 156
23 3300005546 Ga0070696_100227051 Ga0070696_1002270512 156
24 3300005549 Ga0070704_101027017 Ga0070704_1010270171 156
25 3300005985 Ga0081539_10000226 Ga0081539_1000022625 156
26 3300006173 Ga0070716_100259573 Ga0070716_1002595732 156
27 3300006173 Ga0070716_100486644 Ga0070716_1004866441 156
28 3300006852 Ga0075433_10275651 Ga0075433_102756512 156
29 3300006871 Ga0075434_100000003 Ga0075434_10000000332 156
30 3300006871 Ga0075434_100043038 Ga0075434_1000430384 156
31 3300006914 Ga0075436_100173396 Ga0075436_1001733962 156
32 3300007076 Ga0075435_100010435 Ga0075435_1000104354 156
33 3300007265 Ga0099794_10049733 Ga0099794_100497332 156
34 3300009147 Ga0114129_10225321 Ga0114129_102253212 156
35 3300013308 Ga0157375_12764363 Ga0157375_127643631 156
36 3300025910 Ga0207684_11003844 Ga0207684_110038442 156
37 3300025922 Ga0207646_10008428 Ga0207646_100084282 156
38 3300025929 Ga0207664_11103878 Ga0207664_111038782 156
39 3300025939 Ga0207665_10185164 Ga0207665_101851642 156
40 3300035118 Ga0373954_0000003 Ga0373954_0000003_36437_36907 156
41 3300035119 Ga0373956_0066709 Ga0373956_0066709_123_593 156
42 3300035410 Ga0373924_0011224 Ga0373924_0011224_2702_3172 156
43 3300035695 Ga0373927_0043108 Ga0373927_0043108_2112_2624 156
44 3300035724 Ga0373933_0001870 Ga0373933_0001870_847_1317 156
45 3300036401 Ga0373937_0000131 Ga0373937_0000131_55272_55742 156
46 3300044901 Ga0466960_0243811 Ga0466960_0243811_288_758 156
47 3300046675 Ga0495657_0182286 Ga0495657_0182286_784_1254 156
48 3300047444 Ga0495675_0224271 Ga0495675_0224271_423_893 156
49 3300050507 nmdc:mga05p37_266159_c1 nmdc:mga05p37_266159_c1_144_656 156
50 3300050511 nmdc:mga08y16_1182606_c1 nmdc:mga08y16_1182606_c1_102_572 156
51 3300050512 nmdc:mga0n895_283374_c1 nmdc:mga0n895_283374_c1_1095_1607 156
52 3300050512 nmdc:mga0n895_559825_c1 nmdc:mga0n895_559825_c1_606_1076 156
53 3300050512 nmdc:mga0n895_6765_c1 nmdc:mga0n895_6765_c1_4683_5153 156
54 3300050513 nmdc:mga0rr50_2920_c1 nmdc:mga0rr50_2920_c1_6850_7320 156
55 3300050513 nmdc:mga0rr50_58574_c1 nmdc:mga0rr50_58574_c1_541_1011 156
56 3300050514 nmdc:mga08x19_204568_c1 nmdc:mga08x19_204568_c1_106_576 156
57 3300050514 nmdc:mga08x19_34351_c1 nmdc:mga08x19_34351_c1_1733_2203 156
58 3300050514 nmdc:mga08x19_41242_c1 nmdc:mga08x19_41242_c1_2411_2923 156
59 3300050514 nmdc:mga08x19_94217_c1 nmdc:mga08x19_94217_c1_956_1426 156
60 3300050515 nmdc:mga0a205_12629_c1 nmdc:mga0a205_12629_c1_102_614 156
61 3300050515 nmdc:mga0a205_215294_c1 nmdc:mga0a205_215294_c1_1054_1524 156
62 3300005438 Ga0070701_10979191 Ga0070701_109791911 157
63 3300005471 Ga0070698_100267332 Ga0070698_1002673322 157
64 3300005545 Ga0070695_100332598 Ga0070695_1003325982 157
65 3300005549 Ga0070704_100334228 Ga0070704_1003342282 157
66 3300042876 Ga0451577_0298204 Ga0451577_0298204_29_508 157
67 3300054114 Ga0501084_0965646 Ga0501084_0965646_162_635 157
68 3300060353 Ga0501082_0944182 Ga0501082_0944182_216_689 157
69 3300006173 Ga0070716_100477648 Ga0070716_1004776482 158
70 3300014969 Ga0157376_11110261 Ga0157376_111102612 158
71 3300049584 Ga0501068_0608253 Ga0501068_0608253_121_597 158
72 3300050492 nmdc:mga0yw44_30749_c1 nmdc:mga0yw44_30749_c1_1840_2316 158
73 3300005331 Ga0070670_100771741 Ga0070670_1007717412 159
74 3300005458 Ga0070681_11151117 Ga0070681_111511171 159
75 3300005518 Ga0070699_100076537 Ga0070699_1000765373 159
76 3300005842 Ga0068858_100325860 Ga0068858_1003258602 159
77 3300006844 Ga0075428_100066145 Ga0075428_1000661452 159
78 3300006844 Ga0075428_100143936 Ga0075428_1001439362 159
79 3300006847 Ga0075431_100081933 Ga0075431_1000819333 159
80 3300006880 Ga0075429_100032190 Ga0075429_1000321902 159
81 3300009147 Ga0114129_10427625 Ga0114129_104276252 159
82 3300014326 Ga0157380_11878770 Ga0157380_118787702 159
83 3300025899 Ga0207642_10031218 Ga0207642_100312183 159
84 3300026035 Ga0207703_10177081 Ga0207703_101770812 159
85 3300026089 Ga0207648_10194933 Ga0207648_101949331 159
86 3300026118 Ga0207675_100605105 Ga0207675_1006051052 159
87 3300028381 Ga0268264_10968013 Ga0268264_109680132 159
88 3300032002 Ga0307416_101445039 Ga0307416_1014450391 159
89 3300035084 Ga0373928_0156111 Ga0373928_0156111_79_561 159
90 3300049522 Ga0501299_027222 Ga0501299_027222_154_633 159
91 3300049571 Ga0501034_0000999 Ga0501034_0000999_32719_33198 159
92 3300049571 Ga0501034_0016435 Ga0501034_0016435_6541_7020 159
93 3300049584 Ga0501068_0414176 Ga0501068_0414176_121_600 159
94 3300049588 Ga0501072_0000575 Ga0501072_0000575_1850_2329 159
95 3300050507 nmdc:mga05p37_51418_c1 nmdc:mga05p37_51418_c1_795_1277 159
96 3300050508 nmdc:mga09592_82888_c1 nmdc:mga09592_82888_c1_1570_2052 159
97 3300050514 nmdc:mga08x19_23840_c1 nmdc:mga08x19_23840_c1_2836_3315 159
98 3300001977 JGI24746J21847_1007538 JGI24746J21847_10075382 160
99 3300001990 JGI24737J22298_10008941 JGI24737J22298_100089413 160
100 3300001991 JGI24743J22301_10004728 JGI24743J22301_100047283 160
101 3300002070 JGI24750J21931_1001145 JGI24750J21931_10011453 160
102 3300002070 JGI24750J21931_1002899 JGI24750J21931_10028991 160
103 3300002073 JGI24745J21846_1001070 JGI24745J21846_10010703 160
104 3300002074 JGI24748J21848_1003000 JGI24748J21848_10030002 160
105 3300002075 JGI24738J21930_10007173 JGI24738J21930_100071733 160
106 3300002076 JGI24749J21850_1004565 JGI24749J21850_10045653 160
107 3300002076 JGI24749J21850_1010562 JGI24749J21850_10105622 160
108 3300002077 JGI24744J21845_10003130 JGI24744J21845_100031303 160
109 3300002239 JGI24034J26672_10008728 JGI24034J26672_100087282 160
110 3300002244 JGI24742J22300_10001923 JGI24742J22300_100019232 160
111 3300002244 JGI24742J22300_10052258 JGI24742J22300_100522581 160
112 3300002459 JGI24751J29686_10007565 JGI24751J29686_100075653 160
113 3300003659 JGI25404J52841_10002936 JGI25404J52841_100029364 160
114 3300003911 JGI25405J52794_10033093 JGI25405J52794_100330931 160
115 3300005293 Ga0065715_10151111 Ga0065715_101511112 160
116 3300005295 Ga0065707_10127695 Ga0065707_101276952 160
117 3300005295 Ga0065707_10551226 Ga0065707_105512261 160
118 3300005328 Ga0070676_10024314 Ga0070676_100243143 160
119 3300005328 Ga0070676_10034571 Ga0070676_100345712 160
120 3300005328 Ga0070676_10330762 Ga0070676_103307622 160
121 3300005329 Ga0070683_100012422 Ga0070683_1000124225 160
122 3300005330 Ga0070690_100059351 Ga0070690_1000593512 160
123 3300005330 Ga0070690_100169041 Ga0070690_1001690412 160
124 3300005330 Ga0070690_101234006 Ga0070690_1012340061 160
125 3300005331 Ga0070670_100458365 Ga0070670_1004583651 160
126 3300005331 Ga0070670_100585832 Ga0070670_1005858322 160
127 3300005333 Ga0070677_10007692 Ga0070677_100076922 160
128 3300005334 Ga0068869_100000121 Ga0068869_1000001212 160
129 3300005334 Ga0068869_100060152 Ga0068869_1000601522 160
130 3300005334 Ga0068869_100411894 Ga0068869_1004118941 160
131 3300005334 Ga0068869_100600098 Ga0068869_1006000982 160
132 3300005335 Ga0070666_10130452 Ga0070666_101304522 160
133 3300005335 Ga0070666_10562763 Ga0070666_105627631 160
134 3300005338 Ga0068868_100056124 Ga0068868_1000561242 160
135 3300005338 Ga0068868_100057215 Ga0068868_1000572152 160
136 3300005338 Ga0068868_100514721 Ga0068868_1005147212 160
137 3300005339 Ga0070660_100021749 Ga0070660_1000217492 160
138 3300005339 Ga0070660_100046924 Ga0070660_1000469242 160
139 3300005339 Ga0070660_100181458 Ga0070660_1001814582 160
140 3300005339 Ga0070660_100510308 Ga0070660_1005103082 160
141 3300005340 Ga0070689_100008395 Ga0070689_10000839511 160
142 3300005340 Ga0070689_100430933 Ga0070689_1004309332 160
143 3300005340 Ga0070689_100504486 Ga0070689_1005044862 160
144 3300005341 Ga0070691_10017562 Ga0070691_100175623 160
145 3300005343 Ga0070687_100023503 Ga0070687_1000235031 160
146 3300005343 Ga0070687_100088315 Ga0070687_1000883152 160
147 3300005343 Ga0070687_100213709 Ga0070687_1002137092 160
148 3300005343 Ga0070687_100286619 Ga0070687_1002866192 160
149 3300005344 Ga0070661_100029653 Ga0070661_1000296532 160
150 3300005344 Ga0070661_100064222 Ga0070661_1000642222 160
151 3300005344 Ga0070661_100072461 Ga0070661_1000724613 160
152 3300005344 Ga0070661_100101319 Ga0070661_1001013193 160
153 3300005345 Ga0070692_10210751 Ga0070692_102107512 160
154 3300005345 Ga0070692_10453001 Ga0070692_104530012 160
155 3300005345 Ga0070692_10614419 Ga0070692_106144192 160
156 3300005347 Ga0070668_100005467 Ga0070668_1000054675 160
157 3300005347 Ga0070668_100036090 Ga0070668_1000360902 160
158 3300005347 Ga0070668_100186204 Ga0070668_1001862042 160
159 3300005347 Ga0070668_100191117 Ga0070668_1001911172 160
160 3300005347 Ga0070668_100263534 Ga0070668_1002635341 160
161 3300005347 Ga0070668_100324770 Ga0070668_1003247702 160
162 3300005353 Ga0070669_100072739 Ga0070669_1000727393 160
163 3300005353 Ga0070669_100109601 Ga0070669_1001096012 160
164 3300005353 Ga0070669_100293109 Ga0070669_1002931092 160
165 3300005353 Ga0070669_100574881 Ga0070669_1005748812 160
166 3300005353 Ga0070669_101046567 Ga0070669_1010465671 160
167 3300005354 Ga0070675_100054743 Ga0070675_1000547433 160
168 3300005354 Ga0070675_100232834 Ga0070675_1002328342 160
169 3300005354 Ga0070675_100353504 Ga0070675_1003535041 160
170 3300005354 Ga0070675_100393837 Ga0070675_1003938372 160
171 3300005354 Ga0070675_100484506 Ga0070675_1004845062 160
172 3300005354 Ga0070675_101260687 Ga0070675_1012606871 160
173 3300005355 Ga0070671_100022108 Ga0070671_1000221083 160
174 3300005355 Ga0070671_100227394 Ga0070671_1002273941 160
175 3300005355 Ga0070671_100440027 Ga0070671_1004400272 160
176 3300005356 Ga0070674_100016494 Ga0070674_1000164944 160
177 3300005356 Ga0070674_100323903 Ga0070674_1003239031 160
178 3300005356 Ga0070674_100726742 Ga0070674_1007267422 160
179 3300005364 Ga0070673_100006060 Ga0070673_1000060603 160
180 3300005364 Ga0070673_100026639 Ga0070673_1000266394 160
181 3300005364 Ga0070673_100181773 Ga0070673_1001817732 160
182 3300005364 Ga0070673_100231696 Ga0070673_1002316962 160
183 3300005364 Ga0070673_100868938 Ga0070673_1008689382 160
184 3300005365 Ga0070688_100016172 Ga0070688_1000161724 160
185 3300005365 Ga0070688_100027208 Ga0070688_1000272084 160
186 3300005365 Ga0070688_100687700 Ga0070688_1006877001 160
187 3300005366 Ga0070659_100044765 Ga0070659_1000447654 160
188 3300005366 Ga0070659_100052481 Ga0070659_1000524812 160
189 3300005366 Ga0070659_100079603 Ga0070659_1000796032 160
190 3300005366 Ga0070659_100104112 Ga0070659_1001041121 160
191 3300005367 Ga0070667_100005519 Ga0070667_1000055196 160
192 3300005367 Ga0070667_100033447 Ga0070667_1000334474 160
193 3300005367 Ga0070667_100108241 Ga0070667_1001082413 160
194 3300005367 Ga0070667_100309381 Ga0070667_1003093812 160
195 3300005367 Ga0070667_100406708 Ga0070667_1004067081 160
196 3300005367 Ga0070667_100867169 Ga0070667_1008671692 160
197 3300005406 Ga0070703_10366535 Ga0070703_103665351 160
198 3300005434 Ga0070709_10222392 Ga0070709_102223922 160
199 3300005436 Ga0070713_100091210 Ga0070713_1000912102 160
200 3300005437 Ga0070710_10052339 Ga0070710_100523392 160
201 3300005438 Ga0070701_10154102 Ga0070701_101541022 160
202 3300005438 Ga0070701_10222376 Ga0070701_102223762 160
203 3300005439 Ga0070711_100064921 Ga0070711_1000649212 160
204 3300005440 Ga0070705_100212060 Ga0070705_1002120602 160
205 3300005440 Ga0070705_100346408 Ga0070705_1003464082 160
206 3300005440 Ga0070705_100413023 Ga0070705_1004130231 160
207 3300005440 Ga0070705_100563794 Ga0070705_1005637942 160
208 3300005441 Ga0070700_100009952 Ga0070700_1000099525 160
209 3300005441 Ga0070700_100014920 Ga0070700_1000149204 160
210 3300005441 Ga0070700_100061194 Ga0070700_1000611942 160
211 3300005441 Ga0070700_100301833 Ga0070700_1003018332 160
212 3300005441 Ga0070700_101655445 Ga0070700_1016554451 160
213 3300005444 Ga0070694_100128820 Ga0070694_1001288202 160
214 3300005444 Ga0070694_100386472 Ga0070694_1003864722 160
215 3300005444 Ga0070694_100478149 Ga0070694_1004781492 160
216 3300005444 Ga0070694_101718905 Ga0070694_1017189051 160
217 3300005445 Ga0070708_100027191 Ga0070708_1000271912 160
218 3300005455 Ga0070663_100002260 Ga0070663_10000226013 160
219 3300005455 Ga0070663_100016989 Ga0070663_1000169893 160
220 3300005455 Ga0070663_100121476 Ga0070663_1001214762 160
221 3300005455 Ga0070663_100611225 Ga0070663_1006112252 160
222 3300005456 Ga0070678_100025772 Ga0070678_1000257723 160
223 3300005456 Ga0070678_100097419 Ga0070678_1000974192 160
224 3300005456 Ga0070678_100460881 Ga0070678_1004608812 160
225 3300005456 Ga0070678_100710795 Ga0070678_1007107952 160
226 3300005456 Ga0070678_101747043 Ga0070678_1017470431 160
227 3300005457 Ga0070662_100001034 Ga0070662_1000010345 160
228 3300005457 Ga0070662_100009501 Ga0070662_1000095019 160
229 3300005457 Ga0070662_100296879 Ga0070662_1002968792 160
230 3300005457 Ga0070662_100310912 Ga0070662_1003109122 160
231 3300005457 Ga0070662_100361714 Ga0070662_1003617141 160
232 3300005457 Ga0070662_100462122 Ga0070662_1004621222 160
233 3300005457 Ga0070662_100551789 Ga0070662_1005517891 160
234 3300005458 Ga0070681_10581690 Ga0070681_105816902 160
235 3300005458 Ga0070681_11240135 Ga0070681_112401351 160
236 3300005459 Ga0068867_100028941 Ga0068867_1000289416 160
237 3300005459 Ga0068867_100146695 Ga0068867_1001466952 160
238 3300005459 Ga0068867_100280670 Ga0068867_1002806702 160
239 3300005459 Ga0068867_100458383 Ga0068867_1004583832 160
240 3300005459 Ga0068867_101331371 Ga0068867_1013313711 160
241 3300005466 Ga0070685_10008603 Ga0070685_100086037 160
242 3300005466 Ga0070685_10010997 Ga0070685_100109972 160
243 3300005467 Ga0070706_100044678 Ga0070706_1000446783 160
244 3300005467 Ga0070706_101013378 Ga0070706_1010133781 160
245 3300005468 Ga0070707_100723204 Ga0070707_1007232042 160
246 3300005468 Ga0070707_101071414 Ga0070707_1010714141 160
247 3300005471 Ga0070698_100116477 Ga0070698_1001164772 160
248 3300005518 Ga0070699_100185457 Ga0070699_1001854572 160
249 3300005518 Ga0070699_100441456 Ga0070699_1004414562 160
250 3300005518 Ga0070699_100652296 Ga0070699_1006522962 160
251 3300005535 Ga0070684_100157462 Ga0070684_1001574622 160
252 3300005539 Ga0068853_100009533 Ga0068853_1000095334 160
253 3300005539 Ga0068853_100045484 Ga0068853_1000454842 160
254 3300005539 Ga0068853_100071205 Ga0068853_1000712052 160
255 3300005539 Ga0068853_100206358 Ga0068853_1002063582 160
256 3300005539 Ga0068853_100216264 Ga0068853_1002162642 160
257 3300005539 Ga0068853_100829906 Ga0068853_1008299062 160
258 3300005543 Ga0070672_100122602 Ga0070672_1001226022 160
259 3300005543 Ga0070672_100155192 Ga0070672_1001551922 160
260 3300005543 Ga0070672_100160692 Ga0070672_1001606922 160
261 3300005543 Ga0070672_100664402 Ga0070672_1006644022 160
262 3300005544 Ga0070686_100034473 Ga0070686_1000344733 160
263 3300005545 Ga0070695_100064454 Ga0070695_1000644542 160
264 3300005545 Ga0070695_100075160 Ga0070695_1000751603 160
265 3300005545 Ga0070695_100788146 Ga0070695_1007881462 160
266 3300005546 Ga0070696_100228650 Ga0070696_1002286502 160
267 3300005546 Ga0070696_100262180 Ga0070696_1002621802 160
268 3300005546 Ga0070696_100272852 Ga0070696_1002728522 160
269 3300005546 Ga0070696_100638813 Ga0070696_1006388132 160
270 3300005547 Ga0070693_100325824 Ga0070693_1003258241 160
271 3300005547 Ga0070693_100857133 Ga0070693_1008571331 160
272 3300005548 Ga0070665_100054890 Ga0070665_1000548903 160
273 3300005548 Ga0070665_100055967 Ga0070665_1000559672 160
274 3300005548 Ga0070665_100269983 Ga0070665_1002699832 160
275 3300005548 Ga0070665_101828731 Ga0070665_1018287311 160
276 3300005549 Ga0070704_100069481 Ga0070704_1000694812 160
277 3300005549 Ga0070704_100109411 Ga0070704_1001094111 160
278 3300005549 Ga0070704_100407145 Ga0070704_1004071452 160
279 3300005549 Ga0070704_100856297 Ga0070704_1008562972 160
280 3300005549 Ga0070704_101290530 Ga0070704_1012905301 160
281 3300005549 Ga0070704_101298941 Ga0070704_1012989411 160
282 3300005563 Ga0068855_100000618 Ga0068855_10000061818 160
283 3300005563 Ga0068855_100469692 Ga0068855_1004696922 160
284 3300005563 Ga0068855_101043969 Ga0068855_1010439692 160
285 3300005563 Ga0068855_101155850 Ga0068855_1011558502 160
286 3300005564 Ga0070664_100003070 Ga0070664_1000030704 160
287 3300005564 Ga0070664_100010816 Ga0070664_1000108168 160
288 3300005564 Ga0070664_100051886 Ga0070664_1000518864 160
289 3300005564 Ga0070664_100105200 Ga0070664_1001052002 160
290 3300005564 Ga0070664_100515261 Ga0070664_1005152612 160
291 3300005564 Ga0070664_100865294 Ga0070664_1008652941 160
292 3300005577 Ga0068857_100014463 Ga0068857_1000144638 160
293 3300005577 Ga0068857_100016325 Ga0068857_1000163257 160
294 3300005577 Ga0068857_100311755 Ga0068857_1003117552 160
295 3300005578 Ga0068854_100045035 Ga0068854_1000450354 160
296 3300005578 Ga0068854_100107882 Ga0068854_1001078822 160
297 3300005578 Ga0068854_100178633 Ga0068854_1001786332 160
298 3300005614 Ga0068856_100000093 Ga0068856_10000009357 160
299 3300005614 Ga0068856_100028254 Ga0068856_1000282548 160
300 3300005614 Ga0068856_100110886 Ga0068856_1001108864 160
301 3300005614 Ga0068856_100201564 Ga0068856_1002015643 160
302 3300005614 Ga0068856_100629619 Ga0068856_1006296192 160
303 3300005614 Ga0068856_101141795 Ga0068856_1011417952 160
304 3300005615 Ga0070702_100016321 Ga0070702_1000163213 160
305 3300005615 Ga0070702_100025445 Ga0070702_1000254452 160
306 3300005615 Ga0070702_100232526 Ga0070702_1002325262 160
307 3300005616 Ga0068852_100044168 Ga0068852_1000441683 160
308 3300005616 Ga0068852_100471214 Ga0068852_1004712142 160
309 3300005616 Ga0068852_101106465 Ga0068852_1011064652 160
310 3300005617 Ga0068859_100018237 Ga0068859_1000182372 160
311 3300005617 Ga0068859_100027447 Ga0068859_1000274476 160
312 3300005617 Ga0068859_100029782 Ga0068859_1000297828 160
313 3300005617 Ga0068859_100044053 Ga0068859_1000440533 160
314 3300005617 Ga0068859_100119044 Ga0068859_1001190444 160
315 3300005617 Ga0068859_100143080 Ga0068859_1001430802 160
316 3300005617 Ga0068859_100265389 Ga0068859_1002653893 160
317 3300005617 Ga0068859_100599532 Ga0068859_1005995322 160
318 3300005617 Ga0068859_100844812 Ga0068859_1008448122 160
319 3300005617 Ga0068859_101274479 Ga0068859_1012744792 160
320 3300005618 Ga0068864_100013289 Ga0068864_1000132898 160
321 3300005618 Ga0068864_100033901 Ga0068864_1000339013 160
322 3300005618 Ga0068864_100058563 Ga0068864_1000585633 160
323 3300005618 Ga0068864_100129300 Ga0068864_1001293002 160
324 3300005718 Ga0068866_10007073 Ga0068866_100070734 160
325 3300005718 Ga0068866_10015832 Ga0068866_100158322 160
326 3300005718 Ga0068866_10239285 Ga0068866_102392851 160
327 3300005719 Ga0068861_100016323 Ga0068861_10001632310 160
328 3300005719 Ga0068861_100788100 Ga0068861_1007881001 160
329 3300005834 Ga0068851_10003290 Ga0068851_100032902 160
330 3300005834 Ga0068851_10025362 Ga0068851_100253624 160
331 3300005834 Ga0068851_10324163 Ga0068851_103241632 160
332 3300005834 Ga0068851_10426881 Ga0068851_104268811 160
333 3300005834 Ga0068851_10594890 Ga0068851_105948902 160
334 3300005840 Ga0068870_10005949 Ga0068870_100059494 160
335 3300005840 Ga0068870_10013761 Ga0068870_100137613 160
336 3300005840 Ga0068870_10226700 Ga0068870_102267002 160
337 3300005841 Ga0068863_100006688 Ga0068863_1000066887 160
338 3300005841 Ga0068863_100019022 Ga0068863_1000190229 160
339 3300005841 Ga0068863_100071537 Ga0068863_1000715372 160
340 3300005841 Ga0068863_100161972 Ga0068863_1001619722 160
341 3300005841 Ga0068863_100208625 Ga0068863_1002086251 160
342 3300005841 Ga0068863_101315847 Ga0068863_1013158472 160
343 3300005842 Ga0068858_100011753 Ga0068858_1000117536 160
344 3300005842 Ga0068858_100028984 Ga0068858_1000289847 160
345 3300005842 Ga0068858_100052318 Ga0068858_1000523184 160
346 3300005842 Ga0068858_100086576 Ga0068858_1000865762 160
347 3300005842 Ga0068858_100331789 Ga0068858_1003317892 160
348 3300005842 Ga0068858_101605849 Ga0068858_1016058491 160
349 3300005843 Ga0068860_100010410 Ga0068860_1000104107 160
350 3300005843 Ga0068860_100029566 Ga0068860_1000295664 160
351 3300005843 Ga0068860_100051826 Ga0068860_1000518262 160
352 3300005843 Ga0068860_100188108 Ga0068860_1001881082 160
353 3300005843 Ga0068860_100318595 Ga0068860_1003185952 160
354 3300005843 Ga0068860_100329346 Ga0068860_1003293462 160
355 3300005843 Ga0068860_101103367 Ga0068860_1011033672 160
356 3300005844 Ga0068862_100015627 Ga0068862_1000156272 160
357 3300005844 Ga0068862_100033422 Ga0068862_1000334224 160
358 3300005844 Ga0068862_100036439 Ga0068862_1000364393 160
359 3300005844 Ga0068862_100045278 Ga0068862_1000452782 160
360 3300005844 Ga0068862_101029311 Ga0068862_1010293112 160
361 3300005844 Ga0068862_101628756 Ga0068862_1016287561 160
362 3300005937 Ga0081455_10015181 Ga0081455_100151815 160
363 3300005937 Ga0081455_10019463 Ga0081455_100194633 160
364 3300005937 Ga0081455_10026378 Ga0081455_100263784 160
365 3300005937 Ga0081455_10091775 Ga0081455_100917752 160
366 3300005981 Ga0081538_10032628 Ga0081538_100326283 160
367 3300005983 Ga0081540_1000045 Ga0081540_10000459 160
368 3300005983 Ga0081540_1010997 Ga0081540_10109975 160
369 3300005983 Ga0081540_1015520 Ga0081540_10155202 160
370 3300006038 Ga0075365_10007399 Ga0075365_100073992 160
371 3300006038 Ga0075365_10109544 Ga0075365_101095442 160
372 3300006038 Ga0075365_10147347 Ga0075365_101473472 160
373 3300006038 Ga0075365_10553399 Ga0075365_105533992 160
374 3300006051 Ga0075364_10164759 Ga0075364_101647592 160
375 3300006163 Ga0070715_10006868 Ga0070715_100068683 160
376 3300006173 Ga0070716_100263819 Ga0070716_1002638192 160
377 3300006175 Ga0070712_100123209 Ga0070712_1001232092 160
378 3300006237 Ga0097621_100013107 Ga0097621_1000131076 160
379 3300006237 Ga0097621_100136204 Ga0097621_1001362043 160
380 3300006237 Ga0097621_100313650 Ga0097621_1003136502 160
381 3300006358 Ga0068871_100026948 Ga0068871_1000269484 160
382 3300006844 Ga0075428_100003992 Ga0075428_1000039923 160
383 3300006844 Ga0075428_100076532 Ga0075428_1000765322 160
384 3300006844 Ga0075428_100144235 Ga0075428_1001442352 160
385 3300006844 Ga0075428_100443634 Ga0075428_1004436342 160
386 3300006844 Ga0075428_101029908 Ga0075428_1010299082 160
387 3300006846 Ga0075430_100013974 Ga0075430_1000139744 160
388 3300006846 Ga0075430_100194624 Ga0075430_1001946242 160
389 3300006846 Ga0075430_100484203 Ga0075430_1004842032 160
390 3300006847 Ga0075431_100007554 Ga0075431_1000075544 160
391 3300006847 Ga0075431_100062520 Ga0075431_1000625204 160
392 3300006847 Ga0075431_100122616 Ga0075431_1001226163 160
393 3300006852 Ga0075433_10070333 Ga0075433_100703334 160
394 3300006852 Ga0075433_10097309 Ga0075433_100973092 160
395 3300006852 Ga0075433_10364213 Ga0075433_103642132 160
396 3300006852 Ga0075433_10469237 Ga0075433_104692372 160
397 3300006852 Ga0075433_10506724 Ga0075433_105067242 160
398 3300006852 Ga0075433_10628635 Ga0075433_106286351 160
399 3300006871 Ga0075434_100235304 Ga0075434_1002353043 160
400 3300006871 Ga0075434_100259125 Ga0075434_1002591252 160
401 3300006871 Ga0075434_100342726 Ga0075434_1003427262 160
402 3300006871 Ga0075434_101744822 Ga0075434_1017448221 160
403 3300006880 Ga0075429_100001249 Ga0075429_1000012495 160
404 3300006880 Ga0075429_100132177 Ga0075429_1001321772 160
405 3300006881 Ga0068865_100014498 Ga0068865_1000144988 160
406 3300006881 Ga0068865_100210486 Ga0068865_1002104862 160
407 3300006881 Ga0068865_100902599 Ga0068865_1009025992 160
408 3300006914 Ga0075436_100681482 Ga0075436_1006814822 160
409 3300006931 Ga0097620_100018234 Ga0097620_1000182342 160
410 3300006931 Ga0097620_100027450 Ga0097620_1000274506 160
411 3300006931 Ga0097620_100029780 Ga0097620_1000297808 160
412 3300006931 Ga0097620_100044054 Ga0097620_1000440543 160
413 3300006931 Ga0097620_100119044 Ga0097620_1001190444 160
414 3300006931 Ga0097620_100143078 Ga0097620_1001430782 160
415 3300006931 Ga0097620_100265406 Ga0097620_1002654063 160
416 3300006931 Ga0097620_100599517 Ga0097620_1005995172 160
417 3300006931 Ga0097620_100844709 Ga0097620_1008447092 160
418 3300006931 Ga0097620_101226692 Ga0097620_1012266922 160
419 3300006931 Ga0097620_101274412 Ga0097620_1012744122 160
420 3300007076 Ga0075435_100391440 Ga0075435_1003914402 160
421 3300007076 Ga0075435_100561743 Ga0075435_1005617432 160
422 3300007076 Ga0075435_100561763 Ga0075435_1005617632 160
423 3300007265 Ga0099794_10067629 Ga0099794_100676292 160
424 3300009036 Ga0105244_10147439 Ga0105244_101474392 160
425 3300009094 Ga0111539_10075511 Ga0111539_100755114 160
426 3300009094 Ga0111539_10232272 Ga0111539_102322722 160
427 3300009094 Ga0111539_10293738 Ga0111539_102937382 160
428 3300009094 Ga0111539_10353417 Ga0111539_103534172 160
429 3300009094 Ga0111539_10817592 Ga0111539_108175921 160
430 3300009094 Ga0111539_11371738 Ga0111539_113717382 160
431 3300009098 Ga0105245_10031117 Ga0105245_100311172 160
432 3300009098 Ga0105245_10063641 Ga0105245_100636412 160
433 3300009098 Ga0105245_10352820 Ga0105245_103528202 160
434 3300009098 Ga0105245_10381765 Ga0105245_103817652 160
435 3300009098 Ga0105245_10477409 Ga0105245_104774092 160
436 3300009098 Ga0105245_10649630 Ga0105245_106496302 160
437 3300009098 Ga0105245_11365551 Ga0105245_113655511 160
438 3300009101 Ga0105247_10009818 Ga0105247_100098182 160
439 3300009101 Ga0105247_10235644 Ga0105247_102356442 160
440 3300009147 Ga0114129_10007594 Ga0114129_1000759412 160
441 3300009147 Ga0114129_10038987 Ga0114129_100389874 160
442 3300009147 Ga0114129_10179118 Ga0114129_101791182 160
443 3300009147 Ga0114129_10805977 Ga0114129_108059772 160
444 3300009147 Ga0114129_10986247 Ga0114129_109862472 160
445 3300009147 Ga0114129_11106653 Ga0114129_111066532 160
446 3300009148 Ga0105243_10010928 Ga0105243_100109283 160
447 3300009148 Ga0105243_10148592 Ga0105243_101485922 160
448 3300009148 Ga0105243_10269406 Ga0105243_102694062 160
449 3300009148 Ga0105243_10310641 Ga0105243_103106412 160
450 3300009148 Ga0105243_10430274 Ga0105243_104302742 160
451 3300009148 Ga0105243_10516587 Ga0105243_105165872 160
452 3300009148 Ga0105243_10585557 Ga0105243_105855572 160
453 3300009148 Ga0105243_11236442 Ga0105243_112364422 160
454 3300009174 Ga0105241_11167514 Ga0105241_111675142 160
455 3300009174 Ga0105241_12210451 Ga0105241_122104511 160
456 3300009176 Ga0105242_10000568 Ga0105242_100005684 160
457 3300009176 Ga0105242_10019555 Ga0105242_100195554 160
458 3300009176 Ga0105242_10067481 Ga0105242_100674812 160
459 3300009176 Ga0105242_10189508 Ga0105242_101895082 160
460 3300009176 Ga0105242_10372033 Ga0105242_103720332 160
461 3300009176 Ga0105242_10429748 Ga0105242_104297482 160
462 3300009177 Ga0105248_10022908 Ga0105248_100229084 160
463 3300009177 Ga0105248_10034839 Ga0105248_100348395 160
464 3300009177 Ga0105248_10045402 Ga0105248_100454024 160
465 3300009177 Ga0105248_11610904 Ga0105248_116109042 160
466 3300009177 Ga0105248_11809235 Ga0105248_118092352 160
467 3300009545 Ga0105237_10077461 Ga0105237_100774614 160
468 3300009553 Ga0105249_10042946 Ga0105249_100429463 160
469 3300009553 Ga0105249_10055161 Ga0105249_100551612 160
470 3300009553 Ga0105249_10357942 Ga0105249_103579421 160
471 3300009553 Ga0105249_10403971 Ga0105249_104039712 160
472 3300009553 Ga0105249_10477036 Ga0105249_104770362 160
473 3300009553 Ga0105249_10749924 Ga0105249_107499242 160
474 3300009553 Ga0105249_10853931 Ga0105249_108539312 160
475 3300009553 Ga0105249_11226629 Ga0105249_112266291 160
476 3300009553 Ga0105249_11263693 Ga0105249_112636932 160
477 3300010159 Ga0099796_10028001 Ga0099796_100280012 160
478 3300010375 Ga0105239_10019473 Ga0105239_100194732 160
479 3300010375 Ga0105239_10220103 Ga0105239_102201032 160
480 3300010375 Ga0105239_10755654 Ga0105239_107556542 160
481 3300010375 Ga0105239_10816159 Ga0105239_108161592 160
482 3300011119 Ga0105246_10023998 Ga0105246_100239984 160
483 3300011119 Ga0105246_11167382 Ga0105246_111673821 160
484 3300012506 Ga0157324_1005539 Ga0157324_10055392 160
485 3300013100 Ga0157373_10000777 Ga0157373_1000077711 160
486 3300013102 Ga0157371_10021903 Ga0157371_100219035 160
487 3300013102 Ga0157371_10146182 Ga0157371_101461822 160
488 3300013102 Ga0157371_10829294 Ga0157371_108292941 160
489 3300013102 Ga0157371_10914553 Ga0157371_109145532 160
490 3300013105 Ga0157369_10120606 Ga0157369_101206063 160
491 3300013105 Ga0157369_10151570 Ga0157369_101515702 160
492 3300013105 Ga0157369_10442618 Ga0157369_104426182 160
493 3300013105 Ga0157369_11425375 Ga0157369_114253752 160
494 3300013296 Ga0157374_10031839 Ga0157374_100318394 160
495 3300013296 Ga0157374_10031850 Ga0157374_100318504 160
496 3300013296 Ga0157374_10232468 Ga0157374_102324682 160
497 3300013296 Ga0157374_10248219 Ga0157374_102482192 160
498 3300013297 Ga0157378_10015919 Ga0157378_100159198 160
499 3300013297 Ga0157378_10030596 Ga0157378_100305966 160
500 3300013297 Ga0157378_10034657 Ga0157378_100346574 160
501 3300013297 Ga0157378_10281292 Ga0157378_102812922 160
502 3300013297 Ga0157378_10337207 Ga0157378_103372072 160
503 3300013297 Ga0157378_10650113 Ga0157378_106501132 160
504 3300013297 Ga0157378_10791165 Ga0157378_107911652 160
505 3300013297 Ga0157378_11520223 Ga0157378_115202232 160
506 3300013306 Ga0163162_10080829 Ga0163162_100808292 160
507 3300013306 Ga0163162_10114123 Ga0163162_101141234 160
508 3300013306 Ga0163162_10235849 Ga0163162_102358491 160
509 3300013306 Ga0163162_10335641 Ga0163162_103356412 160
510 3300013306 Ga0163162_10921298 Ga0163162_109212982 160
511 3300013307 Ga0157372_10000852 Ga0157372_1000085221 160
512 3300013307 Ga0157372_10225815 Ga0157372_102258152 160
513 3300013307 Ga0157372_11669910 Ga0157372_116699101 160
514 3300013307 Ga0157372_12254589 Ga0157372_122545891 160
515 3300013308 Ga0157375_10014053 Ga0157375_100140538 160
516 3300013308 Ga0157375_10052520 Ga0157375_100525203 160
517 3300013308 Ga0157375_10130292 Ga0157375_101302922 160
518 3300013308 Ga0157375_10983839 Ga0157375_109838392 160
519 3300013308 Ga0157375_11450011 Ga0157375_114500111 160
520 3300013308 Ga0157375_11734466 Ga0157375_117344661 160
521 3300014325 Ga0163163_10023951 Ga0163163_100239513 160
522 3300014325 Ga0163163_10620223 Ga0163163_106202232 160
523 3300014325 Ga0163163_10644346 Ga0163163_106443462 160
524 3300014325 Ga0163163_11694634 Ga0163163_116946341 160
525 3300014325 Ga0163163_12711951 Ga0163163_127119511 160
526 3300014326 Ga0157380_10040596 Ga0157380_100405963 160
527 3300014326 Ga0157380_10094023 Ga0157380_100940232 160
528 3300014326 Ga0157380_11096280 Ga0157380_110962801 160
529 3300014326 Ga0157380_11174751 Ga0157380_111747512 160
530 3300014326 Ga0157380_11392164 Ga0157380_113921642 160
531 3300014968 Ga0157379_10009926 Ga0157379_100099264 160
532 3300014968 Ga0157379_10012304 Ga0157379_100123048 160
533 3300014969 Ga0157376_10410029 Ga0157376_104100292 160
534 3300017792 Ga0163161_10008687 Ga0163161_100086872 160
535 3300017792 Ga0163161_10018498 Ga0163161_100184984 160
536 3300017792 Ga0163161_10390944 Ga0163161_103909442 160
537 3300025315 Ga0207697_10000241 Ga0207697_100002414 160
538 3300025321 Ga0207656_10118384 Ga0207656_101183841 160
539 3300025728 Ga0207655_1099185 Ga0207655_10991851 160
540 3300025885 Ga0207653_10120778 Ga0207653_101207781 160
541 3300025893 Ga0207682_10009064 Ga0207682_100090644 160
542 3300025899 Ga0207642_10007601 Ga0207642_100076012 160
543 3300025899 Ga0207642_10031542 Ga0207642_100315423 160
544 3300025900 Ga0207710_10015280 Ga0207710_100152803 160
545 3300025901 Ga0207688_10003121 Ga0207688_1000312111 160
546 3300025901 Ga0207688_10016163 Ga0207688_100161634 160
547 3300025903 Ga0207680_10012357 Ga0207680_100123574 160
548 3300025903 Ga0207680_10075604 Ga0207680_100756042 160
549 3300025904 Ga0207647_10076912 Ga0207647_100769122 160
550 3300025904 Ga0207647_10255734 Ga0207647_102557341 160
551 3300025907 Ga0207645_10010667 Ga0207645_100106675 160
552 3300025907 Ga0207645_10029673 Ga0207645_100296733 160
553 3300025907 Ga0207645_10104549 Ga0207645_101045492 160
554 3300025907 Ga0207645_10250292 Ga0207645_102502922 160
555 3300025908 Ga0207643_10003471 Ga0207643_100034712 160
556 3300025908 Ga0207643_10010768 Ga0207643_100107686 160
557 3300025908 Ga0207643_10153008 Ga0207643_101530082 160
558 3300025910 Ga0207684_10013079 Ga0207684_100130796 160
559 3300025910 Ga0207684_10104925 Ga0207684_101049252 160
560 3300025912 Ga0207707_10451478 Ga0207707_104514782 160
561 3300025914 Ga0207671_10071930 Ga0207671_100719304 160
562 3300025915 Ga0207693_10227356 Ga0207693_102273562 160
563 3300025916 Ga0207663_10018657 Ga0207663_100186573 160
564 3300025917 Ga0207660_10760133 Ga0207660_107601332 160
565 3300025918 Ga0207662_10003440 Ga0207662_100034408 160
566 3300025918 Ga0207662_10021711 Ga0207662_100217112 160
567 3300025918 Ga0207662_10148147 Ga0207662_101481472 160
568 3300025919 Ga0207657_10002844 Ga0207657_1000284414 160
569 3300025919 Ga0207657_10025055 Ga0207657_100250553 160
570 3300025919 Ga0207657_10127363 Ga0207657_101273632 160
571 3300025920 Ga0207649_10016438 Ga0207649_100164382 160
572 3300025920 Ga0207649_10037862 Ga0207649_100378622 160
573 3300025920 Ga0207649_10046789 Ga0207649_100467892 160
574 3300025922 Ga0207646_10015712 Ga0207646_100157122 160
575 3300025922 Ga0207646_10047615 Ga0207646_100476151 160
576 3300025922 Ga0207646_10761524 Ga0207646_107615242 160
577 3300025922 Ga0207646_10887180 Ga0207646_108871802 160
578 3300025923 Ga0207681_10086779 Ga0207681_100867793 160
579 3300025923 Ga0207681_10134459 Ga0207681_101344592 160
580 3300025923 Ga0207681_10212121 Ga0207681_102121212 160
581 3300025925 Ga0207650_10001318 Ga0207650_1000131817 160
582 3300025925 Ga0207650_10009995 Ga0207650_100099952 160
583 3300025925 Ga0207650_10022994 Ga0207650_100229942 160
584 3300025925 Ga0207650_10078058 Ga0207650_100780584 160
585 3300025925 Ga0207650_10281478 Ga0207650_102814782 160
586 3300025926 Ga0207659_10002890 Ga0207659_100028904 160
587 3300025926 Ga0207659_10056090 Ga0207659_100560902 160
588 3300025926 Ga0207659_10278749 Ga0207659_102787492 160
589 3300025926 Ga0207659_10443449 Ga0207659_104434492 160
590 3300025927 Ga0207687_10033199 Ga0207687_100331993 160
591 3300025927 Ga0207687_10319635 Ga0207687_103196352 160
592 3300025928 Ga0207700_10021540 Ga0207700_100215403 160
593 3300025931 Ga0207644_10012275 Ga0207644_100122758 160
594 3300025931 Ga0207644_10042016 Ga0207644_100420162 160
595 3300025931 Ga0207644_10046582 Ga0207644_100465824 160
596 3300025931 Ga0207644_10455581 Ga0207644_104555812 160
597 3300025931 Ga0207644_10466636 Ga0207644_104666361 160
598 3300025931 Ga0207644_10833555 Ga0207644_108335551 160
599 3300025932 Ga0207690_10000422 Ga0207690_1000042220 160
600 3300025932 Ga0207690_10019200 Ga0207690_100192003 160
601 3300025932 Ga0207690_10698156 Ga0207690_106981561 160
602 3300025933 Ga0207706_10000014 Ga0207706_1000001417 160
603 3300025933 Ga0207706_10018672 Ga0207706_100186725 160
604 3300025933 Ga0207706_10057573 Ga0207706_100575732 160
605 3300025933 Ga0207706_10108159 Ga0207706_101081593 160
606 3300025933 Ga0207706_10201838 Ga0207706_102018382 160
607 3300025933 Ga0207706_10228299 Ga0207706_102282992 160
608 3300025933 Ga0207706_10478795 Ga0207706_104787952 160
609 3300025933 Ga0207706_10810948 Ga0207706_108109481 160
610 3300025934 Ga0207686_10022390 Ga0207686_100223904 160
611 3300025934 Ga0207686_10133913 Ga0207686_101339132 160
612 3300025934 Ga0207686_10632129 Ga0207686_106321292 160
613 3300025934 Ga0207686_10713687 Ga0207686_107136872 160
614 3300025934 Ga0207686_11167315 Ga0207686_111673152 160
615 3300025935 Ga0207709_10011594 Ga0207709_100115943 160
616 3300025935 Ga0207709_10559390 Ga0207709_105593902 160
617 3300025936 Ga0207670_10004340 Ga0207670_1000434010 160
618 3300025936 Ga0207670_10190784 Ga0207670_101907842 160
619 3300025936 Ga0207670_10312115 Ga0207670_103121152 160
620 3300025936 Ga0207670_10349022 Ga0207670_103490222 160
621 3300025936 Ga0207670_10367049 Ga0207670_103670492 160
622 3300025937 Ga0207669_10068170 Ga0207669_100681702 160
623 3300025937 Ga0207669_10085458 Ga0207669_100854582 160
624 3300025937 Ga0207669_10280850 Ga0207669_102808502 160
625 3300025937 Ga0207669_10485132 Ga0207669_104851322 160
626 3300025938 Ga0207704_10092771 Ga0207704_100927712 160
627 3300025938 Ga0207704_10142197 Ga0207704_101421972 160
628 3300025939 Ga0207665_10030040 Ga0207665_100300402 160
629 3300025939 Ga0207665_10249352 Ga0207665_102493522 160
630 3300025939 Ga0207665_10733427 Ga0207665_107334272 160
631 3300025940 Ga0207691_10001791 Ga0207691_100017917 160
632 3300025940 Ga0207691_10008767 Ga0207691_1000876711 160
633 3300025940 Ga0207691_10015083 Ga0207691_100150834 160
634 3300025940 Ga0207691_10025235 Ga0207691_100252355 160
635 3300025940 Ga0207691_10078851 Ga0207691_100788512 160
636 3300025940 Ga0207691_10437769 Ga0207691_104377692 160
637 3300025941 Ga0207711_10005602 Ga0207711_1000560210 160
638 3300025941 Ga0207711_10044888 Ga0207711_100448882 160
639 3300025941 Ga0207711_10098361 Ga0207711_100983612 160
640 3300025941 Ga0207711_10131131 Ga0207711_101311313 160
641 3300025941 Ga0207711_10400993 Ga0207711_104009932 160
642 3300025941 Ga0207711_10636046 Ga0207711_106360461 160
643 3300025941 Ga0207711_10643782 Ga0207711_106437822 160
644 3300025942 Ga0207689_10001355 Ga0207689_100013554 160
645 3300025942 Ga0207689_10002469 Ga0207689_1000246910 160
646 3300025942 Ga0207689_10030920 Ga0207689_100309202 160
647 3300025944 Ga0207661_10029165 Ga0207661_100291654 160
648 3300025944 Ga0207661_10078036 Ga0207661_100780363 160
649 3300025945 Ga0207679_10013364 Ga0207679_100133643 160
650 3300025945 Ga0207679_10082701 Ga0207679_100827012 160
651 3300025945 Ga0207679_10089333 Ga0207679_100893333 160
652 3300025945 Ga0207679_10105567 Ga0207679_101055673 160
653 3300025945 Ga0207679_10251962 Ga0207679_102519622 160
654 3300025949 Ga0207667_10006720 Ga0207667_100067202 160
655 3300025949 Ga0207667_10652415 Ga0207667_106524152 160
656 3300025949 Ga0207667_10823036 Ga0207667_108230361 160
657 3300025949 Ga0207667_10969981 Ga0207667_109699811 160
658 3300025960 Ga0207651_10012974 Ga0207651_100129744 160
659 3300025960 Ga0207651_10043524 Ga0207651_100435243 160
660 3300025960 Ga0207651_10119984 Ga0207651_101199842 160
661 3300025961 Ga0207712_10032002 Ga0207712_100320023 160
662 3300025961 Ga0207712_10034073 Ga0207712_100340733 160
663 3300025961 Ga0207712_10368640 Ga0207712_103686402 160
664 3300025961 Ga0207712_10775586 Ga0207712_107755862 160
665 3300025972 Ga0207668_10004599 Ga0207668_100045999 160
666 3300025972 Ga0207668_10028780 Ga0207668_100287803 160
667 3300025972 Ga0207668_10038565 Ga0207668_100385654 160
668 3300025972 Ga0207668_10183904 Ga0207668_101839042 160
669 3300025972 Ga0207668_10216349 Ga0207668_102163492 160
670 3300025972 Ga0207668_10397628 Ga0207668_103976282 160
671 3300025981 Ga0207640_10078297 Ga0207640_100782973 160
672 3300025986 Ga0207658_10036497 Ga0207658_100364973 160
673 3300025986 Ga0207658_10077918 Ga0207658_100779181 160
674 3300026023 Ga0207677_10028439 Ga0207677_100284392 160
675 3300026023 Ga0207677_10499760 Ga0207677_104997602 160
676 3300026023 Ga0207677_10593832 Ga0207677_105938321 160
677 3300026035 Ga0207703_10023707 Ga0207703_100237074 160
678 3300026035 Ga0207703_10046670 Ga0207703_100466702 160
679 3300026035 Ga0207703_10051633 Ga0207703_100516333 160
680 3300026035 Ga0207703_10125680 Ga0207703_101256802 160
681 3300026035 Ga0207703_11041040 Ga0207703_110410402 160
682 3300026041 Ga0207639_10066575 Ga0207639_100665752 160
683 3300026067 Ga0207678_10002409 Ga0207678_1000240920 160
684 3300026067 Ga0207678_10037506 Ga0207678_100375062 160
685 3300026067 Ga0207678_10038603 Ga0207678_100386033 160
686 3300026075 Ga0207708_10029947 Ga0207708_100299473 160
687 3300026075 Ga0207708_10031440 Ga0207708_100314403 160
688 3300026075 Ga0207708_10105184 Ga0207708_101051842 160
689 3300026075 Ga0207708_10151294 Ga0207708_101512942 160
690 3300026075 Ga0207708_10601844 Ga0207708_106018442 160
691 3300026078 Ga0207702_10045825 Ga0207702_100458253 160
692 3300026078 Ga0207702_10096192 Ga0207702_100961922 160
693 3300026078 Ga0207702_10284966 Ga0207702_102849662 160
694 3300026078 Ga0207702_10836874 Ga0207702_108368742 160
695 3300026088 Ga0207641_10009600 Ga0207641_100096008 160
696 3300026088 Ga0207641_10046594 Ga0207641_100465942 160
697 3300026088 Ga0207641_10124352 Ga0207641_101243522 160
698 3300026088 Ga0207641_10173782 Ga0207641_101737823 160
699 3300026088 Ga0207641_10211681 Ga0207641_102116812 160
700 3300026089 Ga0207648_10066269 Ga0207648_100662695 160
701 3300026089 Ga0207648_10549127 Ga0207648_105491272 160
702 3300026095 Ga0207676_10029818 Ga0207676_100298183 160
703 3300026095 Ga0207676_10044164 Ga0207676_100441641 160
704 3300026095 Ga0207676_10054461 Ga0207676_100544613 160
705 3300026095 Ga0207676_10347619 Ga0207676_103476192 160
706 3300026116 Ga0207674_10007870 Ga0207674_100078705 160
707 3300026116 Ga0207674_10031295 Ga0207674_100312952 160
708 3300026116 Ga0207674_10601975 Ga0207674_106019751 160
709 3300026118 Ga0207675_100003797 Ga0207675_10000379717 160
710 3300026118 Ga0207675_100005624 Ga0207675_10000562410 160
711 3300026118 Ga0207675_100013865 Ga0207675_10001386511 160
712 3300026118 Ga0207675_101093436 Ga0207675_1010934361 160
713 3300026121 Ga0207683_10020959 Ga0207683_100209594 160
714 3300026121 Ga0207683_10048856 Ga0207683_100488563 160
715 3300026121 Ga0207683_10292508 Ga0207683_102925082 160
716 3300026142 Ga0207698_10104548 Ga0207698_101045484 160
717 3300026142 Ga0207698_10128498 Ga0207698_101284982 160
718 3300026142 Ga0207698_10134136 Ga0207698_101341362 160
719 3300027671 Ga0209588_1104444 Ga0209588_11044442 160
720 3300027682 Ga0209971_1005118 Ga0209971_10051184 160
721 3300027907 Ga0207428_10006862 Ga0207428_100068624 160
722 3300028379 Ga0268266_10057021 Ga0268266_100570213 160
723 3300028379 Ga0268266_10083385 Ga0268266_100833852 160
724 3300028380 Ga0268265_10018486 Ga0268265_100184864 160
725 3300028380 Ga0268265_10031527 Ga0268265_100315274 160
726 3300028380 Ga0268265_10099316 Ga0268265_100993162 160
727 3300028380 Ga0268265_10120568 Ga0268265_101205682 160
728 3300028380 Ga0268265_10276228 Ga0268265_102762282 160
729 3300028380 Ga0268265_10372507 Ga0268265_103725072 160
730 3300028381 Ga0268264_10028039 Ga0268264_100280392 160
731 3300028381 Ga0268264_10046400 Ga0268264_100464003 160
732 3300028381 Ga0268264_10102997 Ga0268264_101029972 160
733 3300028381 Ga0268264_10129806 Ga0268264_101298061 160
734 3300028381 Ga0268264_10153784 Ga0268264_101537842 160
735 3300028381 Ga0268264_10229182 Ga0268264_102291822 160
736 3300031911 Ga0307412_10290404 Ga0307412_102904041 160
737 3300032002 Ga0307416_100353038 Ga0307416_1003530382 160
738 3300032002 Ga0307416_100710268 Ga0307416_1007102682 160
739 3300034816 Ga0373930_0000969 Ga0373930_0000969_1612_2094 160
740 3300034817 Ga0373948_0003976 Ga0373948_0003976_1581_2063 160
741 3300034818 Ga0373950_0004481 Ga0373950_0004481_1499_1981 160
742 3300034818 Ga0373950_0025365 Ga0373950_0025365_280_807 160
743 3300034819 Ga0373958_0010777 Ga0373958_0010777_563_1045 160
744 3300035083 Ga0373926_0034021 Ga0373926_0034021_105_587 160
745 3300035084 Ga0373928_0004471 Ga0373928_0004471_926_1408 160
746 3300035088 Ga0373940_0000777 Ga0373940_0000777_3485_3967 160
747 3300035090 Ga0373949_0003420 Ga0373949_0003420_1854_2336 160
748 3300035092 Ga0373952_0002029 Ga0373952_0002029_1491_1973 160
749 3300035112 Ga0373932_0002149 Ga0373932_0002149_3530_4012 160
750 3300035114 Ga0373939_0001716 Ga0373939_0001716_1150_1632 160
751 3300035114 Ga0373939_0034212 Ga0373939_0034212_680_1207 160
752 3300035115 Ga0373941_0031559 Ga0373941_0031559_282_764 160
753 3300035116 Ga0373945_0033095 Ga0373945_0033095_45_527 160
754 3300035119 Ga0373956_0136367 Ga0373956_0136367_119_667 160
755 3300035170 Ga0373943_0007817 Ga0373943_0007817_2618_3100 160
756 3300035170 Ga0373943_0140182 Ga0373943_0140182_266_793 160
757 3300035171 Ga0373946_0012143 Ga0373946_0012143_2122_2604 160
758 3300035171 Ga0373946_0400638 Ga0373946_0400638_30_512 160
759 3300035242 Ga0373962_0002148 Ga0373962_0002148_2786_3268 160
760 3300035691 Ga0373931_0000252 Ga0373931_0000252_20162_20644 160
761 3300035691 Ga0373931_0965794 Ga0373931_0965794_68_550 160
762 3300035692 Ga0373935_0018563 Ga0373935_0018563_2645_3127 160
763 3300035695 Ga0373927_0019884 Ga0373927_0019884_3523_4005 160
764 3300035695 Ga0373927_0109375 Ga0373927_0109375_426_953 160
765 3300035725 Ga0373947_0162305 Ga0373947_0162305_483_965 160
766 3300035725 Ga0373947_0270947 Ga0373947_0270947_261_788 160
767 3300035725 Ga0373947_0562024 Ga0373947_0562024_62_589 160
768 3300036401 Ga0373937_0100352 Ga0373937_0100352_1038_1565 160
769 3300036401 Ga0373937_0173246 Ga0373937_0173246_920_1402 160
770 3300037068 Ga0373925_0037265 Ga0373925_0037265_2420_2902 160
771 3300037068 Ga0373925_0123636 Ga0373925_0123636_65_592 160
772 3300037418 Ga0395900_0379098 Ga0395900_0379098_146_628 160
773 3300037466 Ga0395898_0135055 Ga0395898_0135055_148_630 160
774 3300037466 Ga0395898_0497397 Ga0395898_0497397_382_864 160
775 3300037466 Ga0395898_1023672 Ga0395898_1023672_243_725 160
776 3300038443 Ga0395901_0352270 Ga0395901_0352270_798_1280 160
777 3300042461 Ga0439460_0125926 Ga0439460_0125926_318_809 160
778 3300042876 Ga0451577_0059863 Ga0451577_0059863_2368_2853 160
779 3300042876 Ga0451577_0518524 Ga0451577_0518524_95_619 160
780 3300044712 Ga0453684_1317033 Ga0453684_1317033_12_494 160
781 3300045051 Ga0451576_0001874 Ga0451576_0001874_14390_14875 160
782 3300045051 Ga0451576_0029355 Ga0451576_0029355_3689_4171 160
783 3300045051 Ga0451576_0354367 Ga0451576_0354367_964_1446 160
784 3300045051 Ga0451576_2305649 Ga0451576_2305649_41_523 160
785 3300046452 Ga0495617_007146 Ga0495617_007146_2171_2653 160
786 3300046453 Ga0495627_029326 Ga0495627_029326_642_1124 160
787 3300046460 Ga0495638_0189467 Ga0495638_0189467_121_603 160
788 3300046461 Ga0495641_0007792 Ga0495641_0007792_1338_1820 160
789 3300046472 Ga0495580_0029530 Ga0495580_0029530_2332_2814 160
790 3300046474 Ga0495605_0022593 Ga0495605_0022593_2438_2920 160
791 3300046475 Ga0495639_0008736 Ga0495639_0008736_1709_2191 160
792 3300046491 Ga0495584_0022072 Ga0495584_0022072_1144_1626 160
793 3300046491 Ga0495584_0115405 Ga0495584_0115405_390_872 160
794 3300046491 Ga0495584_0333569 Ga0495584_0333569_266_748 160
795 3300046492 Ga0495585_0040880 Ga0495585_0040880_256_738 160
796 3300046500 Ga0495596_0043015 Ga0495596_0043015_623_1105 160
797 3300046501 Ga0495607_0042179 Ga0495607_0042179_597_1079 160
798 3300046513 Ga0495616_0096061 Ga0495616_0096061_171_653 160
799 3300046517 Ga0495630_0118647 Ga0495630_0118647_1221_1703 160
800 3300046518 Ga0495631_0033286 Ga0495631_0033286_361_843 160
801 3300046520 Ga0495637_0016835 Ga0495637_0016835_1238_1720 160
802 3300046523 Ga0495644_0006521 Ga0495644_0006521_2421_2903 160
803 3300046525 Ga0495663_0025547 Ga0495663_0025547_933_1415 160
804 3300046528 Ga0495642_0366361 Ga0495642_0366361_52_579 160
805 3300046530 Ga0495654_0128448 Ga0495654_0128448_165_647 160
806 3300046537 Ga0495598_0003609 Ga0495598_0003609_253_735 160
807 3300046539 Ga0495621_0005773 Ga0495621_0005773_364_846 160
808 3300046539 Ga0495621_0113868 Ga0495621_0113868_411_893 160
809 3300046558 Ga0495633_0015892 Ga0495633_0015892_1610_2092 160
810 3300046615 Ga0495656_0008616 Ga0495656_0008616_1068_1550 160
811 3300046642 Ga0495634_0121091 Ga0495634_0121091_644_1126 160
812 3300046648 Ga0495611_0048255 Ga0495611_0048255_1171_1653 160
813 3300046664 Ga0495659_0006305 Ga0495659_0006305_1419_1901 160
814 3300046665 Ga0495661_0055083 Ga0495661_0055083_1848_2330 160
815 3300046674 Ga0495588_0212462 Ga0495588_0212462_417_899 160
816 3300046683 Ga0495658_0253005 Ga0495658_0253005_169_651 160
817 3300046684 Ga0495669_0011126 Ga0495669_0011126_2084_2566 160
818 3300046690 Ga0495624_0007311 Ga0495624_0007311_4360_4842 160
819 3300046691 Ga0495670_0012390 Ga0495670_0012390_1298_1780 160
820 3300046691 Ga0495670_0458367 Ga0495670_0458367_189_671 160
821 3300046692 Ga0495671_0019231 Ga0495671_0019231_1518_2000 160
822 3300046694 Ga0495649_0157747 Ga0495649_0157747_56_538 160
823 3300046794 Ga0495589_0014599 Ga0495589_0014599_1711_2193 160
824 3300046810 Ga0495660_0156692 Ga0495660_0156692_186_668 160
825 3300047318 Ga0495636_0126456 Ga0495636_0126456_199_681 160
826 3300047320 Ga0495672_0154397 Ga0495672_0154397_50_532 160
827 3300047321 Ga0495676_0012327 Ga0495676_0012327_4177_4659 160
828 3300047445 Ga0495677_0090822 Ga0495677_0090822_145_627 160
829 3300047446 Ga0495679_017138 Ga0495679_017138_1067_1549 160
830 3300047470 Ga0495681_0039442 Ga0495681_0039442_1395_1877 160
831 3300047472 Ga0495686_0309787 Ga0495686_0309787_203_685 160
832 3300048090 Ga0495615_0050250 Ga0495615_0050250_120_602 160
833 3300048091 Ga0495626_0110144 Ga0495626_0110144_145_627 160
834 3300048903 Ga0496100_0008018 Ga0496100_0008018_4008_4535 160
835 3300048904 Ga0496101_0043209 Ga0496101_0043209_2401_2928 160
836 3300048904 Ga0496101_0088272 Ga0496101_0088272_534_1061 160
837 3300048904 Ga0496101_0129028 Ga0496101_0129028_1303_1785 160
838 3300048905 Ga0496102_0081656 Ga0496102_0081656_113_640 160
839 3300048905 Ga0496102_0119340 Ga0496102_0119340_1260_1787 160
840 3300048905 Ga0496102_0364720 Ga0496102_0364720_81_563 160
841 3300048905 Ga0496102_0594091 Ga0496102_0594091_399_923 160
842 3300048905 Ga0496102_1177639 Ga0496102_1177639_30_557 160
843 3300048906 Ga0496103_0007794 Ga0496103_0007794_1436_1918 160
844 3300048906 Ga0496103_0061716 Ga0496103_0061716_734_1261 160
845 3300048906 Ga0496103_0078809 Ga0496103_0078809_1501_2028 160
846 3300048906 Ga0496103_0489675 Ga0496103_0489675_119_646 160
847 3300048908 Ga0496105_0034883 Ga0496105_0034883_2198_2680 160
848 3300048909 Ga0496106_0002288 Ga0496106_0002288_2261_2788 160
849 3300048909 Ga0496106_0043948 Ga0496106_0043948_908_1432 160
850 3300048909 Ga0496106_0070437 Ga0496106_0070437_1927_2409 160
851 3300048909 Ga0496106_0089845 Ga0496106_0089845_1406_1933 160
852 3300048910 Ga0496107_0007023 Ga0496107_0007023_5372_5899 160
853 3300048910 Ga0496107_0086240 Ga0496107_0086240_262_744 160
854 3300048910 Ga0496107_0125164 Ga0496107_0125164_1318_1845 160
855 3300048910 Ga0496107_0254090 Ga0496107_0254090_237_764 160
856 3300048910 Ga0496107_0333309 Ga0496107_0333309_274_801 160
857 3300048911 Ga0496108_0001781 Ga0496108_0001781_14224_14751 160
858 3300048911 Ga0496108_0033453 Ga0496108_0033453_1681_2163 160
859 3300048911 Ga0496108_0160748 Ga0496108_0160748_800_1327 160
860 3300048912 Ga0496109_0012801 Ga0496109_0012801_559_1086 160
861 3300048912 Ga0496109_0396933 Ga0496109_0396933_17_544 160
862 3300048913 Ga0496110_0030304 Ga0496110_0030304_1933_2415 160
863 3300048913 Ga0496110_0115280 Ga0496110_0115280_1333_1860 160
864 3300048913 Ga0496110_0534304 Ga0496110_0534304_286_768 160
865 3300048913 Ga0496110_0623708 Ga0496110_0623708_15_539 160
866 3300048913 Ga0496110_0899450 Ga0496110_0899450_91_573 160
867 3300048913 Ga0496110_0914738 Ga0496110_0914738_121_603 160
868 3300048914 Ga0496111_0007385 Ga0496111_0007385_1555_2037 160
869 3300048914 Ga0496111_0093896 Ga0496111_0093896_896_1423 160
870 3300048915 Ga0496112_0649363 Ga0496112_0649363_460_942 160
871 3300048916 Ga0496113_0467104 Ga0496113_0467104_428_955 160
872 3300048916 Ga0496113_0953590 Ga0496113_0953590_59_586 160
873 3300048917 Ga0496114_0004981 Ga0496114_0004981_7834_8316 160
874 3300048917 Ga0496114_0390371 Ga0496114_0390371_558_1085 160
875 3300048918 Ga0496115_0003424 Ga0496115_0003424_3883_4365 160
876 3300049522 Ga0501299_163270 Ga0501299_163270_58_540 160
877 3300049585 Ga0501069_0152552 Ga0501069_0152552_67_609 160
878 3300049586 Ga0501070_0113151 Ga0501070_0113151_95_637 160
879 3300049589 Ga0501073_0336758 Ga0501073_0336758_106_588 160
880 3300049679 Ga0501249_164221 Ga0501249_164221_11_493 160
881 3300049742 Ga0501080_0282431 Ga0501080_0282431_947_1489 160
882 3300049744 Ga0501083_0023476 Ga0501083_0023476_1342_1884 160
883 3300050491 nmdc:mga00v17_22927_c1 nmdc:mga00v17_22927_c1_790_1272 160
884 3300050492 nmdc:mga0yw44_188395_c1 nmdc:mga0yw44_188395_c1_606_1088 160
885 3300050492 nmdc:mga0yw44_91804_c1 nmdc:mga0yw44_91804_c1_539_1021 160
886 3300050493 nmdc:mga0k408_324023_c1 nmdc:mga0k408_324023_c1_251_748 160
887 3300050507 nmdc:mga05p37_1652_c1 nmdc:mga05p37_1652_c1_13717_14199 160
888 3300050507 nmdc:mga05p37_35745_c1 nmdc:mga05p37_35745_c1_3567_4049 160
889 3300050507 nmdc:mga05p37_86744_c1 nmdc:mga05p37_86744_c1_324_806 160
890 3300050507 nmdc:mga05p37_985858_c1 nmdc:mga05p37_985858_c1_125_607 160
891 3300050508 nmdc:mga09592_183221_c1 nmdc:mga09592_183221_c1_428_910 160
892 3300050508 nmdc:mga09592_32067_c1 nmdc:mga09592_32067_c1_3096_3578 160
893 3300050508 nmdc:mga09592_5035_c1 nmdc:mga09592_5035_c1_3742_4224 160
894 3300050509 nmdc:mga0qj67_137040_c1 nmdc:mga0qj67_137040_c1_1118_1600 160
895 3300050509 nmdc:mga0qj67_31116_c1 nmdc:mga0qj67_31116_c1_3152_3634 160
896 3300050510 nmdc:mga06r32_103867_c1 nmdc:mga06r32_103867_c1_1232_1714 160
897 3300050510 nmdc:mga06r32_163560_c1 nmdc:mga06r32_163560_c1_300_782 160
898 3300050510 nmdc:mga06r32_47586_c1 nmdc:mga06r32_47586_c1_1341_1823 160
899 3300050511 nmdc:mga08y16_135212_c1 nmdc:mga08y16_135212_c1_1444_1971 160
900 3300050511 nmdc:mga08y16_209149_c1 nmdc:mga08y16_209149_c1_1529_2011 160
901 3300050511 nmdc:mga08y16_269622_c2 nmdc:mga08y16_269622_c2_231_776 160
902 3300050511 nmdc:mga08y16_29453_c1 nmdc:mga08y16_29453_c1_4790_5272 160
903 3300050511 nmdc:mga08y16_343026_c1 nmdc:mga08y16_343026_c1_421_948 160
904 3300050511 nmdc:mga08y16_355235_c1 nmdc:mga08y16_355235_c1_455_937 160
905 3300050511 nmdc:mga08y16_53126_c1 nmdc:mga08y16_53126_c1_2773_3300 160
906 3300050511 nmdc:mga08y16_63895_c1 nmdc:mga08y16_63895_c1_1510_1992 160
907 3300050512 nmdc:mga0n895_1319762_c1 nmdc:mga0n895_1319762_c1_180_662 160
908 3300050512 nmdc:mga0n895_1778071_c1 nmdc:mga0n895_1778071_c1_34_516 160
909 3300050512 nmdc:mga0n895_214018_c1 nmdc:mga0n895_214018_c1_1339_1821 160
910 3300050512 nmdc:mga0n895_218874_c1 nmdc:mga0n895_218874_c1_370_894 160
911 3300050512 nmdc:mga0n895_247163_c1 nmdc:mga0n895_247163_c1_936_1418 160
912 3300050512 nmdc:mga0n895_347152_c1 nmdc:mga0n895_347152_c1_536_1063 160
913 3300050512 nmdc:mga0n895_977418_c1 nmdc:mga0n895_977418_c1_48_530 160
914 3300050513 nmdc:mga0rr50_139090_c1 nmdc:mga0rr50_139090_c1_1454_1936 160
915 3300050513 nmdc:mga0rr50_311577_c1 nmdc:mga0rr50_311577_c1_422_952 160
916 3300050513 nmdc:mga0rr50_538502_c1 nmdc:mga0rr50_538502_c1_356_838 160
917 3300050513 nmdc:mga0rr50_925135_c1 nmdc:mga0rr50_925135_c1_140_667 160
918 3300050514 nmdc:mga08x19_124615_c1 nmdc:mga08x19_124615_c1_13_495 160
919 3300050514 nmdc:mga08x19_22737_c1 nmdc:mga08x19_22737_c1_2007_2489 160
920 3300050514 nmdc:mga08x19_502964_c1 nmdc:mga08x19_502964_c1_269_799 160
921 3300050515 nmdc:mga0a205_141771_c1 nmdc:mga0a205_141771_c1_477_959 160
922 3300050515 nmdc:mga0a205_181007_c1 nmdc:mga0a205_181007_c1_72_554 160
923 3300050515 nmdc:mga0a205_470887_c1 nmdc:mga0a205_470887_c1_398_880 160
924 3300050515 nmdc:mga0a205_614228_c1 nmdc:mga0a205_614228_c1_235_717 160
925 3300053083 Ga0495655_0001127 Ga0495655_0001127_2584_3066 160
926 3300053085 Ga0495619_0158424 Ga0495619_0158424_602_1129 160
927 3300060353 Ga0501082_0133550 Ga0501082_0133550_537_1079 160
928 3300060353 Ga0501082_0288553 Ga0501082_0288553_659_1141 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

23

149

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8171 3 151
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.7895 10 156
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7796 3 151
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.72 10 156
1jch-assembly1.cif.gz_A crystal structure of colicin e3 in complex with its immunity protein 0.5404 47 159
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7647 26 151 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7341 26 151 1.20.120.550
af_I1KUX3_1129_1225_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5745 82 156 1.20.1270.60
af_I1LP17_5_226_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.558 44 158 1.20.1420.10
2xndN00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5519 80 148 1.20.20.10
ID Description Score Start End GO Terms
AF-A0A536UKF0-F1-model_v4 TRAP transporter small permease protein 0.933 55 156 GO:0005886
GO:0015740
GO:0022857
AF-A0A1G6VJW4-F1-model_v4 TRAP transporter small permease protein 0.9073 2 156 GO:0005886
GO:0015740
GO:0022857
AF-A0A4Q4CXK4-F1-model_v4 TRAP transporter small permease protein 0.9038 2 156 GO:0005886
GO:0015740
GO:0022857
AF-A0A1W2DDH7-F1-model_v4 TRAP transporter small permease protein 0.9015 1 156 GO:0005886
GO:0015740
GO:0022857
AF-A0A7W1AM24-F1-model_v4 TRAP transporter small permease protein 0.9005 49 160 GO:0005886
GO:0015740
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.76 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map