F485986
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 928 | 329 | 928 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300050511|nmdc:mga08y16_1182606_c1|nmdc:mga08y16_1182606_c1_102_572 |
| Length | 156 |
| Sequence | VKRLIDGYHRLLTWLMVGTVAVLIVPVTLQIISRYTALIPSWIWTEELSRFLFIWMVMLGAMIGIREGTHFEVDVWPKATALLRIASNLCVLVFALVFVWYGIAFVRFGWDQLSELAELPMPYIFMAWPLAGATWVLFLGESFVTNWRILRGEPAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 210 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.08 |
| Nodule | 0 |
| Rhizoplane | 4.53 |
| Rhizosphere | 94.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1007538 | 3300001977 | Bacteria | 1661 |
| 2 | JGI24737J22298_10008941 | 3300001990 | Bacteria | 3342 |
| 3 | JGI24743J22301_10004728 | 3300001991 | Bacteria | 2236 |
| 4 | JGI24750J21931_1001145 | 3300002070 | Bacteria | 3409 |
| 5 | JGI24750J21931_1002899 | 3300002070 | Bacteria | 2056 |
| 6 | JGI24745J21846_1001070 | 3300002073 | Bacteria | 2585 |
| 7 | JGI24748J21848_1003000 | 3300002074 | Bacteria | 1921 |
| 8 | JGI24738J21930_10007173 | 3300002075 | Bacteria | 2583 |
| 9 | JGI24749J21850_1004565 | 3300002076 | Bacteria | 1937 |
| 10 | JGI24749J21850_1010562 | 3300002076 | Bacteria | 1295 |
| 11 | JGI24744J21845_10003130 | 3300002077 | Bacteria | 3395 |
| 12 | JGI24034J26672_10008728 | 3300002239 | Bacteria | 1484 |
| 13 | JGI24742J22300_10001923 | 3300002244 | Bacteria | 3303 |
| 14 | JGI24742J22300_10052258 | 3300002244 | Bacteria | 742 |
| 15 | JGI24751J29686_10007565 | 3300002459 | Bacteria | 2220 |
| 16 | JGI25406J46586_10084736 | 3300003203 | Bacteria | 965 |
| 17 | JGI25404J52841_10002936 | 3300003659 | Bacteria | 3306 |
| 18 | JGI25405J52794_10033093 | 3300003911 | Bacteria | 1078 |
| 19 | Ga0065715_10151111 | 3300005293 | Bacteria | 1721 |
| 20 | Ga0065707_10127695 | 3300005295 | Bacteria | 1979 |
| 21 | Ga0065707_10551226 | 3300005295 | Bacteria | 721 |
| 22 | Ga0070676_10024314 | 3300005328 | Bacteria | 3411 |
| 23 | Ga0070676_10034571 | 3300005328 | Bacteria | 2902 |
| 24 | Ga0070676_10330762 | 3300005328 | Bacteria | 1042 |
| 25 | Ga0070683_100012422 | 3300005329 | Bacteria | 7401 |
| 26 | Ga0070690_100059351 | 3300005330 | Bacteria | 2459 |
| 27 | Ga0070690_100169041 | 3300005330 | Bacteria | 1503 |
| 28 | Ga0070690_101234006 | 3300005330 | Bacteria | 597 |
| 29 | Ga0070670_100458365 | 3300005331 | Bacteria | 1130 |
| 30 | Ga0070670_100585832 | 3300005331 | Bacteria | 997 |
| 31 | Ga0070670_100771741 | 3300005331 | Bacteria | 867 |
| 32 | Ga0070677_10007692 | 3300005333 | Bacteria | 3607 |
| 33 | Ga0068869_100000121 | 3300005334 | Bacteria | 37550 |
| 34 | Ga0068869_100060152 | 3300005334 | Bacteria | 2783 |
| 35 | Ga0068869_100411894 | 3300005334 | Bacteria | 1114 |
| 36 | Ga0068869_100600098 | 3300005334 | Bacteria | 930 |
| 37 | Ga0070666_10130452 | 3300005335 | Bacteria | 1746 |
| 38 | Ga0070666_10562763 | 3300005335 | Bacteria | 830 |
| 39 | Ga0068868_100056124 | 3300005338 | Bacteria | 3109 |
| 40 | Ga0068868_100057215 | 3300005338 | Bacteria | 3080 |
| 41 | Ga0068868_100514721 | 3300005338 | Bacteria | 1050 |
| 42 | Ga0070660_100021749 | 3300005339 | Bacteria | 4734 |
| 43 | Ga0070660_100046924 | 3300005339 | Bacteria | 3312 |
| 44 | Ga0070660_100181458 | 3300005339 | Bacteria | 1703 |
| 45 | Ga0070660_100510308 | 3300005339 | Bacteria | 1001 |
| 46 | Ga0070689_100008395 | 3300005340 | Bacteria | 7275 |
| 47 | Ga0070689_100430933 | 3300005340 | Bacteria | 1119 |
| 48 | Ga0070689_100504486 | 3300005340 | Bacteria | 1037 |
| 49 | Ga0070691_10017562 | 3300005341 | Bacteria | 3292 |
| 50 | Ga0070687_100023503 | 3300005343 | Bacteria | 2931 |
| 51 | Ga0070687_100088315 | 3300005343 | Bacteria | 1709 |
| 52 | Ga0070687_100213709 | 3300005343 | Bacteria | 1177 |
| 53 | Ga0070687_100286619 | 3300005343 | Bacteria | 1039 |
| 54 | Ga0070661_100029653 | 3300005344 | Bacteria | 3949 |
| 55 | Ga0070661_100064222 | 3300005344 | Bacteria | 2698 |
| 56 | Ga0070661_100072461 | 3300005344 | Bacteria | 2535 |
| 57 | Ga0070661_100101319 | 3300005344 | Bacteria | 2142 |
| 58 | Ga0070692_10210751 | 3300005345 | Bacteria | 1143 |
| 59 | Ga0070692_10453001 | 3300005345 | Bacteria | 822 |
| 60 | Ga0070692_10614419 | 3300005345 | Bacteria | 721 |
| 61 | Ga0070668_100005467 | 3300005347 | Bacteria | 9431 |
| 62 | Ga0070668_100036090 | 3300005347 | Bacteria | 3772 |
| 63 | Ga0070668_100186204 | 3300005347 | Bacteria | 1698 |
| 64 | Ga0070668_100191117 | 3300005347 | Bacteria | 1677 |
| 65 | Ga0070668_100263534 | 3300005347 | Bacteria | 1434 |
| 66 | Ga0070668_100324770 | 3300005347 | Bacteria | 1296 |
| 67 | Ga0070669_100072739 | 3300005353 | Bacteria | 2546 |
| 68 | Ga0070669_100109601 | 3300005353 | Bacteria | 2093 |
| 69 | Ga0070669_100293109 | 3300005353 | Bacteria | 1307 |
| 70 | Ga0070669_100574881 | 3300005353 | Bacteria | 942 |
| 71 | Ga0070669_101046567 | 3300005353 | Bacteria | 701 |
| 72 | Ga0070675_100054743 | 3300005354 | Bacteria | 3283 |
| 73 | Ga0070675_100232834 | 3300005354 | Bacteria | 1607 |
| 74 | Ga0070675_100353504 | 3300005354 | Bacteria | 1303 |
| 75 | Ga0070675_100393837 | 3300005354 | Bacteria | 1235 |
| 76 | Ga0070675_100484506 | 3300005354 | Bacteria | 1113 |
| 77 | Ga0070675_101260687 | 3300005354 | Bacteria | 681 |
| 78 | Ga0070671_100022108 | 3300005355 | Bacteria | 5196 |
| 79 | Ga0070671_100227394 | 3300005355 | Bacteria | 1583 |
| 80 | Ga0070671_100440027 | 3300005355 | Bacteria | 1118 |
| 81 | Ga0070674_100016494 | 3300005356 | Bacteria | 4631 |
| 82 | Ga0070674_100323903 | 3300005356 | Bacteria | 1236 |
| 83 | Ga0070674_100726742 | 3300005356 | Bacteria | 851 |
| 84 | Ga0070673_100006060 | 3300005364 | Bacteria | 7831 |
| 85 | Ga0070673_100026639 | 3300005364 | Bacteria | 4273 |
| 86 | Ga0070673_100181773 | 3300005364 | Bacteria | 1801 |
| 87 | Ga0070673_100231696 | 3300005364 | Bacteria | 1602 |
| 88 | Ga0070673_100868938 | 3300005364 | Bacteria | 835 |
| 89 | Ga0070688_100016172 | 3300005365 | Bacteria | 4260 |
| 90 | Ga0070688_100027208 | 3300005365 | Bacteria | 3405 |
| 91 | Ga0070688_100687700 | 3300005365 | Bacteria | 791 |
| 92 | Ga0070659_100044765 | 3300005366 | Bacteria | 3466 |
| 93 | Ga0070659_100052481 | 3300005366 | Bacteria | 3207 |
| 94 | Ga0070659_100079603 | 3300005366 | Bacteria | 2615 |
| 95 | Ga0070659_100104112 | 3300005366 | Bacteria | 2286 |
| 96 | Ga0070667_100005519 | 3300005367 | Bacteria | 10563 |
| 97 | Ga0070667_100033447 | 3300005367 | Bacteria | 4297 |
| 98 | Ga0070667_100108241 | 3300005367 | Bacteria | 2408 |
| 99 | Ga0070667_100309381 | 3300005367 | Bacteria | 1424 |
| 100 | Ga0070667_100406708 | 3300005367 | Bacteria | 1239 |
| 101 | Ga0070667_100867169 | 3300005367 | Bacteria | 840 |
| 102 | Ga0070703_10366535 | 3300005406 | Bacteria | 619 |
| 103 | Ga0070709_10222392 | 3300005434 | Bacteria | 1347 |
| 104 | Ga0070714_100250794 | 3300005435 | Bacteria | 1636 |
| 105 | Ga0070713_100091210 | 3300005436 | Bacteria | 2621 |
| 106 | Ga0070710_10052339 | 3300005437 | Bacteria | 2296 |
| 107 | Ga0070701_10154102 | 3300005438 | Bacteria | 1326 |
| 108 | Ga0070701_10222376 | 3300005438 | Bacteria | 1126 |
| 109 | Ga0070701_10979191 | 3300005438 | Bacteria | 589 |
| 110 | Ga0070711_100064921 | 3300005439 | Bacteria | 2552 |
| 111 | Ga0070705_100212060 | 3300005440 | Bacteria | 1335 |
| 112 | Ga0070705_100346408 | 3300005440 | Bacteria | 1082 |
| 113 | Ga0070705_100413023 | 3300005440 | Bacteria | 1003 |
| 114 | Ga0070705_100563794 | 3300005440 | Bacteria | 875 |
| 115 | Ga0070700_100009952 | 3300005441 | Bacteria | 5233 |
| 116 | Ga0070700_100014920 | 3300005441 | Bacteria | 4394 |
| 117 | Ga0070700_100061194 | 3300005441 | Bacteria | 2375 |
| 118 | Ga0070700_100301833 | 3300005441 | Bacteria | 1169 |
| 119 | Ga0070700_101655445 | 3300005441 | Bacteria | 548 |
| 120 | Ga0070694_100040772 | 3300005444 | Bacteria | 3096 |
| 121 | Ga0070694_100128820 | 3300005444 | Bacteria | 1826 |
| 122 | Ga0070694_100386472 | 3300005444 | Bacteria | 1093 |
| 123 | Ga0070694_100397214 | 3300005444 | Bacteria | 1079 |
| 124 | Ga0070694_100416469 | 3300005444 | Bacteria | 1055 |
| 125 | Ga0070694_100478149 | 3300005444 | Bacteria | 988 |
| 126 | Ga0070694_101718905 | 3300005444 | Bacteria | 534 |
| 127 | Ga0070708_100027191 | 3300005445 | Bacteria | 4906 |
| 128 | Ga0070663_100002260 | 3300005455 | Bacteria | 10792 |
| 129 | Ga0070663_100016989 | 3300005455 | Bacteria | 4738 |
| 130 | Ga0070663_100121476 | 3300005455 | Bacteria | 1974 |
| 131 | Ga0070663_100611225 | 3300005455 | Bacteria | 918 |
| 132 | Ga0070678_100025772 | 3300005456 | Bacteria | 3963 |
| 133 | Ga0070678_100097419 | 3300005456 | Bacteria | 2271 |
| 134 | Ga0070678_100460881 | 3300005456 | Bacteria | 1115 |
| 135 | Ga0070678_100710795 | 3300005456 | Bacteria | 906 |
| 136 | Ga0070678_101747043 | 3300005456 | Bacteria | 586 |
| 137 | Ga0070662_100001034 | 3300005457 | Bacteria | 16987 |
| 138 | Ga0070662_100009501 | 3300005457 | Bacteria | 6360 |
| 139 | Ga0070662_100296879 | 3300005457 | Bacteria | 1311 |
| 140 | Ga0070662_100310912 | 3300005457 | Bacteria | 1283 |
| 141 | Ga0070662_100361714 | 3300005457 | Bacteria | 1191 |
| 142 | Ga0070662_100462122 | 3300005457 | Bacteria | 1055 |
| 143 | Ga0070662_100551789 | 3300005457 | Bacteria | 966 |
| 144 | Ga0070681_10581690 | 3300005458 | Bacteria | 1034 |
| 145 | Ga0070681_11151117 | 3300005458 | Unclassified | 697 |
| 146 | Ga0070681_11240135 | 3300005458 | Unclassified | 668 |
| 147 | Ga0068867_100028941 | 3300005459 | Bacteria | 3989 |
| 148 | Ga0068867_100146695 | 3300005459 | Bacteria | 1850 |
| 149 | Ga0068867_100280670 | 3300005459 | Bacteria | 1366 |
| 150 | Ga0068867_100458383 | 3300005459 | Bacteria | 1088 |
| 151 | Ga0068867_101331371 | 3300005459 | Bacteria | 664 |
| 152 | Ga0070685_10008603 | 3300005466 | Bacteria | 5252 |
| 153 | Ga0070685_10010997 | 3300005466 | Bacteria | 4721 |
| 154 | Ga0070706_100044678 | 3300005467 | Bacteria | 4092 |
| 155 | Ga0070706_101013378 | 3300005467 | Bacteria | 765 |
| 156 | Ga0070706_101099066 | 3300005467 | Bacteria | 732 |
| 157 | Ga0070707_100043684 | 3300005468 | Bacteria | 4288 |
| 158 | Ga0070707_100723204 | 3300005468 | Bacteria | 958 |
| 159 | Ga0070707_101071414 | 3300005468 | Bacteria | 772 |
| 160 | Ga0070698_100116477 | 3300005471 | Bacteria | 2635 |
| 161 | Ga0070698_100267332 | 3300005471 | Bacteria | 1642 |
| 162 | Ga0070699_100076537 | 3300005518 | Bacteria | 2913 |
| 163 | Ga0070699_100185457 | 3300005518 | Bacteria | 1847 |
| 164 | Ga0070699_100418673 | 3300005518 | Bacteria | 1212 |
| 165 | Ga0070699_100441456 | 3300005518 | Bacteria | 1179 |
| 166 | Ga0070699_100583473 | 3300005518 | Bacteria | 1019 |
| 167 | Ga0070699_100652296 | 3300005518 | Bacteria | 961 |
| 168 | Ga0070684_100157462 | 3300005535 | Bacteria | 2060 |
| 169 | Ga0070697_100109319 | 3300005536 | Bacteria | 2302 |
| 170 | Ga0070697_100180588 | 3300005536 | Bacteria | 1789 |
| 171 | Ga0070697_100779023 | 3300005536 | Bacteria | 846 |
| 172 | Ga0068853_100009533 | 3300005539 | Bacteria | 7824 |
| 173 | Ga0068853_100045484 | 3300005539 | Bacteria | 3760 |
| 174 | Ga0068853_100071205 | 3300005539 | Bacteria | 3027 |
| 175 | Ga0068853_100206358 | 3300005539 | Bacteria | 1790 |
| 176 | Ga0068853_100216264 | 3300005539 | Bacteria | 1748 |
| 177 | Ga0068853_100829906 | 3300005539 | Bacteria | 886 |
| 178 | Ga0070672_100122602 | 3300005543 | Bacteria | 2129 |
| 179 | Ga0070672_100155192 | 3300005543 | Bacteria | 1896 |
| 180 | Ga0070672_100160692 | 3300005543 | Bacteria | 1864 |
| 181 | Ga0070672_100664402 | 3300005543 | Bacteria | 911 |
| 182 | Ga0070686_100034473 | 3300005544 | Bacteria | 3119 |
| 183 | Ga0070695_100038140 | 3300005545 | Bacteria | 3030 |
| 184 | Ga0070695_100064454 | 3300005545 | Bacteria | 2384 |
| 185 | Ga0070695_100075160 | 3300005545 | Bacteria | 2222 |
| 186 | Ga0070695_100147589 | 3300005545 | Bacteria | 1638 |
| 187 | Ga0070695_100332598 | 3300005545 | Bacteria | 1133 |
| 188 | Ga0070695_100788146 | 3300005545 | Bacteria | 761 |
| 189 | Ga0070696_100200764 | 3300005546 | Bacteria | 1489 |
| 190 | Ga0070696_100227051 | 3300005546 | Bacteria | 1403 |
| 191 | Ga0070696_100228650 | 3300005546 | Bacteria | 1398 |
| 192 | Ga0070696_100262180 | 3300005546 | Bacteria | 1311 |
| 193 | Ga0070696_100272852 | 3300005546 | Bacteria | 1286 |
| 194 | Ga0070696_100638813 | 3300005546 | Bacteria | 862 |
| 195 | Ga0070693_100325824 | 3300005547 | Bacteria | 1044 |
| 196 | Ga0070693_100857133 | 3300005547 | Bacteria | 678 |
| 197 | Ga0070665_100054890 | 3300005548 | Bacteria | 3995 |
| 198 | Ga0070665_100055967 | 3300005548 | Bacteria | 3955 |
| 199 | Ga0070665_100269983 | 3300005548 | Bacteria | 1703 |
| 200 | Ga0070665_101828731 | 3300005548 | Bacteria | 614 |
| 201 | Ga0070704_100069481 | 3300005549 | Bacteria | 2552 |
| 202 | Ga0070704_100109411 | 3300005549 | Bacteria | 2100 |
| 203 | Ga0070704_100334228 | 3300005549 | Bacteria | 1274 |
| 204 | Ga0070704_100407145 | 3300005549 | Bacteria | 1162 |
| 205 | Ga0070704_100856297 | 3300005549 | Bacteria | 815 |
| 206 | Ga0070704_101027017 | 3300005549 | Bacteria | 746 |
| 207 | Ga0070704_101290530 | 3300005549 | Bacteria | 668 |
| 208 | Ga0070704_101298941 | 3300005549 | Bacteria | 666 |
| 209 | Ga0068855_100000618 | 3300005563 | Bacteria | 43673 |
| 210 | Ga0068855_100469692 | 3300005563 | Bacteria | 1371 |
| 211 | Ga0068855_100657493 | 3300005563 | Bacteria | 1125 |
| 212 | Ga0068855_101043969 | 3300005563 | Bacteria | 857 |
| 213 | Ga0068855_101155850 | 3300005563 | Bacteria | 807 |
| 214 | Ga0070664_100003070 | 3300005564 | Bacteria | 13501 |
| 215 | Ga0070664_100010816 | 3300005564 | Bacteria | 7400 |
| 216 | Ga0070664_100051886 | 3300005564 | Bacteria | 3473 |
| 217 | Ga0070664_100080557 | 3300005564 | Bacteria | 2805 |
| 218 | Ga0070664_100105200 | 3300005564 | Bacteria | 2458 |
| 219 | Ga0070664_100515261 | 3300005564 | Bacteria | 1103 |
| 220 | Ga0070664_100865294 | 3300005564 | Bacteria | 847 |
| 221 | Ga0068857_100014463 | 3300005577 | Bacteria | 6885 |
| 222 | Ga0068857_100016325 | 3300005577 | Bacteria | 6506 |
| 223 | Ga0068857_100311755 | 3300005577 | Bacteria | 1452 |
| 224 | Ga0068854_100045035 | 3300005578 | Bacteria | 3135 |
| 225 | Ga0068854_100107882 | 3300005578 | Bacteria | 2096 |
| 226 | Ga0068854_100178633 | 3300005578 | Bacteria | 1657 |
| 227 | Ga0068856_100000093 | 3300005614 | Bacteria | 84752 |
| 228 | Ga0068856_100028254 | 3300005614 | Bacteria | 5476 |
| 229 | Ga0068856_100047839 | 3300005614 | Bacteria | 4214 |
| 230 | Ga0068856_100110886 | 3300005614 | Bacteria | 2741 |
| 231 | Ga0068856_100201564 | 3300005614 | Bacteria | 2004 |
| 232 | Ga0068856_100629619 | 3300005614 | Bacteria | 1093 |
| 233 | Ga0068856_101141795 | 3300005614 | Unclassified | 796 |
| 234 | Ga0070702_100016321 | 3300005615 | Bacteria | 3807 |
| 235 | Ga0070702_100025445 | 3300005615 | Bacteria | 3171 |
| 236 | Ga0070702_100232526 | 3300005615 | Bacteria | 1239 |
| 237 | Ga0068852_100044168 | 3300005616 | Bacteria | 3783 |
| 238 | Ga0068852_100471214 | 3300005616 | Bacteria | 1246 |
| 239 | Ga0068852_101106465 | 3300005616 | Bacteria | 812 |
| 240 | Ga0068859_100018237 | 3300005617 | Bacteria | 7057 |
| 241 | Ga0068859_100027447 | 3300005617 | Bacteria | 5709 |
| 242 | Ga0068859_100029782 | 3300005617 | Bacteria | 5477 |
| 243 | Ga0068859_100044053 | 3300005617 | Bacteria | 4485 |
| 244 | Ga0068859_100119044 | 3300005617 | Bacteria | 2707 |
| 245 | Ga0068859_100143080 | 3300005617 | Bacteria | 2465 |
| 246 | Ga0068859_100265389 | 3300005617 | Bacteria | 1809 |
| 247 | Ga0068859_100599532 | 3300005617 | Bacteria | 1195 |
| 248 | Ga0068859_100844812 | 3300005617 | Bacteria | 1002 |
| 249 | Ga0068859_101274479 | 3300005617 | Bacteria | 810 |
| 250 | Ga0068864_100013289 | 3300005618 | Bacteria | 6819 |
| 251 | Ga0068864_100033901 | 3300005618 | Bacteria | 4341 |
| 252 | Ga0068864_100058563 | 3300005618 | Bacteria | 3330 |
| 253 | Ga0068864_100129300 | 3300005618 | Bacteria | 2267 |
| 254 | Ga0068866_10007073 | 3300005718 | Bacteria | 4691 |
| 255 | Ga0068866_10015832 | 3300005718 | Bacteria | 3359 |
| 256 | Ga0068866_10239285 | 3300005718 | Bacteria | 1105 |
| 257 | Ga0068861_100016323 | 3300005719 | Bacteria | 5252 |
| 258 | Ga0068861_100788100 | 3300005719 | Bacteria | 891 |
| 259 | Ga0068851_10003290 | 3300005834 | Bacteria | 7174 |
| 260 | Ga0068851_10025362 | 3300005834 | Bacteria | 2908 |
| 261 | Ga0068851_10324163 | 3300005834 | Bacteria | 891 |
| 262 | Ga0068851_10426881 | 3300005834 | Bacteria | 784 |
| 263 | Ga0068851_10594890 | 3300005834 | Bacteria | 673 |
| 264 | Ga0068870_10005949 | 3300005840 | Bacteria | 5360 |
| 265 | Ga0068870_10013761 | 3300005840 | Bacteria | 3809 |
| 266 | Ga0068870_10226700 | 3300005840 | Bacteria | 1147 |
| 267 | Ga0068863_100006688 | 3300005841 | Bacteria | 11317 |
| 268 | Ga0068863_100019022 | 3300005841 | Bacteria | 6573 |
| 269 | Ga0068863_100071537 | 3300005841 | Bacteria | 3281 |
| 270 | Ga0068863_100161972 | 3300005841 | Bacteria | 2143 |
| 271 | Ga0068863_100208625 | 3300005841 | Bacteria | 1881 |
| 272 | Ga0068863_101315847 | 3300005841 | Bacteria | 730 |
| 273 | Ga0068863_101585438 | 3300005841 | Bacteria | 664 |
| 274 | Ga0068858_100011753 | 3300005842 | Bacteria | 8258 |
| 275 | Ga0068858_100028984 | 3300005842 | Bacteria | 5140 |
| 276 | Ga0068858_100052318 | 3300005842 | Bacteria | 3778 |
| 277 | Ga0068858_100086576 | 3300005842 | Bacteria | 2914 |
| 278 | Ga0068858_100325860 | 3300005842 | Bacteria | 1469 |
| 279 | Ga0068858_100331789 | 3300005842 | Bacteria | 1455 |
| 280 | Ga0068858_101605849 | 3300005842 | Unclassified | 642 |
| 281 | Ga0068860_100010410 | 3300005843 | Bacteria | 9198 |
| 282 | Ga0068860_100029566 | 3300005843 | Bacteria | 5272 |
| 283 | Ga0068860_100051826 | 3300005843 | Bacteria | 3904 |
| 284 | Ga0068860_100188108 | 3300005843 | Bacteria | 1997 |
| 285 | Ga0068860_100318595 | 3300005843 | Bacteria | 1526 |
| 286 | Ga0068860_100329346 | 3300005843 | Bacteria | 1500 |
| 287 | Ga0068860_101103367 | 3300005843 | Bacteria | 813 |
| 288 | Ga0068862_100015627 | 3300005844 | Bacteria | 6304 |
| 289 | Ga0068862_100033422 | 3300005844 | Bacteria | 4348 |
| 290 | Ga0068862_100036439 | 3300005844 | Bacteria | 4169 |
| 291 | Ga0068862_100045278 | 3300005844 | Bacteria | 3754 |
| 292 | Ga0068862_101029311 | 3300005844 | Bacteria | 816 |
| 293 | Ga0068862_101628756 | 3300005844 | Bacteria | 653 |
| 294 | Ga0081455_10015181 | 3300005937 | Bacteria | 7494 |
| 295 | Ga0081455_10019463 | 3300005937 | Bacteria | 6422 |
| 296 | Ga0081455_10026378 | 3300005937 | Bacteria | 5345 |
| 297 | Ga0081455_10091775 | 3300005937 | Bacteria | 2459 |
| 298 | Ga0081538_10032628 | 3300005981 | Bacteria | 3484 |
| 299 | Ga0081540_1000045 | 3300005983 | Bacteria | 134124 |
| 300 | Ga0081540_1010997 | 3300005983 | Bacteria | 6076 |
| 301 | Ga0081540_1015520 | 3300005983 | Bacteria | 4820 |
| 302 | Ga0081539_10000226 | 3300005985 | Bacteria | 132618 |
| 303 | Ga0075365_10007399 | 3300006038 | Bacteria | 6144 |
| 304 | Ga0075365_10109544 | 3300006038 | Bacteria | 1897 |
| 305 | Ga0075365_10147347 | 3300006038 | Bacteria | 1636 |
| 306 | Ga0075365_10553399 | 3300006038 | Bacteria | 814 |
| 307 | Ga0075364_10164759 | 3300006051 | Bacteria | 1497 |
| 308 | Ga0070715_10006868 | 3300006163 | Bacteria | 3889 |
| 309 | Ga0070716_100259573 | 3300006173 | Bacteria | 1188 |
| 310 | Ga0070716_100263819 | 3300006173 | Bacteria | 1180 |
| 311 | Ga0070716_100477648 | 3300006173 | Bacteria | 915 |
| 312 | Ga0070716_100486644 | 3300006173 | Bacteria | 907 |
| 313 | Ga0070712_100123209 | 3300006175 | Bacteria | 1954 |
| 314 | Ga0097621_100013107 | 3300006237 | Bacteria | 6165 |
| 315 | Ga0097621_100136204 | 3300006237 | Bacteria | 2095 |
| 316 | Ga0097621_100313650 | 3300006237 | Bacteria | 1388 |
| 317 | Ga0068871_100026948 | 3300006358 | Bacteria | 4490 |
| 318 | Ga0075428_100003992 | 3300006844 | Bacteria | 16191 |
| 319 | Ga0075428_100066145 | 3300006844 | Bacteria | 3958 |
| 320 | Ga0075428_100076532 | 3300006844 | Bacteria | 3653 |
| 321 | Ga0075428_100143936 | 3300006844 | Bacteria | 2591 |
| 322 | Ga0075428_100144235 | 3300006844 | Bacteria | 2588 |
| 323 | Ga0075428_100443634 | 3300006844 | Bacteria | 1390 |
| 324 | Ga0075428_101029908 | 3300006844 | Bacteria | 871 |
| 325 | Ga0075430_100013974 | 3300006846 | Bacteria | 6843 |
| 326 | Ga0075430_100194624 | 3300006846 | Bacteria | 1685 |
| 327 | Ga0075430_100484203 | 3300006846 | Bacteria | 1021 |
| 328 | Ga0075431_100007554 | 3300006847 | Bacteria | 10825 |
| 329 | Ga0075431_100062520 | 3300006847 | Bacteria | 3841 |
| 330 | Ga0075431_100081933 | 3300006847 | Bacteria | 3331 |
| 331 | Ga0075431_100122616 | 3300006847 | Bacteria | 2682 |
| 332 | Ga0075433_10070333 | 3300006852 | Bacteria | 3075 |
| 333 | Ga0075433_10097309 | 3300006852 | Bacteria | 2605 |
| 334 | Ga0075433_10275651 | 3300006852 | Bacteria | 1491 |
| 335 | Ga0075433_10364213 | 3300006852 | Bacteria | 1277 |
| 336 | Ga0075433_10469237 | 3300006852 | Bacteria | 1109 |
| 337 | Ga0075433_10506724 | 3300006852 | Bacteria | 1062 |
| 338 | Ga0075433_10628635 | 3300006852 | Bacteria | 942 |
| 339 | Ga0075434_100000003 | 3300006871 | Bacteria | 134839 |
| 340 | Ga0075434_100043038 | 3300006871 | Bacteria | 4477 |
| 341 | Ga0075434_100235304 | 3300006871 | Bacteria | 1852 |
| 342 | Ga0075434_100259125 | 3300006871 | Bacteria | 1758 |
| 343 | Ga0075434_100342726 | 3300006871 | Bacteria | 1515 |
| 344 | Ga0075434_101744822 | 3300006871 | Bacteria | 630 |
| 345 | Ga0075429_100001249 | 3300006880 | Bacteria | 20643 |
| 346 | Ga0075429_100032190 | 3300006880 | Bacteria | 4557 |
| 347 | Ga0075429_100132177 | 3300006880 | Bacteria | 2183 |
| 348 | Ga0068865_100014498 | 3300006881 | Bacteria | 5009 |
| 349 | Ga0068865_100210486 | 3300006881 | Bacteria | 1515 |
| 350 | Ga0068865_100902599 | 3300006881 | Bacteria | 768 |
| 351 | Ga0075436_100173396 | 3300006914 | Bacteria | 1523 |
| 352 | Ga0075436_100681482 | 3300006914 | Bacteria | 761 |
| 353 | Ga0097620_100018234 | 3300006931 | Bacteria | 7057 |
| 354 | Ga0097620_100027450 | 3300006931 | Bacteria | 5709 |
| 355 | Ga0097620_100029780 | 3300006931 | Bacteria | 5477 |
| 356 | Ga0097620_100044054 | 3300006931 | Bacteria | 4485 |
| 357 | Ga0097620_100119044 | 3300006931 | Bacteria | 2707 |
| 358 | Ga0097620_100143078 | 3300006931 | Bacteria | 2465 |
| 359 | Ga0097620_100265406 | 3300006931 | Bacteria | 1809 |
| 360 | Ga0097620_100599517 | 3300006931 | Bacteria | 1195 |
| 361 | Ga0097620_100844709 | 3300006931 | Bacteria | 1002 |
| 362 | Ga0097620_101226692 | 3300006931 | Bacteria | 826 |
| 363 | Ga0097620_101274412 | 3300006931 | Bacteria | 810 |
| 364 | Ga0075435_100010435 | 3300007076 | Bacteria | 6796 |
| 365 | Ga0075435_100391440 | 3300007076 | Bacteria | 1194 |
| 366 | Ga0075435_100561743 | 3300007076 | Bacteria | 989 |
| 367 | Ga0075435_100561763 | 3300007076 | Bacteria | 989 |
| 368 | Ga0099794_10049733 | 3300007265 | Bacteria | 2015 |
| 369 | Ga0099794_10067629 | 3300007265 | Bacteria | 1745 |
| 370 | Ga0105244_10147439 | 3300009036 | Bacteria | 1129 |
| 371 | Ga0111539_10075511 | 3300009094 | Bacteria | 3970 |
| 372 | Ga0111539_10232272 | 3300009094 | Bacteria | 2148 |
| 373 | Ga0111539_10293738 | 3300009094 | Bacteria | 1891 |
| 374 | Ga0111539_10353417 | 3300009094 | Bacteria | 1710 |
| 375 | Ga0111539_10817592 | 3300009094 | Bacteria | 1084 |
| 376 | Ga0111539_11371738 | 3300009094 | Bacteria | 820 |
| 377 | Ga0105245_10031117 | 3300009098 | Bacteria | 4721 |
| 378 | Ga0105245_10063641 | 3300009098 | Bacteria | 3331 |
| 379 | Ga0105245_10352820 | 3300009098 | Bacteria | 1458 |
| 380 | Ga0105245_10381765 | 3300009098 | Bacteria | 1403 |
| 381 | Ga0105245_10477409 | 3300009098 | Bacteria | 1259 |
| 382 | Ga0105245_10649630 | 3300009098 | Bacteria | 1085 |
| 383 | Ga0105245_11365551 | 3300009098 | Bacteria | 758 |
| 384 | Ga0105247_10009818 | 3300009101 | Bacteria | 5798 |
| 385 | Ga0105247_10235644 | 3300009101 | Bacteria | 1245 |
| 386 | Ga0114129_10007594 | 3300009147 | Bacteria | 15436 |
| 387 | Ga0114129_10038987 | 3300009147 | Bacteria | 6697 |
| 388 | Ga0114129_10179118 | 3300009147 | Bacteria | 2886 |
| 389 | Ga0114129_10225321 | 3300009147 | Bacteria | 2527 |
| 390 | Ga0114129_10427625 | 3300009147 | Bacteria | 1740 |
| 391 | Ga0114129_10805977 | 3300009147 | Bacteria | 1197 |
| 392 | Ga0114129_10986247 | 3300009147 | Bacteria | 1062 |
| 393 | Ga0114129_11106653 | 3300009147 | Bacteria | 991 |
| 394 | Ga0105243_10010928 | 3300009148 | Bacteria | 6868 |
| 395 | Ga0105243_10148592 | 3300009148 | Bacteria | 2008 |
| 396 | Ga0105243_10269406 | 3300009148 | Bacteria | 1528 |
| 397 | Ga0105243_10310641 | 3300009148 | Bacteria | 1432 |
| 398 | Ga0105243_10430274 | 3300009148 | Bacteria | 1233 |
| 399 | Ga0105243_10516587 | 3300009148 | Bacteria | 1135 |
| 400 | Ga0105243_10585557 | 3300009148 | Bacteria | 1072 |
| 401 | Ga0105243_11236442 | 3300009148 | Bacteria | 761 |
| 402 | Ga0105241_11167514 | 3300009174 | Bacteria | 728 |
| 403 | Ga0105241_12210451 | 3300009174 | Unclassified | 546 |
| 404 | Ga0105242_10000568 | 3300009176 | Bacteria | 29246 |
| 405 | Ga0105242_10019555 | 3300009176 | Bacteria | 5308 |
| 406 | Ga0105242_10067481 | 3300009176 | Bacteria | 2957 |
| 407 | Ga0105242_10189508 | 3300009176 | Bacteria | 1820 |
| 408 | Ga0105242_10372033 | 3300009176 | Bacteria | 1326 |
| 409 | Ga0105242_10429748 | 3300009176 | Bacteria | 1240 |
| 410 | Ga0105248_10022908 | 3300009177 | Bacteria | 6935 |
| 411 | Ga0105248_10034839 | 3300009177 | Bacteria | 5633 |
| 412 | Ga0105248_10045402 | 3300009177 | Bacteria | 4927 |
| 413 | Ga0105248_11610904 | 3300009177 | Bacteria | 735 |
| 414 | Ga0105248_11809235 | 3300009177 | Bacteria | 693 |
| 415 | Ga0105237_10077461 | 3300009545 | Bacteria | 3314 |
| 416 | Ga0105249_10042946 | 3300009553 | Bacteria | 4112 |
| 417 | Ga0105249_10055161 | 3300009553 | Bacteria | 3634 |
| 418 | Ga0105249_10357942 | 3300009553 | Bacteria | 1480 |
| 419 | Ga0105249_10403971 | 3300009553 | Bacteria | 1397 |
| 420 | Ga0105249_10477036 | 3300009553 | Bacteria | 1290 |
| 421 | Ga0105249_10749924 | 3300009553 | Bacteria | 1038 |
| 422 | Ga0105249_10853931 | 3300009553 | Bacteria | 976 |
| 423 | Ga0105249_11226629 | 3300009553 | Bacteria | 821 |
| 424 | Ga0105249_11263693 | 3300009553 | Bacteria | 810 |
| 425 | Ga0099796_10028001 | 3300010159 | Bacteria | 1805 |
| 426 | Ga0105239_10019473 | 3300010375 | Bacteria | 7492 |
| 427 | Ga0105239_10220103 | 3300010375 | Bacteria | 2129 |
| 428 | Ga0105239_10755654 | 3300010375 | Bacteria | 1113 |
| 429 | Ga0105239_10816159 | 3300010375 | Bacteria | 1069 |
| 430 | Ga0105246_10023998 | 3300011119 | Bacteria | 3954 |
| 431 | Ga0105246_11167382 | 3300011119 | Bacteria | 707 |
| 432 | Ga0157324_1005539 | 3300012506 | Bacteria | 918 |
| 433 | Ga0157373_10000777 | 3300013100 | Bacteria | 24608 |
| 434 | Ga0157371_10021903 | 3300013102 | Bacteria | 4690 |
| 435 | Ga0157371_10146182 | 3300013102 | Bacteria | 1685 |
| 436 | Ga0157371_10829294 | 3300013102 | Unclassified | 698 |
| 437 | Ga0157371_10914553 | 3300013102 | Bacteria | 666 |
| 438 | Ga0157369_10120606 | 3300013105 | Bacteria | 2783 |
| 439 | Ga0157369_10151570 | 3300013105 | Bacteria | 2450 |
| 440 | Ga0157369_10442618 | 3300013105 | Bacteria | 1346 |
| 441 | Ga0157369_11425375 | 3300013105 | Unclassified | 705 |
| 442 | Ga0157374_10031839 | 3300013296 | Bacteria | 4797 |
| 443 | Ga0157374_10031850 | 3300013296 | Bacteria | 4796 |
| 444 | Ga0157374_10232468 | 3300013296 | Bacteria | 1811 |
| 445 | Ga0157374_10248219 | 3300013296 | Bacteria | 1751 |
| 446 | Ga0157378_10015919 | 3300013297 | Bacteria | 6585 |
| 447 | Ga0157378_10030596 | 3300013297 | Bacteria | 4757 |
| 448 | Ga0157378_10034657 | 3300013297 | Bacteria | 4464 |
| 449 | Ga0157378_10281292 | 3300013297 | Bacteria | 1604 |
| 450 | Ga0157378_10337207 | 3300013297 | Bacteria | 1469 |
| 451 | Ga0157378_10650113 | 3300013297 | Bacteria | 1070 |
| 452 | Ga0157378_10791165 | 3300013297 | Bacteria | 974 |
| 453 | Ga0157378_11520223 | 3300013297 | Bacteria | 714 |
| 454 | Ga0163162_10080829 | 3300013306 | Bacteria | 3319 |
| 455 | Ga0163162_10114123 | 3300013306 | Bacteria | 2801 |
| 456 | Ga0163162_10235849 | 3300013306 | Bacteria | 1960 |
| 457 | Ga0163162_10335641 | 3300013306 | Bacteria | 1644 |
| 458 | Ga0163162_10921298 | 3300013306 | Bacteria | 986 |
| 459 | Ga0157372_10000852 | 3300013307 | Bacteria | 33078 |
| 460 | Ga0157372_10225815 | 3300013307 | Bacteria | 2171 |
| 461 | Ga0157372_11669910 | 3300013307 | Bacteria | 733 |
| 462 | Ga0157372_12254589 | 3300013307 | Bacteria | 625 |
| 463 | Ga0157375_10014053 | 3300013308 | Bacteria | 7140 |
| 464 | Ga0157375_10052520 | 3300013308 | Bacteria | 4007 |
| 465 | Ga0157375_10130292 | 3300013308 | Bacteria | 2634 |
| 466 | Ga0157375_10983839 | 3300013308 | Bacteria | 984 |
| 467 | Ga0157375_11450011 | 3300013308 | Bacteria | 809 |
| 468 | Ga0157375_11734466 | 3300013308 | Bacteria | 740 |
| 469 | Ga0157375_12764363 | 3300013308 | Bacteria | 587 |
| 470 | Ga0163163_10023951 | 3300014325 | Bacteria | 5805 |
| 471 | Ga0163163_10620223 | 3300014325 | Bacteria | 1145 |
| 472 | Ga0163163_10644346 | 3300014325 | Bacteria | 1123 |
| 473 | Ga0163163_11694634 | 3300014325 | Unclassified | 693 |
| 474 | Ga0163163_12711951 | 3300014325 | Bacteria | 552 |
| 475 | Ga0157380_10040596 | 3300014326 | Bacteria | 3625 |
| 476 | Ga0157380_10094023 | 3300014326 | Bacteria | 2480 |
| 477 | Ga0157380_11096280 | 3300014326 | Bacteria | 835 |
| 478 | Ga0157380_11174751 | 3300014326 | Bacteria | 810 |
| 479 | Ga0157380_11392164 | 3300014326 | Bacteria | 751 |
| 480 | Ga0157380_11878770 | 3300014326 | Bacteria | 659 |
| 481 | Ga0157379_10009926 | 3300014968 | Bacteria | 8291 |
| 482 | Ga0157379_10012304 | 3300014968 | Bacteria | 7474 |
| 483 | Ga0157376_10410029 | 3300014969 | Bacteria | 1312 |
| 484 | Ga0157376_11110261 | 3300014969 | Bacteria | 817 |
| 485 | Ga0163161_10008687 | 3300017792 | Bacteria | 7025 |
| 486 | Ga0163161_10018498 | 3300017792 | Bacteria | 4882 |
| 487 | Ga0163161_10390944 | 3300017792 | Bacteria | 1113 |
| 488 | Ga0207697_10000241 | 3300025315 | Bacteria | 29902 |
| 489 | Ga0207656_10118384 | 3300025321 | Bacteria | 1231 |
| 490 | Ga0207655_1099185 | 3300025728 | Bacteria | 1007 |
| 491 | Ga0207653_10120778 | 3300025885 | Bacteria | 943 |
| 492 | Ga0207682_10009064 | 3300025893 | Bacteria | 3930 |
| 493 | Ga0207642_10007601 | 3300025899 | Bacteria | 3669 |
| 494 | Ga0207642_10031218 | 3300025899 | Bacteria | 2229 |
| 495 | Ga0207642_10031542 | 3300025899 | Bacteria | 2221 |
| 496 | Ga0207710_10015280 | 3300025900 | Bacteria | 3242 |
| 497 | Ga0207688_10003121 | 3300025901 | Bacteria | 9045 |
| 498 | Ga0207688_10016163 | 3300025901 | Bacteria | 4046 |
| 499 | Ga0207680_10012357 | 3300025903 | Bacteria | 4346 |
| 500 | Ga0207680_10075604 | 3300025903 | Bacteria | 2101 |
| 501 | Ga0207647_10076912 | 3300025904 | Bacteria | 2007 |
| 502 | Ga0207647_10255734 | 3300025904 | Bacteria | 1004 |
| 503 | Ga0207645_10010667 | 3300025907 | Bacteria | 6303 |
| 504 | Ga0207645_10029673 | 3300025907 | Bacteria | 3525 |
| 505 | Ga0207645_10104549 | 3300025907 | Bacteria | 1829 |
| 506 | Ga0207645_10250292 | 3300025907 | Bacteria | 1172 |
| 507 | Ga0207643_10003471 | 3300025908 | Bacteria | 8483 |
| 508 | Ga0207643_10010768 | 3300025908 | Bacteria | 4931 |
| 509 | Ga0207643_10153008 | 3300025908 | Bacteria | 1384 |
| 510 | Ga0207684_10013079 | 3300025910 | Bacteria | 7183 |
| 511 | Ga0207684_10104925 | 3300025910 | Bacteria | 2417 |
| 512 | Ga0207684_11003844 | 3300025910 | Bacteria | 698 |
| 513 | Ga0207707_10451478 | 3300025912 | Bacteria | 1100 |
| 514 | Ga0207671_10071930 | 3300025914 | Bacteria | 2580 |
| 515 | Ga0207693_10227356 | 3300025915 | Bacteria | 1465 |
| 516 | Ga0207663_10018657 | 3300025916 | Bacteria | 3893 |
| 517 | Ga0207660_10760133 | 3300025917 | Bacteria | 791 |
| 518 | Ga0207662_10003440 | 3300025918 | Bacteria | 8146 |
| 519 | Ga0207662_10021711 | 3300025918 | Bacteria | 3673 |
| 520 | Ga0207662_10148147 | 3300025918 | Bacteria | 1491 |
| 521 | Ga0207657_10002844 | 3300025919 | Bacteria | 18599 |
| 522 | Ga0207657_10025055 | 3300025919 | Bacteria | 5510 |
| 523 | Ga0207657_10127363 | 3300025919 | Bacteria | 2090 |
| 524 | Ga0207649_10016438 | 3300025920 | Bacteria | 4173 |
| 525 | Ga0207649_10037862 | 3300025920 | Bacteria | 2917 |
| 526 | Ga0207649_10046789 | 3300025920 | Bacteria | 2660 |
| 527 | Ga0207646_10008428 | 3300025922 | Bacteria | 10338 |
| 528 | Ga0207646_10015712 | 3300025922 | Bacteria | 7134 |
| 529 | Ga0207646_10047615 | 3300025922 | Bacteria | 3845 |
| 530 | Ga0207646_10761524 | 3300025922 | Bacteria | 864 |
| 531 | Ga0207646_10887180 | 3300025922 | Bacteria | 792 |
| 532 | Ga0207681_10086779 | 3300025923 | Bacteria | 2224 |
| 533 | Ga0207681_10134459 | 3300025923 | Bacteria | 1833 |
| 534 | Ga0207681_10212121 | 3300025923 | Bacteria | 1493 |
| 535 | Ga0207650_10001318 | 3300025925 | Bacteria | 17984 |
| 536 | Ga0207650_10009995 | 3300025925 | Bacteria | 6496 |
| 537 | Ga0207650_10022994 | 3300025925 | Bacteria | 4417 |
| 538 | Ga0207650_10078058 | 3300025925 | Bacteria | 2504 |
| 539 | Ga0207650_10281478 | 3300025925 | Bacteria | 1354 |
| 540 | Ga0207659_10002890 | 3300025926 | Bacteria | 10218 |
| 541 | Ga0207659_10056090 | 3300025926 | Bacteria | 2820 |
| 542 | Ga0207659_10278749 | 3300025926 | Bacteria | 1366 |
| 543 | Ga0207659_10443449 | 3300025926 | Bacteria | 1092 |
| 544 | Ga0207687_10033199 | 3300025927 | Bacteria | 3500 |
| 545 | Ga0207687_10319635 | 3300025927 | Bacteria | 1256 |
| 546 | Ga0207700_10021540 | 3300025928 | Bacteria | 4404 |
| 547 | Ga0207664_11103878 | 3300025929 | Bacteria | 709 |
| 548 | Ga0207644_10012275 | 3300025931 | Bacteria | 5686 |
| 549 | Ga0207644_10042016 | 3300025931 | Bacteria | 3237 |
| 550 | Ga0207644_10046582 | 3300025931 | Bacteria | 3090 |
| 551 | Ga0207644_10455581 | 3300025931 | Bacteria | 1051 |
| 552 | Ga0207644_10466636 | 3300025931 | Bacteria | 1038 |
| 553 | Ga0207644_10833555 | 3300025931 | Unclassified | 772 |
| 554 | Ga0207690_10000422 | 3300025932 | Bacteria | 27626 |
| 555 | Ga0207690_10019200 | 3300025932 | Bacteria | 4203 |
| 556 | Ga0207690_10698156 | 3300025932 | Bacteria | 834 |
| 557 | Ga0207706_10000014 | 3300025933 | Bacteria | 177082 |
| 558 | Ga0207706_10018672 | 3300025933 | Bacteria | 6239 |
| 559 | Ga0207706_10057573 | 3300025933 | Bacteria | 3424 |
| 560 | Ga0207706_10108159 | 3300025933 | Bacteria | 2447 |
| 561 | Ga0207706_10201838 | 3300025933 | Bacteria | 1744 |
| 562 | Ga0207706_10228299 | 3300025933 | Bacteria | 1629 |
| 563 | Ga0207706_10478795 | 3300025933 | Bacteria | 1076 |
| 564 | Ga0207706_10810948 | 3300025933 | Bacteria | 795 |
| 565 | Ga0207686_10022390 | 3300025934 | Bacteria | 3639 |
| 566 | Ga0207686_10133913 | 3300025934 | Bacteria | 1703 |
| 567 | Ga0207686_10632129 | 3300025934 | Bacteria | 845 |
| 568 | Ga0207686_10713687 | 3300025934 | Bacteria | 798 |
| 569 | Ga0207686_11167315 | 3300025934 | Bacteria | 629 |
| 570 | Ga0207709_10011594 | 3300025935 | Bacteria | 4861 |
| 571 | Ga0207709_10559390 | 3300025935 | Bacteria | 900 |
| 572 | Ga0207670_10004340 | 3300025936 | Bacteria | 7620 |
| 573 | Ga0207670_10190784 | 3300025936 | Bacteria | 1551 |
| 574 | Ga0207670_10312115 | 3300025936 | Bacteria | 1235 |
| 575 | Ga0207670_10349022 | 3300025936 | Bacteria | 1171 |
| 576 | Ga0207670_10367049 | 3300025936 | Bacteria | 1143 |
| 577 | Ga0207669_10068170 | 3300025937 | Bacteria | 2220 |
| 578 | Ga0207669_10085458 | 3300025937 | Bacteria | 2037 |
| 579 | Ga0207669_10280850 | 3300025937 | Bacteria | 1256 |
| 580 | Ga0207669_10485132 | 3300025937 | Bacteria | 986 |
| 581 | Ga0207704_10092771 | 3300025938 | Bacteria | 1988 |
| 582 | Ga0207704_10142197 | 3300025938 | Bacteria | 1680 |
| 583 | Ga0207665_10030040 | 3300025939 | Bacteria | 3591 |
| 584 | Ga0207665_10185164 | 3300025939 | Bacteria | 1510 |
| 585 | Ga0207665_10249352 | 3300025939 | Bacteria | 1311 |
| 586 | Ga0207665_10733427 | 3300025939 | Bacteria | 778 |
| 587 | Ga0207691_10001791 | 3300025940 | Bacteria | 21133 |
| 588 | Ga0207691_10008767 | 3300025940 | Bacteria | 9702 |
| 589 | Ga0207691_10015083 | 3300025940 | Bacteria | 7353 |
| 590 | Ga0207691_10025235 | 3300025940 | Bacteria | 5581 |
| 591 | Ga0207691_10078851 | 3300025940 | Bacteria | 2964 |
| 592 | Ga0207691_10437769 | 3300025940 | Bacteria | 1113 |
| 593 | Ga0207711_10005602 | 3300025941 | Bacteria | 10615 |
| 594 | Ga0207711_10044888 | 3300025941 | Bacteria | 3775 |
| 595 | Ga0207711_10098361 | 3300025941 | Bacteria | 2585 |
| 596 | Ga0207711_10131131 | 3300025941 | Bacteria | 2248 |
| 597 | Ga0207711_10400993 | 3300025941 | Bacteria | 1274 |
| 598 | Ga0207711_10636046 | 3300025941 | Bacteria | 995 |
| 599 | Ga0207711_10643782 | 3300025941 | Bacteria | 989 |
| 600 | Ga0207689_10001355 | 3300025942 | Bacteria | 23517 |
| 601 | Ga0207689_10002469 | 3300025942 | Bacteria | 17219 |
| 602 | Ga0207689_10030920 | 3300025942 | Bacteria | 4460 |
| 603 | Ga0207661_10029165 | 3300025944 | Bacteria | 4235 |
| 604 | Ga0207661_10078036 | 3300025944 | Bacteria | 2725 |
| 605 | Ga0207679_10013364 | 3300025945 | Bacteria | 5380 |
| 606 | Ga0207679_10028372 | 3300025945 | Bacteria | 3883 |
| 607 | Ga0207679_10082701 | 3300025945 | Bacteria | 2459 |
| 608 | Ga0207679_10089333 | 3300025945 | Bacteria | 2378 |
| 609 | Ga0207679_10105567 | 3300025945 | Bacteria | 2212 |
| 610 | Ga0207679_10251962 | 3300025945 | Bacteria | 1501 |
| 611 | Ga0207667_10006720 | 3300025949 | Bacteria | 13895 |
| 612 | Ga0207667_10652415 | 3300025949 | Bacteria | 1058 |
| 613 | Ga0207667_10823036 | 3300025949 | Bacteria | 924 |
| 614 | Ga0207667_10969981 | 3300025949 | Bacteria | 839 |
| 615 | Ga0207651_10012974 | 3300025960 | Bacteria | 4745 |
| 616 | Ga0207651_10043524 | 3300025960 | Bacteria | 2997 |
| 617 | Ga0207651_10119984 | 3300025960 | Bacteria | 1992 |
| 618 | Ga0207712_10032002 | 3300025961 | Bacteria | 3547 |
| 619 | Ga0207712_10034073 | 3300025961 | Bacteria | 3448 |
| 620 | Ga0207712_10368640 | 3300025961 | Bacteria | 1198 |
| 621 | Ga0207712_10775586 | 3300025961 | Bacteria | 841 |
| 622 | Ga0207668_10004599 | 3300025972 | Bacteria | 8114 |
| 623 | Ga0207668_10028780 | 3300025972 | Bacteria | 3636 |
| 624 | Ga0207668_10038565 | 3300025972 | Bacteria | 3208 |
| 625 | Ga0207668_10183904 | 3300025972 | Bacteria | 1651 |
| 626 | Ga0207668_10216349 | 3300025972 | Bacteria | 1535 |
| 627 | Ga0207668_10397628 | 3300025972 | Bacteria | 1164 |
| 628 | Ga0207640_10078297 | 3300025981 | Bacteria | 2250 |
| 629 | Ga0207640_10134385 | 3300025981 | Bacteria | 1793 |
| 630 | Ga0207658_10036497 | 3300025986 | Bacteria | 3524 |
| 631 | Ga0207658_10077918 | 3300025986 | Bacteria | 2530 |
| 632 | Ga0207677_10028439 | 3300026023 | Bacteria | 3535 |
| 633 | Ga0207677_10499760 | 3300026023 | Bacteria | 1051 |
| 634 | Ga0207677_10593832 | 3300026023 | Bacteria | 971 |
| 635 | Ga0207703_10023707 | 3300026035 | Bacteria | 4826 |
| 636 | Ga0207703_10046670 | 3300026035 | Bacteria | 3490 |
| 637 | Ga0207703_10051633 | 3300026035 | Bacteria | 3333 |
| 638 | Ga0207703_10125680 | 3300026035 | Bacteria | 2207 |
| 639 | Ga0207703_10177081 | 3300026035 | Bacteria | 1880 |
| 640 | Ga0207703_11041040 | 3300026035 | Bacteria | 786 |
| 641 | Ga0207639_10066575 | 3300026041 | Bacteria | 2800 |
| 642 | Ga0207678_10002409 | 3300026067 | Bacteria | 16996 |
| 643 | Ga0207678_10037506 | 3300026067 | Bacteria | 4215 |
| 644 | Ga0207678_10038603 | 3300026067 | Bacteria | 4148 |
| 645 | Ga0207708_10029947 | 3300026075 | Bacteria | 4127 |
| 646 | Ga0207708_10031440 | 3300026075 | Bacteria | 4028 |
| 647 | Ga0207708_10105184 | 3300026075 | Bacteria | 2187 |
| 648 | Ga0207708_10151294 | 3300026075 | Bacteria | 1827 |
| 649 | Ga0207708_10601844 | 3300026075 | Bacteria | 931 |
| 650 | Ga0207702_10045825 | 3300026078 | Bacteria | 3679 |
| 651 | Ga0207702_10049706 | 3300026078 | Bacteria | 3539 |
| 652 | Ga0207702_10096192 | 3300026078 | Bacteria | 2604 |
| 653 | Ga0207702_10284966 | 3300026078 | Bacteria | 1563 |
| 654 | Ga0207702_10836874 | 3300026078 | Bacteria | 910 |
| 655 | Ga0207641_10009600 | 3300026088 | Bacteria | 7974 |
| 656 | Ga0207641_10046594 | 3300026088 | Bacteria | 3654 |
| 657 | Ga0207641_10124352 | 3300026088 | Bacteria | 2307 |
| 658 | Ga0207641_10173782 | 3300026088 | Bacteria | 1968 |
| 659 | Ga0207641_10211681 | 3300026088 | Bacteria | 1793 |
| 660 | Ga0207648_10066269 | 3300026089 | Bacteria | 3149 |
| 661 | Ga0207648_10194933 | 3300026089 | Bacteria | 1796 |
| 662 | Ga0207648_10549127 | 3300026089 | Bacteria | 1061 |
| 663 | Ga0207676_10029818 | 3300026095 | Bacteria | 4088 |
| 664 | Ga0207676_10044164 | 3300026095 | Bacteria | 3436 |
| 665 | Ga0207676_10054461 | 3300026095 | Bacteria | 3135 |
| 666 | Ga0207676_10347619 | 3300026095 | Bacteria | 1370 |
| 667 | Ga0207674_10007870 | 3300026116 | Bacteria | 12387 |
| 668 | Ga0207674_10031295 | 3300026116 | Bacteria | 5590 |
| 669 | Ga0207674_10601975 | 3300026116 | Bacteria | 1062 |
| 670 | Ga0207675_100003797 | 3300026118 | Bacteria | 14713 |
| 671 | Ga0207675_100005624 | 3300026118 | Bacteria | 12000 |
| 672 | Ga0207675_100013865 | 3300026118 | Bacteria | 7517 |
| 673 | Ga0207675_100605105 | 3300026118 | Bacteria | 1099 |
| 674 | Ga0207675_101093436 | 3300026118 | Bacteria | 817 |
| 675 | Ga0207683_10020959 | 3300026121 | Bacteria | 5594 |
| 676 | Ga0207683_10048856 | 3300026121 | Bacteria | 3702 |
| 677 | Ga0207683_10292508 | 3300026121 | Bacteria | 1489 |
| 678 | Ga0207698_10104548 | 3300026142 | Bacteria | 2356 |
| 679 | Ga0207698_10128498 | 3300026142 | Bacteria | 2161 |
| 680 | Ga0207698_10134136 | 3300026142 | Bacteria | 2121 |
| 681 | Ga0209588_1104444 | 3300027671 | Bacteria | 911 |
| 682 | Ga0209971_1005118 | 3300027682 | Bacteria | 3113 |
| 683 | Ga0207428_10006862 | 3300027907 | Bacteria | 10435 |
| 684 | Ga0268266_10057021 | 3300028379 | Bacteria | 3360 |
| 685 | Ga0268266_10083385 | 3300028379 | Bacteria | 2790 |
| 686 | Ga0268265_10018486 | 3300028380 | Bacteria | 4831 |
| 687 | Ga0268265_10031527 | 3300028380 | Bacteria | 3828 |
| 688 | Ga0268265_10099316 | 3300028380 | Bacteria | 2346 |
| 689 | Ga0268265_10120568 | 3300028380 | Bacteria | 2160 |
| 690 | Ga0268265_10276228 | 3300028380 | Bacteria | 1501 |
| 691 | Ga0268265_10372507 | 3300028380 | Bacteria | 1311 |
| 692 | Ga0268264_10028039 | 3300028381 | Bacteria | 4605 |
| 693 | Ga0268264_10046400 | 3300028381 | Bacteria | 3608 |
| 694 | Ga0268264_10102997 | 3300028381 | Bacteria | 2485 |
| 695 | Ga0268264_10129806 | 3300028381 | Bacteria | 2232 |
| 696 | Ga0268264_10153784 | 3300028381 | Bacteria | 2065 |
| 697 | Ga0268264_10229182 | 3300028381 | Bacteria | 1715 |
| 698 | Ga0268264_10968013 | 3300028381 | Bacteria | 857 |
| 699 | Ga0307412_10290404 | 3300031911 | Bacteria | 1288 |
| 700 | Ga0307416_100353038 | 3300032002 | Bacteria | 1489 |
| 701 | Ga0307416_100710268 | 3300032002 | Bacteria | 1095 |
| 702 | Ga0307416_101445039 | 3300032002 | Bacteria | 793 |
| 703 | Ga0373930_0000969 | 3300034816 | Bacteria | 4114 |
| 704 | Ga0373948_0003976 | 3300034817 | Bacteria | 2311 |
| 705 | Ga0373950_0004481 | 3300034818 | Bacteria | 2048 |
| 706 | Ga0373950_0025365 | 3300034818 | Bacteria | 1071 |
| 707 | Ga0373958_0010777 | 3300034819 | Bacteria | 1531 |
| 708 | Ga0373926_0034021 | 3300035083 | Bacteria | 1803 |
| 709 | Ga0373928_0004471 | 3300035084 | Bacteria | 2665 |
| 710 | Ga0373928_0156111 | 3300035084 | Bacteria | 635 |
| 711 | Ga0373940_0000777 | 3300035088 | Bacteria | 5241 |
| 712 | Ga0373949_0003420 | 3300035090 | Bacteria | 3784 |
| 713 | Ga0373952_0002029 | 3300035092 | Bacteria | 3655 |
| 714 | Ga0373932_0002149 | 3300035112 | Bacteria | 5113 |
| 715 | Ga0373939_0001716 | 3300035114 | Bacteria | 5275 |
| 716 | Ga0373939_0034212 | 3300035114 | Bacteria | 1490 |
| 717 | Ga0373941_0031559 | 3300035115 | Bacteria | 1579 |
| 718 | Ga0373945_0033095 | 3300035116 | Bacteria | 1835 |
| 719 | Ga0373954_0000003 | 3300035118 | Bacteria | 137757 |
| 720 | Ga0373956_0066709 | 3300035119 | Bacteria | 1637 |
| 721 | Ga0373956_0136367 | 3300035119 | Bacteria | 1151 |
| 722 | Ga0373943_0007817 | 3300035170 | Bacteria | 4803 |
| 723 | Ga0373943_0140182 | 3300035170 | Bacteria | 1302 |
| 724 | Ga0373946_0012143 | 3300035171 | Bacteria | 3221 |
| 725 | Ga0373946_0400638 | 3300035171 | Bacteria | 693 |
| 726 | Ga0373962_0002148 | 3300035242 | Bacteria | 4703 |
| 727 | Ga0373924_0011224 | 3300035410 | Bacteria | 3322 |
| 728 | Ga0373931_0000252 | 3300035691 | Bacteria | 22764 |
| 729 | Ga0373931_0965794 | 3300035691 | Unclassified | 575 |
| 730 | Ga0373935_0018563 | 3300035692 | Bacteria | 4233 |
| 731 | Ga0373927_0019884 | 3300035695 | Bacteria | 4403 |
| 732 | Ga0373927_0043108 | 3300035695 | Bacteria | 2922 |
| 733 | Ga0373927_0109375 | 3300035695 | Bacteria | 1801 |
| 734 | Ga0373933_0001870 | 3300035724 | Bacteria | 12159 |
| 735 | Ga0373947_0162305 | 3300035725 | Bacteria | 1446 |
| 736 | Ga0373947_0270947 | 3300035725 | Bacteria | 1127 |
| 737 | Ga0373947_0562024 | 3300035725 | Bacteria | 777 |
| 738 | Ga0373937_0000131 | 3300036401 | Bacteria | 72767 |
| 739 | Ga0373937_0100352 | 3300036401 | Bacteria | 2686 |
| 740 | Ga0373937_0173246 | 3300036401 | Bacteria | 2025 |
| 741 | Ga0373925_0037265 | 3300037068 | Bacteria | 3589 |
| 742 | Ga0373925_0123636 | 3300037068 | Bacteria | 2011 |
| 743 | Ga0395900_0379098 | 3300037418 | Bacteria | 1383 |
| 744 | Ga0395898_0135055 | 3300037466 | Bacteria | 2362 |
| 745 | Ga0395898_0497397 | 3300037466 | Bacteria | 1160 |
| 746 | Ga0395898_1023672 | 3300037466 | Bacteria | 761 |
| 747 | Ga0395901_0352270 | 3300038443 | Bacteria | 1519 |
| 748 | Ga0439460_0125926 | 3300042461 | Bacteria | 841 |
| 749 | Ga0451577_0059863 | 3300042876 | Bacteria | 3395 |
| 750 | Ga0451577_0298204 | 3300042876 | Bacteria | 1461 |
| 751 | Ga0451577_0518524 | 3300042876 | Bacteria | 1082 |
| 752 | Ga0453684_1317033 | 3300044712 | Bacteria | 753 |
| 753 | Ga0466960_0243811 | 3300044901 | Bacteria | 996 |
| 754 | Ga0451576_0001874 | 3300045051 | Bacteria | 33900 |
| 755 | Ga0451576_0029355 | 3300045051 | Bacteria | 5885 |
| 756 | Ga0451576_0354367 | 3300045051 | Bacteria | 1536 |
| 757 | Ga0451576_2305649 | 3300045051 | Bacteria | 552 |
| 758 | Ga0495617_007146 | 3300046452 | Bacteria | 3891 |
| 759 | Ga0495627_029326 | 3300046453 | Bacteria | 1752 |
| 760 | Ga0495638_0189467 | 3300046460 | Bacteria | 1168 |
| 761 | Ga0495641_0007792 | 3300046461 | Bacteria | 6631 |
| 762 | Ga0495580_0029530 | 3300046472 | Bacteria | 3978 |
| 763 | Ga0495605_0022593 | 3300046474 | Bacteria | 3320 |
| 764 | Ga0495639_0008736 | 3300046475 | Bacteria | 4346 |
| 765 | Ga0495584_0022072 | 3300046491 | Bacteria | 3230 |
| 766 | Ga0495584_0115405 | 3300046491 | Bacteria | 1359 |
| 767 | Ga0495584_0333569 | 3300046491 | Bacteria | 770 |
| 768 | Ga0495585_0040880 | 3300046492 | Bacteria | 2602 |
| 769 | Ga0495596_0043015 | 3300046500 | Bacteria | 1780 |
| 770 | Ga0495607_0042179 | 3300046501 | Bacteria | 2706 |
| 771 | Ga0495616_0096061 | 3300046513 | Bacteria | 1396 |
| 772 | Ga0495630_0118647 | 3300046517 | Bacteria | 2007 |
| 773 | Ga0495631_0033286 | 3300046518 | Bacteria | 2316 |
| 774 | Ga0495637_0016835 | 3300046520 | Bacteria | 3414 |
| 775 | Ga0495644_0006521 | 3300046523 | Bacteria | 4518 |
| 776 | Ga0495663_0025547 | 3300046525 | Bacteria | 1723 |
| 777 | Ga0495642_0366361 | 3300046528 | Bacteria | 634 |
| 778 | Ga0495654_0128448 | 3300046530 | Bacteria | 1140 |
| 779 | Ga0495598_0003609 | 3300046537 | Bacteria | 3299 |
| 780 | Ga0495621_0005773 | 3300046539 | Bacteria | 3578 |
| 781 | Ga0495621_0113868 | 3300046539 | Bacteria | 1040 |
| 782 | Ga0495633_0015892 | 3300046558 | Bacteria | 3896 |
| 783 | Ga0495656_0008616 | 3300046615 | Bacteria | 3646 |
| 784 | Ga0495634_0121091 | 3300046642 | Bacteria | 1676 |
| 785 | Ga0495611_0048255 | 3300046648 | Bacteria | 1913 |
| 786 | Ga0495659_0006305 | 3300046664 | Bacteria | 3748 |
| 787 | Ga0495661_0055083 | 3300046665 | Bacteria | 2385 |
| 788 | Ga0495588_0212462 | 3300046674 | Bacteria | 1021 |
| 789 | Ga0495657_0182286 | 3300046675 | Bacteria | 1288 |
| 790 | Ga0495658_0253005 | 3300046683 | Bacteria | 1108 |
| 791 | Ga0495669_0011126 | 3300046684 | Bacteria | 3813 |
| 792 | Ga0495624_0007311 | 3300046690 | Bacteria | 7759 |
| 793 | Ga0495670_0012390 | 3300046691 | Bacteria | 4193 |
| 794 | Ga0495670_0458367 | 3300046691 | Bacteria | 691 |
| 795 | Ga0495671_0019231 | 3300046692 | Bacteria | 3614 |
| 796 | Ga0495649_0157747 | 3300046694 | Bacteria | 1190 |
| 797 | Ga0495589_0014599 | 3300046794 | Bacteria | 4042 |
| 798 | Ga0495660_0156692 | 3300046810 | Bacteria | 1120 |
| 799 | Ga0495636_0126456 | 3300047318 | Bacteria | 1134 |
| 800 | Ga0495672_0154397 | 3300047320 | Bacteria | 1187 |
| 801 | Ga0495676_0012327 | 3300047321 | Bacteria | 7700 |
| 802 | Ga0495675_0224271 | 3300047444 | Bacteria | 1136 |
| 803 | Ga0495677_0090822 | 3300047445 | Bacteria | 1150 |
| 804 | Ga0495679_017138 | 3300047446 | Bacteria | 2601 |
| 805 | Ga0495681_0039442 | 3300047470 | Bacteria | 2306 |
| 806 | Ga0495686_0309787 | 3300047472 | Bacteria | 869 |
| 807 | Ga0495615_0050250 | 3300048090 | Bacteria | 1071 |
| 808 | Ga0495626_0110144 | 3300048091 | Bacteria | 1193 |
| 809 | Ga0496100_0008018 | 3300048903 | Bacteria | 5868 |
| 810 | Ga0496101_0043209 | 3300048904 | Bacteria | 3220 |
| 811 | Ga0496101_0088272 | 3300048904 | Bacteria | 2303 |
| 812 | Ga0496101_0129028 | 3300048904 | Bacteria | 1918 |
| 813 | Ga0496102_0081656 | 3300048905 | Bacteria | 2980 |
| 814 | Ga0496102_0119340 | 3300048905 | Bacteria | 2462 |
| 815 | Ga0496102_0364720 | 3300048905 | Bacteria | 1360 |
| 816 | Ga0496102_0594091 | 3300048905 | Bacteria | 1030 |
| 817 | Ga0496102_1177639 | 3300048905 | Unclassified | 686 |
| 818 | Ga0496103_0007794 | 3300048906 | Bacteria | 6365 |
| 819 | Ga0496103_0061716 | 3300048906 | Bacteria | 2332 |
| 820 | Ga0496103_0078809 | 3300048906 | Bacteria | 2069 |
| 821 | Ga0496103_0489675 | 3300048906 | Bacteria | 787 |
| 822 | Ga0496105_0034883 | 3300048908 | Bacteria | 4139 |
| 823 | Ga0496106_0002288 | 3300048909 | Bacteria | 14290 |
| 824 | Ga0496106_0043948 | 3300048909 | Bacteria | 3354 |
| 825 | Ga0496106_0070437 | 3300048909 | Bacteria | 2670 |
| 826 | Ga0496106_0089845 | 3300048909 | Bacteria | 2369 |
| 827 | Ga0496107_0007023 | 3300048910 | Bacteria | 7756 |
| 828 | Ga0496107_0086240 | 3300048910 | Bacteria | 2291 |
| 829 | Ga0496107_0125164 | 3300048910 | Bacteria | 1895 |
| 830 | Ga0496107_0254090 | 3300048910 | Bacteria | 1308 |
| 831 | Ga0496107_0333309 | 3300048910 | Bacteria | 1129 |
| 832 | Ga0496108_0001781 | 3300048911 | Bacteria | 17169 |
| 833 | Ga0496108_0033453 | 3300048911 | Bacteria | 4271 |
| 834 | Ga0496108_0160748 | 3300048911 | Bacteria | 1941 |
| 835 | Ga0496109_0012801 | 3300048912 | Bacteria | 7252 |
| 836 | Ga0496109_0396933 | 3300048912 | Bacteria | 1303 |
| 837 | Ga0496110_0030304 | 3300048913 | Bacteria | 4662 |
| 838 | Ga0496110_0115280 | 3300048913 | Bacteria | 2418 |
| 839 | Ga0496110_0534304 | 3300048913 | Bacteria | 1066 |
| 840 | Ga0496110_0623708 | 3300048913 | Bacteria | 977 |
| 841 | Ga0496110_0899450 | 3300048913 | Bacteria | 791 |
| 842 | Ga0496110_0914738 | 3300048913 | Bacteria | 783 |
| 843 | Ga0496111_0007385 | 3300048914 | Bacteria | 7197 |
| 844 | Ga0496111_0093896 | 3300048914 | Bacteria | 2200 |
| 845 | Ga0496112_0649363 | 3300048915 | Bacteria | 985 |
| 846 | Ga0496113_0467104 | 3300048916 | Bacteria | 1014 |
| 847 | Ga0496113_0953590 | 3300048916 | Unclassified | 677 |
| 848 | Ga0496114_0004981 | 3300048917 | Bacteria | 10361 |
| 849 | Ga0496114_0390371 | 3300048917 | Bacteria | 1232 |
| 850 | Ga0496115_0003424 | 3300048918 | Bacteria | 11397 |
| 851 | Ga0501299_027222 | 3300049522 | Bacteria | 1084 |
| 852 | Ga0501299_163270 | 3300049522 | Bacteria | 571 |
| 853 | Ga0501034_0000999 | 3300049571 | Bacteria | 40516 |
| 854 | Ga0501034_0016435 | 3300049571 | Bacteria | 7595 |
| 855 | Ga0501068_0414176 | 3300049584 | Bacteria | 870 |
| 856 | Ga0501068_0608253 | 3300049584 | Bacteria | 712 |
| 857 | Ga0501069_0152552 | 3300049585 | Bacteria | 1328 |
| 858 | Ga0501070_0113151 | 3300049586 | Bacteria | 2243 |
| 859 | Ga0501072_0000575 | 3300049588 | Bacteria | 26469 |
| 860 | Ga0501073_0336758 | 3300049589 | Bacteria | 1041 |
| 861 | Ga0501249_164221 | 3300049679 | Bacteria | 566 |
| 862 | Ga0501080_0282431 | 3300049742 | Bacteria | 1509 |
| 863 | Ga0501083_0023476 | 3300049744 | Bacteria | 4276 |
| 864 | nmdc:mga00v17_22927_c1 | 3300050491 | Bacteria | 3608 |
| 865 | nmdc:mga0yw44_188395_c1 | 3300050492 | Bacteria | 1360 |
| 866 | nmdc:mga0yw44_30749_c1 | 3300050492 | Bacteria | 3116 |
| 867 | nmdc:mga0yw44_91804_c1 | 3300050492 | Bacteria | 1921 |
| 868 | nmdc:mga0k408_324023_c1 | 3300050493 | Bacteria | 919 |
| 869 | nmdc:mga05p37_1652_c1 | 3300050507 | Bacteria | 25883 |
| 870 | nmdc:mga05p37_266159_c1 | 3300050507 | Bacteria | 2050 |
| 871 | nmdc:mga05p37_35745_c1 | 3300050507 | Bacteria | 6093 |
| 872 | nmdc:mga05p37_51418_c1 | 3300050507 | Bacteria | 5067 |
| 873 | nmdc:mga05p37_86744_c1 | 3300050507 | Bacteria | 3858 |
| 874 | nmdc:mga05p37_985858_c1 | 3300050507 | Bacteria | 897 |
| 875 | nmdc:mga09592_183221_c1 | 3300050508 | Bacteria | 1812 |
| 876 | nmdc:mga09592_32067_c1 | 3300050508 | Bacteria | 4379 |
| 877 | nmdc:mga09592_5035_c1 | 3300050508 | Bacteria | 10721 |
| 878 | nmdc:mga09592_82888_c1 | 3300050508 | Bacteria | 2733 |
| 879 | nmdc:mga0qj67_137040_c1 | 3300050509 | Bacteria | 1983 |
| 880 | nmdc:mga0qj67_31116_c1 | 3300050509 | Bacteria | 4156 |
| 881 | nmdc:mga06r32_103867_c1 | 3300050510 | Bacteria | 2790 |
| 882 | nmdc:mga06r32_163560_c1 | 3300050510 | Bacteria | 2208 |
| 883 | nmdc:mga06r32_47586_c1 | 3300050510 | Bacteria | 4097 |
| 884 | nmdc:mga08y16_1182606_c1 | 3300050511 | Unclassified | 736 |
| 885 | nmdc:mga08y16_135212_c1 | 3300050511 | Bacteria | 2562 |
| 886 | nmdc:mga08y16_209149_c1 | 3300050511 | Bacteria | 2021 |
| 887 | nmdc:mga08y16_269622_c2 | 3300050511 | Bacteria | 1341 |
| 888 | nmdc:mga08y16_29453_c1 | 3300050511 | Bacteria | 5785 |
| 889 | nmdc:mga08y16_343026_c1 | 3300050511 | Bacteria | 1535 |
| 890 | nmdc:mga08y16_355235_c1 | 3300050511 | Bacteria | 1505 |
| 891 | nmdc:mga08y16_53126_c1 | 3300050511 | Bacteria | 4238 |
| 892 | nmdc:mga08y16_63895_c1 | 3300050511 | Bacteria | 3845 |
| 893 | nmdc:mga0n895_1319762_c1 | 3300050512 | Bacteria | 692 |
| 894 | nmdc:mga0n895_1778071_c1 | 3300050512 | Bacteria | 577 |
| 895 | nmdc:mga0n895_214018_c1 | 3300050512 | Bacteria | 1957 |
| 896 | nmdc:mga0n895_218874_c1 | 3300050512 | Bacteria | 1933 |
| 897 | nmdc:mga0n895_247163_c1 | 3300050512 | Bacteria | 1810 |
| 898 | nmdc:mga0n895_283374_c1 | 3300050512 | Bacteria | 1680 |
| 899 | nmdc:mga0n895_347152_c1 | 3300050512 | Bacteria | 1503 |
| 900 | nmdc:mga0n895_559825_c1 | 3300050512 | Bacteria | 1148 |
| 901 | nmdc:mga0n895_6765_c1 | 3300050512 | Bacteria | 9780 |
| 902 | nmdc:mga0n895_977418_c1 | 3300050512 | Bacteria | 829 |
| 903 | nmdc:mga0rr50_139090_c1 | 3300050513 | Bacteria | 1952 |
| 904 | nmdc:mga0rr50_2920_c1 | 3300050513 | Bacteria | 9758 |
| 905 | nmdc:mga0rr50_311577_c1 | 3300050513 | Bacteria | 1318 |
| 906 | nmdc:mga0rr50_538502_c1 | 3300050513 | Bacteria | 994 |
| 907 | nmdc:mga0rr50_58574_c1 | 3300050513 | Bacteria | 2887 |
| 908 | nmdc:mga0rr50_925135_c1 | 3300050513 | Bacteria | 743 |
| 909 | nmdc:mga08x19_124615_c1 | 3300050514 | Bacteria | 1729 |
| 910 | nmdc:mga08x19_204568_c1 | 3300050514 | Bacteria | 1354 |
| 911 | nmdc:mga08x19_22737_c1 | 3300050514 | Bacteria | 3884 |
| 912 | nmdc:mga08x19_23840_c1 | 3300050514 | Bacteria | 3798 |
| 913 | nmdc:mga08x19_34351_c1 | 3300050514 | Bacteria | 3204 |
| 914 | nmdc:mga08x19_41242_c1 | 3300050514 | Bacteria | 2939 |
| 915 | nmdc:mga08x19_502964_c1 | 3300050514 | Bacteria | 856 |
| 916 | nmdc:mga08x19_94217_c1 | 3300050514 | Bacteria | 1980 |
| 917 | nmdc:mga0a205_12629_c1 | 3300050515 | Bacteria | 7819 |
| 918 | nmdc:mga0a205_141771_c1 | 3300050515 | Bacteria | 2303 |
| 919 | nmdc:mga0a205_181007_c1 | 3300050515 | Bacteria | 2002 |
| 920 | nmdc:mga0a205_215294_c1 | 3300050515 | Bacteria | 1808 |
| 921 | nmdc:mga0a205_470887_c1 | 3300050515 | Bacteria | 1115 |
| 922 | nmdc:mga0a205_614228_c1 | 3300050515 | Bacteria | 940 |
| 923 | Ga0495655_0001127 | 3300053083 | Bacteria | 4130 |
| 924 | Ga0495619_0158424 | 3300053085 | Bacteria | 1563 |
| 925 | Ga0501084_0965646 | 3300054114 | Unclassified | 716 |
| 926 | Ga0501082_0133550 | 3300060353 | Bacteria | 2153 |
| 927 | Ga0501082_0288553 | 3300060353 | Bacteria | 1429 |
| 928 | Ga0501082_0944182 | 3300060353 | Unclassified | 754 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005563 | Ga0068855_100657493 | Ga0068855_1006574932 | 155 |
| 2 | 3300005564 | Ga0070664_100080557 | Ga0070664_1000805572 | 155 |
| 3 | 3300005614 | Ga0068856_100047839 | Ga0068856_1000478395 | 155 |
| 4 | 3300005841 | Ga0068863_101585438 | Ga0068863_1015854381 | 155 |
| 5 | 3300025945 | Ga0207679_10028372 | Ga0207679_100283724 | 155 |
| 6 | 3300025981 | Ga0207640_10134385 | Ga0207640_101343852 | 155 |
| 7 | 3300026078 | Ga0207702_10049706 | Ga0207702_100497063 | 155 |
| 8 | 3300003203 | JGI25406J46586_10084736 | JGI25406J46586_100847361 | 156 |
| 9 | 3300005435 | Ga0070714_100250794 | Ga0070714_1002507941 | 156 |
| 10 | 3300005444 | Ga0070694_100040772 | Ga0070694_1000407723 | 156 |
| 11 | 3300005444 | Ga0070694_100397214 | Ga0070694_1003972141 | 156 |
| 12 | 3300005444 | Ga0070694_100416469 | Ga0070694_1004164692 | 156 |
| 13 | 3300005467 | Ga0070706_101099066 | Ga0070706_1010990662 | 156 |
| 14 | 3300005468 | Ga0070707_100043684 | Ga0070707_1000436843 | 156 |
| 15 | 3300005518 | Ga0070699_100418673 | Ga0070699_1004186731 | 156 |
| 16 | 3300005518 | Ga0070699_100583473 | Ga0070699_1005834731 | 156 |
| 17 | 3300005536 | Ga0070697_100109319 | Ga0070697_1001093192 | 156 |
| 18 | 3300005536 | Ga0070697_100180588 | Ga0070697_1001805881 | 156 |
| 19 | 3300005536 | Ga0070697_100779023 | Ga0070697_1007790231 | 156 |
| 20 | 3300005545 | Ga0070695_100038140 | Ga0070695_1000381403 | 156 |
| 21 | 3300005545 | Ga0070695_100147589 | Ga0070695_1001475892 | 156 |
| 22 | 3300005546 | Ga0070696_100200764 | Ga0070696_1002007642 | 156 |
| 23 | 3300005546 | Ga0070696_100227051 | Ga0070696_1002270512 | 156 |
| 24 | 3300005549 | Ga0070704_101027017 | Ga0070704_1010270171 | 156 |
| 25 | 3300005985 | Ga0081539_10000226 | Ga0081539_1000022625 | 156 |
| 26 | 3300006173 | Ga0070716_100259573 | Ga0070716_1002595732 | 156 |
| 27 | 3300006173 | Ga0070716_100486644 | Ga0070716_1004866441 | 156 |
| 28 | 3300006852 | Ga0075433_10275651 | Ga0075433_102756512 | 156 |
| 29 | 3300006871 | Ga0075434_100000003 | Ga0075434_10000000332 | 156 |
| 30 | 3300006871 | Ga0075434_100043038 | Ga0075434_1000430384 | 156 |
| 31 | 3300006914 | Ga0075436_100173396 | Ga0075436_1001733962 | 156 |
| 32 | 3300007076 | Ga0075435_100010435 | Ga0075435_1000104354 | 156 |
| 33 | 3300007265 | Ga0099794_10049733 | Ga0099794_100497332 | 156 |
| 34 | 3300009147 | Ga0114129_10225321 | Ga0114129_102253212 | 156 |
| 35 | 3300013308 | Ga0157375_12764363 | Ga0157375_127643631 | 156 |
| 36 | 3300025910 | Ga0207684_11003844 | Ga0207684_110038442 | 156 |
| 37 | 3300025922 | Ga0207646_10008428 | Ga0207646_100084282 | 156 |
| 38 | 3300025929 | Ga0207664_11103878 | Ga0207664_111038782 | 156 |
| 39 | 3300025939 | Ga0207665_10185164 | Ga0207665_101851642 | 156 |
| 40 | 3300035118 | Ga0373954_0000003 | Ga0373954_0000003_36437_36907 | 156 |
| 41 | 3300035119 | Ga0373956_0066709 | Ga0373956_0066709_123_593 | 156 |
| 42 | 3300035410 | Ga0373924_0011224 | Ga0373924_0011224_2702_3172 | 156 |
| 43 | 3300035695 | Ga0373927_0043108 | Ga0373927_0043108_2112_2624 | 156 |
| 44 | 3300035724 | Ga0373933_0001870 | Ga0373933_0001870_847_1317 | 156 |
| 45 | 3300036401 | Ga0373937_0000131 | Ga0373937_0000131_55272_55742 | 156 |
| 46 | 3300044901 | Ga0466960_0243811 | Ga0466960_0243811_288_758 | 156 |
| 47 | 3300046675 | Ga0495657_0182286 | Ga0495657_0182286_784_1254 | 156 |
| 48 | 3300047444 | Ga0495675_0224271 | Ga0495675_0224271_423_893 | 156 |
| 49 | 3300050507 | nmdc:mga05p37_266159_c1 | nmdc:mga05p37_266159_c1_144_656 | 156 |
| 50 | 3300050511 | nmdc:mga08y16_1182606_c1 | nmdc:mga08y16_1182606_c1_102_572 | 156 |
| 51 | 3300050512 | nmdc:mga0n895_283374_c1 | nmdc:mga0n895_283374_c1_1095_1607 | 156 |
| 52 | 3300050512 | nmdc:mga0n895_559825_c1 | nmdc:mga0n895_559825_c1_606_1076 | 156 |
| 53 | 3300050512 | nmdc:mga0n895_6765_c1 | nmdc:mga0n895_6765_c1_4683_5153 | 156 |
| 54 | 3300050513 | nmdc:mga0rr50_2920_c1 | nmdc:mga0rr50_2920_c1_6850_7320 | 156 |
| 55 | 3300050513 | nmdc:mga0rr50_58574_c1 | nmdc:mga0rr50_58574_c1_541_1011 | 156 |
| 56 | 3300050514 | nmdc:mga08x19_204568_c1 | nmdc:mga08x19_204568_c1_106_576 | 156 |
| 57 | 3300050514 | nmdc:mga08x19_34351_c1 | nmdc:mga08x19_34351_c1_1733_2203 | 156 |
| 58 | 3300050514 | nmdc:mga08x19_41242_c1 | nmdc:mga08x19_41242_c1_2411_2923 | 156 |
| 59 | 3300050514 | nmdc:mga08x19_94217_c1 | nmdc:mga08x19_94217_c1_956_1426 | 156 |
| 60 | 3300050515 | nmdc:mga0a205_12629_c1 | nmdc:mga0a205_12629_c1_102_614 | 156 |
| 61 | 3300050515 | nmdc:mga0a205_215294_c1 | nmdc:mga0a205_215294_c1_1054_1524 | 156 |
| 62 | 3300005438 | Ga0070701_10979191 | Ga0070701_109791911 | 157 |
| 63 | 3300005471 | Ga0070698_100267332 | Ga0070698_1002673322 | 157 |
| 64 | 3300005545 | Ga0070695_100332598 | Ga0070695_1003325982 | 157 |
| 65 | 3300005549 | Ga0070704_100334228 | Ga0070704_1003342282 | 157 |
| 66 | 3300042876 | Ga0451577_0298204 | Ga0451577_0298204_29_508 | 157 |
| 67 | 3300054114 | Ga0501084_0965646 | Ga0501084_0965646_162_635 | 157 |
| 68 | 3300060353 | Ga0501082_0944182 | Ga0501082_0944182_216_689 | 157 |
| 69 | 3300006173 | Ga0070716_100477648 | Ga0070716_1004776482 | 158 |
| 70 | 3300014969 | Ga0157376_11110261 | Ga0157376_111102612 | 158 |
| 71 | 3300049584 | Ga0501068_0608253 | Ga0501068_0608253_121_597 | 158 |
| 72 | 3300050492 | nmdc:mga0yw44_30749_c1 | nmdc:mga0yw44_30749_c1_1840_2316 | 158 |
| 73 | 3300005331 | Ga0070670_100771741 | Ga0070670_1007717412 | 159 |
| 74 | 3300005458 | Ga0070681_11151117 | Ga0070681_111511171 | 159 |
| 75 | 3300005518 | Ga0070699_100076537 | Ga0070699_1000765373 | 159 |
| 76 | 3300005842 | Ga0068858_100325860 | Ga0068858_1003258602 | 159 |
| 77 | 3300006844 | Ga0075428_100066145 | Ga0075428_1000661452 | 159 |
| 78 | 3300006844 | Ga0075428_100143936 | Ga0075428_1001439362 | 159 |
| 79 | 3300006847 | Ga0075431_100081933 | Ga0075431_1000819333 | 159 |
| 80 | 3300006880 | Ga0075429_100032190 | Ga0075429_1000321902 | 159 |
| 81 | 3300009147 | Ga0114129_10427625 | Ga0114129_104276252 | 159 |
| 82 | 3300014326 | Ga0157380_11878770 | Ga0157380_118787702 | 159 |
| 83 | 3300025899 | Ga0207642_10031218 | Ga0207642_100312183 | 159 |
| 84 | 3300026035 | Ga0207703_10177081 | Ga0207703_101770812 | 159 |
| 85 | 3300026089 | Ga0207648_10194933 | Ga0207648_101949331 | 159 |
| 86 | 3300026118 | Ga0207675_100605105 | Ga0207675_1006051052 | 159 |
| 87 | 3300028381 | Ga0268264_10968013 | Ga0268264_109680132 | 159 |
| 88 | 3300032002 | Ga0307416_101445039 | Ga0307416_1014450391 | 159 |
| 89 | 3300035084 | Ga0373928_0156111 | Ga0373928_0156111_79_561 | 159 |
| 90 | 3300049522 | Ga0501299_027222 | Ga0501299_027222_154_633 | 159 |
| 91 | 3300049571 | Ga0501034_0000999 | Ga0501034_0000999_32719_33198 | 159 |
| 92 | 3300049571 | Ga0501034_0016435 | Ga0501034_0016435_6541_7020 | 159 |
| 93 | 3300049584 | Ga0501068_0414176 | Ga0501068_0414176_121_600 | 159 |
| 94 | 3300049588 | Ga0501072_0000575 | Ga0501072_0000575_1850_2329 | 159 |
| 95 | 3300050507 | nmdc:mga05p37_51418_c1 | nmdc:mga05p37_51418_c1_795_1277 | 159 |
| 96 | 3300050508 | nmdc:mga09592_82888_c1 | nmdc:mga09592_82888_c1_1570_2052 | 159 |
| 97 | 3300050514 | nmdc:mga08x19_23840_c1 | nmdc:mga08x19_23840_c1_2836_3315 | 159 |
| 98 | 3300001977 | JGI24746J21847_1007538 | JGI24746J21847_10075382 | 160 |
| 99 | 3300001990 | JGI24737J22298_10008941 | JGI24737J22298_100089413 | 160 |
| 100 | 3300001991 | JGI24743J22301_10004728 | JGI24743J22301_100047283 | 160 |
| 101 | 3300002070 | JGI24750J21931_1001145 | JGI24750J21931_10011453 | 160 |
| 102 | 3300002070 | JGI24750J21931_1002899 | JGI24750J21931_10028991 | 160 |
| 103 | 3300002073 | JGI24745J21846_1001070 | JGI24745J21846_10010703 | 160 |
| 104 | 3300002074 | JGI24748J21848_1003000 | JGI24748J21848_10030002 | 160 |
| 105 | 3300002075 | JGI24738J21930_10007173 | JGI24738J21930_100071733 | 160 |
| 106 | 3300002076 | JGI24749J21850_1004565 | JGI24749J21850_10045653 | 160 |
| 107 | 3300002076 | JGI24749J21850_1010562 | JGI24749J21850_10105622 | 160 |
| 108 | 3300002077 | JGI24744J21845_10003130 | JGI24744J21845_100031303 | 160 |
| 109 | 3300002239 | JGI24034J26672_10008728 | JGI24034J26672_100087282 | 160 |
| 110 | 3300002244 | JGI24742J22300_10001923 | JGI24742J22300_100019232 | 160 |
| 111 | 3300002244 | JGI24742J22300_10052258 | JGI24742J22300_100522581 | 160 |
| 112 | 3300002459 | JGI24751J29686_10007565 | JGI24751J29686_100075653 | 160 |
| 113 | 3300003659 | JGI25404J52841_10002936 | JGI25404J52841_100029364 | 160 |
| 114 | 3300003911 | JGI25405J52794_10033093 | JGI25405J52794_100330931 | 160 |
| 115 | 3300005293 | Ga0065715_10151111 | Ga0065715_101511112 | 160 |
| 116 | 3300005295 | Ga0065707_10127695 | Ga0065707_101276952 | 160 |
| 117 | 3300005295 | Ga0065707_10551226 | Ga0065707_105512261 | 160 |
| 118 | 3300005328 | Ga0070676_10024314 | Ga0070676_100243143 | 160 |
| 119 | 3300005328 | Ga0070676_10034571 | Ga0070676_100345712 | 160 |
| 120 | 3300005328 | Ga0070676_10330762 | Ga0070676_103307622 | 160 |
| 121 | 3300005329 | Ga0070683_100012422 | Ga0070683_1000124225 | 160 |
| 122 | 3300005330 | Ga0070690_100059351 | Ga0070690_1000593512 | 160 |
| 123 | 3300005330 | Ga0070690_100169041 | Ga0070690_1001690412 | 160 |
| 124 | 3300005330 | Ga0070690_101234006 | Ga0070690_1012340061 | 160 |
| 125 | 3300005331 | Ga0070670_100458365 | Ga0070670_1004583651 | 160 |
| 126 | 3300005331 | Ga0070670_100585832 | Ga0070670_1005858322 | 160 |
| 127 | 3300005333 | Ga0070677_10007692 | Ga0070677_100076922 | 160 |
| 128 | 3300005334 | Ga0068869_100000121 | Ga0068869_1000001212 | 160 |
| 129 | 3300005334 | Ga0068869_100060152 | Ga0068869_1000601522 | 160 |
| 130 | 3300005334 | Ga0068869_100411894 | Ga0068869_1004118941 | 160 |
| 131 | 3300005334 | Ga0068869_100600098 | Ga0068869_1006000982 | 160 |
| 132 | 3300005335 | Ga0070666_10130452 | Ga0070666_101304522 | 160 |
| 133 | 3300005335 | Ga0070666_10562763 | Ga0070666_105627631 | 160 |
| 134 | 3300005338 | Ga0068868_100056124 | Ga0068868_1000561242 | 160 |
| 135 | 3300005338 | Ga0068868_100057215 | Ga0068868_1000572152 | 160 |
| 136 | 3300005338 | Ga0068868_100514721 | Ga0068868_1005147212 | 160 |
| 137 | 3300005339 | Ga0070660_100021749 | Ga0070660_1000217492 | 160 |
| 138 | 3300005339 | Ga0070660_100046924 | Ga0070660_1000469242 | 160 |
| 139 | 3300005339 | Ga0070660_100181458 | Ga0070660_1001814582 | 160 |
| 140 | 3300005339 | Ga0070660_100510308 | Ga0070660_1005103082 | 160 |
| 141 | 3300005340 | Ga0070689_100008395 | Ga0070689_10000839511 | 160 |
| 142 | 3300005340 | Ga0070689_100430933 | Ga0070689_1004309332 | 160 |
| 143 | 3300005340 | Ga0070689_100504486 | Ga0070689_1005044862 | 160 |
| 144 | 3300005341 | Ga0070691_10017562 | Ga0070691_100175623 | 160 |
| 145 | 3300005343 | Ga0070687_100023503 | Ga0070687_1000235031 | 160 |
| 146 | 3300005343 | Ga0070687_100088315 | Ga0070687_1000883152 | 160 |
| 147 | 3300005343 | Ga0070687_100213709 | Ga0070687_1002137092 | 160 |
| 148 | 3300005343 | Ga0070687_100286619 | Ga0070687_1002866192 | 160 |
| 149 | 3300005344 | Ga0070661_100029653 | Ga0070661_1000296532 | 160 |
| 150 | 3300005344 | Ga0070661_100064222 | Ga0070661_1000642222 | 160 |
| 151 | 3300005344 | Ga0070661_100072461 | Ga0070661_1000724613 | 160 |
| 152 | 3300005344 | Ga0070661_100101319 | Ga0070661_1001013193 | 160 |
| 153 | 3300005345 | Ga0070692_10210751 | Ga0070692_102107512 | 160 |
| 154 | 3300005345 | Ga0070692_10453001 | Ga0070692_104530012 | 160 |
| 155 | 3300005345 | Ga0070692_10614419 | Ga0070692_106144192 | 160 |
| 156 | 3300005347 | Ga0070668_100005467 | Ga0070668_1000054675 | 160 |
| 157 | 3300005347 | Ga0070668_100036090 | Ga0070668_1000360902 | 160 |
| 158 | 3300005347 | Ga0070668_100186204 | Ga0070668_1001862042 | 160 |
| 159 | 3300005347 | Ga0070668_100191117 | Ga0070668_1001911172 | 160 |
| 160 | 3300005347 | Ga0070668_100263534 | Ga0070668_1002635341 | 160 |
| 161 | 3300005347 | Ga0070668_100324770 | Ga0070668_1003247702 | 160 |
| 162 | 3300005353 | Ga0070669_100072739 | Ga0070669_1000727393 | 160 |
| 163 | 3300005353 | Ga0070669_100109601 | Ga0070669_1001096012 | 160 |
| 164 | 3300005353 | Ga0070669_100293109 | Ga0070669_1002931092 | 160 |
| 165 | 3300005353 | Ga0070669_100574881 | Ga0070669_1005748812 | 160 |
| 166 | 3300005353 | Ga0070669_101046567 | Ga0070669_1010465671 | 160 |
| 167 | 3300005354 | Ga0070675_100054743 | Ga0070675_1000547433 | 160 |
| 168 | 3300005354 | Ga0070675_100232834 | Ga0070675_1002328342 | 160 |
| 169 | 3300005354 | Ga0070675_100353504 | Ga0070675_1003535041 | 160 |
| 170 | 3300005354 | Ga0070675_100393837 | Ga0070675_1003938372 | 160 |
| 171 | 3300005354 | Ga0070675_100484506 | Ga0070675_1004845062 | 160 |
| 172 | 3300005354 | Ga0070675_101260687 | Ga0070675_1012606871 | 160 |
| 173 | 3300005355 | Ga0070671_100022108 | Ga0070671_1000221083 | 160 |
| 174 | 3300005355 | Ga0070671_100227394 | Ga0070671_1002273941 | 160 |
| 175 | 3300005355 | Ga0070671_100440027 | Ga0070671_1004400272 | 160 |
| 176 | 3300005356 | Ga0070674_100016494 | Ga0070674_1000164944 | 160 |
| 177 | 3300005356 | Ga0070674_100323903 | Ga0070674_1003239031 | 160 |
| 178 | 3300005356 | Ga0070674_100726742 | Ga0070674_1007267422 | 160 |
| 179 | 3300005364 | Ga0070673_100006060 | Ga0070673_1000060603 | 160 |
| 180 | 3300005364 | Ga0070673_100026639 | Ga0070673_1000266394 | 160 |
| 181 | 3300005364 | Ga0070673_100181773 | Ga0070673_1001817732 | 160 |
| 182 | 3300005364 | Ga0070673_100231696 | Ga0070673_1002316962 | 160 |
| 183 | 3300005364 | Ga0070673_100868938 | Ga0070673_1008689382 | 160 |
| 184 | 3300005365 | Ga0070688_100016172 | Ga0070688_1000161724 | 160 |
| 185 | 3300005365 | Ga0070688_100027208 | Ga0070688_1000272084 | 160 |
| 186 | 3300005365 | Ga0070688_100687700 | Ga0070688_1006877001 | 160 |
| 187 | 3300005366 | Ga0070659_100044765 | Ga0070659_1000447654 | 160 |
| 188 | 3300005366 | Ga0070659_100052481 | Ga0070659_1000524812 | 160 |
| 189 | 3300005366 | Ga0070659_100079603 | Ga0070659_1000796032 | 160 |
| 190 | 3300005366 | Ga0070659_100104112 | Ga0070659_1001041121 | 160 |
| 191 | 3300005367 | Ga0070667_100005519 | Ga0070667_1000055196 | 160 |
| 192 | 3300005367 | Ga0070667_100033447 | Ga0070667_1000334474 | 160 |
| 193 | 3300005367 | Ga0070667_100108241 | Ga0070667_1001082413 | 160 |
| 194 | 3300005367 | Ga0070667_100309381 | Ga0070667_1003093812 | 160 |
| 195 | 3300005367 | Ga0070667_100406708 | Ga0070667_1004067081 | 160 |
| 196 | 3300005367 | Ga0070667_100867169 | Ga0070667_1008671692 | 160 |
| 197 | 3300005406 | Ga0070703_10366535 | Ga0070703_103665351 | 160 |
| 198 | 3300005434 | Ga0070709_10222392 | Ga0070709_102223922 | 160 |
| 199 | 3300005436 | Ga0070713_100091210 | Ga0070713_1000912102 | 160 |
| 200 | 3300005437 | Ga0070710_10052339 | Ga0070710_100523392 | 160 |
| 201 | 3300005438 | Ga0070701_10154102 | Ga0070701_101541022 | 160 |
| 202 | 3300005438 | Ga0070701_10222376 | Ga0070701_102223762 | 160 |
| 203 | 3300005439 | Ga0070711_100064921 | Ga0070711_1000649212 | 160 |
| 204 | 3300005440 | Ga0070705_100212060 | Ga0070705_1002120602 | 160 |
| 205 | 3300005440 | Ga0070705_100346408 | Ga0070705_1003464082 | 160 |
| 206 | 3300005440 | Ga0070705_100413023 | Ga0070705_1004130231 | 160 |
| 207 | 3300005440 | Ga0070705_100563794 | Ga0070705_1005637942 | 160 |
| 208 | 3300005441 | Ga0070700_100009952 | Ga0070700_1000099525 | 160 |
| 209 | 3300005441 | Ga0070700_100014920 | Ga0070700_1000149204 | 160 |
| 210 | 3300005441 | Ga0070700_100061194 | Ga0070700_1000611942 | 160 |
| 211 | 3300005441 | Ga0070700_100301833 | Ga0070700_1003018332 | 160 |
| 212 | 3300005441 | Ga0070700_101655445 | Ga0070700_1016554451 | 160 |
| 213 | 3300005444 | Ga0070694_100128820 | Ga0070694_1001288202 | 160 |
| 214 | 3300005444 | Ga0070694_100386472 | Ga0070694_1003864722 | 160 |
| 215 | 3300005444 | Ga0070694_100478149 | Ga0070694_1004781492 | 160 |
| 216 | 3300005444 | Ga0070694_101718905 | Ga0070694_1017189051 | 160 |
| 217 | 3300005445 | Ga0070708_100027191 | Ga0070708_1000271912 | 160 |
| 218 | 3300005455 | Ga0070663_100002260 | Ga0070663_10000226013 | 160 |
| 219 | 3300005455 | Ga0070663_100016989 | Ga0070663_1000169893 | 160 |
| 220 | 3300005455 | Ga0070663_100121476 | Ga0070663_1001214762 | 160 |
| 221 | 3300005455 | Ga0070663_100611225 | Ga0070663_1006112252 | 160 |
| 222 | 3300005456 | Ga0070678_100025772 | Ga0070678_1000257723 | 160 |
| 223 | 3300005456 | Ga0070678_100097419 | Ga0070678_1000974192 | 160 |
| 224 | 3300005456 | Ga0070678_100460881 | Ga0070678_1004608812 | 160 |
| 225 | 3300005456 | Ga0070678_100710795 | Ga0070678_1007107952 | 160 |
| 226 | 3300005456 | Ga0070678_101747043 | Ga0070678_1017470431 | 160 |
| 227 | 3300005457 | Ga0070662_100001034 | Ga0070662_1000010345 | 160 |
| 228 | 3300005457 | Ga0070662_100009501 | Ga0070662_1000095019 | 160 |
| 229 | 3300005457 | Ga0070662_100296879 | Ga0070662_1002968792 | 160 |
| 230 | 3300005457 | Ga0070662_100310912 | Ga0070662_1003109122 | 160 |
| 231 | 3300005457 | Ga0070662_100361714 | Ga0070662_1003617141 | 160 |
| 232 | 3300005457 | Ga0070662_100462122 | Ga0070662_1004621222 | 160 |
| 233 | 3300005457 | Ga0070662_100551789 | Ga0070662_1005517891 | 160 |
| 234 | 3300005458 | Ga0070681_10581690 | Ga0070681_105816902 | 160 |
| 235 | 3300005458 | Ga0070681_11240135 | Ga0070681_112401351 | 160 |
| 236 | 3300005459 | Ga0068867_100028941 | Ga0068867_1000289416 | 160 |
| 237 | 3300005459 | Ga0068867_100146695 | Ga0068867_1001466952 | 160 |
| 238 | 3300005459 | Ga0068867_100280670 | Ga0068867_1002806702 | 160 |
| 239 | 3300005459 | Ga0068867_100458383 | Ga0068867_1004583832 | 160 |
| 240 | 3300005459 | Ga0068867_101331371 | Ga0068867_1013313711 | 160 |
| 241 | 3300005466 | Ga0070685_10008603 | Ga0070685_100086037 | 160 |
| 242 | 3300005466 | Ga0070685_10010997 | Ga0070685_100109972 | 160 |
| 243 | 3300005467 | Ga0070706_100044678 | Ga0070706_1000446783 | 160 |
| 244 | 3300005467 | Ga0070706_101013378 | Ga0070706_1010133781 | 160 |
| 245 | 3300005468 | Ga0070707_100723204 | Ga0070707_1007232042 | 160 |
| 246 | 3300005468 | Ga0070707_101071414 | Ga0070707_1010714141 | 160 |
| 247 | 3300005471 | Ga0070698_100116477 | Ga0070698_1001164772 | 160 |
| 248 | 3300005518 | Ga0070699_100185457 | Ga0070699_1001854572 | 160 |
| 249 | 3300005518 | Ga0070699_100441456 | Ga0070699_1004414562 | 160 |
| 250 | 3300005518 | Ga0070699_100652296 | Ga0070699_1006522962 | 160 |
| 251 | 3300005535 | Ga0070684_100157462 | Ga0070684_1001574622 | 160 |
| 252 | 3300005539 | Ga0068853_100009533 | Ga0068853_1000095334 | 160 |
| 253 | 3300005539 | Ga0068853_100045484 | Ga0068853_1000454842 | 160 |
| 254 | 3300005539 | Ga0068853_100071205 | Ga0068853_1000712052 | 160 |
| 255 | 3300005539 | Ga0068853_100206358 | Ga0068853_1002063582 | 160 |
| 256 | 3300005539 | Ga0068853_100216264 | Ga0068853_1002162642 | 160 |
| 257 | 3300005539 | Ga0068853_100829906 | Ga0068853_1008299062 | 160 |
| 258 | 3300005543 | Ga0070672_100122602 | Ga0070672_1001226022 | 160 |
| 259 | 3300005543 | Ga0070672_100155192 | Ga0070672_1001551922 | 160 |
| 260 | 3300005543 | Ga0070672_100160692 | Ga0070672_1001606922 | 160 |
| 261 | 3300005543 | Ga0070672_100664402 | Ga0070672_1006644022 | 160 |
| 262 | 3300005544 | Ga0070686_100034473 | Ga0070686_1000344733 | 160 |
| 263 | 3300005545 | Ga0070695_100064454 | Ga0070695_1000644542 | 160 |
| 264 | 3300005545 | Ga0070695_100075160 | Ga0070695_1000751603 | 160 |
| 265 | 3300005545 | Ga0070695_100788146 | Ga0070695_1007881462 | 160 |
| 266 | 3300005546 | Ga0070696_100228650 | Ga0070696_1002286502 | 160 |
| 267 | 3300005546 | Ga0070696_100262180 | Ga0070696_1002621802 | 160 |
| 268 | 3300005546 | Ga0070696_100272852 | Ga0070696_1002728522 | 160 |
| 269 | 3300005546 | Ga0070696_100638813 | Ga0070696_1006388132 | 160 |
| 270 | 3300005547 | Ga0070693_100325824 | Ga0070693_1003258241 | 160 |
| 271 | 3300005547 | Ga0070693_100857133 | Ga0070693_1008571331 | 160 |
| 272 | 3300005548 | Ga0070665_100054890 | Ga0070665_1000548903 | 160 |
| 273 | 3300005548 | Ga0070665_100055967 | Ga0070665_1000559672 | 160 |
| 274 | 3300005548 | Ga0070665_100269983 | Ga0070665_1002699832 | 160 |
| 275 | 3300005548 | Ga0070665_101828731 | Ga0070665_1018287311 | 160 |
| 276 | 3300005549 | Ga0070704_100069481 | Ga0070704_1000694812 | 160 |
| 277 | 3300005549 | Ga0070704_100109411 | Ga0070704_1001094111 | 160 |
| 278 | 3300005549 | Ga0070704_100407145 | Ga0070704_1004071452 | 160 |
| 279 | 3300005549 | Ga0070704_100856297 | Ga0070704_1008562972 | 160 |
| 280 | 3300005549 | Ga0070704_101290530 | Ga0070704_1012905301 | 160 |
| 281 | 3300005549 | Ga0070704_101298941 | Ga0070704_1012989411 | 160 |
| 282 | 3300005563 | Ga0068855_100000618 | Ga0068855_10000061818 | 160 |
| 283 | 3300005563 | Ga0068855_100469692 | Ga0068855_1004696922 | 160 |
| 284 | 3300005563 | Ga0068855_101043969 | Ga0068855_1010439692 | 160 |
| 285 | 3300005563 | Ga0068855_101155850 | Ga0068855_1011558502 | 160 |
| 286 | 3300005564 | Ga0070664_100003070 | Ga0070664_1000030704 | 160 |
| 287 | 3300005564 | Ga0070664_100010816 | Ga0070664_1000108168 | 160 |
| 288 | 3300005564 | Ga0070664_100051886 | Ga0070664_1000518864 | 160 |
| 289 | 3300005564 | Ga0070664_100105200 | Ga0070664_1001052002 | 160 |
| 290 | 3300005564 | Ga0070664_100515261 | Ga0070664_1005152612 | 160 |
| 291 | 3300005564 | Ga0070664_100865294 | Ga0070664_1008652941 | 160 |
| 292 | 3300005577 | Ga0068857_100014463 | Ga0068857_1000144638 | 160 |
| 293 | 3300005577 | Ga0068857_100016325 | Ga0068857_1000163257 | 160 |
| 294 | 3300005577 | Ga0068857_100311755 | Ga0068857_1003117552 | 160 |
| 295 | 3300005578 | Ga0068854_100045035 | Ga0068854_1000450354 | 160 |
| 296 | 3300005578 | Ga0068854_100107882 | Ga0068854_1001078822 | 160 |
| 297 | 3300005578 | Ga0068854_100178633 | Ga0068854_1001786332 | 160 |
| 298 | 3300005614 | Ga0068856_100000093 | Ga0068856_10000009357 | 160 |
| 299 | 3300005614 | Ga0068856_100028254 | Ga0068856_1000282548 | 160 |
| 300 | 3300005614 | Ga0068856_100110886 | Ga0068856_1001108864 | 160 |
| 301 | 3300005614 | Ga0068856_100201564 | Ga0068856_1002015643 | 160 |
| 302 | 3300005614 | Ga0068856_100629619 | Ga0068856_1006296192 | 160 |
| 303 | 3300005614 | Ga0068856_101141795 | Ga0068856_1011417952 | 160 |
| 304 | 3300005615 | Ga0070702_100016321 | Ga0070702_1000163213 | 160 |
| 305 | 3300005615 | Ga0070702_100025445 | Ga0070702_1000254452 | 160 |
| 306 | 3300005615 | Ga0070702_100232526 | Ga0070702_1002325262 | 160 |
| 307 | 3300005616 | Ga0068852_100044168 | Ga0068852_1000441683 | 160 |
| 308 | 3300005616 | Ga0068852_100471214 | Ga0068852_1004712142 | 160 |
| 309 | 3300005616 | Ga0068852_101106465 | Ga0068852_1011064652 | 160 |
| 310 | 3300005617 | Ga0068859_100018237 | Ga0068859_1000182372 | 160 |
| 311 | 3300005617 | Ga0068859_100027447 | Ga0068859_1000274476 | 160 |
| 312 | 3300005617 | Ga0068859_100029782 | Ga0068859_1000297828 | 160 |
| 313 | 3300005617 | Ga0068859_100044053 | Ga0068859_1000440533 | 160 |
| 314 | 3300005617 | Ga0068859_100119044 | Ga0068859_1001190444 | 160 |
| 315 | 3300005617 | Ga0068859_100143080 | Ga0068859_1001430802 | 160 |
| 316 | 3300005617 | Ga0068859_100265389 | Ga0068859_1002653893 | 160 |
| 317 | 3300005617 | Ga0068859_100599532 | Ga0068859_1005995322 | 160 |
| 318 | 3300005617 | Ga0068859_100844812 | Ga0068859_1008448122 | 160 |
| 319 | 3300005617 | Ga0068859_101274479 | Ga0068859_1012744792 | 160 |
| 320 | 3300005618 | Ga0068864_100013289 | Ga0068864_1000132898 | 160 |
| 321 | 3300005618 | Ga0068864_100033901 | Ga0068864_1000339013 | 160 |
| 322 | 3300005618 | Ga0068864_100058563 | Ga0068864_1000585633 | 160 |
| 323 | 3300005618 | Ga0068864_100129300 | Ga0068864_1001293002 | 160 |
| 324 | 3300005718 | Ga0068866_10007073 | Ga0068866_100070734 | 160 |
| 325 | 3300005718 | Ga0068866_10015832 | Ga0068866_100158322 | 160 |
| 326 | 3300005718 | Ga0068866_10239285 | Ga0068866_102392851 | 160 |
| 327 | 3300005719 | Ga0068861_100016323 | Ga0068861_10001632310 | 160 |
| 328 | 3300005719 | Ga0068861_100788100 | Ga0068861_1007881001 | 160 |
| 329 | 3300005834 | Ga0068851_10003290 | Ga0068851_100032902 | 160 |
| 330 | 3300005834 | Ga0068851_10025362 | Ga0068851_100253624 | 160 |
| 331 | 3300005834 | Ga0068851_10324163 | Ga0068851_103241632 | 160 |
| 332 | 3300005834 | Ga0068851_10426881 | Ga0068851_104268811 | 160 |
| 333 | 3300005834 | Ga0068851_10594890 | Ga0068851_105948902 | 160 |
| 334 | 3300005840 | Ga0068870_10005949 | Ga0068870_100059494 | 160 |
| 335 | 3300005840 | Ga0068870_10013761 | Ga0068870_100137613 | 160 |
| 336 | 3300005840 | Ga0068870_10226700 | Ga0068870_102267002 | 160 |
| 337 | 3300005841 | Ga0068863_100006688 | Ga0068863_1000066887 | 160 |
| 338 | 3300005841 | Ga0068863_100019022 | Ga0068863_1000190229 | 160 |
| 339 | 3300005841 | Ga0068863_100071537 | Ga0068863_1000715372 | 160 |
| 340 | 3300005841 | Ga0068863_100161972 | Ga0068863_1001619722 | 160 |
| 341 | 3300005841 | Ga0068863_100208625 | Ga0068863_1002086251 | 160 |
| 342 | 3300005841 | Ga0068863_101315847 | Ga0068863_1013158472 | 160 |
| 343 | 3300005842 | Ga0068858_100011753 | Ga0068858_1000117536 | 160 |
| 344 | 3300005842 | Ga0068858_100028984 | Ga0068858_1000289847 | 160 |
| 345 | 3300005842 | Ga0068858_100052318 | Ga0068858_1000523184 | 160 |
| 346 | 3300005842 | Ga0068858_100086576 | Ga0068858_1000865762 | 160 |
| 347 | 3300005842 | Ga0068858_100331789 | Ga0068858_1003317892 | 160 |
| 348 | 3300005842 | Ga0068858_101605849 | Ga0068858_1016058491 | 160 |
| 349 | 3300005843 | Ga0068860_100010410 | Ga0068860_1000104107 | 160 |
| 350 | 3300005843 | Ga0068860_100029566 | Ga0068860_1000295664 | 160 |
| 351 | 3300005843 | Ga0068860_100051826 | Ga0068860_1000518262 | 160 |
| 352 | 3300005843 | Ga0068860_100188108 | Ga0068860_1001881082 | 160 |
| 353 | 3300005843 | Ga0068860_100318595 | Ga0068860_1003185952 | 160 |
| 354 | 3300005843 | Ga0068860_100329346 | Ga0068860_1003293462 | 160 |
| 355 | 3300005843 | Ga0068860_101103367 | Ga0068860_1011033672 | 160 |
| 356 | 3300005844 | Ga0068862_100015627 | Ga0068862_1000156272 | 160 |
| 357 | 3300005844 | Ga0068862_100033422 | Ga0068862_1000334224 | 160 |
| 358 | 3300005844 | Ga0068862_100036439 | Ga0068862_1000364393 | 160 |
| 359 | 3300005844 | Ga0068862_100045278 | Ga0068862_1000452782 | 160 |
| 360 | 3300005844 | Ga0068862_101029311 | Ga0068862_1010293112 | 160 |
| 361 | 3300005844 | Ga0068862_101628756 | Ga0068862_1016287561 | 160 |
| 362 | 3300005937 | Ga0081455_10015181 | Ga0081455_100151815 | 160 |
| 363 | 3300005937 | Ga0081455_10019463 | Ga0081455_100194633 | 160 |
| 364 | 3300005937 | Ga0081455_10026378 | Ga0081455_100263784 | 160 |
| 365 | 3300005937 | Ga0081455_10091775 | Ga0081455_100917752 | 160 |
| 366 | 3300005981 | Ga0081538_10032628 | Ga0081538_100326283 | 160 |
| 367 | 3300005983 | Ga0081540_1000045 | Ga0081540_10000459 | 160 |
| 368 | 3300005983 | Ga0081540_1010997 | Ga0081540_10109975 | 160 |
| 369 | 3300005983 | Ga0081540_1015520 | Ga0081540_10155202 | 160 |
| 370 | 3300006038 | Ga0075365_10007399 | Ga0075365_100073992 | 160 |
| 371 | 3300006038 | Ga0075365_10109544 | Ga0075365_101095442 | 160 |
| 372 | 3300006038 | Ga0075365_10147347 | Ga0075365_101473472 | 160 |
| 373 | 3300006038 | Ga0075365_10553399 | Ga0075365_105533992 | 160 |
| 374 | 3300006051 | Ga0075364_10164759 | Ga0075364_101647592 | 160 |
| 375 | 3300006163 | Ga0070715_10006868 | Ga0070715_100068683 | 160 |
| 376 | 3300006173 | Ga0070716_100263819 | Ga0070716_1002638192 | 160 |
| 377 | 3300006175 | Ga0070712_100123209 | Ga0070712_1001232092 | 160 |
| 378 | 3300006237 | Ga0097621_100013107 | Ga0097621_1000131076 | 160 |
| 379 | 3300006237 | Ga0097621_100136204 | Ga0097621_1001362043 | 160 |
| 380 | 3300006237 | Ga0097621_100313650 | Ga0097621_1003136502 | 160 |
| 381 | 3300006358 | Ga0068871_100026948 | Ga0068871_1000269484 | 160 |
| 382 | 3300006844 | Ga0075428_100003992 | Ga0075428_1000039923 | 160 |
| 383 | 3300006844 | Ga0075428_100076532 | Ga0075428_1000765322 | 160 |
| 384 | 3300006844 | Ga0075428_100144235 | Ga0075428_1001442352 | 160 |
| 385 | 3300006844 | Ga0075428_100443634 | Ga0075428_1004436342 | 160 |
| 386 | 3300006844 | Ga0075428_101029908 | Ga0075428_1010299082 | 160 |
| 387 | 3300006846 | Ga0075430_100013974 | Ga0075430_1000139744 | 160 |
| 388 | 3300006846 | Ga0075430_100194624 | Ga0075430_1001946242 | 160 |
| 389 | 3300006846 | Ga0075430_100484203 | Ga0075430_1004842032 | 160 |
| 390 | 3300006847 | Ga0075431_100007554 | Ga0075431_1000075544 | 160 |
| 391 | 3300006847 | Ga0075431_100062520 | Ga0075431_1000625204 | 160 |
| 392 | 3300006847 | Ga0075431_100122616 | Ga0075431_1001226163 | 160 |
| 393 | 3300006852 | Ga0075433_10070333 | Ga0075433_100703334 | 160 |
| 394 | 3300006852 | Ga0075433_10097309 | Ga0075433_100973092 | 160 |
| 395 | 3300006852 | Ga0075433_10364213 | Ga0075433_103642132 | 160 |
| 396 | 3300006852 | Ga0075433_10469237 | Ga0075433_104692372 | 160 |
| 397 | 3300006852 | Ga0075433_10506724 | Ga0075433_105067242 | 160 |
| 398 | 3300006852 | Ga0075433_10628635 | Ga0075433_106286351 | 160 |
| 399 | 3300006871 | Ga0075434_100235304 | Ga0075434_1002353043 | 160 |
| 400 | 3300006871 | Ga0075434_100259125 | Ga0075434_1002591252 | 160 |
| 401 | 3300006871 | Ga0075434_100342726 | Ga0075434_1003427262 | 160 |
| 402 | 3300006871 | Ga0075434_101744822 | Ga0075434_1017448221 | 160 |
| 403 | 3300006880 | Ga0075429_100001249 | Ga0075429_1000012495 | 160 |
| 404 | 3300006880 | Ga0075429_100132177 | Ga0075429_1001321772 | 160 |
| 405 | 3300006881 | Ga0068865_100014498 | Ga0068865_1000144988 | 160 |
| 406 | 3300006881 | Ga0068865_100210486 | Ga0068865_1002104862 | 160 |
| 407 | 3300006881 | Ga0068865_100902599 | Ga0068865_1009025992 | 160 |
| 408 | 3300006914 | Ga0075436_100681482 | Ga0075436_1006814822 | 160 |
| 409 | 3300006931 | Ga0097620_100018234 | Ga0097620_1000182342 | 160 |
| 410 | 3300006931 | Ga0097620_100027450 | Ga0097620_1000274506 | 160 |
| 411 | 3300006931 | Ga0097620_100029780 | Ga0097620_1000297808 | 160 |
| 412 | 3300006931 | Ga0097620_100044054 | Ga0097620_1000440543 | 160 |
| 413 | 3300006931 | Ga0097620_100119044 | Ga0097620_1001190444 | 160 |
| 414 | 3300006931 | Ga0097620_100143078 | Ga0097620_1001430782 | 160 |
| 415 | 3300006931 | Ga0097620_100265406 | Ga0097620_1002654063 | 160 |
| 416 | 3300006931 | Ga0097620_100599517 | Ga0097620_1005995172 | 160 |
| 417 | 3300006931 | Ga0097620_100844709 | Ga0097620_1008447092 | 160 |
| 418 | 3300006931 | Ga0097620_101226692 | Ga0097620_1012266922 | 160 |
| 419 | 3300006931 | Ga0097620_101274412 | Ga0097620_1012744122 | 160 |
| 420 | 3300007076 | Ga0075435_100391440 | Ga0075435_1003914402 | 160 |
| 421 | 3300007076 | Ga0075435_100561743 | Ga0075435_1005617432 | 160 |
| 422 | 3300007076 | Ga0075435_100561763 | Ga0075435_1005617632 | 160 |
| 423 | 3300007265 | Ga0099794_10067629 | Ga0099794_100676292 | 160 |
| 424 | 3300009036 | Ga0105244_10147439 | Ga0105244_101474392 | 160 |
| 425 | 3300009094 | Ga0111539_10075511 | Ga0111539_100755114 | 160 |
| 426 | 3300009094 | Ga0111539_10232272 | Ga0111539_102322722 | 160 |
| 427 | 3300009094 | Ga0111539_10293738 | Ga0111539_102937382 | 160 |
| 428 | 3300009094 | Ga0111539_10353417 | Ga0111539_103534172 | 160 |
| 429 | 3300009094 | Ga0111539_10817592 | Ga0111539_108175921 | 160 |
| 430 | 3300009094 | Ga0111539_11371738 | Ga0111539_113717382 | 160 |
| 431 | 3300009098 | Ga0105245_10031117 | Ga0105245_100311172 | 160 |
| 432 | 3300009098 | Ga0105245_10063641 | Ga0105245_100636412 | 160 |
| 433 | 3300009098 | Ga0105245_10352820 | Ga0105245_103528202 | 160 |
| 434 | 3300009098 | Ga0105245_10381765 | Ga0105245_103817652 | 160 |
| 435 | 3300009098 | Ga0105245_10477409 | Ga0105245_104774092 | 160 |
| 436 | 3300009098 | Ga0105245_10649630 | Ga0105245_106496302 | 160 |
| 437 | 3300009098 | Ga0105245_11365551 | Ga0105245_113655511 | 160 |
| 438 | 3300009101 | Ga0105247_10009818 | Ga0105247_100098182 | 160 |
| 439 | 3300009101 | Ga0105247_10235644 | Ga0105247_102356442 | 160 |
| 440 | 3300009147 | Ga0114129_10007594 | Ga0114129_1000759412 | 160 |
| 441 | 3300009147 | Ga0114129_10038987 | Ga0114129_100389874 | 160 |
| 442 | 3300009147 | Ga0114129_10179118 | Ga0114129_101791182 | 160 |
| 443 | 3300009147 | Ga0114129_10805977 | Ga0114129_108059772 | 160 |
| 444 | 3300009147 | Ga0114129_10986247 | Ga0114129_109862472 | 160 |
| 445 | 3300009147 | Ga0114129_11106653 | Ga0114129_111066532 | 160 |
| 446 | 3300009148 | Ga0105243_10010928 | Ga0105243_100109283 | 160 |
| 447 | 3300009148 | Ga0105243_10148592 | Ga0105243_101485922 | 160 |
| 448 | 3300009148 | Ga0105243_10269406 | Ga0105243_102694062 | 160 |
| 449 | 3300009148 | Ga0105243_10310641 | Ga0105243_103106412 | 160 |
| 450 | 3300009148 | Ga0105243_10430274 | Ga0105243_104302742 | 160 |
| 451 | 3300009148 | Ga0105243_10516587 | Ga0105243_105165872 | 160 |
| 452 | 3300009148 | Ga0105243_10585557 | Ga0105243_105855572 | 160 |
| 453 | 3300009148 | Ga0105243_11236442 | Ga0105243_112364422 | 160 |
| 454 | 3300009174 | Ga0105241_11167514 | Ga0105241_111675142 | 160 |
| 455 | 3300009174 | Ga0105241_12210451 | Ga0105241_122104511 | 160 |
| 456 | 3300009176 | Ga0105242_10000568 | Ga0105242_100005684 | 160 |
| 457 | 3300009176 | Ga0105242_10019555 | Ga0105242_100195554 | 160 |
| 458 | 3300009176 | Ga0105242_10067481 | Ga0105242_100674812 | 160 |
| 459 | 3300009176 | Ga0105242_10189508 | Ga0105242_101895082 | 160 |
| 460 | 3300009176 | Ga0105242_10372033 | Ga0105242_103720332 | 160 |
| 461 | 3300009176 | Ga0105242_10429748 | Ga0105242_104297482 | 160 |
| 462 | 3300009177 | Ga0105248_10022908 | Ga0105248_100229084 | 160 |
| 463 | 3300009177 | Ga0105248_10034839 | Ga0105248_100348395 | 160 |
| 464 | 3300009177 | Ga0105248_10045402 | Ga0105248_100454024 | 160 |
| 465 | 3300009177 | Ga0105248_11610904 | Ga0105248_116109042 | 160 |
| 466 | 3300009177 | Ga0105248_11809235 | Ga0105248_118092352 | 160 |
| 467 | 3300009545 | Ga0105237_10077461 | Ga0105237_100774614 | 160 |
| 468 | 3300009553 | Ga0105249_10042946 | Ga0105249_100429463 | 160 |
| 469 | 3300009553 | Ga0105249_10055161 | Ga0105249_100551612 | 160 |
| 470 | 3300009553 | Ga0105249_10357942 | Ga0105249_103579421 | 160 |
| 471 | 3300009553 | Ga0105249_10403971 | Ga0105249_104039712 | 160 |
| 472 | 3300009553 | Ga0105249_10477036 | Ga0105249_104770362 | 160 |
| 473 | 3300009553 | Ga0105249_10749924 | Ga0105249_107499242 | 160 |
| 474 | 3300009553 | Ga0105249_10853931 | Ga0105249_108539312 | 160 |
| 475 | 3300009553 | Ga0105249_11226629 | Ga0105249_112266291 | 160 |
| 476 | 3300009553 | Ga0105249_11263693 | Ga0105249_112636932 | 160 |
| 477 | 3300010159 | Ga0099796_10028001 | Ga0099796_100280012 | 160 |
| 478 | 3300010375 | Ga0105239_10019473 | Ga0105239_100194732 | 160 |
| 479 | 3300010375 | Ga0105239_10220103 | Ga0105239_102201032 | 160 |
| 480 | 3300010375 | Ga0105239_10755654 | Ga0105239_107556542 | 160 |
| 481 | 3300010375 | Ga0105239_10816159 | Ga0105239_108161592 | 160 |
| 482 | 3300011119 | Ga0105246_10023998 | Ga0105246_100239984 | 160 |
| 483 | 3300011119 | Ga0105246_11167382 | Ga0105246_111673821 | 160 |
| 484 | 3300012506 | Ga0157324_1005539 | Ga0157324_10055392 | 160 |
| 485 | 3300013100 | Ga0157373_10000777 | Ga0157373_1000077711 | 160 |
| 486 | 3300013102 | Ga0157371_10021903 | Ga0157371_100219035 | 160 |
| 487 | 3300013102 | Ga0157371_10146182 | Ga0157371_101461822 | 160 |
| 488 | 3300013102 | Ga0157371_10829294 | Ga0157371_108292941 | 160 |
| 489 | 3300013102 | Ga0157371_10914553 | Ga0157371_109145532 | 160 |
| 490 | 3300013105 | Ga0157369_10120606 | Ga0157369_101206063 | 160 |
| 491 | 3300013105 | Ga0157369_10151570 | Ga0157369_101515702 | 160 |
| 492 | 3300013105 | Ga0157369_10442618 | Ga0157369_104426182 | 160 |
| 493 | 3300013105 | Ga0157369_11425375 | Ga0157369_114253752 | 160 |
| 494 | 3300013296 | Ga0157374_10031839 | Ga0157374_100318394 | 160 |
| 495 | 3300013296 | Ga0157374_10031850 | Ga0157374_100318504 | 160 |
| 496 | 3300013296 | Ga0157374_10232468 | Ga0157374_102324682 | 160 |
| 497 | 3300013296 | Ga0157374_10248219 | Ga0157374_102482192 | 160 |
| 498 | 3300013297 | Ga0157378_10015919 | Ga0157378_100159198 | 160 |
| 499 | 3300013297 | Ga0157378_10030596 | Ga0157378_100305966 | 160 |
| 500 | 3300013297 | Ga0157378_10034657 | Ga0157378_100346574 | 160 |
| 501 | 3300013297 | Ga0157378_10281292 | Ga0157378_102812922 | 160 |
| 502 | 3300013297 | Ga0157378_10337207 | Ga0157378_103372072 | 160 |
| 503 | 3300013297 | Ga0157378_10650113 | Ga0157378_106501132 | 160 |
| 504 | 3300013297 | Ga0157378_10791165 | Ga0157378_107911652 | 160 |
| 505 | 3300013297 | Ga0157378_11520223 | Ga0157378_115202232 | 160 |
| 506 | 3300013306 | Ga0163162_10080829 | Ga0163162_100808292 | 160 |
| 507 | 3300013306 | Ga0163162_10114123 | Ga0163162_101141234 | 160 |
| 508 | 3300013306 | Ga0163162_10235849 | Ga0163162_102358491 | 160 |
| 509 | 3300013306 | Ga0163162_10335641 | Ga0163162_103356412 | 160 |
| 510 | 3300013306 | Ga0163162_10921298 | Ga0163162_109212982 | 160 |
| 511 | 3300013307 | Ga0157372_10000852 | Ga0157372_1000085221 | 160 |
| 512 | 3300013307 | Ga0157372_10225815 | Ga0157372_102258152 | 160 |
| 513 | 3300013307 | Ga0157372_11669910 | Ga0157372_116699101 | 160 |
| 514 | 3300013307 | Ga0157372_12254589 | Ga0157372_122545891 | 160 |
| 515 | 3300013308 | Ga0157375_10014053 | Ga0157375_100140538 | 160 |
| 516 | 3300013308 | Ga0157375_10052520 | Ga0157375_100525203 | 160 |
| 517 | 3300013308 | Ga0157375_10130292 | Ga0157375_101302922 | 160 |
| 518 | 3300013308 | Ga0157375_10983839 | Ga0157375_109838392 | 160 |
| 519 | 3300013308 | Ga0157375_11450011 | Ga0157375_114500111 | 160 |
| 520 | 3300013308 | Ga0157375_11734466 | Ga0157375_117344661 | 160 |
| 521 | 3300014325 | Ga0163163_10023951 | Ga0163163_100239513 | 160 |
| 522 | 3300014325 | Ga0163163_10620223 | Ga0163163_106202232 | 160 |
| 523 | 3300014325 | Ga0163163_10644346 | Ga0163163_106443462 | 160 |
| 524 | 3300014325 | Ga0163163_11694634 | Ga0163163_116946341 | 160 |
| 525 | 3300014325 | Ga0163163_12711951 | Ga0163163_127119511 | 160 |
| 526 | 3300014326 | Ga0157380_10040596 | Ga0157380_100405963 | 160 |
| 527 | 3300014326 | Ga0157380_10094023 | Ga0157380_100940232 | 160 |
| 528 | 3300014326 | Ga0157380_11096280 | Ga0157380_110962801 | 160 |
| 529 | 3300014326 | Ga0157380_11174751 | Ga0157380_111747512 | 160 |
| 530 | 3300014326 | Ga0157380_11392164 | Ga0157380_113921642 | 160 |
| 531 | 3300014968 | Ga0157379_10009926 | Ga0157379_100099264 | 160 |
| 532 | 3300014968 | Ga0157379_10012304 | Ga0157379_100123048 | 160 |
| 533 | 3300014969 | Ga0157376_10410029 | Ga0157376_104100292 | 160 |
| 534 | 3300017792 | Ga0163161_10008687 | Ga0163161_100086872 | 160 |
| 535 | 3300017792 | Ga0163161_10018498 | Ga0163161_100184984 | 160 |
| 536 | 3300017792 | Ga0163161_10390944 | Ga0163161_103909442 | 160 |
| 537 | 3300025315 | Ga0207697_10000241 | Ga0207697_100002414 | 160 |
| 538 | 3300025321 | Ga0207656_10118384 | Ga0207656_101183841 | 160 |
| 539 | 3300025728 | Ga0207655_1099185 | Ga0207655_10991851 | 160 |
| 540 | 3300025885 | Ga0207653_10120778 | Ga0207653_101207781 | 160 |
| 541 | 3300025893 | Ga0207682_10009064 | Ga0207682_100090644 | 160 |
| 542 | 3300025899 | Ga0207642_10007601 | Ga0207642_100076012 | 160 |
| 543 | 3300025899 | Ga0207642_10031542 | Ga0207642_100315423 | 160 |
| 544 | 3300025900 | Ga0207710_10015280 | Ga0207710_100152803 | 160 |
| 545 | 3300025901 | Ga0207688_10003121 | Ga0207688_1000312111 | 160 |
| 546 | 3300025901 | Ga0207688_10016163 | Ga0207688_100161634 | 160 |
| 547 | 3300025903 | Ga0207680_10012357 | Ga0207680_100123574 | 160 |
| 548 | 3300025903 | Ga0207680_10075604 | Ga0207680_100756042 | 160 |
| 549 | 3300025904 | Ga0207647_10076912 | Ga0207647_100769122 | 160 |
| 550 | 3300025904 | Ga0207647_10255734 | Ga0207647_102557341 | 160 |
| 551 | 3300025907 | Ga0207645_10010667 | Ga0207645_100106675 | 160 |
| 552 | 3300025907 | Ga0207645_10029673 | Ga0207645_100296733 | 160 |
| 553 | 3300025907 | Ga0207645_10104549 | Ga0207645_101045492 | 160 |
| 554 | 3300025907 | Ga0207645_10250292 | Ga0207645_102502922 | 160 |
| 555 | 3300025908 | Ga0207643_10003471 | Ga0207643_100034712 | 160 |
| 556 | 3300025908 | Ga0207643_10010768 | Ga0207643_100107686 | 160 |
| 557 | 3300025908 | Ga0207643_10153008 | Ga0207643_101530082 | 160 |
| 558 | 3300025910 | Ga0207684_10013079 | Ga0207684_100130796 | 160 |
| 559 | 3300025910 | Ga0207684_10104925 | Ga0207684_101049252 | 160 |
| 560 | 3300025912 | Ga0207707_10451478 | Ga0207707_104514782 | 160 |
| 561 | 3300025914 | Ga0207671_10071930 | Ga0207671_100719304 | 160 |
| 562 | 3300025915 | Ga0207693_10227356 | Ga0207693_102273562 | 160 |
| 563 | 3300025916 | Ga0207663_10018657 | Ga0207663_100186573 | 160 |
| 564 | 3300025917 | Ga0207660_10760133 | Ga0207660_107601332 | 160 |
| 565 | 3300025918 | Ga0207662_10003440 | Ga0207662_100034408 | 160 |
| 566 | 3300025918 | Ga0207662_10021711 | Ga0207662_100217112 | 160 |
| 567 | 3300025918 | Ga0207662_10148147 | Ga0207662_101481472 | 160 |
| 568 | 3300025919 | Ga0207657_10002844 | Ga0207657_1000284414 | 160 |
| 569 | 3300025919 | Ga0207657_10025055 | Ga0207657_100250553 | 160 |
| 570 | 3300025919 | Ga0207657_10127363 | Ga0207657_101273632 | 160 |
| 571 | 3300025920 | Ga0207649_10016438 | Ga0207649_100164382 | 160 |
| 572 | 3300025920 | Ga0207649_10037862 | Ga0207649_100378622 | 160 |
| 573 | 3300025920 | Ga0207649_10046789 | Ga0207649_100467892 | 160 |
| 574 | 3300025922 | Ga0207646_10015712 | Ga0207646_100157122 | 160 |
| 575 | 3300025922 | Ga0207646_10047615 | Ga0207646_100476151 | 160 |
| 576 | 3300025922 | Ga0207646_10761524 | Ga0207646_107615242 | 160 |
| 577 | 3300025922 | Ga0207646_10887180 | Ga0207646_108871802 | 160 |
| 578 | 3300025923 | Ga0207681_10086779 | Ga0207681_100867793 | 160 |
| 579 | 3300025923 | Ga0207681_10134459 | Ga0207681_101344592 | 160 |
| 580 | 3300025923 | Ga0207681_10212121 | Ga0207681_102121212 | 160 |
| 581 | 3300025925 | Ga0207650_10001318 | Ga0207650_1000131817 | 160 |
| 582 | 3300025925 | Ga0207650_10009995 | Ga0207650_100099952 | 160 |
| 583 | 3300025925 | Ga0207650_10022994 | Ga0207650_100229942 | 160 |
| 584 | 3300025925 | Ga0207650_10078058 | Ga0207650_100780584 | 160 |
| 585 | 3300025925 | Ga0207650_10281478 | Ga0207650_102814782 | 160 |
| 586 | 3300025926 | Ga0207659_10002890 | Ga0207659_100028904 | 160 |
| 587 | 3300025926 | Ga0207659_10056090 | Ga0207659_100560902 | 160 |
| 588 | 3300025926 | Ga0207659_10278749 | Ga0207659_102787492 | 160 |
| 589 | 3300025926 | Ga0207659_10443449 | Ga0207659_104434492 | 160 |
| 590 | 3300025927 | Ga0207687_10033199 | Ga0207687_100331993 | 160 |
| 591 | 3300025927 | Ga0207687_10319635 | Ga0207687_103196352 | 160 |
| 592 | 3300025928 | Ga0207700_10021540 | Ga0207700_100215403 | 160 |
| 593 | 3300025931 | Ga0207644_10012275 | Ga0207644_100122758 | 160 |
| 594 | 3300025931 | Ga0207644_10042016 | Ga0207644_100420162 | 160 |
| 595 | 3300025931 | Ga0207644_10046582 | Ga0207644_100465824 | 160 |
| 596 | 3300025931 | Ga0207644_10455581 | Ga0207644_104555812 | 160 |
| 597 | 3300025931 | Ga0207644_10466636 | Ga0207644_104666361 | 160 |
| 598 | 3300025931 | Ga0207644_10833555 | Ga0207644_108335551 | 160 |
| 599 | 3300025932 | Ga0207690_10000422 | Ga0207690_1000042220 | 160 |
| 600 | 3300025932 | Ga0207690_10019200 | Ga0207690_100192003 | 160 |
| 601 | 3300025932 | Ga0207690_10698156 | Ga0207690_106981561 | 160 |
| 602 | 3300025933 | Ga0207706_10000014 | Ga0207706_1000001417 | 160 |
| 603 | 3300025933 | Ga0207706_10018672 | Ga0207706_100186725 | 160 |
| 604 | 3300025933 | Ga0207706_10057573 | Ga0207706_100575732 | 160 |
| 605 | 3300025933 | Ga0207706_10108159 | Ga0207706_101081593 | 160 |
| 606 | 3300025933 | Ga0207706_10201838 | Ga0207706_102018382 | 160 |
| 607 | 3300025933 | Ga0207706_10228299 | Ga0207706_102282992 | 160 |
| 608 | 3300025933 | Ga0207706_10478795 | Ga0207706_104787952 | 160 |
| 609 | 3300025933 | Ga0207706_10810948 | Ga0207706_108109481 | 160 |
| 610 | 3300025934 | Ga0207686_10022390 | Ga0207686_100223904 | 160 |
| 611 | 3300025934 | Ga0207686_10133913 | Ga0207686_101339132 | 160 |
| 612 | 3300025934 | Ga0207686_10632129 | Ga0207686_106321292 | 160 |
| 613 | 3300025934 | Ga0207686_10713687 | Ga0207686_107136872 | 160 |
| 614 | 3300025934 | Ga0207686_11167315 | Ga0207686_111673152 | 160 |
| 615 | 3300025935 | Ga0207709_10011594 | Ga0207709_100115943 | 160 |
| 616 | 3300025935 | Ga0207709_10559390 | Ga0207709_105593902 | 160 |
| 617 | 3300025936 | Ga0207670_10004340 | Ga0207670_1000434010 | 160 |
| 618 | 3300025936 | Ga0207670_10190784 | Ga0207670_101907842 | 160 |
| 619 | 3300025936 | Ga0207670_10312115 | Ga0207670_103121152 | 160 |
| 620 | 3300025936 | Ga0207670_10349022 | Ga0207670_103490222 | 160 |
| 621 | 3300025936 | Ga0207670_10367049 | Ga0207670_103670492 | 160 |
| 622 | 3300025937 | Ga0207669_10068170 | Ga0207669_100681702 | 160 |
| 623 | 3300025937 | Ga0207669_10085458 | Ga0207669_100854582 | 160 |
| 624 | 3300025937 | Ga0207669_10280850 | Ga0207669_102808502 | 160 |
| 625 | 3300025937 | Ga0207669_10485132 | Ga0207669_104851322 | 160 |
| 626 | 3300025938 | Ga0207704_10092771 | Ga0207704_100927712 | 160 |
| 627 | 3300025938 | Ga0207704_10142197 | Ga0207704_101421972 | 160 |
| 628 | 3300025939 | Ga0207665_10030040 | Ga0207665_100300402 | 160 |
| 629 | 3300025939 | Ga0207665_10249352 | Ga0207665_102493522 | 160 |
| 630 | 3300025939 | Ga0207665_10733427 | Ga0207665_107334272 | 160 |
| 631 | 3300025940 | Ga0207691_10001791 | Ga0207691_100017917 | 160 |
| 632 | 3300025940 | Ga0207691_10008767 | Ga0207691_1000876711 | 160 |
| 633 | 3300025940 | Ga0207691_10015083 | Ga0207691_100150834 | 160 |
| 634 | 3300025940 | Ga0207691_10025235 | Ga0207691_100252355 | 160 |
| 635 | 3300025940 | Ga0207691_10078851 | Ga0207691_100788512 | 160 |
| 636 | 3300025940 | Ga0207691_10437769 | Ga0207691_104377692 | 160 |
| 637 | 3300025941 | Ga0207711_10005602 | Ga0207711_1000560210 | 160 |
| 638 | 3300025941 | Ga0207711_10044888 | Ga0207711_100448882 | 160 |
| 639 | 3300025941 | Ga0207711_10098361 | Ga0207711_100983612 | 160 |
| 640 | 3300025941 | Ga0207711_10131131 | Ga0207711_101311313 | 160 |
| 641 | 3300025941 | Ga0207711_10400993 | Ga0207711_104009932 | 160 |
| 642 | 3300025941 | Ga0207711_10636046 | Ga0207711_106360461 | 160 |
| 643 | 3300025941 | Ga0207711_10643782 | Ga0207711_106437822 | 160 |
| 644 | 3300025942 | Ga0207689_10001355 | Ga0207689_100013554 | 160 |
| 645 | 3300025942 | Ga0207689_10002469 | Ga0207689_1000246910 | 160 |
| 646 | 3300025942 | Ga0207689_10030920 | Ga0207689_100309202 | 160 |
| 647 | 3300025944 | Ga0207661_10029165 | Ga0207661_100291654 | 160 |
| 648 | 3300025944 | Ga0207661_10078036 | Ga0207661_100780363 | 160 |
| 649 | 3300025945 | Ga0207679_10013364 | Ga0207679_100133643 | 160 |
| 650 | 3300025945 | Ga0207679_10082701 | Ga0207679_100827012 | 160 |
| 651 | 3300025945 | Ga0207679_10089333 | Ga0207679_100893333 | 160 |
| 652 | 3300025945 | Ga0207679_10105567 | Ga0207679_101055673 | 160 |
| 653 | 3300025945 | Ga0207679_10251962 | Ga0207679_102519622 | 160 |
| 654 | 3300025949 | Ga0207667_10006720 | Ga0207667_100067202 | 160 |
| 655 | 3300025949 | Ga0207667_10652415 | Ga0207667_106524152 | 160 |
| 656 | 3300025949 | Ga0207667_10823036 | Ga0207667_108230361 | 160 |
| 657 | 3300025949 | Ga0207667_10969981 | Ga0207667_109699811 | 160 |
| 658 | 3300025960 | Ga0207651_10012974 | Ga0207651_100129744 | 160 |
| 659 | 3300025960 | Ga0207651_10043524 | Ga0207651_100435243 | 160 |
| 660 | 3300025960 | Ga0207651_10119984 | Ga0207651_101199842 | 160 |
| 661 | 3300025961 | Ga0207712_10032002 | Ga0207712_100320023 | 160 |
| 662 | 3300025961 | Ga0207712_10034073 | Ga0207712_100340733 | 160 |
| 663 | 3300025961 | Ga0207712_10368640 | Ga0207712_103686402 | 160 |
| 664 | 3300025961 | Ga0207712_10775586 | Ga0207712_107755862 | 160 |
| 665 | 3300025972 | Ga0207668_10004599 | Ga0207668_100045999 | 160 |
| 666 | 3300025972 | Ga0207668_10028780 | Ga0207668_100287803 | 160 |
| 667 | 3300025972 | Ga0207668_10038565 | Ga0207668_100385654 | 160 |
| 668 | 3300025972 | Ga0207668_10183904 | Ga0207668_101839042 | 160 |
| 669 | 3300025972 | Ga0207668_10216349 | Ga0207668_102163492 | 160 |
| 670 | 3300025972 | Ga0207668_10397628 | Ga0207668_103976282 | 160 |
| 671 | 3300025981 | Ga0207640_10078297 | Ga0207640_100782973 | 160 |
| 672 | 3300025986 | Ga0207658_10036497 | Ga0207658_100364973 | 160 |
| 673 | 3300025986 | Ga0207658_10077918 | Ga0207658_100779181 | 160 |
| 674 | 3300026023 | Ga0207677_10028439 | Ga0207677_100284392 | 160 |
| 675 | 3300026023 | Ga0207677_10499760 | Ga0207677_104997602 | 160 |
| 676 | 3300026023 | Ga0207677_10593832 | Ga0207677_105938321 | 160 |
| 677 | 3300026035 | Ga0207703_10023707 | Ga0207703_100237074 | 160 |
| 678 | 3300026035 | Ga0207703_10046670 | Ga0207703_100466702 | 160 |
| 679 | 3300026035 | Ga0207703_10051633 | Ga0207703_100516333 | 160 |
| 680 | 3300026035 | Ga0207703_10125680 | Ga0207703_101256802 | 160 |
| 681 | 3300026035 | Ga0207703_11041040 | Ga0207703_110410402 | 160 |
| 682 | 3300026041 | Ga0207639_10066575 | Ga0207639_100665752 | 160 |
| 683 | 3300026067 | Ga0207678_10002409 | Ga0207678_1000240920 | 160 |
| 684 | 3300026067 | Ga0207678_10037506 | Ga0207678_100375062 | 160 |
| 685 | 3300026067 | Ga0207678_10038603 | Ga0207678_100386033 | 160 |
| 686 | 3300026075 | Ga0207708_10029947 | Ga0207708_100299473 | 160 |
| 687 | 3300026075 | Ga0207708_10031440 | Ga0207708_100314403 | 160 |
| 688 | 3300026075 | Ga0207708_10105184 | Ga0207708_101051842 | 160 |
| 689 | 3300026075 | Ga0207708_10151294 | Ga0207708_101512942 | 160 |
| 690 | 3300026075 | Ga0207708_10601844 | Ga0207708_106018442 | 160 |
| 691 | 3300026078 | Ga0207702_10045825 | Ga0207702_100458253 | 160 |
| 692 | 3300026078 | Ga0207702_10096192 | Ga0207702_100961922 | 160 |
| 693 | 3300026078 | Ga0207702_10284966 | Ga0207702_102849662 | 160 |
| 694 | 3300026078 | Ga0207702_10836874 | Ga0207702_108368742 | 160 |
| 695 | 3300026088 | Ga0207641_10009600 | Ga0207641_100096008 | 160 |
| 696 | 3300026088 | Ga0207641_10046594 | Ga0207641_100465942 | 160 |
| 697 | 3300026088 | Ga0207641_10124352 | Ga0207641_101243522 | 160 |
| 698 | 3300026088 | Ga0207641_10173782 | Ga0207641_101737823 | 160 |
| 699 | 3300026088 | Ga0207641_10211681 | Ga0207641_102116812 | 160 |
| 700 | 3300026089 | Ga0207648_10066269 | Ga0207648_100662695 | 160 |
| 701 | 3300026089 | Ga0207648_10549127 | Ga0207648_105491272 | 160 |
| 702 | 3300026095 | Ga0207676_10029818 | Ga0207676_100298183 | 160 |
| 703 | 3300026095 | Ga0207676_10044164 | Ga0207676_100441641 | 160 |
| 704 | 3300026095 | Ga0207676_10054461 | Ga0207676_100544613 | 160 |
| 705 | 3300026095 | Ga0207676_10347619 | Ga0207676_103476192 | 160 |
| 706 | 3300026116 | Ga0207674_10007870 | Ga0207674_100078705 | 160 |
| 707 | 3300026116 | Ga0207674_10031295 | Ga0207674_100312952 | 160 |
| 708 | 3300026116 | Ga0207674_10601975 | Ga0207674_106019751 | 160 |
| 709 | 3300026118 | Ga0207675_100003797 | Ga0207675_10000379717 | 160 |
| 710 | 3300026118 | Ga0207675_100005624 | Ga0207675_10000562410 | 160 |
| 711 | 3300026118 | Ga0207675_100013865 | Ga0207675_10001386511 | 160 |
| 712 | 3300026118 | Ga0207675_101093436 | Ga0207675_1010934361 | 160 |
| 713 | 3300026121 | Ga0207683_10020959 | Ga0207683_100209594 | 160 |
| 714 | 3300026121 | Ga0207683_10048856 | Ga0207683_100488563 | 160 |
| 715 | 3300026121 | Ga0207683_10292508 | Ga0207683_102925082 | 160 |
| 716 | 3300026142 | Ga0207698_10104548 | Ga0207698_101045484 | 160 |
| 717 | 3300026142 | Ga0207698_10128498 | Ga0207698_101284982 | 160 |
| 718 | 3300026142 | Ga0207698_10134136 | Ga0207698_101341362 | 160 |
| 719 | 3300027671 | Ga0209588_1104444 | Ga0209588_11044442 | 160 |
| 720 | 3300027682 | Ga0209971_1005118 | Ga0209971_10051184 | 160 |
| 721 | 3300027907 | Ga0207428_10006862 | Ga0207428_100068624 | 160 |
| 722 | 3300028379 | Ga0268266_10057021 | Ga0268266_100570213 | 160 |
| 723 | 3300028379 | Ga0268266_10083385 | Ga0268266_100833852 | 160 |
| 724 | 3300028380 | Ga0268265_10018486 | Ga0268265_100184864 | 160 |
| 725 | 3300028380 | Ga0268265_10031527 | Ga0268265_100315274 | 160 |
| 726 | 3300028380 | Ga0268265_10099316 | Ga0268265_100993162 | 160 |
| 727 | 3300028380 | Ga0268265_10120568 | Ga0268265_101205682 | 160 |
| 728 | 3300028380 | Ga0268265_10276228 | Ga0268265_102762282 | 160 |
| 729 | 3300028380 | Ga0268265_10372507 | Ga0268265_103725072 | 160 |
| 730 | 3300028381 | Ga0268264_10028039 | Ga0268264_100280392 | 160 |
| 731 | 3300028381 | Ga0268264_10046400 | Ga0268264_100464003 | 160 |
| 732 | 3300028381 | Ga0268264_10102997 | Ga0268264_101029972 | 160 |
| 733 | 3300028381 | Ga0268264_10129806 | Ga0268264_101298061 | 160 |
| 734 | 3300028381 | Ga0268264_10153784 | Ga0268264_101537842 | 160 |
| 735 | 3300028381 | Ga0268264_10229182 | Ga0268264_102291822 | 160 |
| 736 | 3300031911 | Ga0307412_10290404 | Ga0307412_102904041 | 160 |
| 737 | 3300032002 | Ga0307416_100353038 | Ga0307416_1003530382 | 160 |
| 738 | 3300032002 | Ga0307416_100710268 | Ga0307416_1007102682 | 160 |
| 739 | 3300034816 | Ga0373930_0000969 | Ga0373930_0000969_1612_2094 | 160 |
| 740 | 3300034817 | Ga0373948_0003976 | Ga0373948_0003976_1581_2063 | 160 |
| 741 | 3300034818 | Ga0373950_0004481 | Ga0373950_0004481_1499_1981 | 160 |
| 742 | 3300034818 | Ga0373950_0025365 | Ga0373950_0025365_280_807 | 160 |
| 743 | 3300034819 | Ga0373958_0010777 | Ga0373958_0010777_563_1045 | 160 |
| 744 | 3300035083 | Ga0373926_0034021 | Ga0373926_0034021_105_587 | 160 |
| 745 | 3300035084 | Ga0373928_0004471 | Ga0373928_0004471_926_1408 | 160 |
| 746 | 3300035088 | Ga0373940_0000777 | Ga0373940_0000777_3485_3967 | 160 |
| 747 | 3300035090 | Ga0373949_0003420 | Ga0373949_0003420_1854_2336 | 160 |
| 748 | 3300035092 | Ga0373952_0002029 | Ga0373952_0002029_1491_1973 | 160 |
| 749 | 3300035112 | Ga0373932_0002149 | Ga0373932_0002149_3530_4012 | 160 |
| 750 | 3300035114 | Ga0373939_0001716 | Ga0373939_0001716_1150_1632 | 160 |
| 751 | 3300035114 | Ga0373939_0034212 | Ga0373939_0034212_680_1207 | 160 |
| 752 | 3300035115 | Ga0373941_0031559 | Ga0373941_0031559_282_764 | 160 |
| 753 | 3300035116 | Ga0373945_0033095 | Ga0373945_0033095_45_527 | 160 |
| 754 | 3300035119 | Ga0373956_0136367 | Ga0373956_0136367_119_667 | 160 |
| 755 | 3300035170 | Ga0373943_0007817 | Ga0373943_0007817_2618_3100 | 160 |
| 756 | 3300035170 | Ga0373943_0140182 | Ga0373943_0140182_266_793 | 160 |
| 757 | 3300035171 | Ga0373946_0012143 | Ga0373946_0012143_2122_2604 | 160 |
| 758 | 3300035171 | Ga0373946_0400638 | Ga0373946_0400638_30_512 | 160 |
| 759 | 3300035242 | Ga0373962_0002148 | Ga0373962_0002148_2786_3268 | 160 |
| 760 | 3300035691 | Ga0373931_0000252 | Ga0373931_0000252_20162_20644 | 160 |
| 761 | 3300035691 | Ga0373931_0965794 | Ga0373931_0965794_68_550 | 160 |
| 762 | 3300035692 | Ga0373935_0018563 | Ga0373935_0018563_2645_3127 | 160 |
| 763 | 3300035695 | Ga0373927_0019884 | Ga0373927_0019884_3523_4005 | 160 |
| 764 | 3300035695 | Ga0373927_0109375 | Ga0373927_0109375_426_953 | 160 |
| 765 | 3300035725 | Ga0373947_0162305 | Ga0373947_0162305_483_965 | 160 |
| 766 | 3300035725 | Ga0373947_0270947 | Ga0373947_0270947_261_788 | 160 |
| 767 | 3300035725 | Ga0373947_0562024 | Ga0373947_0562024_62_589 | 160 |
| 768 | 3300036401 | Ga0373937_0100352 | Ga0373937_0100352_1038_1565 | 160 |
| 769 | 3300036401 | Ga0373937_0173246 | Ga0373937_0173246_920_1402 | 160 |
| 770 | 3300037068 | Ga0373925_0037265 | Ga0373925_0037265_2420_2902 | 160 |
| 771 | 3300037068 | Ga0373925_0123636 | Ga0373925_0123636_65_592 | 160 |
| 772 | 3300037418 | Ga0395900_0379098 | Ga0395900_0379098_146_628 | 160 |
| 773 | 3300037466 | Ga0395898_0135055 | Ga0395898_0135055_148_630 | 160 |
| 774 | 3300037466 | Ga0395898_0497397 | Ga0395898_0497397_382_864 | 160 |
| 775 | 3300037466 | Ga0395898_1023672 | Ga0395898_1023672_243_725 | 160 |
| 776 | 3300038443 | Ga0395901_0352270 | Ga0395901_0352270_798_1280 | 160 |
| 777 | 3300042461 | Ga0439460_0125926 | Ga0439460_0125926_318_809 | 160 |
| 778 | 3300042876 | Ga0451577_0059863 | Ga0451577_0059863_2368_2853 | 160 |
| 779 | 3300042876 | Ga0451577_0518524 | Ga0451577_0518524_95_619 | 160 |
| 780 | 3300044712 | Ga0453684_1317033 | Ga0453684_1317033_12_494 | 160 |
| 781 | 3300045051 | Ga0451576_0001874 | Ga0451576_0001874_14390_14875 | 160 |
| 782 | 3300045051 | Ga0451576_0029355 | Ga0451576_0029355_3689_4171 | 160 |
| 783 | 3300045051 | Ga0451576_0354367 | Ga0451576_0354367_964_1446 | 160 |
| 784 | 3300045051 | Ga0451576_2305649 | Ga0451576_2305649_41_523 | 160 |
| 785 | 3300046452 | Ga0495617_007146 | Ga0495617_007146_2171_2653 | 160 |
| 786 | 3300046453 | Ga0495627_029326 | Ga0495627_029326_642_1124 | 160 |
| 787 | 3300046460 | Ga0495638_0189467 | Ga0495638_0189467_121_603 | 160 |
| 788 | 3300046461 | Ga0495641_0007792 | Ga0495641_0007792_1338_1820 | 160 |
| 789 | 3300046472 | Ga0495580_0029530 | Ga0495580_0029530_2332_2814 | 160 |
| 790 | 3300046474 | Ga0495605_0022593 | Ga0495605_0022593_2438_2920 | 160 |
| 791 | 3300046475 | Ga0495639_0008736 | Ga0495639_0008736_1709_2191 | 160 |
| 792 | 3300046491 | Ga0495584_0022072 | Ga0495584_0022072_1144_1626 | 160 |
| 793 | 3300046491 | Ga0495584_0115405 | Ga0495584_0115405_390_872 | 160 |
| 794 | 3300046491 | Ga0495584_0333569 | Ga0495584_0333569_266_748 | 160 |
| 795 | 3300046492 | Ga0495585_0040880 | Ga0495585_0040880_256_738 | 160 |
| 796 | 3300046500 | Ga0495596_0043015 | Ga0495596_0043015_623_1105 | 160 |
| 797 | 3300046501 | Ga0495607_0042179 | Ga0495607_0042179_597_1079 | 160 |
| 798 | 3300046513 | Ga0495616_0096061 | Ga0495616_0096061_171_653 | 160 |
| 799 | 3300046517 | Ga0495630_0118647 | Ga0495630_0118647_1221_1703 | 160 |
| 800 | 3300046518 | Ga0495631_0033286 | Ga0495631_0033286_361_843 | 160 |
| 801 | 3300046520 | Ga0495637_0016835 | Ga0495637_0016835_1238_1720 | 160 |
| 802 | 3300046523 | Ga0495644_0006521 | Ga0495644_0006521_2421_2903 | 160 |
| 803 | 3300046525 | Ga0495663_0025547 | Ga0495663_0025547_933_1415 | 160 |
| 804 | 3300046528 | Ga0495642_0366361 | Ga0495642_0366361_52_579 | 160 |
| 805 | 3300046530 | Ga0495654_0128448 | Ga0495654_0128448_165_647 | 160 |
| 806 | 3300046537 | Ga0495598_0003609 | Ga0495598_0003609_253_735 | 160 |
| 807 | 3300046539 | Ga0495621_0005773 | Ga0495621_0005773_364_846 | 160 |
| 808 | 3300046539 | Ga0495621_0113868 | Ga0495621_0113868_411_893 | 160 |
| 809 | 3300046558 | Ga0495633_0015892 | Ga0495633_0015892_1610_2092 | 160 |
| 810 | 3300046615 | Ga0495656_0008616 | Ga0495656_0008616_1068_1550 | 160 |
| 811 | 3300046642 | Ga0495634_0121091 | Ga0495634_0121091_644_1126 | 160 |
| 812 | 3300046648 | Ga0495611_0048255 | Ga0495611_0048255_1171_1653 | 160 |
| 813 | 3300046664 | Ga0495659_0006305 | Ga0495659_0006305_1419_1901 | 160 |
| 814 | 3300046665 | Ga0495661_0055083 | Ga0495661_0055083_1848_2330 | 160 |
| 815 | 3300046674 | Ga0495588_0212462 | Ga0495588_0212462_417_899 | 160 |
| 816 | 3300046683 | Ga0495658_0253005 | Ga0495658_0253005_169_651 | 160 |
| 817 | 3300046684 | Ga0495669_0011126 | Ga0495669_0011126_2084_2566 | 160 |
| 818 | 3300046690 | Ga0495624_0007311 | Ga0495624_0007311_4360_4842 | 160 |
| 819 | 3300046691 | Ga0495670_0012390 | Ga0495670_0012390_1298_1780 | 160 |
| 820 | 3300046691 | Ga0495670_0458367 | Ga0495670_0458367_189_671 | 160 |
| 821 | 3300046692 | Ga0495671_0019231 | Ga0495671_0019231_1518_2000 | 160 |
| 822 | 3300046694 | Ga0495649_0157747 | Ga0495649_0157747_56_538 | 160 |
| 823 | 3300046794 | Ga0495589_0014599 | Ga0495589_0014599_1711_2193 | 160 |
| 824 | 3300046810 | Ga0495660_0156692 | Ga0495660_0156692_186_668 | 160 |
| 825 | 3300047318 | Ga0495636_0126456 | Ga0495636_0126456_199_681 | 160 |
| 826 | 3300047320 | Ga0495672_0154397 | Ga0495672_0154397_50_532 | 160 |
| 827 | 3300047321 | Ga0495676_0012327 | Ga0495676_0012327_4177_4659 | 160 |
| 828 | 3300047445 | Ga0495677_0090822 | Ga0495677_0090822_145_627 | 160 |
| 829 | 3300047446 | Ga0495679_017138 | Ga0495679_017138_1067_1549 | 160 |
| 830 | 3300047470 | Ga0495681_0039442 | Ga0495681_0039442_1395_1877 | 160 |
| 831 | 3300047472 | Ga0495686_0309787 | Ga0495686_0309787_203_685 | 160 |
| 832 | 3300048090 | Ga0495615_0050250 | Ga0495615_0050250_120_602 | 160 |
| 833 | 3300048091 | Ga0495626_0110144 | Ga0495626_0110144_145_627 | 160 |
| 834 | 3300048903 | Ga0496100_0008018 | Ga0496100_0008018_4008_4535 | 160 |
| 835 | 3300048904 | Ga0496101_0043209 | Ga0496101_0043209_2401_2928 | 160 |
| 836 | 3300048904 | Ga0496101_0088272 | Ga0496101_0088272_534_1061 | 160 |
| 837 | 3300048904 | Ga0496101_0129028 | Ga0496101_0129028_1303_1785 | 160 |
| 838 | 3300048905 | Ga0496102_0081656 | Ga0496102_0081656_113_640 | 160 |
| 839 | 3300048905 | Ga0496102_0119340 | Ga0496102_0119340_1260_1787 | 160 |
| 840 | 3300048905 | Ga0496102_0364720 | Ga0496102_0364720_81_563 | 160 |
| 841 | 3300048905 | Ga0496102_0594091 | Ga0496102_0594091_399_923 | 160 |
| 842 | 3300048905 | Ga0496102_1177639 | Ga0496102_1177639_30_557 | 160 |
| 843 | 3300048906 | Ga0496103_0007794 | Ga0496103_0007794_1436_1918 | 160 |
| 844 | 3300048906 | Ga0496103_0061716 | Ga0496103_0061716_734_1261 | 160 |
| 845 | 3300048906 | Ga0496103_0078809 | Ga0496103_0078809_1501_2028 | 160 |
| 846 | 3300048906 | Ga0496103_0489675 | Ga0496103_0489675_119_646 | 160 |
| 847 | 3300048908 | Ga0496105_0034883 | Ga0496105_0034883_2198_2680 | 160 |
| 848 | 3300048909 | Ga0496106_0002288 | Ga0496106_0002288_2261_2788 | 160 |
| 849 | 3300048909 | Ga0496106_0043948 | Ga0496106_0043948_908_1432 | 160 |
| 850 | 3300048909 | Ga0496106_0070437 | Ga0496106_0070437_1927_2409 | 160 |
| 851 | 3300048909 | Ga0496106_0089845 | Ga0496106_0089845_1406_1933 | 160 |
| 852 | 3300048910 | Ga0496107_0007023 | Ga0496107_0007023_5372_5899 | 160 |
| 853 | 3300048910 | Ga0496107_0086240 | Ga0496107_0086240_262_744 | 160 |
| 854 | 3300048910 | Ga0496107_0125164 | Ga0496107_0125164_1318_1845 | 160 |
| 855 | 3300048910 | Ga0496107_0254090 | Ga0496107_0254090_237_764 | 160 |
| 856 | 3300048910 | Ga0496107_0333309 | Ga0496107_0333309_274_801 | 160 |
| 857 | 3300048911 | Ga0496108_0001781 | Ga0496108_0001781_14224_14751 | 160 |
| 858 | 3300048911 | Ga0496108_0033453 | Ga0496108_0033453_1681_2163 | 160 |
| 859 | 3300048911 | Ga0496108_0160748 | Ga0496108_0160748_800_1327 | 160 |
| 860 | 3300048912 | Ga0496109_0012801 | Ga0496109_0012801_559_1086 | 160 |
| 861 | 3300048912 | Ga0496109_0396933 | Ga0496109_0396933_17_544 | 160 |
| 862 | 3300048913 | Ga0496110_0030304 | Ga0496110_0030304_1933_2415 | 160 |
| 863 | 3300048913 | Ga0496110_0115280 | Ga0496110_0115280_1333_1860 | 160 |
| 864 | 3300048913 | Ga0496110_0534304 | Ga0496110_0534304_286_768 | 160 |
| 865 | 3300048913 | Ga0496110_0623708 | Ga0496110_0623708_15_539 | 160 |
| 866 | 3300048913 | Ga0496110_0899450 | Ga0496110_0899450_91_573 | 160 |
| 867 | 3300048913 | Ga0496110_0914738 | Ga0496110_0914738_121_603 | 160 |
| 868 | 3300048914 | Ga0496111_0007385 | Ga0496111_0007385_1555_2037 | 160 |
| 869 | 3300048914 | Ga0496111_0093896 | Ga0496111_0093896_896_1423 | 160 |
| 870 | 3300048915 | Ga0496112_0649363 | Ga0496112_0649363_460_942 | 160 |
| 871 | 3300048916 | Ga0496113_0467104 | Ga0496113_0467104_428_955 | 160 |
| 872 | 3300048916 | Ga0496113_0953590 | Ga0496113_0953590_59_586 | 160 |
| 873 | 3300048917 | Ga0496114_0004981 | Ga0496114_0004981_7834_8316 | 160 |
| 874 | 3300048917 | Ga0496114_0390371 | Ga0496114_0390371_558_1085 | 160 |
| 875 | 3300048918 | Ga0496115_0003424 | Ga0496115_0003424_3883_4365 | 160 |
| 876 | 3300049522 | Ga0501299_163270 | Ga0501299_163270_58_540 | 160 |
| 877 | 3300049585 | Ga0501069_0152552 | Ga0501069_0152552_67_609 | 160 |
| 878 | 3300049586 | Ga0501070_0113151 | Ga0501070_0113151_95_637 | 160 |
| 879 | 3300049589 | Ga0501073_0336758 | Ga0501073_0336758_106_588 | 160 |
| 880 | 3300049679 | Ga0501249_164221 | Ga0501249_164221_11_493 | 160 |
| 881 | 3300049742 | Ga0501080_0282431 | Ga0501080_0282431_947_1489 | 160 |
| 882 | 3300049744 | Ga0501083_0023476 | Ga0501083_0023476_1342_1884 | 160 |
| 883 | 3300050491 | nmdc:mga00v17_22927_c1 | nmdc:mga00v17_22927_c1_790_1272 | 160 |
| 884 | 3300050492 | nmdc:mga0yw44_188395_c1 | nmdc:mga0yw44_188395_c1_606_1088 | 160 |
| 885 | 3300050492 | nmdc:mga0yw44_91804_c1 | nmdc:mga0yw44_91804_c1_539_1021 | 160 |
| 886 | 3300050493 | nmdc:mga0k408_324023_c1 | nmdc:mga0k408_324023_c1_251_748 | 160 |
| 887 | 3300050507 | nmdc:mga05p37_1652_c1 | nmdc:mga05p37_1652_c1_13717_14199 | 160 |
| 888 | 3300050507 | nmdc:mga05p37_35745_c1 | nmdc:mga05p37_35745_c1_3567_4049 | 160 |
| 889 | 3300050507 | nmdc:mga05p37_86744_c1 | nmdc:mga05p37_86744_c1_324_806 | 160 |
| 890 | 3300050507 | nmdc:mga05p37_985858_c1 | nmdc:mga05p37_985858_c1_125_607 | 160 |
| 891 | 3300050508 | nmdc:mga09592_183221_c1 | nmdc:mga09592_183221_c1_428_910 | 160 |
| 892 | 3300050508 | nmdc:mga09592_32067_c1 | nmdc:mga09592_32067_c1_3096_3578 | 160 |
| 893 | 3300050508 | nmdc:mga09592_5035_c1 | nmdc:mga09592_5035_c1_3742_4224 | 160 |
| 894 | 3300050509 | nmdc:mga0qj67_137040_c1 | nmdc:mga0qj67_137040_c1_1118_1600 | 160 |
| 895 | 3300050509 | nmdc:mga0qj67_31116_c1 | nmdc:mga0qj67_31116_c1_3152_3634 | 160 |
| 896 | 3300050510 | nmdc:mga06r32_103867_c1 | nmdc:mga06r32_103867_c1_1232_1714 | 160 |
| 897 | 3300050510 | nmdc:mga06r32_163560_c1 | nmdc:mga06r32_163560_c1_300_782 | 160 |
| 898 | 3300050510 | nmdc:mga06r32_47586_c1 | nmdc:mga06r32_47586_c1_1341_1823 | 160 |
| 899 | 3300050511 | nmdc:mga08y16_135212_c1 | nmdc:mga08y16_135212_c1_1444_1971 | 160 |
| 900 | 3300050511 | nmdc:mga08y16_209149_c1 | nmdc:mga08y16_209149_c1_1529_2011 | 160 |
| 901 | 3300050511 | nmdc:mga08y16_269622_c2 | nmdc:mga08y16_269622_c2_231_776 | 160 |
| 902 | 3300050511 | nmdc:mga08y16_29453_c1 | nmdc:mga08y16_29453_c1_4790_5272 | 160 |
| 903 | 3300050511 | nmdc:mga08y16_343026_c1 | nmdc:mga08y16_343026_c1_421_948 | 160 |
| 904 | 3300050511 | nmdc:mga08y16_355235_c1 | nmdc:mga08y16_355235_c1_455_937 | 160 |
| 905 | 3300050511 | nmdc:mga08y16_53126_c1 | nmdc:mga08y16_53126_c1_2773_3300 | 160 |
| 906 | 3300050511 | nmdc:mga08y16_63895_c1 | nmdc:mga08y16_63895_c1_1510_1992 | 160 |
| 907 | 3300050512 | nmdc:mga0n895_1319762_c1 | nmdc:mga0n895_1319762_c1_180_662 | 160 |
| 908 | 3300050512 | nmdc:mga0n895_1778071_c1 | nmdc:mga0n895_1778071_c1_34_516 | 160 |
| 909 | 3300050512 | nmdc:mga0n895_214018_c1 | nmdc:mga0n895_214018_c1_1339_1821 | 160 |
| 910 | 3300050512 | nmdc:mga0n895_218874_c1 | nmdc:mga0n895_218874_c1_370_894 | 160 |
| 911 | 3300050512 | nmdc:mga0n895_247163_c1 | nmdc:mga0n895_247163_c1_936_1418 | 160 |
| 912 | 3300050512 | nmdc:mga0n895_347152_c1 | nmdc:mga0n895_347152_c1_536_1063 | 160 |
| 913 | 3300050512 | nmdc:mga0n895_977418_c1 | nmdc:mga0n895_977418_c1_48_530 | 160 |
| 914 | 3300050513 | nmdc:mga0rr50_139090_c1 | nmdc:mga0rr50_139090_c1_1454_1936 | 160 |
| 915 | 3300050513 | nmdc:mga0rr50_311577_c1 | nmdc:mga0rr50_311577_c1_422_952 | 160 |
| 916 | 3300050513 | nmdc:mga0rr50_538502_c1 | nmdc:mga0rr50_538502_c1_356_838 | 160 |
| 917 | 3300050513 | nmdc:mga0rr50_925135_c1 | nmdc:mga0rr50_925135_c1_140_667 | 160 |
| 918 | 3300050514 | nmdc:mga08x19_124615_c1 | nmdc:mga08x19_124615_c1_13_495 | 160 |
| 919 | 3300050514 | nmdc:mga08x19_22737_c1 | nmdc:mga08x19_22737_c1_2007_2489 | 160 |
| 920 | 3300050514 | nmdc:mga08x19_502964_c1 | nmdc:mga08x19_502964_c1_269_799 | 160 |
| 921 | 3300050515 | nmdc:mga0a205_141771_c1 | nmdc:mga0a205_141771_c1_477_959 | 160 |
| 922 | 3300050515 | nmdc:mga0a205_181007_c1 | nmdc:mga0a205_181007_c1_72_554 | 160 |
| 923 | 3300050515 | nmdc:mga0a205_470887_c1 | nmdc:mga0a205_470887_c1_398_880 | 160 |
| 924 | 3300050515 | nmdc:mga0a205_614228_c1 | nmdc:mga0a205_614228_c1_235_717 | 160 |
| 925 | 3300053083 | Ga0495655_0001127 | Ga0495655_0001127_2584_3066 | 160 |
| 926 | 3300053085 | Ga0495619_0158424 | Ga0495619_0158424_602_1129 | 160 |
| 927 | 3300060353 | Ga0501082_0133550 | Ga0501082_0133550_537_1079 | 160 |
| 928 | 3300060353 | Ga0501082_0288553 | Ga0501082_0288553_659_1141 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.8171 | 3 | 151 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.7895 | 10 | 156 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7796 | 3 | 151 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.72 | 10 | 156 |
| 1jch-assembly1.cif.gz_A | crystal structure of colicin e3 in complex with its immunity protein | 0.5404 | 47 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7647 | 26 | 151 | 1.20.120.550 |
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7341 | 26 | 151 | 1.20.120.550 |
| af_I1KUX3_1129_1225_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.5745 | 82 | 156 | 1.20.1270.60 |
| af_I1LP17_5_226_1.20.1420.10 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain | 0.558 | 44 | 158 | 1.20.1420.10 |
| 2xndN00 | Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C | 0.5519 | 80 | 148 | 1.20.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536UKF0-F1-model_v4 | TRAP transporter small permease protein | 0.933 | 55 | 156 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A1G6VJW4-F1-model_v4 | TRAP transporter small permease protein | 0.9073 | 2 | 156 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A4Q4CXK4-F1-model_v4 | TRAP transporter small permease protein | 0.9038 | 2 | 156 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A1W2DDH7-F1-model_v4 | TRAP transporter small permease protein | 0.9015 | 1 | 156 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A7W1AM24-F1-model_v4 | TRAP transporter small permease protein | 0.9005 | 49 | 160 |
GO:0005886
GO:0015740 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar