F486010
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 930 | 223 | 1860 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10240107|Ga0070658_102401072 |
| Length | 184 |
| Sequence | MIGLGEAGAIPMSDVLLFERAAPSFAASLARRGHHIVYRANESNHCPGCGRSHWYIGRISAECGFCGTAVPLAETSVVEAAPHSSRPKASVTSADQRRFPRMPAKGRKLQLLIDGSPASFALQDISEGGVRGKTAPELVPGAKVHVRFEGGILVPAVVKWAEKGLVGLAFIDPIILDRSAQRQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 180 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 220 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 223 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.32 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 4.52 |
| Rhizosphere | 94.73 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 14.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10240107 | 3300005327 | Bacteria | 1536 |
| 2 | JGI24740J21852_10001126 | 3300001979 | Bacteria | 12102 |
| 3 | JGI24740J21852_10004688 | 3300001979 | Bacteria | 5857 |
| 4 | JGI24739J22299_10141477 | 3300001989 | Bacteria | 713 |
| 5 | JGI24737J22298_10003380 | 3300001990 | Bacteria | 5642 |
| 6 | JGI24735J21928_10010414 | 3300002067 | Bacteria | 2965 |
| 7 | JGI24735J21928_10017009 | 3300002067 | Bacteria | 2251 |
| 8 | JGI24034J26672_10053221 | 3300002239 | Bacteria | 699 |
| 9 | rootL2_10267806 | 3300003322 | Unclassified | 1031 |
| 10 | rootH1_10278953 | 3300003323 | Bacteria | 1737 |
| 11 | Ga0070658_10009104 | 3300005327 | Bacteria | 7985 |
| 12 | Ga0070658_10012256 | 3300005327 | Bacteria | 6882 |
| 13 | Ga0070658_10018898 | 3300005327 | Bacteria | 5521 |
| 14 | Ga0070658_10050982 | 3300005327 | Bacteria | 3354 |
| 15 | Ga0070658_10126304 | 3300005327 | Bacteria | 2129 |
| 16 | Ga0070658_10137343 | 3300005327 | Bacteria | 2041 |
| 17 | Ga0070658_10144517 | 3300005327 | Unclassified | 1988 |
| 18 | Ga0070658_10189803 | 3300005327 | Bacteria | 1732 |
| 19 | Ga0070658_10214334 | 3300005327 | Bacteria | 1627 |
| 20 | Ga0070658_10292776 | 3300005327 | Bacteria | 1387 |
| 21 | Ga0070658_10318734 | 3300005327 | Bacteria | 1327 |
| 22 | Ga0070658_10669328 | 3300005327 | Bacteria | 901 |
| 23 | Ga0070676_10168981 | 3300005328 | Bacteria | 1413 |
| 24 | Ga0070676_10181160 | 3300005328 | Bacteria | 1370 |
| 25 | Ga0070676_10268988 | 3300005328 | Bacteria | 1144 |
| 26 | Ga0070676_10553910 | 3300005328 | Bacteria | 823 |
| 27 | Ga0070683_100024323 | 3300005329 | Bacteria | 5424 |
| 28 | Ga0070683_100156382 | 3300005329 | Bacteria | 2162 |
| 29 | Ga0070683_100222484 | 3300005329 | Unclassified | 1794 |
| 30 | Ga0070683_100384525 | 3300005329 | Bacteria | 1337 |
| 31 | Ga0070683_100542599 | 3300005329 | Bacteria | 1112 |
| 32 | Ga0070683_100583260 | 3300005329 | Bacteria | 1069 |
| 33 | Ga0070670_100067994 | 3300005331 | Bacteria | 3057 |
| 34 | Ga0070670_100099710 | 3300005331 | Bacteria | 2499 |
| 35 | Ga0070670_100162474 | 3300005331 | Bacteria | 1936 |
| 36 | Ga0070670_100929619 | 3300005331 | Bacteria | 789 |
| 37 | Ga0070670_100996201 | 3300005331 | Bacteria | 762 |
| 38 | Ga0068869_100315233 | 3300005334 | Unclassified | 1267 |
| 39 | Ga0070666_10020324 | 3300005335 | Bacteria | 4291 |
| 40 | Ga0070666_10021333 | 3300005335 | Bacteria | 4198 |
| 41 | Ga0070666_10021757 | 3300005335 | Bacteria | 4156 |
| 42 | Ga0070666_10060975 | 3300005335 | Bacteria | 2553 |
| 43 | Ga0070666_10173313 | 3300005335 | Bacteria | 1511 |
| 44 | Ga0070680_100059955 | 3300005336 | Bacteria | 3114 |
| 45 | Ga0070680_100080167 | 3300005336 | Bacteria | 2692 |
| 46 | Ga0070680_100210135 | 3300005336 | Bacteria | 1642 |
| 47 | Ga0070680_100375654 | 3300005336 | Bacteria | 1210 |
| 48 | Ga0070682_100013855 | 3300005337 | Bacteria | 4649 |
| 49 | Ga0070682_100229221 | 3300005337 | Bacteria | 1327 |
| 50 | Ga0070682_101026883 | 3300005337 | Unclassified | 686 |
| 51 | Ga0070682_101605724 | 3300005337 | Bacteria | 562 |
| 52 | Ga0068868_100033262 | 3300005338 | Bacteria | 3973 |
| 53 | Ga0068868_100051631 | 3300005338 | Bacteria | 3236 |
| 54 | Ga0068868_100078620 | 3300005338 | Bacteria | 2641 |
| 55 | Ga0068868_100129706 | 3300005338 | Bacteria | 2062 |
| 56 | Ga0068868_100308483 | 3300005338 | Bacteria | 1346 |
| 57 | Ga0068868_101100384 | 3300005338 | Bacteria | 731 |
| 58 | Ga0070660_100003053 | 3300005339 | Bacteria | 11523 |
| 59 | Ga0070660_100008261 | 3300005339 | Bacteria | 7275 |
| 60 | Ga0070660_100031936 | 3300005339 | Bacteria | 3959 |
| 61 | Ga0070660_100032328 | 3300005339 | Bacteria | 3936 |
| 62 | Ga0070660_100057071 | 3300005339 | Bacteria | 3023 |
| 63 | Ga0070660_100114235 | 3300005339 | Bacteria | 2151 |
| 64 | Ga0070660_100117222 | 3300005339 | Bacteria | 2124 |
| 65 | Ga0070660_100128950 | 3300005339 | Bacteria | 2023 |
| 66 | Ga0070660_100306813 | 3300005339 | Bacteria | 1302 |
| 67 | Ga0070660_100329855 | 3300005339 | Unclassified | 1254 |
| 68 | Ga0070660_100447868 | 3300005339 | Bacteria | 1071 |
| 69 | Ga0070660_100670327 | 3300005339 | Bacteria | 869 |
| 70 | Ga0070660_100713793 | 3300005339 | Bacteria | 841 |
| 71 | Ga0070689_101016397 | 3300005340 | Unclassified | 738 |
| 72 | Ga0070691_10003582 | 3300005341 | Bacteria | 7010 |
| 73 | Ga0070661_100026533 | 3300005344 | Bacteria | 4167 |
| 74 | Ga0070661_100056051 | 3300005344 | Bacteria | 2886 |
| 75 | Ga0070661_100099815 | 3300005344 | Unclassified | 2158 |
| 76 | Ga0070661_100108040 | 3300005344 | Bacteria | 2075 |
| 77 | Ga0070661_100126363 | 3300005344 | Bacteria | 1918 |
| 78 | Ga0070661_100133516 | 3300005344 | Bacteria | 1866 |
| 79 | Ga0070661_100259356 | 3300005344 | Unclassified | 1343 |
| 80 | Ga0070661_100317045 | 3300005344 | Bacteria | 1217 |
| 81 | Ga0070661_100474986 | 3300005344 | Bacteria | 998 |
| 82 | Ga0070661_100485528 | 3300005344 | Bacteria | 987 |
| 83 | Ga0070661_100598029 | 3300005344 | Bacteria | 891 |
| 84 | Ga0070661_101188688 | 3300005344 | Unclassified | 637 |
| 85 | Ga0070692_10006534 | 3300005345 | Bacteria | 5069 |
| 86 | Ga0070675_100049667 | 3300005354 | Bacteria | 3443 |
| 87 | Ga0070675_100257690 | 3300005354 | Bacteria | 1528 |
| 88 | Ga0070675_100593569 | 3300005354 | Bacteria | 1004 |
| 89 | Ga0070671_100002090 | 3300005355 | Bacteria | 15383 |
| 90 | Ga0070671_100015766 | 3300005355 | Bacteria | 6106 |
| 91 | Ga0070671_100024750 | 3300005355 | Bacteria | 4917 |
| 92 | Ga0070671_100028475 | 3300005355 | Bacteria | 4600 |
| 93 | Ga0070671_100056433 | 3300005355 | Bacteria | 3267 |
| 94 | Ga0070671_100059294 | 3300005355 | Unclassified | 3185 |
| 95 | Ga0070671_100126174 | 3300005355 | Bacteria | 2154 |
| 96 | Ga0070671_100302705 | 3300005355 | Bacteria | 1361 |
| 97 | Ga0070671_100441765 | 3300005355 | Unclassified | 1115 |
| 98 | Ga0070674_100018560 | 3300005356 | Bacteria | 4401 |
| 99 | Ga0070674_100028383 | 3300005356 | Bacteria | 3675 |
| 100 | Ga0070674_100751110 | 3300005356 | Bacteria | 838 |
| 101 | Ga0070673_100030023 | 3300005364 | Bacteria | 4062 |
| 102 | Ga0070673_100039241 | 3300005364 | Bacteria | 3622 |
| 103 | Ga0070673_100039882 | 3300005364 | Bacteria | 3598 |
| 104 | Ga0070673_100324412 | 3300005364 | Unclassified | 1361 |
| 105 | Ga0070659_100004452 | 3300005366 | Bacteria | 10009 |
| 106 | Ga0070659_100009360 | 3300005366 | Bacteria | 7195 |
| 107 | Ga0070659_100041705 | 3300005366 | Bacteria | 3588 |
| 108 | Ga0070659_100050354 | 3300005366 | Bacteria | 3274 |
| 109 | Ga0070659_100086992 | 3300005366 | Bacteria | 2502 |
| 110 | Ga0070659_100095748 | 3300005366 | Bacteria | 2384 |
| 111 | Ga0070659_100160934 | 3300005366 | Bacteria | 1835 |
| 112 | Ga0070659_100202607 | 3300005366 | Bacteria | 1634 |
| 113 | Ga0070659_100297472 | 3300005366 | Unclassified | 1345 |
| 114 | Ga0070659_100341327 | 3300005366 | Bacteria | 1255 |
| 115 | Ga0070659_100381757 | 3300005366 | Bacteria | 1187 |
| 116 | Ga0070659_100730976 | 3300005366 | Unclassified | 857 |
| 117 | Ga0070659_100885051 | 3300005366 | Bacteria | 780 |
| 118 | Ga0070659_101235960 | 3300005366 | Unclassified | 661 |
| 119 | Ga0070659_101331368 | 3300005366 | Unclassified | 637 |
| 120 | Ga0070667_100010677 | 3300005367 | Bacteria | 7587 |
| 121 | Ga0070667_100027546 | 3300005367 | Bacteria | 4728 |
| 122 | Ga0070667_100029232 | 3300005367 | Bacteria | 4591 |
| 123 | Ga0070667_100034693 | 3300005367 | Bacteria | 4223 |
| 124 | Ga0070709_10182391 | 3300005434 | Bacteria | 1475 |
| 125 | Ga0070714_100024648 | 3300005435 | Bacteria | 4957 |
| 126 | Ga0070714_100051350 | 3300005435 | Bacteria | 3514 |
| 127 | Ga0070714_100077427 | 3300005435 | Bacteria | 2889 |
| 128 | Ga0070714_100083682 | 3300005435 | Bacteria | 2783 |
| 129 | Ga0070714_100118908 | 3300005435 | Bacteria | 2348 |
| 130 | Ga0070714_100124451 | 3300005435 | Bacteria | 2297 |
| 131 | Ga0070714_100377650 | 3300005435 | Bacteria | 1336 |
| 132 | Ga0070714_100515657 | 3300005435 | Bacteria | 1141 |
| 133 | Ga0070713_100037787 | 3300005436 | Bacteria | 3905 |
| 134 | Ga0070713_100060401 | 3300005436 | Bacteria | 3168 |
| 135 | Ga0070713_100149553 | 3300005436 | Bacteria | 2076 |
| 136 | Ga0070713_100283377 | 3300005436 | Bacteria | 1521 |
| 137 | Ga0070710_10654621 | 3300005437 | Bacteria | 737 |
| 138 | Ga0070701_10056286 | 3300005438 | Bacteria | 2057 |
| 139 | Ga0070663_100081089 | 3300005455 | Bacteria | 2384 |
| 140 | Ga0070663_100082406 | 3300005455 | Bacteria | 2366 |
| 141 | Ga0070663_100111579 | 3300005455 | Bacteria | 2055 |
| 142 | Ga0070663_100117144 | 3300005455 | Unclassified | 2008 |
| 143 | Ga0070663_100126678 | 3300005455 | Bacteria | 1935 |
| 144 | Ga0070663_100211025 | 3300005455 | Unclassified | 1520 |
| 145 | Ga0070663_100215665 | 3300005455 | Bacteria | 1505 |
| 146 | Ga0070678_100031044 | 3300005456 | Bacteria | 3680 |
| 147 | Ga0070678_100393715 | 3300005456 | Unclassified | 1202 |
| 148 | Ga0070662_100009880 | 3300005457 | Bacteria | 6251 |
| 149 | Ga0070662_100109917 | 3300005457 | Bacteria | 2098 |
| 150 | Ga0070662_100122792 | 3300005457 | Bacteria | 1992 |
| 151 | Ga0070662_100192805 | 3300005457 | Unclassified | 1613 |
| 152 | Ga0070662_100244743 | 3300005457 | Bacteria | 1439 |
| 153 | Ga0070662_100432791 | 3300005457 | Bacteria | 1090 |
| 154 | Ga0070662_100543652 | 3300005457 | Bacteria | 973 |
| 155 | Ga0070681_10226833 | 3300005458 | Bacteria | 1783 |
| 156 | Ga0070681_10242084 | 3300005458 | Unclassified | 1717 |
| 157 | Ga0070681_10313255 | 3300005458 | Bacteria | 1479 |
| 158 | Ga0070681_10356957 | 3300005458 | Bacteria | 1372 |
| 159 | Ga0068867_100107486 | 3300005459 | Bacteria | 2138 |
| 160 | Ga0068867_100296207 | 3300005459 | Bacteria | 1332 |
| 161 | Ga0068867_100549656 | 3300005459 | Bacteria | 1000 |
| 162 | Ga0068867_100758623 | 3300005459 | Bacteria | 862 |
| 163 | Ga0070679_100038807 | 3300005530 | Bacteria | 4735 |
| 164 | Ga0070679_100044440 | 3300005530 | Bacteria | 4425 |
| 165 | Ga0070679_100079195 | 3300005530 | Bacteria | 3275 |
| 166 | Ga0070679_100416136 | 3300005530 | Unclassified | 1290 |
| 167 | Ga0070679_100709016 | 3300005530 | Bacteria | 949 |
| 168 | Ga0070679_100945526 | 3300005530 | Bacteria | 805 |
| 169 | Ga0070684_100002671 | 3300005535 | Bacteria | 13167 |
| 170 | Ga0070684_100034298 | 3300005535 | Bacteria | 4338 |
| 171 | Ga0070684_100353112 | 3300005535 | Bacteria | 1352 |
| 172 | Ga0068853_100025015 | 3300005539 | Bacteria | 5010 |
| 173 | Ga0068853_100095736 | 3300005539 | Bacteria | 2618 |
| 174 | Ga0068853_100164720 | 3300005539 | Bacteria | 2003 |
| 175 | Ga0068853_100275758 | 3300005539 | Bacteria | 1549 |
| 176 | Ga0068853_101403305 | 3300005539 | Bacteria | 675 |
| 177 | Ga0070672_100000461 | 3300005543 | Bacteria | 23612 |
| 178 | Ga0070672_100275877 | 3300005543 | Bacteria | 1420 |
| 179 | Ga0070672_100427333 | 3300005543 | Bacteria | 1138 |
| 180 | Ga0070686_100218439 | 3300005544 | Bacteria | 1376 |
| 181 | Ga0070686_100538375 | 3300005544 | Unclassified | 912 |
| 182 | Ga0070693_100071516 | 3300005547 | Unclassified | 2044 |
| 183 | Ga0070693_100783939 | 3300005547 | Unclassified | 705 |
| 184 | Ga0070665_100012613 | 3300005548 | Bacteria | 8508 |
| 185 | Ga0070665_100040150 | 3300005548 | Bacteria | 4704 |
| 186 | Ga0070665_100169141 | 3300005548 | Bacteria | 2187 |
| 187 | Ga0070665_100190168 | 3300005548 | Bacteria | 2054 |
| 188 | Ga0070665_100680549 | 3300005548 | Unclassified | 1042 |
| 189 | Ga0070665_100957088 | 3300005548 | Bacteria | 869 |
| 190 | Ga0068855_100115015 | 3300005563 | Bacteria | 3084 |
| 191 | Ga0068855_100124450 | 3300005563 | Bacteria | 2949 |
| 192 | Ga0068855_100129420 | 3300005563 | Bacteria | 2884 |
| 193 | Ga0068855_100160692 | 3300005563 | Bacteria | 2550 |
| 194 | Ga0068855_100174522 | 3300005563 | Bacteria | 2433 |
| 195 | Ga0068855_100178434 | 3300005563 | Bacteria | 2402 |
| 196 | Ga0068855_100200788 | 3300005563 | Bacteria | 2244 |
| 197 | Ga0068855_100217838 | 3300005563 | Unclassified | 2142 |
| 198 | Ga0068855_100515666 | 3300005563 | Bacteria | 1297 |
| 199 | Ga0070664_100002518 | 3300005564 | Bacteria | 14767 |
| 200 | Ga0070664_100028887 | 3300005564 | Bacteria | 4618 |
| 201 | Ga0070664_100040831 | 3300005564 | Bacteria | 3913 |
| 202 | Ga0070664_100047412 | 3300005564 | Bacteria | 3629 |
| 203 | Ga0070664_100063374 | 3300005564 | Bacteria | 3152 |
| 204 | Ga0070664_100186882 | 3300005564 | Bacteria | 1844 |
| 205 | Ga0070664_100244736 | 3300005564 | Bacteria | 1611 |
| 206 | Ga0068857_100000489 | 3300005577 | Bacteria | 28341 |
| 207 | Ga0068857_100039427 | 3300005577 | Bacteria | 4184 |
| 208 | Ga0068857_100091002 | 3300005577 | Bacteria | 2730 |
| 209 | Ga0068857_100190905 | 3300005577 | Bacteria | 1866 |
| 210 | Ga0068857_100303721 | 3300005577 | Bacteria | 1471 |
| 211 | Ga0068854_100012018 | 3300005578 | Bacteria | 5658 |
| 212 | Ga0068854_100013400 | 3300005578 | Bacteria | 5380 |
| 213 | Ga0068854_100030482 | 3300005578 | Bacteria | 3741 |
| 214 | Ga0068854_100033456 | 3300005578 | Bacteria | 3584 |
| 215 | Ga0068854_100080454 | 3300005578 | Bacteria | 2404 |
| 216 | Ga0068854_100215840 | 3300005578 | Bacteria | 1515 |
| 217 | Ga0068854_100276267 | 3300005578 | Bacteria | 1351 |
| 218 | Ga0068854_100279508 | 3300005578 | Unclassified | 1343 |
| 219 | Ga0068854_100300388 | 3300005578 | Bacteria | 1298 |
| 220 | Ga0068854_100523488 | 3300005578 | Bacteria | 1002 |
| 221 | Ga0068854_100622269 | 3300005578 | Bacteria | 924 |
| 222 | Ga0068854_100958766 | 3300005578 | Bacteria | 755 |
| 223 | Ga0068856_100013400 | 3300005614 | Bacteria | 7938 |
| 224 | Ga0068856_100053557 | 3300005614 | Bacteria | 3978 |
| 225 | Ga0068856_100067154 | 3300005614 | Bacteria | 3544 |
| 226 | Ga0068856_100107491 | 3300005614 | Bacteria | 2785 |
| 227 | Ga0068856_100116416 | 3300005614 | Bacteria | 2673 |
| 228 | Ga0068856_100137905 | 3300005614 | Bacteria | 2445 |
| 229 | Ga0068856_100242001 | 3300005614 | Bacteria | 1819 |
| 230 | Ga0068856_100244315 | 3300005614 | Bacteria | 1810 |
| 231 | Ga0068856_100359161 | 3300005614 | Bacteria | 1475 |
| 232 | Ga0068856_100402279 | 3300005614 | Bacteria | 1389 |
| 233 | Ga0068856_100543609 | 3300005614 | Bacteria | 1183 |
| 234 | Ga0068856_100674668 | 3300005614 | Bacteria | 1054 |
| 235 | Ga0068856_100706562 | 3300005614 | Bacteria | 1028 |
| 236 | Ga0068856_101128147 | 3300005614 | Bacteria | 801 |
| 237 | Ga0068856_101376511 | 3300005614 | Bacteria | 720 |
| 238 | Ga0068852_100004443 | 3300005616 | Bacteria | 9913 |
| 239 | Ga0068852_100021963 | 3300005616 | Bacteria | 5108 |
| 240 | Ga0068852_100027753 | 3300005616 | Bacteria | 4619 |
| 241 | Ga0068852_100031074 | 3300005616 | Bacteria | 4402 |
| 242 | Ga0068852_100034952 | 3300005616 | Bacteria | 4187 |
| 243 | Ga0068852_100053062 | 3300005616 | Bacteria | 3488 |
| 244 | Ga0068852_100119684 | 3300005616 | Bacteria | 2408 |
| 245 | Ga0068852_100220790 | 3300005616 | Bacteria | 1802 |
| 246 | Ga0068852_100222790 | 3300005616 | Bacteria | 1794 |
| 247 | Ga0068852_100328348 | 3300005616 | Bacteria | 1488 |
| 248 | Ga0068852_100356102 | 3300005616 | Bacteria | 1430 |
| 249 | Ga0068852_100399636 | 3300005616 | Unclassified | 1351 |
| 250 | Ga0068852_100435479 | 3300005616 | Bacteria | 1295 |
| 251 | Ga0068852_100526037 | 3300005616 | Bacteria | 1180 |
| 252 | Ga0068852_100639315 | 3300005616 | Bacteria | 1071 |
| 253 | Ga0068859_100180501 | 3300005617 | Bacteria | 2194 |
| 254 | Ga0068864_100051914 | 3300005618 | Bacteria | 3533 |
| 255 | Ga0068864_100053150 | 3300005618 | Bacteria | 3493 |
| 256 | Ga0068864_100117483 | 3300005618 | Bacteria | 2374 |
| 257 | Ga0068864_100340250 | 3300005618 | Unclassified | 1414 |
| 258 | Ga0068866_10020801 | 3300005718 | Bacteria | 3012 |
| 259 | Ga0068851_10007599 | 3300005834 | Bacteria | 4984 |
| 260 | Ga0068851_10050154 | 3300005834 | Bacteria | 2119 |
| 261 | Ga0068851_10085228 | 3300005834 | Bacteria | 1656 |
| 262 | Ga0068851_10135629 | 3300005834 | Bacteria | 1334 |
| 263 | Ga0068870_10405259 | 3300005840 | Bacteria | 888 |
| 264 | Ga0068863_100029810 | 3300005841 | Bacteria | 5210 |
| 265 | Ga0068863_100034080 | 3300005841 | Bacteria | 4850 |
| 266 | Ga0068863_100046826 | 3300005841 | Bacteria | 4105 |
| 267 | Ga0068863_100092486 | 3300005841 | Unclassified | 2869 |
| 268 | Ga0068858_100013510 | 3300005842 | Bacteria | 7704 |
| 269 | Ga0068858_100041013 | 3300005842 | Bacteria | 4293 |
| 270 | Ga0068858_100193155 | 3300005842 | Bacteria | 1923 |
| 271 | Ga0068860_100429669 | 3300005843 | Bacteria | 1310 |
| 272 | Ga0068860_100615448 | 3300005843 | Bacteria | 1092 |
| 273 | Ga0068862_100203121 | 3300005844 | Bacteria | 1788 |
| 274 | Ga0081539_10030833 | 3300005985 | Bacteria | 3320 |
| 275 | Ga0081539_10042787 | 3300005985 | Bacteria | 2634 |
| 276 | Ga0081539_10101652 | 3300005985 | Unclassified | 1464 |
| 277 | Ga0070717_10012042 | 3300006028 | Bacteria | 6589 |
| 278 | Ga0070717_10832085 | 3300006028 | Unclassified | 840 |
| 279 | Ga0075364_10664963 | 3300006051 | Bacteria | 711 |
| 280 | Ga0070715_10181307 | 3300006163 | Bacteria | 1056 |
| 281 | Ga0070716_100086756 | 3300006173 | Bacteria | 1883 |
| 282 | Ga0075369_10199929 | 3300006186 | Bacteria | 922 |
| 283 | Ga0097621_100209501 | 3300006237 | Bacteria | 1695 |
| 284 | Ga0097621_101211207 | 3300006237 | Bacteria | 711 |
| 285 | Ga0068871_100019390 | 3300006358 | Bacteria | 5193 |
| 286 | Ga0068871_100079789 | 3300006358 | Bacteria | 2709 |
| 287 | Ga0068871_100382945 | 3300006358 | Bacteria | 1250 |
| 288 | Ga0075434_100785517 | 3300006871 | Unclassified | 968 |
| 289 | Ga0068865_100025105 | 3300006881 | Bacteria | 3916 |
| 290 | Ga0068865_100086744 | 3300006881 | Bacteria | 2260 |
| 291 | Ga0068865_100256131 | 3300006881 | Unclassified | 1383 |
| 292 | Ga0097620_100180502 | 3300006931 | Bacteria | 2194 |
| 293 | Ga0105240_10024420 | 3300009093 | Bacteria | 7965 |
| 294 | Ga0105240_10087322 | 3300009093 | Bacteria | 3819 |
| 295 | Ga0105240_10393398 | 3300009093 | Bacteria | 1563 |
| 296 | Ga0105245_10049870 | 3300009098 | Bacteria | 3750 |
| 297 | Ga0105245_10599849 | 3300009098 | Bacteria | 1128 |
| 298 | Ga0105247_10116345 | 3300009101 | Bacteria | 1727 |
| 299 | Ga0105247_10210229 | 3300009101 | Bacteria | 1312 |
| 300 | Ga0105241_10025711 | 3300009174 | Bacteria | 4376 |
| 301 | Ga0105241_10140856 | 3300009174 | Bacteria | 1963 |
| 302 | Ga0105241_10742811 | 3300009174 | Unclassified | 899 |
| 303 | Ga0105242_10016709 | 3300009176 | Bacteria | 5708 |
| 304 | Ga0105242_10579264 | 3300009176 | Unclassified | 1080 |
| 305 | Ga0105248_10026359 | 3300009177 | Bacteria | 6465 |
| 306 | Ga0105248_10038209 | 3300009177 | Bacteria | 5372 |
| 307 | Ga0105248_10104194 | 3300009177 | Bacteria | 3198 |
| 308 | Ga0105248_10114594 | 3300009177 | Bacteria | 3040 |
| 309 | Ga0105248_10228183 | 3300009177 | Bacteria | 2096 |
| 310 | Ga0105248_10490247 | 3300009177 | Unclassified | 1385 |
| 311 | Ga0105248_10961257 | 3300009177 | Bacteria | 965 |
| 312 | Ga0105248_11056138 | 3300009177 | Unclassified | 918 |
| 313 | Ga0105237_10021095 | 3300009545 | Bacteria | 6701 |
| 314 | Ga0105237_10142523 | 3300009545 | Bacteria | 2391 |
| 315 | Ga0105238_10017635 | 3300009551 | Bacteria | 7257 |
| 316 | Ga0105238_10135699 | 3300009551 | Bacteria | 2438 |
| 317 | Ga0105238_10197199 | 3300009551 | Bacteria | 1989 |
| 318 | Ga0105238_10236138 | 3300009551 | Bacteria | 1805 |
| 319 | Ga0105238_10396735 | 3300009551 | Bacteria | 1372 |
| 320 | Ga0105238_10439728 | 3300009551 | Unclassified | 1300 |
| 321 | Ga0105238_10603691 | 3300009551 | Bacteria | 1105 |
| 322 | Ga0105239_10027029 | 3300010375 | Bacteria | 6316 |
| 323 | Ga0105246_10114352 | 3300011119 | Bacteria | 1988 |
| 324 | Ga0105246_10158042 | 3300011119 | Bacteria | 1724 |
| 325 | Ga0157373_10014198 | 3300013100 | Bacteria | 5842 |
| 326 | Ga0157373_10014974 | 3300013100 | Bacteria | 5675 |
| 327 | Ga0157373_10063395 | 3300013100 | Bacteria | 2617 |
| 328 | Ga0157373_10109243 | 3300013100 | Bacteria | 1945 |
| 329 | Ga0157373_10153236 | 3300013100 | Bacteria | 1621 |
| 330 | Ga0157373_10238318 | 3300013100 | Bacteria | 1286 |
| 331 | Ga0157373_10385557 | 3300013100 | Bacteria | 1003 |
| 332 | Ga0157371_10121607 | 3300013102 | Bacteria | 1856 |
| 333 | Ga0157371_10166613 | 3300013102 | Unclassified | 1574 |
| 334 | Ga0157371_10489293 | 3300013102 | Unclassified | 908 |
| 335 | Ga0157371_10996903 | 3300013102 | Unclassified | 639 |
| 336 | Ga0157371_11134935 | 3300013102 | Bacteria | 600 |
| 337 | Ga0157371_11249529 | 3300013102 | Unclassified | 573 |
| 338 | Ga0157370_10002746 | 3300013104 | Bacteria | 21034 |
| 339 | Ga0157370_10050746 | 3300013104 | Bacteria | 3964 |
| 340 | Ga0157370_10069760 | 3300013104 | Bacteria | 3319 |
| 341 | Ga0157370_10095543 | 3300013104 | Bacteria | 2788 |
| 342 | Ga0157370_10133468 | 3300013104 | Bacteria | 2315 |
| 343 | Ga0157370_10203545 | 3300013104 | Unclassified | 1836 |
| 344 | Ga0157370_10476141 | 3300013104 | Bacteria | 1147 |
| 345 | Ga0157370_10487620 | 3300013104 | Unclassified | 1132 |
| 346 | Ga0157370_10530284 | 3300013104 | Unclassified | 1080 |
| 347 | Ga0157369_10004619 | 3300013105 | Bacteria | 16188 |
| 348 | Ga0157369_10023641 | 3300013105 | Bacteria | 6846 |
| 349 | Ga0157369_10030800 | 3300013105 | Bacteria | 5914 |
| 350 | Ga0157369_10034637 | 3300013105 | Bacteria | 5539 |
| 351 | Ga0157369_10063178 | 3300013105 | Bacteria | 3990 |
| 352 | Ga0157369_10102744 | 3300013105 | Bacteria | 3045 |
| 353 | Ga0157369_10117807 | 3300013105 | Bacteria | 2819 |
| 354 | Ga0157369_10160228 | 3300013105 | Bacteria | 2375 |
| 355 | Ga0157369_10165280 | 3300013105 | Bacteria | 2334 |
| 356 | Ga0157369_10186201 | 3300013105 | Bacteria | 2183 |
| 357 | Ga0157369_10214914 | 3300013105 | Bacteria | 2014 |
| 358 | Ga0157369_10303168 | 3300013105 | Bacteria | 1661 |
| 359 | Ga0157369_10333383 | 3300013105 | Bacteria | 1576 |
| 360 | Ga0157369_10850498 | 3300013105 | Bacteria | 936 |
| 361 | Ga0157369_11817098 | 3300013105 | Unclassified | 619 |
| 362 | Ga0157374_10021305 | 3300013296 | Bacteria | 5766 |
| 363 | Ga0157374_10029007 | 3300013296 | Bacteria | 5004 |
| 364 | Ga0157374_10063153 | 3300013296 | Bacteria | 3473 |
| 365 | Ga0157374_10119412 | 3300013296 | Bacteria | 2543 |
| 366 | Ga0157374_10293136 | 3300013296 | Bacteria | 1608 |
| 367 | Ga0157374_10323900 | 3300013296 | Bacteria | 1528 |
| 368 | Ga0157374_10643549 | 3300013296 | Bacteria | 1072 |
| 369 | Ga0157378_10219689 | 3300013297 | Bacteria | 1806 |
| 370 | Ga0157378_10480521 | 3300013297 | Bacteria | 1238 |
| 371 | Ga0157378_10589598 | 3300013297 | Bacteria | 1121 |
| 372 | Ga0163162_10019183 | 3300013306 | Bacteria | 6706 |
| 373 | Ga0163162_10048537 | 3300013306 | Bacteria | 4254 |
| 374 | Ga0163162_10287058 | 3300013306 | Unclassified | 1777 |
| 375 | Ga0157372_10074479 | 3300013307 | Bacteria | 3828 |
| 376 | Ga0157372_10159755 | 3300013307 | Bacteria | 2604 |
| 377 | Ga0157372_10192727 | 3300013307 | Unclassified | 2361 |
| 378 | Ga0157372_10206753 | 3300013307 | Bacteria | 2275 |
| 379 | Ga0157372_10281459 | 3300013307 | Bacteria | 1934 |
| 380 | Ga0157372_10381411 | 3300013307 | Bacteria | 1642 |
| 381 | Ga0157372_10442817 | 3300013307 | Bacteria | 1514 |
| 382 | Ga0157372_10448476 | 3300013307 | Bacteria | 1504 |
| 383 | Ga0157372_11671906 | 3300013307 | Bacteria | 733 |
| 384 | Ga0157375_10024280 | 3300013308 | Bacteria | 5607 |
| 385 | Ga0157375_10052650 | 3300013308 | Bacteria | 4003 |
| 386 | Ga0157375_10439554 | 3300013308 | Bacteria | 1470 |
| 387 | Ga0157375_10832131 | 3300013308 | Bacteria | 1070 |
| 388 | Ga0157375_11882243 | 3300013308 | Unclassified | 710 |
| 389 | Ga0163163_10011842 | 3300014325 | Bacteria | 7929 |
| 390 | Ga0163163_10034598 | 3300014325 | Bacteria | 4895 |
| 391 | Ga0163163_10037142 | 3300014325 | Bacteria | 4737 |
| 392 | Ga0157377_10085863 | 3300014745 | Bacteria | 1848 |
| 393 | Ga0157379_10876979 | 3300014968 | Bacteria | 850 |
| 394 | Ga0157376_10302569 | 3300014969 | Bacteria | 1514 |
| 395 | Ga0206356_11797130 | 3300020070 | Bacteria | 2049 |
| 396 | Ga0206355_1601105 | 3300020076 | Bacteria | 2043 |
| 397 | Ga0213876_10015773 | 3300021384 | Bacteria | 3998 |
| 398 | Ga0207697_10155619 | 3300025315 | Bacteria | 996 |
| 399 | Ga0207656_10025258 | 3300025321 | Bacteria | 2410 |
| 400 | Ga0207656_10113354 | 3300025321 | Bacteria | 1255 |
| 401 | Ga0207656_10223640 | 3300025321 | Bacteria | 915 |
| 402 | Ga0207642_10011605 | 3300025899 | Bacteria | 3150 |
| 403 | Ga0207710_10218595 | 3300025900 | Bacteria | 945 |
| 404 | Ga0207688_10207361 | 3300025901 | Bacteria | 1177 |
| 405 | Ga0207680_10003692 | 3300025903 | Bacteria | 7193 |
| 406 | Ga0207680_10010957 | 3300025903 | Bacteria | 4559 |
| 407 | Ga0207680_10013553 | 3300025903 | Bacteria | 4193 |
| 408 | Ga0207680_10112205 | 3300025903 | Bacteria | 1770 |
| 409 | Ga0207647_10007000 | 3300025904 | Bacteria | 8179 |
| 410 | Ga0207647_10014002 | 3300025904 | Bacteria | 5549 |
| 411 | Ga0207647_10018752 | 3300025904 | Bacteria | 4670 |
| 412 | Ga0207647_10022272 | 3300025904 | Bacteria | 4212 |
| 413 | Ga0207647_10024348 | 3300025904 | Bacteria | 3992 |
| 414 | Ga0207647_10036155 | 3300025904 | Bacteria | 3140 |
| 415 | Ga0207647_10041018 | 3300025904 | Bacteria | 2912 |
| 416 | Ga0207647_10048627 | 3300025904 | Bacteria | 2633 |
| 417 | Ga0207647_10080059 | 3300025904 | Bacteria | 1960 |
| 418 | Ga0207647_10089347 | 3300025904 | Bacteria | 1839 |
| 419 | Ga0207685_10260262 | 3300025905 | Unclassified | 843 |
| 420 | Ga0207699_10048389 | 3300025906 | Bacteria | 2498 |
| 421 | Ga0207645_10051000 | 3300025907 | Bacteria | 2644 |
| 422 | Ga0207645_10110365 | 3300025907 | Bacteria | 1780 |
| 423 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 424 | Ga0207705_10000493 | 3300025909 | Bacteria | 33656 |
| 425 | Ga0207705_10001025 | 3300025909 | Bacteria | 22684 |
| 426 | Ga0207705_10009697 | 3300025909 | Bacteria | 7003 |
| 427 | Ga0207705_10019512 | 3300025909 | Unclassified | 4848 |
| 428 | Ga0207705_10027645 | 3300025909 | Bacteria | 4046 |
| 429 | Ga0207705_10028284 | 3300025909 | Bacteria | 3996 |
| 430 | Ga0207705_10037912 | 3300025909 | Bacteria | 3449 |
| 431 | Ga0207705_10042739 | 3300025909 | Bacteria | 3254 |
| 432 | Ga0207705_10097045 | 3300025909 | Bacteria | 2164 |
| 433 | Ga0207705_10255496 | 3300025909 | Bacteria | 1337 |
| 434 | Ga0207705_10268769 | 3300025909 | Bacteria | 1304 |
| 435 | Ga0207705_10356814 | 3300025909 | Bacteria | 1127 |
| 436 | Ga0207707_10017647 | 3300025912 | Bacteria | 6225 |
| 437 | Ga0207707_10077183 | 3300025912 | Bacteria | 2908 |
| 438 | Ga0207707_10209630 | 3300025912 | Bacteria | 1698 |
| 439 | Ga0207695_10008855 | 3300025913 | Bacteria | 12532 |
| 440 | Ga0207695_10009362 | 3300025913 | Bacteria | 12112 |
| 441 | Ga0207695_10057313 | 3300025913 | Bacteria | 4048 |
| 442 | Ga0207695_10315334 | 3300025913 | Bacteria | 1454 |
| 443 | Ga0207671_10024193 | 3300025914 | Bacteria | 4570 |
| 444 | Ga0207671_10028319 | 3300025914 | Bacteria | 4186 |
| 445 | Ga0207660_10000770 | 3300025917 | Bacteria | 21320 |
| 446 | Ga0207660_10003208 | 3300025917 | Bacteria | 10700 |
| 447 | Ga0207660_10382789 | 3300025917 | Bacteria | 1131 |
| 448 | Ga0207660_10521874 | 3300025917 | Unclassified | 965 |
| 449 | Ga0207657_10002261 | 3300025919 | Bacteria | 20877 |
| 450 | Ga0207657_10003123 | 3300025919 | Bacteria | 17708 |
| 451 | Ga0207657_10006107 | 3300025919 | Bacteria | 12524 |
| 452 | Ga0207657_10018368 | 3300025919 | Bacteria | 6677 |
| 453 | Ga0207657_10026360 | 3300025919 | Bacteria | 5343 |
| 454 | Ga0207657_10040433 | 3300025919 | Bacteria | 4131 |
| 455 | Ga0207657_10056349 | 3300025919 | Bacteria | 3392 |
| 456 | Ga0207657_10066200 | 3300025919 | Bacteria | 3076 |
| 457 | Ga0207657_10076653 | 3300025919 | Bacteria | 2820 |
| 458 | Ga0207657_10109570 | 3300025919 | Bacteria | 2282 |
| 459 | Ga0207657_10115485 | 3300025919 | Bacteria | 2212 |
| 460 | Ga0207657_10174288 | 3300025919 | Bacteria | 1741 |
| 461 | Ga0207657_10429289 | 3300025919 | Bacteria | 1038 |
| 462 | Ga0207649_10006255 | 3300025920 | Bacteria | 6468 |
| 463 | Ga0207649_10021154 | 3300025920 | Bacteria | 3740 |
| 464 | Ga0207649_10033502 | 3300025920 | Bacteria | 3070 |
| 465 | Ga0207649_10101062 | 3300025920 | Bacteria | 1908 |
| 466 | Ga0207649_10135803 | 3300025920 | Unclassified | 1676 |
| 467 | Ga0207649_10205843 | 3300025920 | Bacteria | 1393 |
| 468 | Ga0207649_10234168 | 3300025920 | Bacteria | 1315 |
| 469 | Ga0207649_10344207 | 3300025920 | Bacteria | 1102 |
| 470 | Ga0207649_10525587 | 3300025920 | Bacteria | 903 |
| 471 | Ga0207649_10573796 | 3300025920 | Unclassified | 865 |
| 472 | Ga0207649_10603588 | 3300025920 | Unclassified | 844 |
| 473 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 474 | Ga0207652_10151864 | 3300025921 | Bacteria | 2074 |
| 475 | Ga0207694_10024170 | 3300025924 | Bacteria | 4614 |
| 476 | Ga0207694_10025296 | 3300025924 | Bacteria | 4511 |
| 477 | Ga0207694_10671482 | 3300025924 | Unclassified | 873 |
| 478 | Ga0207650_10087834 | 3300025925 | Bacteria | 2370 |
| 479 | Ga0207650_10184267 | 3300025925 | Unclassified | 1665 |
| 480 | Ga0207650_10286661 | 3300025925 | Bacteria | 1342 |
| 481 | Ga0207650_10670192 | 3300025925 | Unclassified | 875 |
| 482 | Ga0207659_10207770 | 3300025926 | Bacteria | 1567 |
| 483 | Ga0207659_10274319 | 3300025926 | Bacteria | 1376 |
| 484 | Ga0207687_10083000 | 3300025927 | Bacteria | 2319 |
| 485 | Ga0207700_10037272 | 3300025928 | Bacteria | 3519 |
| 486 | Ga0207700_10053420 | 3300025928 | Bacteria | 3027 |
| 487 | Ga0207700_10118377 | 3300025928 | Bacteria | 2143 |
| 488 | Ga0207664_10036282 | 3300025929 | Bacteria | 3810 |
| 489 | Ga0207664_10252888 | 3300025929 | Bacteria | 1538 |
| 490 | Ga0207644_10000747 | 3300025931 | Bacteria | 20633 |
| 491 | Ga0207644_10006207 | 3300025931 | Bacteria | 7793 |
| 492 | Ga0207644_10015057 | 3300025931 | Bacteria | 5188 |
| 493 | Ga0207644_10016318 | 3300025931 | Bacteria | 4996 |
| 494 | Ga0207644_10016718 | 3300025931 | Bacteria | 4939 |
| 495 | Ga0207644_10023819 | 3300025931 | Bacteria | 4197 |
| 496 | Ga0207644_10156432 | 3300025931 | Bacteria | 1768 |
| 497 | Ga0207644_10702358 | 3300025931 | Bacteria | 843 |
| 498 | Ga0207690_10008784 | 3300025932 | Bacteria | 5997 |
| 499 | Ga0207690_10015093 | 3300025932 | Bacteria | 4677 |
| 500 | Ga0207690_10060505 | 3300025932 | Bacteria | 2570 |
| 501 | Ga0207690_10066579 | 3300025932 | Bacteria | 2468 |
| 502 | Ga0207690_10152704 | 3300025932 | Bacteria | 1713 |
| 503 | Ga0207690_10417273 | 3300025932 | Bacteria | 1073 |
| 504 | Ga0207690_11017128 | 3300025932 | Unclassified | 690 |
| 505 | Ga0207706_10008319 | 3300025933 | Bacteria | 9566 |
| 506 | Ga0207706_10019826 | 3300025933 | Bacteria | 6045 |
| 507 | Ga0207706_10037830 | 3300025933 | Bacteria | 4283 |
| 508 | Ga0207706_10054006 | 3300025933 | Bacteria | 3546 |
| 509 | Ga0207706_10131582 | 3300025933 | Bacteria | 2200 |
| 510 | Ga0207706_10233077 | 3300025933 | Bacteria | 1610 |
| 511 | Ga0207706_10254876 | 3300025933 | Bacteria | 1532 |
| 512 | Ga0207706_10310147 | 3300025933 | Bacteria | 1374 |
| 513 | Ga0207706_10441557 | 3300025933 | Bacteria | 1126 |
| 514 | Ga0207706_10541087 | 3300025933 | Bacteria | 1003 |
| 515 | Ga0207706_10578983 | 3300025933 | Bacteria | 965 |
| 516 | Ga0207686_10064988 | 3300025934 | Bacteria | 2324 |
| 517 | Ga0207670_10644647 | 3300025936 | Bacteria | 873 |
| 518 | Ga0207669_10027200 | 3300025937 | Bacteria | 3127 |
| 519 | Ga0207669_10081406 | 3300025937 | Bacteria | 2074 |
| 520 | Ga0207669_10281606 | 3300025937 | Bacteria | 1254 |
| 521 | Ga0207704_10032107 | 3300025938 | Bacteria | 2967 |
| 522 | Ga0207704_10975778 | 3300025938 | Unclassified | 716 |
| 523 | Ga0207665_10049456 | 3300025939 | Bacteria | 2825 |
| 524 | Ga0207665_10132756 | 3300025939 | Bacteria | 1769 |
| 525 | Ga0207691_10004673 | 3300025940 | Bacteria | 13258 |
| 526 | Ga0207691_10005523 | 3300025940 | Bacteria | 12217 |
| 527 | Ga0207691_10013134 | 3300025940 | Bacteria | 7928 |
| 528 | Ga0207691_10269925 | 3300025940 | Bacteria | 1465 |
| 529 | Ga0207711_10007240 | 3300025941 | Bacteria | 9299 |
| 530 | Ga0207711_10007576 | 3300025941 | Bacteria | 9084 |
| 531 | Ga0207711_10014416 | 3300025941 | Bacteria | 6564 |
| 532 | Ga0207711_10020622 | 3300025941 | Bacteria | 5500 |
| 533 | Ga0207711_10033837 | 3300025941 | Bacteria | 4326 |
| 534 | Ga0207711_10204330 | 3300025941 | Bacteria | 1803 |
| 535 | Ga0207711_10311060 | 3300025941 | Bacteria | 1454 |
| 536 | Ga0207711_10637293 | 3300025941 | Bacteria | 994 |
| 537 | Ga0207711_10827109 | 3300025941 | Unclassified | 862 |
| 538 | Ga0207711_11044215 | 3300025941 | Bacteria | 757 |
| 539 | Ga0207661_10002378 | 3300025944 | Bacteria | 12950 |
| 540 | Ga0207661_10012640 | 3300025944 | Bacteria | 6145 |
| 541 | Ga0207661_10594680 | 3300025944 | Unclassified | 1015 |
| 542 | Ga0207661_10737127 | 3300025944 | Unclassified | 907 |
| 543 | Ga0207679_10007576 | 3300025945 | Bacteria | 6892 |
| 544 | Ga0207679_10020448 | 3300025945 | Bacteria | 4467 |
| 545 | Ga0207679_10059420 | 3300025945 | Bacteria | 2837 |
| 546 | Ga0207679_10069570 | 3300025945 | Bacteria | 2649 |
| 547 | Ga0207679_10117050 | 3300025945 | Bacteria | 2114 |
| 548 | Ga0207679_10125411 | 3300025945 | Bacteria | 2051 |
| 549 | Ga0207679_10299494 | 3300025945 | Bacteria | 1386 |
| 550 | Ga0207679_10478083 | 3300025945 | Bacteria | 1109 |
| 551 | Ga0207679_10798141 | 3300025945 | Bacteria | 860 |
| 552 | Ga0207667_10004710 | 3300025949 | Bacteria | 16697 |
| 553 | Ga0207667_10022167 | 3300025949 | Bacteria | 7025 |
| 554 | Ga0207667_10026666 | 3300025949 | Bacteria | 6306 |
| 555 | Ga0207667_10078827 | 3300025949 | Bacteria | 3413 |
| 556 | Ga0207667_10178420 | 3300025949 | Bacteria | 2182 |
| 557 | Ga0207667_10261594 | 3300025949 | Unclassified | 1769 |
| 558 | Ga0207667_10313539 | 3300025949 | Unclassified | 1602 |
| 559 | Ga0207667_10790375 | 3300025949 | Bacteria | 946 |
| 560 | Ga0207667_10945478 | 3300025949 | Unclassified | 851 |
| 561 | Ga0207667_10948104 | 3300025949 | Bacteria | 850 |
| 562 | Ga0207667_11219828 | 3300025949 | Unclassified | 731 |
| 563 | Ga0207651_10012099 | 3300025960 | Bacteria | 4864 |
| 564 | Ga0207651_10014049 | 3300025960 | Bacteria | 4609 |
| 565 | Ga0207651_10015757 | 3300025960 | Bacteria | 4404 |
| 566 | Ga0207651_10017768 | 3300025960 | Bacteria | 4210 |
| 567 | Ga0207651_10029038 | 3300025960 | Bacteria | 3498 |
| 568 | Ga0207651_10078455 | 3300025960 | Bacteria | 2369 |
| 569 | Ga0207640_10025603 | 3300025981 | Bacteria | 3573 |
| 570 | Ga0207640_10037577 | 3300025981 | Bacteria | 3048 |
| 571 | Ga0207640_10095945 | 3300025981 | Bacteria | 2066 |
| 572 | Ga0207640_10153773 | 3300025981 | Bacteria | 1693 |
| 573 | Ga0207640_10177872 | 3300025981 | Unclassified | 1592 |
| 574 | Ga0207640_10219580 | 3300025981 | Bacteria | 1454 |
| 575 | Ga0207640_10522418 | 3300025981 | Bacteria | 992 |
| 576 | Ga0207640_10707786 | 3300025981 | Bacteria | 864 |
| 577 | Ga0207640_11116681 | 3300025981 | Unclassified | 698 |
| 578 | Ga0207658_10013412 | 3300025986 | Bacteria | 5598 |
| 579 | Ga0207658_10065328 | 3300025986 | Bacteria | 2732 |
| 580 | Ga0207658_10309592 | 3300025986 | Bacteria | 1364 |
| 581 | Ga0207658_10405856 | 3300025986 | Bacteria | 1198 |
| 582 | Ga0207677_10006373 | 3300026023 | Bacteria | 6471 |
| 583 | Ga0207677_10081189 | 3300026023 | Bacteria | 2326 |
| 584 | Ga0207677_10150836 | 3300026023 | Bacteria | 1793 |
| 585 | Ga0207677_10174809 | 3300026023 | Bacteria | 1683 |
| 586 | Ga0207677_11277365 | 3300026023 | Unclassified | 674 |
| 587 | Ga0207703_10012807 | 3300026035 | Bacteria | 6538 |
| 588 | Ga0207703_10028733 | 3300026035 | Bacteria | 4386 |
| 589 | Ga0207703_10112271 | 3300026035 | Bacteria | 2328 |
| 590 | Ga0207703_10288547 | 3300026035 | Unclassified | 1492 |
| 591 | Ga0207639_10000923 | 3300026041 | Bacteria | 19909 |
| 592 | Ga0207639_10001159 | 3300026041 | Bacteria | 17877 |
| 593 | Ga0207639_10706898 | 3300026041 | Bacteria | 935 |
| 594 | Ga0207639_10866551 | 3300026041 | Bacteria | 843 |
| 595 | Ga0207639_10917004 | 3300026041 | Unclassified | 819 |
| 596 | Ga0207678_10006063 | 3300026067 | Bacteria | 10752 |
| 597 | Ga0207678_10009081 | 3300026067 | Bacteria | 8752 |
| 598 | Ga0207678_10046333 | 3300026067 | Bacteria | 3760 |
| 599 | Ga0207678_10053830 | 3300026067 | Bacteria | 3467 |
| 600 | Ga0207678_10055524 | 3300026067 | Bacteria | 3412 |
| 601 | Ga0207678_10138920 | 3300026067 | Bacteria | 2073 |
| 602 | Ga0207678_10143449 | 3300026067 | Bacteria | 2038 |
| 603 | Ga0207678_10164425 | 3300026067 | Unclassified | 1895 |
| 604 | Ga0207678_10558145 | 3300026067 | Unclassified | 1002 |
| 605 | Ga0207678_10617858 | 3300026067 | Bacteria | 951 |
| 606 | Ga0207702_10002063 | 3300026078 | Bacteria | 19455 |
| 607 | Ga0207702_10019681 | 3300026078 | Bacteria | 5588 |
| 608 | Ga0207702_10025645 | 3300026078 | Bacteria | 4893 |
| 609 | Ga0207702_10059906 | 3300026078 | Bacteria | 3244 |
| 610 | Ga0207702_10060514 | 3300026078 | Bacteria | 3229 |
| 611 | Ga0207702_10074449 | 3300026078 | Bacteria | 2931 |
| 612 | Ga0207702_10177756 | 3300026078 | Bacteria | 1957 |
| 613 | Ga0207702_10221564 | 3300026078 | Bacteria | 1763 |
| 614 | Ga0207702_10244287 | 3300026078 | Unclassified | 1683 |
| 615 | Ga0207702_10330691 | 3300026078 | Bacteria | 1453 |
| 616 | Ga0207641_10073824 | 3300026088 | Bacteria | 2940 |
| 617 | Ga0207641_10710167 | 3300026088 | Bacteria | 990 |
| 618 | Ga0207648_10008762 | 3300026089 | Bacteria | 9748 |
| 619 | Ga0207648_10010578 | 3300026089 | Bacteria | 8729 |
| 620 | Ga0207648_10088236 | 3300026089 | Bacteria | 2708 |
| 621 | Ga0207648_10348933 | 3300026089 | Bacteria | 1334 |
| 622 | Ga0207676_10033010 | 3300026095 | Bacteria | 3907 |
| 623 | Ga0207676_10093212 | 3300026095 | Bacteria | 2479 |
| 624 | Ga0207676_10233662 | 3300026095 | Bacteria | 1645 |
| 625 | Ga0207676_10277997 | 3300026095 | Bacteria | 1519 |
| 626 | Ga0207674_10006843 | 3300026116 | Bacteria | 13372 |
| 627 | Ga0207674_10012374 | 3300026116 | Bacteria | 9538 |
| 628 | Ga0207674_10077107 | 3300026116 | Bacteria | 3339 |
| 629 | Ga0207674_10080912 | 3300026116 | Bacteria | 3251 |
| 630 | Ga0207674_10115084 | 3300026116 | Bacteria | 2661 |
| 631 | Ga0207674_10157321 | 3300026116 | Bacteria | 2228 |
| 632 | Ga0207674_10193343 | 3300026116 | Bacteria | 1984 |
| 633 | Ga0207674_10818294 | 3300026116 | Unclassified | 899 |
| 634 | Ga0207674_11400548 | 3300026116 | Unclassified | 668 |
| 635 | Ga0207683_10014680 | 3300026121 | Bacteria | 6670 |
| 636 | Ga0207683_10021530 | 3300026121 | Bacteria | 5522 |
| 637 | Ga0207683_10222611 | 3300026121 | Bacteria | 1719 |
| 638 | Ga0207698_10000896 | 3300026142 | Bacteria | 17309 |
| 639 | Ga0207698_10003271 | 3300026142 | Bacteria | 9734 |
| 640 | Ga0207698_10006737 | 3300026142 | Bacteria | 7176 |
| 641 | Ga0207698_10008977 | 3300026142 | Bacteria | 6344 |
| 642 | Ga0207698_10022783 | 3300026142 | Bacteria | 4362 |
| 643 | Ga0207698_10035355 | 3300026142 | Bacteria | 3654 |
| 644 | Ga0207698_10043850 | 3300026142 | Bacteria | 3355 |
| 645 | Ga0207698_10216528 | 3300026142 | Bacteria | 1727 |
| 646 | Ga0207698_10219416 | 3300026142 | Unclassified | 1717 |
| 647 | Ga0207698_10310425 | 3300026142 | Bacteria | 1472 |
| 648 | Ga0207698_10535537 | 3300026142 | Bacteria | 1145 |
| 649 | Ga0207698_10746658 | 3300026142 | Unclassified | 977 |
| 650 | Ga0207698_10975881 | 3300026142 | Unclassified | 857 |
| 651 | Ga0207698_11139976 | 3300026142 | Unclassified | 793 |
| 652 | Ga0207698_12055493 | 3300026142 | Unclassified | 585 |
| 653 | Ga0268266_10000767 | 3300028379 | Bacteria | 42918 |
| 654 | Ga0268266_10029135 | 3300028379 | Bacteria | 4693 |
| 655 | Ga0268266_10045135 | 3300028379 | Bacteria | 3769 |
| 656 | Ga0268266_10212037 | 3300028379 | Bacteria | 1776 |
| 657 | Ga0268266_10665544 | 3300028379 | Bacteria | 1002 |
| 658 | Ga0268266_11375540 | 3300028379 | Unclassified | 681 |
| 659 | Ga0268265_10363928 | 3300028380 | Bacteria | 1325 |
| 660 | Ga0268264_10266424 | 3300028381 | Bacteria | 1599 |
| 661 | Ga0268264_10399541 | 3300028381 | Bacteria | 1320 |
| 662 | Ga0307408_100039656 | 3300031548 | Bacteria | 3331 |
| 663 | Ga0307405_10148856 | 3300031731 | Bacteria | 1643 |
| 664 | Ga0307413_10014680 | 3300031824 | Bacteria | 3988 |
| 665 | Ga0307413_10035173 | 3300031824 | Bacteria | 2870 |
| 666 | Ga0307410_10010532 | 3300031852 | Bacteria | 5244 |
| 667 | Ga0307410_10031141 | 3300031852 | Bacteria | 3419 |
| 668 | Ga0307410_10128545 | 3300031852 | Bacteria | 1858 |
| 669 | Ga0307406_10101720 | 3300031901 | Bacteria | 1959 |
| 670 | Ga0307406_10547227 | 3300031901 | Bacteria | 946 |
| 671 | Ga0307407_10105882 | 3300031903 | Bacteria | 1755 |
| 672 | Ga0307407_10218692 | 3300031903 | Bacteria | 1287 |
| 673 | Ga0307412_10154743 | 3300031911 | Bacteria | 1696 |
| 674 | Ga0307409_100031493 | 3300031995 | Bacteria | 3829 |
| 675 | Ga0307409_100115218 | 3300031995 | Bacteria | 2262 |
| 676 | Ga0307409_100148144 | 3300031995 | Bacteria | 2033 |
| 677 | Ga0307416_100020756 | 3300032002 | Bacteria | 4697 |
| 678 | Ga0307416_100023349 | 3300032002 | Bacteria | 4487 |
| 679 | Ga0307414_10009432 | 3300032004 | Bacteria | 5607 |
| 680 | Ga0307414_10040743 | 3300032004 | Bacteria | 3139 |
| 681 | Ga0307414_10391625 | 3300032004 | Bacteria | 1204 |
| 682 | Ga0307411_10007591 | 3300032005 | Bacteria | 5543 |
| 683 | Ga0307411_10024440 | 3300032005 | Bacteria | 3602 |
| 684 | Ga0307411_10119092 | 3300032005 | Bacteria | 1906 |
| 685 | Ga0307415_100004410 | 3300032126 | Bacteria | 7295 |
| 686 | Ga0307415_100066475 | 3300032126 | Bacteria | 2516 |
| 687 | Ga0373923_0112263 | 3300035111 | Bacteria | 1211 |
| 688 | Ga0373954_0049544 | 3300035118 | Bacteria | 1969 |
| 689 | Ga0373956_0097486 | 3300035119 | Bacteria | 1361 |
| 690 | Ga0373960_0244112 | 3300035121 | Unclassified | 650 |
| 691 | Ga0373946_0050901 | 3300035171 | Bacteria | 1732 |
| 692 | Ga0373931_0094472 | 3300035691 | Bacteria | 1672 |
| 693 | Ga0373935_0153284 | 3300035692 | Bacteria | 1565 |
| 694 | Ga0373933_0014251 | 3300035724 | Unclassified | 4417 |
| 695 | Ga0373933_0653287 | 3300035724 | Unclassified | 691 |
| 696 | Ga0373947_0577649 | 3300035725 | Unclassified | 766 |
| 697 | Ga0373937_0004829 | 3300036401 | Bacteria | 11457 |
| 698 | Ga0395899_0021048 | 3300037312 | Bacteria | 4946 |
| 699 | Ga0395899_0036604 | 3300037312 | Bacteria | 3680 |
| 700 | Ga0395899_0042007 | 3300037312 | Bacteria | 3414 |
| 701 | Ga0395899_0048839 | 3300037312 | Bacteria | 3147 |
| 702 | Ga0395899_0050645 | 3300037312 | Bacteria | 3083 |
| 703 | Ga0395899_0051337 | 3300037312 | Bacteria | 3060 |
| 704 | Ga0395899_0053501 | 3300037312 | Bacteria | 2989 |
| 705 | Ga0395899_0090055 | 3300037312 | Bacteria | 2224 |
| 706 | Ga0395899_0102274 | 3300037312 | Bacteria | 2067 |
| 707 | Ga0395899_0162413 | 3300037312 | Bacteria | 1577 |
| 708 | Ga0395899_0194735 | 3300037312 | Unclassified | 1417 |
| 709 | Ga0395899_0213622 | 3300037312 | Bacteria | 1339 |
| 710 | Ga0395899_0285816 | 3300037312 | Unclassified | 1120 |
| 711 | Ga0395899_0292103 | 3300037312 | Unclassified | 1105 |
| 712 | Ga0395900_0003085 | 3300037418 | Bacteria | 18103 |
| 713 | Ga0395900_0009276 | 3300037418 | Bacteria | 10089 |
| 714 | Ga0395900_0010484 | 3300037418 | Bacteria | 9479 |
| 715 | Ga0395900_0030431 | 3300037418 | Bacteria | 5544 |
| 716 | Ga0395900_0030498 | 3300037418 | Bacteria | 5536 |
| 717 | Ga0395900_0050997 | 3300037418 | Bacteria | 4262 |
| 718 | Ga0395900_0053926 | 3300037418 | Unclassified | 4139 |
| 719 | Ga0395900_0062637 | 3300037418 | Bacteria | 3823 |
| 720 | Ga0395900_0073419 | 3300037418 | Bacteria | 3517 |
| 721 | Ga0395900_0088171 | 3300037418 | Bacteria | 3189 |
| 722 | Ga0395900_0102036 | 3300037418 | Bacteria | 2947 |
| 723 | Ga0395900_0115343 | 3300037418 | Bacteria | 2756 |
| 724 | Ga0395900_0130385 | 3300037418 | Bacteria | 2577 |
| 725 | Ga0395900_0131903 | 3300037418 | Bacteria | 2560 |
| 726 | Ga0395900_0133413 | 3300037418 | Bacteria | 2544 |
| 727 | Ga0395900_0164577 | 3300037418 | Bacteria | 2261 |
| 728 | Ga0395900_0172571 | 3300037418 | Bacteria | 2200 |
| 729 | Ga0395900_0262255 | 3300037418 | Bacteria | 1725 |
| 730 | Ga0395900_0308123 | 3300037418 | Unclassified | 1567 |
| 731 | Ga0395900_0415743 | 3300037418 | Unclassified | 1306 |
| 732 | Ga0395900_0505633 | 3300037418 | Unclassified | 1158 |
| 733 | Ga0395900_0542483 | 3300037418 | Unclassified | 1108 |
| 734 | Ga0395900_0572365 | 3300037418 | Bacteria | 1072 |
| 735 | Ga0395900_0694432 | 3300037418 | Unclassified | 951 |
| 736 | Ga0395900_1028220 | 3300037418 | Unclassified | 743 |
| 737 | Ga0395900_1333342 | 3300037418 | Unclassified | 631 |
| 738 | Ga0395898_0011721 | 3300037466 | Bacteria | 9089 |
| 739 | Ga0395898_0015329 | 3300037466 | Bacteria | 7861 |
| 740 | Ga0395898_0019188 | 3300037466 | Bacteria | 6961 |
| 741 | Ga0395898_0025785 | 3300037466 | Bacteria | 5920 |
| 742 | Ga0395898_0053789 | 3300037466 | Bacteria | 3930 |
| 743 | Ga0395898_0055306 | 3300037466 | Bacteria | 3870 |
| 744 | Ga0395898_0087550 | 3300037466 | Bacteria | 3000 |
| 745 | Ga0395898_0178684 | 3300037466 | Unclassified | 2028 |
| 746 | Ga0395898_0217297 | 3300037466 | Bacteria | 1823 |
| 747 | Ga0395898_0226204 | 3300037466 | Bacteria | 1784 |
| 748 | Ga0395898_0337753 | 3300037466 | Bacteria | 1436 |
| 749 | Ga0395898_0381880 | 3300037466 | Bacteria | 1343 |
| 750 | Ga0395898_0678779 | 3300037466 | Bacteria | 972 |
| 751 | Ga0395898_0689444 | 3300037466 | Unclassified | 963 |
| 752 | Ga0395905_0001169 | 3300037471 | Bacteria | 32772 |
| 753 | Ga0395905_0001983 | 3300037471 | Bacteria | 23389 |
| 754 | Ga0395905_0006012 | 3300037471 | Bacteria | 12289 |
| 755 | Ga0395905_0006135 | 3300037471 | Bacteria | 12132 |
| 756 | Ga0395905_0008256 | 3300037471 | Bacteria | 10285 |
| 757 | Ga0395905_0028510 | 3300037471 | Bacteria | 5263 |
| 758 | Ga0395905_0033050 | 3300037471 | Bacteria | 4863 |
| 759 | Ga0395905_0033437 | 3300037471 | Bacteria | 4830 |
| 760 | Ga0395905_0034571 | 3300037471 | Bacteria | 4746 |
| 761 | Ga0395905_0037838 | 3300037471 | Bacteria | 4527 |
| 762 | Ga0395905_0045884 | 3300037471 | Bacteria | 4099 |
| 763 | Ga0395905_0051435 | 3300037471 | Bacteria | 3859 |
| 764 | Ga0395905_0057078 | 3300037471 | Bacteria | 3651 |
| 765 | Ga0395905_0062402 | 3300037471 | Bacteria | 3486 |
| 766 | Ga0395905_0084238 | 3300037471 | Bacteria | 2978 |
| 767 | Ga0395905_0092392 | 3300037471 | Bacteria | 2838 |
| 768 | Ga0395905_0128774 | 3300037471 | Bacteria | 2380 |
| 769 | Ga0395905_0144847 | 3300037471 | Bacteria | 2235 |
| 770 | Ga0395905_0212009 | 3300037471 | Bacteria | 1814 |
| 771 | Ga0395905_0294178 | 3300037471 | Bacteria | 1511 |
| 772 | Ga0395905_0413108 | 3300037471 | Bacteria | 1245 |
| 773 | Ga0395905_0433132 | 3300037471 | Bacteria | 1212 |
| 774 | Ga0395905_0543099 | 3300037471 | Unclassified | 1063 |
| 775 | Ga0395905_0647645 | 3300037471 | Bacteria | 958 |
| 776 | Ga0395905_0665994 | 3300037471 | Bacteria | 943 |
| 777 | Ga0395905_0667690 | 3300037471 | Bacteria | 941 |
| 778 | Ga0395905_0945837 | 3300037471 | Unclassified | 764 |
| 779 | Ga0395905_0999755 | 3300037471 | Bacteria | 739 |
| 780 | Ga0395905_1223661 | 3300037471 | Unclassified | 654 |
| 781 | Ga0395901_0006031 | 3300038443 | Bacteria | 12280 |
| 782 | Ga0395901_0028506 | 3300038443 | Bacteria | 5742 |
| 783 | Ga0395901_0050004 | 3300038443 | Bacteria | 4344 |
| 784 | Ga0395901_0067878 | 3300038443 | Bacteria | 3714 |
| 785 | Ga0395901_0082714 | 3300038443 | Bacteria | 3354 |
| 786 | Ga0395901_0101199 | 3300038443 | Bacteria | 3024 |
| 787 | Ga0395901_0106570 | 3300038443 | Bacteria | 2941 |
| 788 | Ga0395901_0115762 | 3300038443 | Bacteria | 2816 |
| 789 | Ga0395901_0116588 | 3300038443 | Bacteria | 2805 |
| 790 | Ga0395901_0121033 | 3300038443 | Bacteria | 2750 |
| 791 | Ga0395901_0125924 | 3300038443 | Bacteria | 2692 |
| 792 | Ga0395901_0130740 | 3300038443 | Bacteria | 2638 |
| 793 | Ga0395901_0133252 | 3300038443 | Bacteria | 2611 |
| 794 | Ga0395901_0175992 | 3300038443 | Bacteria | 2244 |
| 795 | Ga0395901_0230494 | 3300038443 | Bacteria | 1933 |
| 796 | Ga0395901_0319888 | 3300038443 | Bacteria | 1605 |
| 797 | Ga0395901_0347379 | 3300038443 | Bacteria | 1531 |
| 798 | Ga0395901_0440675 | 3300038443 | Unclassified | 1333 |
| 799 | Ga0395901_0495449 | 3300038443 | Bacteria | 1244 |
| 800 | Ga0395901_0508607 | 3300038443 | Unclassified | 1225 |
| 801 | Ga0395901_0554006 | 3300038443 | Unclassified | 1165 |
| 802 | Ga0395901_0602161 | 3300038443 | Bacteria | 1108 |
| 803 | Ga0395901_0642761 | 3300038443 | Bacteria | 1065 |
| 804 | Ga0395901_0777050 | 3300038443 | Bacteria | 948 |
| 805 | Ga0395901_0902722 | 3300038443 | Bacteria | 865 |
| 806 | Ga0436365_0481817 | 3300039437 | Bacteria | 15552 |
| 807 | Ga0439448_0004598 | 3300042005 | Bacteria | 3902 |
| 808 | Ga0439458_0000480 | 3300042157 | Bacteria | 10247 |
| 809 | Ga0439458_0001207 | 3300042157 | Bacteria | 6549 |
| 810 | Ga0439458_0007205 | 3300042157 | Bacteria | 2475 |
| 811 | Ga0466969_0053154 | 3300044656 | Bacteria | 1988 |
| 812 | Ga0466972_0119841 | 3300044658 | Bacteria | 1241 |
| 813 | Ga0466966_0000001 | 3300044684 | Bacteria | 410376 |
| 814 | Ga0466966_0010135 | 3300044684 | Bacteria | 6252 |
| 815 | Ga0466966_0045027 | 3300044684 | Bacteria | 2822 |
| 816 | Ga0466966_0050485 | 3300044684 | Bacteria | 2645 |
| 817 | Ga0466966_0102144 | 3300044684 | Bacteria | 1772 |
| 818 | Ga0466966_0705909 | 3300044684 | Unclassified | 608 |
| 819 | Ga0466961_0009876 | 3300044693 | Bacteria | 6080 |
| 820 | Ga0466961_0168457 | 3300044693 | Bacteria | 1363 |
| 821 | Ga0466963_0006272 | 3300044694 | Bacteria | 7029 |
| 822 | Ga0466963_0010178 | 3300044694 | Bacteria | 5686 |
| 823 | Ga0466963_0150551 | 3300044694 | Unclassified | 1615 |
| 824 | Ga0466963_0378012 | 3300044694 | Bacteria | 998 |
| 825 | Ga0466963_0467005 | 3300044694 | Unclassified | 890 |
| 826 | Ga0466964_0059314 | 3300044706 | Bacteria | 1589 |
| 827 | Ga0466964_0347434 | 3300044706 | Unclassified | 761 |
| 828 | Ga0466971_0064787 | 3300044719 | Unclassified | 1654 |
| 829 | Ga0466971_0241360 | 3300044719 | Unclassified | 859 |
| 830 | Ga0466970_0008343 | 3300044765 | Bacteria | 5211 |
| 831 | Ga0466970_0033889 | 3300044765 | Bacteria | 2701 |
| 832 | Ga0466957_0000183 | 3300044842 | Bacteria | 28401 |
| 833 | Ga0466957_0008937 | 3300044842 | Bacteria | 5710 |
| 834 | Ga0466957_0011371 | 3300044842 | Bacteria | 5133 |
| 835 | Ga0466957_0128657 | 3300044842 | Bacteria | 1620 |
| 836 | Ga0466957_0172057 | 3300044842 | Bacteria | 1411 |
| 837 | Ga0466957_0469958 | 3300044842 | Bacteria | 869 |
| 838 | Ga0466957_0480373 | 3300044842 | Bacteria | 859 |
| 839 | Ga0466957_0560413 | 3300044842 | Unclassified | 797 |
| 840 | Ga0466957_0575264 | 3300044842 | Unclassified | 787 |
| 841 | Ga0466960_0013146 | 3300044901 | Bacteria | 3510 |
| 842 | Ga0466960_0158182 | 3300044901 | Bacteria | 1215 |
| 843 | Ga0466959_0004304 | 3300045049 | Bacteria | 9503 |
| 844 | Ga0466959_0083054 | 3300045049 | Bacteria | 2307 |
| 845 | Ga0466959_0089032 | 3300045049 | Bacteria | 2218 |
| 846 | Ga0466959_0103432 | 3300045049 | Bacteria | 2037 |
| 847 | Ga0466959_0132379 | 3300045049 | Bacteria | 1767 |
| 848 | Ga0466958_0010395 | 3300045836 | Bacteria | 5211 |
| 849 | Ga0466958_0047500 | 3300045836 | Bacteria | 2592 |
| 850 | Ga0466958_0085191 | 3300045836 | Bacteria | 1949 |
| 851 | Ga0466958_0130082 | 3300045836 | Unclassified | 1580 |
| 852 | Ga0466958_0154575 | 3300045836 | Bacteria | 1448 |
| 853 | Ga0466958_0221517 | 3300045836 | Unclassified | 1207 |
| 854 | Ga0466967_0007477 | 3300045976 | Bacteria | 7884 |
| 855 | Ga0466967_0011797 | 3300045976 | Bacteria | 6644 |
| 856 | Ga0466967_0062028 | 3300045976 | Bacteria | 3318 |
| 857 | Ga0466967_0113070 | 3300045976 | Bacteria | 2497 |
| 858 | Ga0466967_0118782 | 3300045976 | Bacteria | 2439 |
| 859 | Ga0466967_0134561 | 3300045976 | Bacteria | 2298 |
| 860 | Ga0466967_0320165 | 3300045976 | Viruses | 1495 |
| 861 | Ga0466967_0402360 | 3300045976 | Bacteria | 1332 |
| 862 | Ga0466967_0520729 | 3300045976 | Bacteria | 1168 |
| 863 | Ga0466967_0578979 | 3300045976 | Bacteria | 1106 |
| 864 | Ga0466967_0724920 | 3300045976 | Unclassified | 985 |
| 865 | Ga0466967_0745784 | 3300045976 | Bacteria | 971 |
| 866 | Ga0466967_0778481 | 3300045976 | Unclassified | 949 |
| 867 | Ga0466967_0786938 | 3300045976 | Unclassified | 944 |
| 868 | Ga0466967_0996193 | 3300045976 | Unclassified | 834 |
| 869 | Ga0495663_0125449 | 3300046525 | Unclassified | 862 |
| 870 | Ga0495586_0392618 | 3300046535 | Unclassified | 798 |
| 871 | Ga0495598_0002244 | 3300046537 | Bacteria | 3976 |
| 872 | Ga0495621_0000972 | 3300046539 | Bacteria | 7305 |
| 873 | Ga0495633_0042594 | 3300046558 | Bacteria | 2155 |
| 874 | Ga0495668_0077275 | 3300046616 | Bacteria | 1827 |
| 875 | Ga0495623_0064093 | 3300046679 | Bacteria | 2300 |
| 876 | Ga0495669_0029165 | 3300046684 | Bacteria | 2419 |
| 877 | Ga0495669_0080319 | 3300046684 | Bacteria | 1496 |
| 878 | Ga0495669_0243949 | 3300046684 | Bacteria | 862 |
| 879 | Ga0495670_0000071 | 3300046691 | Bacteria | 45180 |
| 880 | Ga0495600_0265660 | 3300046809 | Bacteria | 1089 |
| 881 | Ga0495602_0043086 | 3300048088 | Unclassified | 4107 |
| 882 | Ga0496100_0083922 | 3300048903 | Bacteria | 2158 |
| 883 | Ga0496101_0115149 | 3300048904 | Bacteria | 2027 |
| 884 | Ga0496101_0144671 | 3300048904 | Bacteria | 1815 |
| 885 | Ga0496101_0216755 | 3300048904 | Unclassified | 1484 |
| 886 | Ga0496102_0063070 | 3300048905 | Bacteria | 3393 |
| 887 | Ga0496102_0673775 | 3300048905 | Bacteria | 957 |
| 888 | Ga0496104_0065814 | 3300048907 | Bacteria | 3440 |
| 889 | Ga0496105_0039333 | 3300048908 | Bacteria | 3898 |
| 890 | Ga0496105_0137137 | 3300048908 | Bacteria | 2015 |
| 891 | Ga0496106_0017617 | 3300048909 | Bacteria | 5284 |
| 892 | Ga0496106_0705234 | 3300048909 | Unclassified | 804 |
| 893 | Ga0496107_0011494 | 3300048910 | Bacteria | 6167 |
| 894 | Ga0496107_0189121 | 3300048910 | Unclassified | 1529 |
| 895 | Ga0496107_0316958 | 3300048910 | Bacteria | 1160 |
| 896 | Ga0496108_0006177 | 3300048911 | Bacteria | 9691 |
| 897 | Ga0496108_0034647 | 3300048911 | Bacteria | 4194 |
| 898 | Ga0496108_0046784 | 3300048911 | Bacteria | 3615 |
| 899 | Ga0496109_0021950 | 3300048912 | Bacteria | 5653 |
| 900 | Ga0496109_0034955 | 3300048912 | Bacteria | 4530 |
| 901 | Ga0496109_0068968 | 3300048912 | Bacteria | 3241 |
| 902 | Ga0496109_0219805 | 3300048912 | Bacteria | 1787 |
| 903 | Ga0496110_0013619 | 3300048913 | Bacteria | 6732 |
| 904 | Ga0496110_0427452 | 3300048913 | Unclassified | 1207 |
| 905 | Ga0496111_0005193 | 3300048914 | Bacteria | 8304 |
| 906 | Ga0496111_0007572 | 3300048914 | Bacteria | 7126 |
| 907 | Ga0496111_0029259 | 3300048914 | Bacteria | 3911 |
| 908 | Ga0496112_0012266 | 3300048915 | Bacteria | 7870 |
| 909 | Ga0496112_0054746 | 3300048915 | Bacteria | 3921 |
| 910 | Ga0496112_0095037 | 3300048915 | Bacteria | 2951 |
| 911 | Ga0496112_0163559 | 3300048915 | Bacteria | 2191 |
| 912 | Ga0496112_0263820 | 3300048915 | Bacteria | 1671 |
| 913 | Ga0496112_0264652 | 3300048915 | Bacteria | 1668 |
| 914 | Ga0496112_0886951 | 3300048915 | Bacteria | 814 |
| 915 | Ga0496113_0012069 | 3300048916 | Bacteria | 5795 |
| 916 | Ga0496113_0120879 | 3300048916 | Bacteria | 2047 |
| 917 | Ga0496113_0381671 | 3300048916 | Unclassified | 1131 |
| 918 | Ga0496113_0536789 | 3300048916 | Unclassified | 938 |
| 919 | Ga0496113_0695847 | 3300048916 | Bacteria | 811 |
| 920 | Ga0496114_0012137 | 3300048917 | Bacteria | 6894 |
| 921 | Ga0496114_0215334 | 3300048917 | Bacteria | 1685 |
| 922 | Ga0496114_0358059 | 3300048917 | Bacteria | 1291 |
| 923 | Ga0496115_0015819 | 3300048918 | Bacteria | 5729 |
| 924 | nmdc:mga0n895_901262_c1 | 3300050512 | Unclassified | 870 |
| 925 | Ga0587090_014290 | 3300059510 | Unclassified | 1159 |
| 926 | Ga0466962_0006344 | 3300061719 | Bacteria | 5677 |
| 927 | Ga0466962_0013258 | 3300061719 | Bacteria | 3964 |
| 928 | Ga0466962_0015820 | 3300061719 | Bacteria | 3640 |
| 929 | Ga0466962_0044372 | 3300061719 | Bacteria | 2126 |
| 930 | 2885429574 | 2885427238 | Bacteria | 2291351 |
| 931 | Ga0070658_10240107 | |||
| 932 | JGI24740J21852_10001126 | |||
| 933 | JGI24740J21852_10004688 | |||
| 934 | JGI24739J22299_10141477 | |||
| 935 | JGI24737J22298_10003380 | |||
| 936 | JGI24735J21928_10010414 | |||
| 937 | JGI24735J21928_10017009 | |||
| 938 | JGI24034J26672_10053221 | |||
| 939 | rootL2_10267806 | |||
| 940 | rootH1_10278953 | |||
| 941 | Ga0070658_10009104 | |||
| 942 | Ga0070658_10012256 | |||
| 943 | Ga0070658_10018898 | |||
| 944 | Ga0070658_10050982 | |||
| 945 | Ga0070658_10126304 | |||
| 946 | Ga0070658_10137343 | |||
| 947 | Ga0070658_10144517 | |||
| 948 | Ga0070658_10189803 | |||
| 949 | Ga0070658_10214334 | |||
| 950 | Ga0070658_10292776 | |||
| 951 | Ga0070658_10318734 | |||
| 952 | Ga0070658_10669328 | |||
| 953 | Ga0070676_10168981 | |||
| 954 | Ga0070676_10181160 | |||
| 955 | Ga0070676_10268988 | |||
| 956 | Ga0070676_10553910 | |||
| 957 | Ga0070683_100024323 | |||
| 958 | Ga0070683_100156382 | |||
| 959 | Ga0070683_100222484 | |||
| 960 | Ga0070683_100384525 | |||
| 961 | Ga0070683_100542599 | |||
| 962 | Ga0070683_100583260 | |||
| 963 | Ga0070670_100067994 | |||
| 964 | Ga0070670_100099710 | |||
| 965 | Ga0070670_100162474 | |||
| 966 | Ga0070670_100929619 | |||
| 967 | Ga0070670_100996201 | |||
| 968 | Ga0068869_100315233 | |||
| 969 | Ga0070666_10020324 | |||
| 970 | Ga0070666_10021333 | |||
| 971 | Ga0070666_10021757 | |||
| 972 | Ga0070666_10060975 | |||
| 973 | Ga0070666_10173313 | |||
| 974 | Ga0070680_100059955 | |||
| 975 | Ga0070680_100080167 | |||
| 976 | Ga0070680_100210135 | |||
| 977 | Ga0070680_100375654 | |||
| 978 | Ga0070682_100013855 | |||
| 979 | Ga0070682_100229221 | |||
| 980 | Ga0070682_101026883 | |||
| 981 | Ga0070682_101605724 | |||
| 982 | Ga0068868_100033262 | |||
| 983 | Ga0068868_100051631 | |||
| 984 | Ga0068868_100078620 | |||
| 985 | Ga0068868_100129706 | |||
| 986 | Ga0068868_100308483 | |||
| 987 | Ga0068868_101100384 | |||
| 988 | Ga0070660_100003053 | |||
| 989 | Ga0070660_100008261 | |||
| 990 | Ga0070660_100031936 | |||
| 991 | Ga0070660_100032328 | |||
| 992 | Ga0070660_100057071 | |||
| 993 | Ga0070660_100114235 | |||
| 994 | Ga0070660_100117222 | |||
| 995 | Ga0070660_100128950 | |||
| 996 | Ga0070660_100306813 | |||
| 997 | Ga0070660_100329855 | |||
| 998 | Ga0070660_100447868 | |||
| 999 | Ga0070660_100670327 | |||
| 1000 | Ga0070660_100713793 | |||
| 1001 | Ga0070689_101016397 | |||
| 1002 | Ga0070691_10003582 | |||
| 1003 | Ga0070661_100026533 | |||
| 1004 | Ga0070661_100056051 | |||
| 1005 | Ga0070661_100099815 | |||
| 1006 | Ga0070661_100108040 | |||
| 1007 | Ga0070661_100126363 | |||
| 1008 | Ga0070661_100133516 | |||
| 1009 | Ga0070661_100259356 | |||
| 1010 | Ga0070661_100317045 | |||
| 1011 | Ga0070661_100474986 | |||
| 1012 | Ga0070661_100485528 | |||
| 1013 | Ga0070661_100598029 | |||
| 1014 | Ga0070661_101188688 | |||
| 1015 | Ga0070692_10006534 | |||
| 1016 | Ga0070675_100049667 | |||
| 1017 | Ga0070675_100257690 | |||
| 1018 | Ga0070675_100593569 | |||
| 1019 | Ga0070671_100002090 | |||
| 1020 | Ga0070671_100015766 | |||
| 1021 | Ga0070671_100024750 | |||
| 1022 | Ga0070671_100028475 | |||
| 1023 | Ga0070671_100056433 | |||
| 1024 | Ga0070671_100059294 | |||
| 1025 | Ga0070671_100126174 | |||
| 1026 | Ga0070671_100302705 | |||
| 1027 | Ga0070671_100441765 | |||
| 1028 | Ga0070674_100018560 | |||
| 1029 | Ga0070674_100028383 | |||
| 1030 | Ga0070674_100751110 | |||
| 1031 | Ga0070673_100030023 | |||
| 1032 | Ga0070673_100039241 | |||
| 1033 | Ga0070673_100039882 | |||
| 1034 | Ga0070673_100324412 | |||
| 1035 | Ga0070659_100004452 | |||
| 1036 | Ga0070659_100009360 | |||
| 1037 | Ga0070659_100041705 | |||
| 1038 | Ga0070659_100050354 | |||
| 1039 | Ga0070659_100086992 | |||
| 1040 | Ga0070659_100095748 | |||
| 1041 | Ga0070659_100160934 | |||
| 1042 | Ga0070659_100202607 | |||
| 1043 | Ga0070659_100297472 | |||
| 1044 | Ga0070659_100341327 | |||
| 1045 | Ga0070659_100381757 | |||
| 1046 | Ga0070659_100730976 | |||
| 1047 | Ga0070659_100885051 | |||
| 1048 | Ga0070659_101235960 | |||
| 1049 | Ga0070659_101331368 | |||
| 1050 | Ga0070667_100010677 | |||
| 1051 | Ga0070667_100027546 | |||
| 1052 | Ga0070667_100029232 | |||
| 1053 | Ga0070667_100034693 | |||
| 1054 | Ga0070709_10182391 | |||
| 1055 | Ga0070714_100024648 | |||
| 1056 | Ga0070714_100051350 | |||
| 1057 | Ga0070714_100077427 | |||
| 1058 | Ga0070714_100083682 | |||
| 1059 | Ga0070714_100118908 | |||
| 1060 | Ga0070714_100124451 | |||
| 1061 | Ga0070714_100377650 | |||
| 1062 | Ga0070714_100515657 | |||
| 1063 | Ga0070713_100037787 | |||
| 1064 | Ga0070713_100060401 | |||
| 1065 | Ga0070713_100149553 | |||
| 1066 | Ga0070713_100283377 | |||
| 1067 | Ga0070710_10654621 | |||
| 1068 | Ga0070701_10056286 | |||
| 1069 | Ga0070663_100081089 | |||
| 1070 | Ga0070663_100082406 | |||
| 1071 | Ga0070663_100111579 | |||
| 1072 | Ga0070663_100117144 | |||
| 1073 | Ga0070663_100126678 | |||
| 1074 | Ga0070663_100211025 | |||
| 1075 | Ga0070663_100215665 | |||
| 1076 | Ga0070678_100031044 | |||
| 1077 | Ga0070678_100393715 | |||
| 1078 | Ga0070662_100009880 | |||
| 1079 | Ga0070662_100109917 | |||
| 1080 | Ga0070662_100122792 | |||
| 1081 | Ga0070662_100192805 | |||
| 1082 | Ga0070662_100244743 | |||
| 1083 | Ga0070662_100432791 | |||
| 1084 | Ga0070662_100543652 | |||
| 1085 | Ga0070681_10226833 | |||
| 1086 | Ga0070681_10242084 | |||
| 1087 | Ga0070681_10313255 | |||
| 1088 | Ga0070681_10356957 | |||
| 1089 | Ga0068867_100107486 | |||
| 1090 | Ga0068867_100296207 | |||
| 1091 | Ga0068867_100549656 | |||
| 1092 | Ga0068867_100758623 | |||
| 1093 | Ga0070679_100038807 | |||
| 1094 | Ga0070679_100044440 | |||
| 1095 | Ga0070679_100079195 | |||
| 1096 | Ga0070679_100416136 | |||
| 1097 | Ga0070679_100709016 | |||
| 1098 | Ga0070679_100945526 | |||
| 1099 | Ga0070684_100002671 | |||
| 1100 | Ga0070684_100034298 | |||
| 1101 | Ga0070684_100353112 | |||
| 1102 | Ga0068853_100025015 | |||
| 1103 | Ga0068853_100095736 | |||
| 1104 | Ga0068853_100164720 | |||
| 1105 | Ga0068853_100275758 | |||
| 1106 | Ga0068853_101403305 | |||
| 1107 | Ga0070672_100000461 | |||
| 1108 | Ga0070672_100275877 | |||
| 1109 | Ga0070672_100427333 | |||
| 1110 | Ga0070686_100218439 | |||
| 1111 | Ga0070686_100538375 | |||
| 1112 | Ga0070693_100071516 | |||
| 1113 | Ga0070693_100783939 | |||
| 1114 | Ga0070665_100012613 | |||
| 1115 | Ga0070665_100040150 | |||
| 1116 | Ga0070665_100169141 | |||
| 1117 | Ga0070665_100190168 | |||
| 1118 | Ga0070665_100680549 | |||
| 1119 | Ga0070665_100957088 | |||
| 1120 | Ga0068855_100115015 | |||
| 1121 | Ga0068855_100124450 | |||
| 1122 | Ga0068855_100129420 | |||
| 1123 | Ga0068855_100160692 | |||
| 1124 | Ga0068855_100174522 | |||
| 1125 | Ga0068855_100178434 | |||
| 1126 | Ga0068855_100200788 | |||
| 1127 | Ga0068855_100217838 | |||
| 1128 | Ga0068855_100515666 | |||
| 1129 | Ga0070664_100002518 | |||
| 1130 | Ga0070664_100028887 | |||
| 1131 | Ga0070664_100040831 | |||
| 1132 | Ga0070664_100047412 | |||
| 1133 | Ga0070664_100063374 | |||
| 1134 | Ga0070664_100186882 | |||
| 1135 | Ga0070664_100244736 | |||
| 1136 | Ga0068857_100000489 | |||
| 1137 | Ga0068857_100039427 | |||
| 1138 | Ga0068857_100091002 | |||
| 1139 | Ga0068857_100190905 | |||
| 1140 | Ga0068857_100303721 | |||
| 1141 | Ga0068854_100012018 | |||
| 1142 | Ga0068854_100013400 | |||
| 1143 | Ga0068854_100030482 | |||
| 1144 | Ga0068854_100033456 | |||
| 1145 | Ga0068854_100080454 | |||
| 1146 | Ga0068854_100215840 | |||
| 1147 | Ga0068854_100276267 | |||
| 1148 | Ga0068854_100279508 | |||
| 1149 | Ga0068854_100300388 | |||
| 1150 | Ga0068854_100523488 | |||
| 1151 | Ga0068854_100622269 | |||
| 1152 | Ga0068854_100958766 | |||
| 1153 | Ga0068856_100013400 | |||
| 1154 | Ga0068856_100053557 | |||
| 1155 | Ga0068856_100067154 | |||
| 1156 | Ga0068856_100107491 | |||
| 1157 | Ga0068856_100116416 | |||
| 1158 | Ga0068856_100137905 | |||
| 1159 | Ga0068856_100242001 | |||
| 1160 | Ga0068856_100244315 | |||
| 1161 | Ga0068856_100359161 | |||
| 1162 | Ga0068856_100402279 | |||
| 1163 | Ga0068856_100543609 | |||
| 1164 | Ga0068856_100674668 | |||
| 1165 | Ga0068856_100706562 | |||
| 1166 | Ga0068856_101128147 | |||
| 1167 | Ga0068856_101376511 | |||
| 1168 | Ga0068852_100004443 | |||
| 1169 | Ga0068852_100021963 | |||
| 1170 | Ga0068852_100027753 | |||
| 1171 | Ga0068852_100031074 | |||
| 1172 | Ga0068852_100034952 | |||
| 1173 | Ga0068852_100053062 | |||
| 1174 | Ga0068852_100119684 | |||
| 1175 | Ga0068852_100220790 | |||
| 1176 | Ga0068852_100222790 | |||
| 1177 | Ga0068852_100328348 | |||
| 1178 | Ga0068852_100356102 | |||
| 1179 | Ga0068852_100399636 | |||
| 1180 | Ga0068852_100435479 | |||
| 1181 | Ga0068852_100526037 | |||
| 1182 | Ga0068852_100639315 | |||
| 1183 | Ga0068859_100180501 | |||
| 1184 | Ga0068864_100051914 | |||
| 1185 | Ga0068864_100053150 | |||
| 1186 | Ga0068864_100117483 | |||
| 1187 | Ga0068864_100340250 | |||
| 1188 | Ga0068866_10020801 | |||
| 1189 | Ga0068851_10007599 | |||
| 1190 | Ga0068851_10050154 | |||
| 1191 | Ga0068851_10085228 | |||
| 1192 | Ga0068851_10135629 | |||
| 1193 | Ga0068870_10405259 | |||
| 1194 | Ga0068863_100029810 | |||
| 1195 | Ga0068863_100034080 | |||
| 1196 | Ga0068863_100046826 | |||
| 1197 | Ga0068863_100092486 | |||
| 1198 | Ga0068858_100013510 | |||
| 1199 | Ga0068858_100041013 | |||
| 1200 | Ga0068858_100193155 | |||
| 1201 | Ga0068860_100429669 | |||
| 1202 | Ga0068860_100615448 | |||
| 1203 | Ga0068862_100203121 | |||
| 1204 | Ga0081539_10030833 | |||
| 1205 | Ga0081539_10042787 | |||
| 1206 | Ga0081539_10101652 | |||
| 1207 | Ga0070717_10012042 | |||
| 1208 | Ga0070717_10832085 | |||
| 1209 | Ga0075364_10664963 | |||
| 1210 | Ga0070715_10181307 | |||
| 1211 | Ga0070716_100086756 | |||
| 1212 | Ga0075369_10199929 | |||
| 1213 | Ga0097621_100209501 | |||
| 1214 | Ga0097621_101211207 | |||
| 1215 | Ga0068871_100019390 | |||
| 1216 | Ga0068871_100079789 | |||
| 1217 | Ga0068871_100382945 | |||
| 1218 | Ga0075434_100785517 | |||
| 1219 | Ga0068865_100025105 | |||
| 1220 | Ga0068865_100086744 | |||
| 1221 | Ga0068865_100256131 | |||
| 1222 | Ga0097620_100180502 | |||
| 1223 | Ga0105240_10024420 | |||
| 1224 | Ga0105240_10087322 | |||
| 1225 | Ga0105240_10393398 | |||
| 1226 | Ga0105245_10049870 | |||
| 1227 | Ga0105245_10599849 | |||
| 1228 | Ga0105247_10116345 | |||
| 1229 | Ga0105247_10210229 | |||
| 1230 | Ga0105241_10025711 | |||
| 1231 | Ga0105241_10140856 | |||
| 1232 | Ga0105241_10742811 | |||
| 1233 | Ga0105242_10016709 | |||
| 1234 | Ga0105242_10579264 | |||
| 1235 | Ga0105248_10026359 | |||
| 1236 | Ga0105248_10038209 | |||
| 1237 | Ga0105248_10104194 | |||
| 1238 | Ga0105248_10114594 | |||
| 1239 | Ga0105248_10228183 | |||
| 1240 | Ga0105248_10490247 | |||
| 1241 | Ga0105248_10961257 | |||
| 1242 | Ga0105248_11056138 | |||
| 1243 | Ga0105237_10021095 | |||
| 1244 | Ga0105237_10142523 | |||
| 1245 | Ga0105238_10017635 | |||
| 1246 | Ga0105238_10135699 | |||
| 1247 | Ga0105238_10197199 | |||
| 1248 | Ga0105238_10236138 | |||
| 1249 | Ga0105238_10396735 | |||
| 1250 | Ga0105238_10439728 | |||
| 1251 | Ga0105238_10603691 | |||
| 1252 | Ga0105239_10027029 | |||
| 1253 | Ga0105246_10114352 | |||
| 1254 | Ga0105246_10158042 | |||
| 1255 | Ga0157373_10014198 | |||
| 1256 | Ga0157373_10014974 | |||
| 1257 | Ga0157373_10063395 | |||
| 1258 | Ga0157373_10109243 | |||
| 1259 | Ga0157373_10153236 | |||
| 1260 | Ga0157373_10238318 | |||
| 1261 | Ga0157373_10385557 | |||
| 1262 | Ga0157371_10121607 | |||
| 1263 | Ga0157371_10166613 | |||
| 1264 | Ga0157371_10489293 | |||
| 1265 | Ga0157371_10996903 | |||
| 1266 | Ga0157371_11134935 | |||
| 1267 | Ga0157371_11249529 | |||
| 1268 | Ga0157370_10002746 | |||
| 1269 | Ga0157370_10050746 | |||
| 1270 | Ga0157370_10069760 | |||
| 1271 | Ga0157370_10095543 | |||
| 1272 | Ga0157370_10133468 | |||
| 1273 | Ga0157370_10203545 | |||
| 1274 | Ga0157370_10476141 | |||
| 1275 | Ga0157370_10487620 | |||
| 1276 | Ga0157370_10530284 | |||
| 1277 | Ga0157369_10004619 | |||
| 1278 | Ga0157369_10023641 | |||
| 1279 | Ga0157369_10030800 | |||
| 1280 | Ga0157369_10034637 | |||
| 1281 | Ga0157369_10063178 | |||
| 1282 | Ga0157369_10102744 | |||
| 1283 | Ga0157369_10117807 | |||
| 1284 | Ga0157369_10160228 | |||
| 1285 | Ga0157369_10165280 | |||
| 1286 | Ga0157369_10186201 | |||
| 1287 | Ga0157369_10214914 | |||
| 1288 | Ga0157369_10303168 | |||
| 1289 | Ga0157369_10333383 | |||
| 1290 | Ga0157369_10850498 | |||
| 1291 | Ga0157369_11817098 | |||
| 1292 | Ga0157374_10021305 | |||
| 1293 | Ga0157374_10029007 | |||
| 1294 | Ga0157374_10063153 | |||
| 1295 | Ga0157374_10119412 | |||
| 1296 | Ga0157374_10293136 | |||
| 1297 | Ga0157374_10323900 | |||
| 1298 | Ga0157374_10643549 | |||
| 1299 | Ga0157378_10219689 | |||
| 1300 | Ga0157378_10480521 | |||
| 1301 | Ga0157378_10589598 | |||
| 1302 | Ga0163162_10019183 | |||
| 1303 | Ga0163162_10048537 | |||
| 1304 | Ga0163162_10287058 | |||
| 1305 | Ga0157372_10074479 | |||
| 1306 | Ga0157372_10159755 | |||
| 1307 | Ga0157372_10192727 | |||
| 1308 | Ga0157372_10206753 | |||
| 1309 | Ga0157372_10281459 | |||
| 1310 | Ga0157372_10381411 | |||
| 1311 | Ga0157372_10442817 | |||
| 1312 | Ga0157372_10448476 | |||
| 1313 | Ga0157372_11671906 | |||
| 1314 | Ga0157375_10024280 | |||
| 1315 | Ga0157375_10052650 | |||
| 1316 | Ga0157375_10439554 | |||
| 1317 | Ga0157375_10832131 | |||
| 1318 | Ga0157375_11882243 | |||
| 1319 | Ga0163163_10011842 | |||
| 1320 | Ga0163163_10034598 | |||
| 1321 | Ga0163163_10037142 | |||
| 1322 | Ga0157377_10085863 | |||
| 1323 | Ga0157379_10876979 | |||
| 1324 | Ga0157376_10302569 | |||
| 1325 | Ga0206356_11797130 | |||
| 1326 | Ga0206355_1601105 | |||
| 1327 | Ga0213876_10015773 | |||
| 1328 | Ga0207697_10155619 | |||
| 1329 | Ga0207656_10025258 | |||
| 1330 | Ga0207656_10113354 | |||
| 1331 | Ga0207656_10223640 | |||
| 1332 | Ga0207642_10011605 | |||
| 1333 | Ga0207710_10218595 | |||
| 1334 | Ga0207688_10207361 | |||
| 1335 | Ga0207680_10003692 | |||
| 1336 | Ga0207680_10010957 | |||
| 1337 | Ga0207680_10013553 | |||
| 1338 | Ga0207680_10112205 | |||
| 1339 | Ga0207647_10007000 | |||
| 1340 | Ga0207647_10014002 | |||
| 1341 | Ga0207647_10018752 | |||
| 1342 | Ga0207647_10022272 | |||
| 1343 | Ga0207647_10024348 | |||
| 1344 | Ga0207647_10036155 | |||
| 1345 | Ga0207647_10041018 | |||
| 1346 | Ga0207647_10048627 | |||
| 1347 | Ga0207647_10080059 | |||
| 1348 | Ga0207647_10089347 | |||
| 1349 | Ga0207685_10260262 | |||
| 1350 | Ga0207699_10048389 | |||
| 1351 | Ga0207645_10051000 | |||
| 1352 | Ga0207645_10110365 | |||
| 1353 | Ga0207705_10000003 | |||
| 1354 | Ga0207705_10000493 | |||
| 1355 | Ga0207705_10001025 | |||
| 1356 | Ga0207705_10009697 | |||
| 1357 | Ga0207705_10019512 | |||
| 1358 | Ga0207705_10027645 | |||
| 1359 | Ga0207705_10028284 | |||
| 1360 | Ga0207705_10037912 | |||
| 1361 | Ga0207705_10042739 | |||
| 1362 | Ga0207705_10097045 | |||
| 1363 | Ga0207705_10255496 | |||
| 1364 | Ga0207705_10268769 | |||
| 1365 | Ga0207705_10356814 | |||
| 1366 | Ga0207707_10017647 | |||
| 1367 | Ga0207707_10077183 | |||
| 1368 | Ga0207707_10209630 | |||
| 1369 | Ga0207695_10008855 | |||
| 1370 | Ga0207695_10009362 | |||
| 1371 | Ga0207695_10057313 | |||
| 1372 | Ga0207695_10315334 | |||
| 1373 | Ga0207671_10024193 | |||
| 1374 | Ga0207671_10028319 | |||
| 1375 | Ga0207660_10000770 | |||
| 1376 | Ga0207660_10003208 | |||
| 1377 | Ga0207660_10382789 | |||
| 1378 | Ga0207660_10521874 | |||
| 1379 | Ga0207657_10002261 | |||
| 1380 | Ga0207657_10003123 | |||
| 1381 | Ga0207657_10006107 | |||
| 1382 | Ga0207657_10018368 | |||
| 1383 | Ga0207657_10026360 | |||
| 1384 | Ga0207657_10040433 | |||
| 1385 | Ga0207657_10056349 | |||
| 1386 | Ga0207657_10066200 | |||
| 1387 | Ga0207657_10076653 | |||
| 1388 | Ga0207657_10109570 | |||
| 1389 | Ga0207657_10115485 | |||
| 1390 | Ga0207657_10174288 | |||
| 1391 | Ga0207657_10429289 | |||
| 1392 | Ga0207649_10006255 | |||
| 1393 | Ga0207649_10021154 | |||
| 1394 | Ga0207649_10033502 | |||
| 1395 | Ga0207649_10101062 | |||
| 1396 | Ga0207649_10135803 | |||
| 1397 | Ga0207649_10205843 | |||
| 1398 | Ga0207649_10234168 | |||
| 1399 | Ga0207649_10344207 | |||
| 1400 | Ga0207649_10525587 | |||
| 1401 | Ga0207649_10573796 | |||
| 1402 | Ga0207649_10603588 | |||
| 1403 | Ga0207652_10000034 | |||
| 1404 | Ga0207652_10151864 | |||
| 1405 | Ga0207694_10024170 | |||
| 1406 | Ga0207694_10025296 | |||
| 1407 | Ga0207694_10671482 | |||
| 1408 | Ga0207650_10087834 | |||
| 1409 | Ga0207650_10184267 | |||
| 1410 | Ga0207650_10286661 | |||
| 1411 | Ga0207650_10670192 | |||
| 1412 | Ga0207659_10207770 | |||
| 1413 | Ga0207659_10274319 | |||
| 1414 | Ga0207687_10083000 | |||
| 1415 | Ga0207700_10037272 | |||
| 1416 | Ga0207700_10053420 | |||
| 1417 | Ga0207700_10118377 | |||
| 1418 | Ga0207664_10036282 | |||
| 1419 | Ga0207664_10252888 | |||
| 1420 | Ga0207644_10000747 | |||
| 1421 | Ga0207644_10006207 | |||
| 1422 | Ga0207644_10015057 | |||
| 1423 | Ga0207644_10016318 | |||
| 1424 | Ga0207644_10016718 | |||
| 1425 | Ga0207644_10023819 | |||
| 1426 | Ga0207644_10156432 | |||
| 1427 | Ga0207644_10702358 | |||
| 1428 | Ga0207690_10008784 | |||
| 1429 | Ga0207690_10015093 | |||
| 1430 | Ga0207690_10060505 | |||
| 1431 | Ga0207690_10066579 | |||
| 1432 | Ga0207690_10152704 | |||
| 1433 | Ga0207690_10417273 | |||
| 1434 | Ga0207690_11017128 | |||
| 1435 | Ga0207706_10008319 | |||
| 1436 | Ga0207706_10019826 | |||
| 1437 | Ga0207706_10037830 | |||
| 1438 | Ga0207706_10054006 | |||
| 1439 | Ga0207706_10131582 | |||
| 1440 | Ga0207706_10233077 | |||
| 1441 | Ga0207706_10254876 | |||
| 1442 | Ga0207706_10310147 | |||
| 1443 | Ga0207706_10441557 | |||
| 1444 | Ga0207706_10541087 | |||
| 1445 | Ga0207706_10578983 | |||
| 1446 | Ga0207686_10064988 | |||
| 1447 | Ga0207670_10644647 | |||
| 1448 | Ga0207669_10027200 | |||
| 1449 | Ga0207669_10081406 | |||
| 1450 | Ga0207669_10281606 | |||
| 1451 | Ga0207704_10032107 | |||
| 1452 | Ga0207704_10975778 | |||
| 1453 | Ga0207665_10049456 | |||
| 1454 | Ga0207665_10132756 | |||
| 1455 | Ga0207691_10004673 | |||
| 1456 | Ga0207691_10005523 | |||
| 1457 | Ga0207691_10013134 | |||
| 1458 | Ga0207691_10269925 | |||
| 1459 | Ga0207711_10007240 | |||
| 1460 | Ga0207711_10007576 | |||
| 1461 | Ga0207711_10014416 | |||
| 1462 | Ga0207711_10020622 | |||
| 1463 | Ga0207711_10033837 | |||
| 1464 | Ga0207711_10204330 | |||
| 1465 | Ga0207711_10311060 | |||
| 1466 | Ga0207711_10637293 | |||
| 1467 | Ga0207711_10827109 | |||
| 1468 | Ga0207711_11044215 | |||
| 1469 | Ga0207661_10002378 | |||
| 1470 | Ga0207661_10012640 | |||
| 1471 | Ga0207661_10594680 | |||
| 1472 | Ga0207661_10737127 | |||
| 1473 | Ga0207679_10007576 | |||
| 1474 | Ga0207679_10020448 | |||
| 1475 | Ga0207679_10059420 | |||
| 1476 | Ga0207679_10069570 | |||
| 1477 | Ga0207679_10117050 | |||
| 1478 | Ga0207679_10125411 | |||
| 1479 | Ga0207679_10299494 | |||
| 1480 | Ga0207679_10478083 | |||
| 1481 | Ga0207679_10798141 | |||
| 1482 | Ga0207667_10004710 | |||
| 1483 | Ga0207667_10022167 | |||
| 1484 | Ga0207667_10026666 | |||
| 1485 | Ga0207667_10078827 | |||
| 1486 | Ga0207667_10178420 | |||
| 1487 | Ga0207667_10261594 | |||
| 1488 | Ga0207667_10313539 | |||
| 1489 | Ga0207667_10790375 | |||
| 1490 | Ga0207667_10945478 | |||
| 1491 | Ga0207667_10948104 | |||
| 1492 | Ga0207667_11219828 | |||
| 1493 | Ga0207651_10012099 | |||
| 1494 | Ga0207651_10014049 | |||
| 1495 | Ga0207651_10015757 | |||
| 1496 | Ga0207651_10017768 | |||
| 1497 | Ga0207651_10029038 | |||
| 1498 | Ga0207651_10078455 | |||
| 1499 | Ga0207640_10025603 | |||
| 1500 | Ga0207640_10037577 | |||
| 1501 | Ga0207640_10095945 | |||
| 1502 | Ga0207640_10153773 | |||
| 1503 | Ga0207640_10177872 | |||
| 1504 | Ga0207640_10219580 | |||
| 1505 | Ga0207640_10522418 | |||
| 1506 | Ga0207640_10707786 | |||
| 1507 | Ga0207640_11116681 | |||
| 1508 | Ga0207658_10013412 | |||
| 1509 | Ga0207658_10065328 | |||
| 1510 | Ga0207658_10309592 | |||
| 1511 | Ga0207658_10405856 | |||
| 1512 | Ga0207677_10006373 | |||
| 1513 | Ga0207677_10081189 | |||
| 1514 | Ga0207677_10150836 | |||
| 1515 | Ga0207677_10174809 | |||
| 1516 | Ga0207677_11277365 | |||
| 1517 | Ga0207703_10012807 | |||
| 1518 | Ga0207703_10028733 | |||
| 1519 | Ga0207703_10112271 | |||
| 1520 | Ga0207703_10288547 | |||
| 1521 | Ga0207639_10000923 | |||
| 1522 | Ga0207639_10001159 | |||
| 1523 | Ga0207639_10706898 | |||
| 1524 | Ga0207639_10866551 | |||
| 1525 | Ga0207639_10917004 | |||
| 1526 | Ga0207678_10006063 | |||
| 1527 | Ga0207678_10009081 | |||
| 1528 | Ga0207678_10046333 | |||
| 1529 | Ga0207678_10053830 | |||
| 1530 | Ga0207678_10055524 | |||
| 1531 | Ga0207678_10138920 | |||
| 1532 | Ga0207678_10143449 | |||
| 1533 | Ga0207678_10164425 | |||
| 1534 | Ga0207678_10558145 | |||
| 1535 | Ga0207678_10617858 | |||
| 1536 | Ga0207702_10002063 | |||
| 1537 | Ga0207702_10019681 | |||
| 1538 | Ga0207702_10025645 | |||
| 1539 | Ga0207702_10059906 | |||
| 1540 | Ga0207702_10060514 | |||
| 1541 | Ga0207702_10074449 | |||
| 1542 | Ga0207702_10177756 | |||
| 1543 | Ga0207702_10221564 | |||
| 1544 | Ga0207702_10244287 | |||
| 1545 | Ga0207702_10330691 | |||
| 1546 | Ga0207641_10073824 | |||
| 1547 | Ga0207641_10710167 | |||
| 1548 | Ga0207648_10008762 | |||
| 1549 | Ga0207648_10010578 | |||
| 1550 | Ga0207648_10088236 | |||
| 1551 | Ga0207648_10348933 | |||
| 1552 | Ga0207676_10033010 | |||
| 1553 | Ga0207676_10093212 | |||
| 1554 | Ga0207676_10233662 | |||
| 1555 | Ga0207676_10277997 | |||
| 1556 | Ga0207674_10006843 | |||
| 1557 | Ga0207674_10012374 | |||
| 1558 | Ga0207674_10077107 | |||
| 1559 | Ga0207674_10080912 | |||
| 1560 | Ga0207674_10115084 | |||
| 1561 | Ga0207674_10157321 | |||
| 1562 | Ga0207674_10193343 | |||
| 1563 | Ga0207674_10818294 | |||
| 1564 | Ga0207674_11400548 | |||
| 1565 | Ga0207683_10014680 | |||
| 1566 | Ga0207683_10021530 | |||
| 1567 | Ga0207683_10222611 | |||
| 1568 | Ga0207698_10000896 | |||
| 1569 | Ga0207698_10003271 | |||
| 1570 | Ga0207698_10006737 | |||
| 1571 | Ga0207698_10008977 | |||
| 1572 | Ga0207698_10022783 | |||
| 1573 | Ga0207698_10035355 | |||
| 1574 | Ga0207698_10043850 | |||
| 1575 | Ga0207698_10216528 | |||
| 1576 | Ga0207698_10219416 | |||
| 1577 | Ga0207698_10310425 | |||
| 1578 | Ga0207698_10535537 | |||
| 1579 | Ga0207698_10746658 | |||
| 1580 | Ga0207698_10975881 | |||
| 1581 | Ga0207698_11139976 | |||
| 1582 | Ga0207698_12055493 | |||
| 1583 | Ga0268266_10000767 | |||
| 1584 | Ga0268266_10029135 | |||
| 1585 | Ga0268266_10045135 | |||
| 1586 | Ga0268266_10212037 | |||
| 1587 | Ga0268266_10665544 | |||
| 1588 | Ga0268266_11375540 | |||
| 1589 | Ga0268265_10363928 | |||
| 1590 | Ga0268264_10266424 | |||
| 1591 | Ga0268264_10399541 | |||
| 1592 | Ga0307408_100039656 | |||
| 1593 | Ga0307405_10148856 | |||
| 1594 | Ga0307413_10014680 | |||
| 1595 | Ga0307413_10035173 | |||
| 1596 | Ga0307410_10010532 | |||
| 1597 | Ga0307410_10031141 | |||
| 1598 | Ga0307410_10128545 | |||
| 1599 | Ga0307406_10101720 | |||
| 1600 | Ga0307406_10547227 | |||
| 1601 | Ga0307407_10105882 | |||
| 1602 | Ga0307407_10218692 | |||
| 1603 | Ga0307412_10154743 | |||
| 1604 | Ga0307409_100031493 | |||
| 1605 | Ga0307409_100115218 | |||
| 1606 | Ga0307409_100148144 | |||
| 1607 | Ga0307416_100020756 | |||
| 1608 | Ga0307416_100023349 | |||
| 1609 | Ga0307414_10009432 | |||
| 1610 | Ga0307414_10040743 | |||
| 1611 | Ga0307414_10391625 | |||
| 1612 | Ga0307411_10007591 | |||
| 1613 | Ga0307411_10024440 | |||
| 1614 | Ga0307411_10119092 | |||
| 1615 | Ga0307415_100004410 | |||
| 1616 | Ga0307415_100066475 | |||
| 1617 | Ga0373923_0112263 | |||
| 1618 | Ga0373954_0049544 | |||
| 1619 | Ga0373956_0097486 | |||
| 1620 | Ga0373960_0244112 | |||
| 1621 | Ga0373946_0050901 | |||
| 1622 | Ga0373931_0094472 | |||
| 1623 | Ga0373935_0153284 | |||
| 1624 | Ga0373933_0014251 | |||
| 1625 | Ga0373933_0653287 | |||
| 1626 | Ga0373947_0577649 | |||
| 1627 | Ga0373937_0004829 | |||
| 1628 | Ga0395899_0021048 | |||
| 1629 | Ga0395899_0036604 | |||
| 1630 | Ga0395899_0042007 | |||
| 1631 | Ga0395899_0048839 | |||
| 1632 | Ga0395899_0050645 | |||
| 1633 | Ga0395899_0051337 | |||
| 1634 | Ga0395899_0053501 | |||
| 1635 | Ga0395899_0090055 | |||
| 1636 | Ga0395899_0102274 | |||
| 1637 | Ga0395899_0162413 | |||
| 1638 | Ga0395899_0194735 | |||
| 1639 | Ga0395899_0213622 | |||
| 1640 | Ga0395899_0285816 | |||
| 1641 | Ga0395899_0292103 | |||
| 1642 | Ga0395900_0003085 | |||
| 1643 | Ga0395900_0009276 | |||
| 1644 | Ga0395900_0010484 | |||
| 1645 | Ga0395900_0030431 | |||
| 1646 | Ga0395900_0030498 | |||
| 1647 | Ga0395900_0050997 | |||
| 1648 | Ga0395900_0053926 | |||
| 1649 | Ga0395900_0062637 | |||
| 1650 | Ga0395900_0073419 | |||
| 1651 | Ga0395900_0088171 | |||
| 1652 | Ga0395900_0102036 | |||
| 1653 | Ga0395900_0115343 | |||
| 1654 | Ga0395900_0130385 | |||
| 1655 | Ga0395900_0131903 | |||
| 1656 | Ga0395900_0133413 | |||
| 1657 | Ga0395900_0164577 | |||
| 1658 | Ga0395900_0172571 | |||
| 1659 | Ga0395900_0262255 | |||
| 1660 | Ga0395900_0308123 | |||
| 1661 | Ga0395900_0415743 | |||
| 1662 | Ga0395900_0505633 | |||
| 1663 | Ga0395900_0542483 | |||
| 1664 | Ga0395900_0572365 | |||
| 1665 | Ga0395900_0694432 | |||
| 1666 | Ga0395900_1028220 | |||
| 1667 | Ga0395900_1333342 | |||
| 1668 | Ga0395898_0011721 | |||
| 1669 | Ga0395898_0015329 | |||
| 1670 | Ga0395898_0019188 | |||
| 1671 | Ga0395898_0025785 | |||
| 1672 | Ga0395898_0053789 | |||
| 1673 | Ga0395898_0055306 | |||
| 1674 | Ga0395898_0087550 | |||
| 1675 | Ga0395898_0178684 | |||
| 1676 | Ga0395898_0217297 | |||
| 1677 | Ga0395898_0226204 | |||
| 1678 | Ga0395898_0337753 | |||
| 1679 | Ga0395898_0381880 | |||
| 1680 | Ga0395898_0678779 | |||
| 1681 | Ga0395898_0689444 | |||
| 1682 | Ga0395905_0001169 | |||
| 1683 | Ga0395905_0001983 | |||
| 1684 | Ga0395905_0006012 | |||
| 1685 | Ga0395905_0006135 | |||
| 1686 | Ga0395905_0008256 | |||
| 1687 | Ga0395905_0028510 | |||
| 1688 | Ga0395905_0033050 | |||
| 1689 | Ga0395905_0033437 | |||
| 1690 | Ga0395905_0034571 | |||
| 1691 | Ga0395905_0037838 | |||
| 1692 | Ga0395905_0045884 | |||
| 1693 | Ga0395905_0051435 | |||
| 1694 | Ga0395905_0057078 | |||
| 1695 | Ga0395905_0062402 | |||
| 1696 | Ga0395905_0084238 | |||
| 1697 | Ga0395905_0092392 | |||
| 1698 | Ga0395905_0128774 | |||
| 1699 | Ga0395905_0144847 | |||
| 1700 | Ga0395905_0212009 | |||
| 1701 | Ga0395905_0294178 | |||
| 1702 | Ga0395905_0413108 | |||
| 1703 | Ga0395905_0433132 | |||
| 1704 | Ga0395905_0543099 | |||
| 1705 | Ga0395905_0647645 | |||
| 1706 | Ga0395905_0665994 | |||
| 1707 | Ga0395905_0667690 | |||
| 1708 | Ga0395905_0945837 | |||
| 1709 | Ga0395905_0999755 | |||
| 1710 | Ga0395905_1223661 | |||
| 1711 | Ga0395901_0006031 | |||
| 1712 | Ga0395901_0028506 | |||
| 1713 | Ga0395901_0050004 | |||
| 1714 | Ga0395901_0067878 | |||
| 1715 | Ga0395901_0082714 | |||
| 1716 | Ga0395901_0101199 | |||
| 1717 | Ga0395901_0106570 | |||
| 1718 | Ga0395901_0115762 | |||
| 1719 | Ga0395901_0116588 | |||
| 1720 | Ga0395901_0121033 | |||
| 1721 | Ga0395901_0125924 | |||
| 1722 | Ga0395901_0130740 | |||
| 1723 | Ga0395901_0133252 | |||
| 1724 | Ga0395901_0175992 | |||
| 1725 | Ga0395901_0230494 | |||
| 1726 | Ga0395901_0319888 | |||
| 1727 | Ga0395901_0347379 | |||
| 1728 | Ga0395901_0440675 | |||
| 1729 | Ga0395901_0495449 | |||
| 1730 | Ga0395901_0508607 | |||
| 1731 | Ga0395901_0554006 | |||
| 1732 | Ga0395901_0602161 | |||
| 1733 | Ga0395901_0642761 | |||
| 1734 | Ga0395901_0777050 | |||
| 1735 | Ga0395901_0902722 | |||
| 1736 | Ga0436365_0481817 | |||
| 1737 | Ga0439448_0004598 | |||
| 1738 | Ga0439458_0000480 | |||
| 1739 | Ga0439458_0001207 | |||
| 1740 | Ga0439458_0007205 | |||
| 1741 | Ga0466969_0053154 | |||
| 1742 | Ga0466972_0119841 | |||
| 1743 | Ga0466966_0000001 | |||
| 1744 | Ga0466966_0010135 | |||
| 1745 | Ga0466966_0045027 | |||
| 1746 | Ga0466966_0050485 | |||
| 1747 | Ga0466966_0102144 | |||
| 1748 | Ga0466966_0705909 | |||
| 1749 | Ga0466961_0009876 | |||
| 1750 | Ga0466961_0168457 | |||
| 1751 | Ga0466963_0006272 | |||
| 1752 | Ga0466963_0010178 | |||
| 1753 | Ga0466963_0150551 | |||
| 1754 | Ga0466963_0378012 | |||
| 1755 | Ga0466963_0467005 | |||
| 1756 | Ga0466964_0059314 | |||
| 1757 | Ga0466964_0347434 | |||
| 1758 | Ga0466971_0064787 | |||
| 1759 | Ga0466971_0241360 | |||
| 1760 | Ga0466970_0008343 | |||
| 1761 | Ga0466970_0033889 | |||
| 1762 | Ga0466957_0000183 | |||
| 1763 | Ga0466957_0008937 | |||
| 1764 | Ga0466957_0011371 | |||
| 1765 | Ga0466957_0128657 | |||
| 1766 | Ga0466957_0172057 | |||
| 1767 | Ga0466957_0469958 | |||
| 1768 | Ga0466957_0480373 | |||
| 1769 | Ga0466957_0560413 | |||
| 1770 | Ga0466957_0575264 | |||
| 1771 | Ga0466960_0013146 | |||
| 1772 | Ga0466960_0158182 | |||
| 1773 | Ga0466959_0004304 | |||
| 1774 | Ga0466959_0083054 | |||
| 1775 | Ga0466959_0089032 | |||
| 1776 | Ga0466959_0103432 | |||
| 1777 | Ga0466959_0132379 | |||
| 1778 | Ga0466958_0010395 | |||
| 1779 | Ga0466958_0047500 | |||
| 1780 | Ga0466958_0085191 | |||
| 1781 | Ga0466958_0130082 | |||
| 1782 | Ga0466958_0154575 | |||
| 1783 | Ga0466958_0221517 | |||
| 1784 | Ga0466967_0007477 | |||
| 1785 | Ga0466967_0011797 | |||
| 1786 | Ga0466967_0062028 | |||
| 1787 | Ga0466967_0113070 | |||
| 1788 | Ga0466967_0118782 | |||
| 1789 | Ga0466967_0134561 | |||
| 1790 | Ga0466967_0320165 | |||
| 1791 | Ga0466967_0402360 | |||
| 1792 | Ga0466967_0520729 | |||
| 1793 | Ga0466967_0578979 | |||
| 1794 | Ga0466967_0724920 | |||
| 1795 | Ga0466967_0745784 | |||
| 1796 | Ga0466967_0778481 | |||
| 1797 | Ga0466967_0786938 | |||
| 1798 | Ga0466967_0996193 | |||
| 1799 | Ga0495663_0125449 | |||
| 1800 | Ga0495586_0392618 | |||
| 1801 | Ga0495598_0002244 | |||
| 1802 | Ga0495621_0000972 | |||
| 1803 | Ga0495633_0042594 | |||
| 1804 | Ga0495668_0077275 | |||
| 1805 | Ga0495623_0064093 | |||
| 1806 | Ga0495669_0029165 | |||
| 1807 | Ga0495669_0080319 | |||
| 1808 | Ga0495669_0243949 | |||
| 1809 | Ga0495670_0000071 | |||
| 1810 | Ga0495600_0265660 | |||
| 1811 | Ga0495602_0043086 | |||
| 1812 | Ga0496100_0083922 | |||
| 1813 | Ga0496101_0115149 | |||
| 1814 | Ga0496101_0144671 | |||
| 1815 | Ga0496101_0216755 | |||
| 1816 | Ga0496102_0063070 | |||
| 1817 | Ga0496102_0673775 | |||
| 1818 | Ga0496104_0065814 | |||
| 1819 | Ga0496105_0039333 | |||
| 1820 | Ga0496105_0137137 | |||
| 1821 | Ga0496106_0017617 | |||
| 1822 | Ga0496106_0705234 | |||
| 1823 | Ga0496107_0011494 | |||
| 1824 | Ga0496107_0189121 | |||
| 1825 | Ga0496107_0316958 | |||
| 1826 | Ga0496108_0006177 | |||
| 1827 | Ga0496108_0034647 | |||
| 1828 | Ga0496108_0046784 | |||
| 1829 | Ga0496109_0021950 | |||
| 1830 | Ga0496109_0034955 | |||
| 1831 | Ga0496109_0068968 | |||
| 1832 | Ga0496109_0219805 | |||
| 1833 | Ga0496110_0013619 | |||
| 1834 | Ga0496110_0427452 | |||
| 1835 | Ga0496111_0005193 | |||
| 1836 | Ga0496111_0007572 | |||
| 1837 | Ga0496111_0029259 | |||
| 1838 | Ga0496112_0012266 | |||
| 1839 | Ga0496112_0054746 | |||
| 1840 | Ga0496112_0095037 | |||
| 1841 | Ga0496112_0163559 | |||
| 1842 | Ga0496112_0263820 | |||
| 1843 | Ga0496112_0264652 | |||
| 1844 | Ga0496112_0886951 | |||
| 1845 | Ga0496113_0012069 | |||
| 1846 | Ga0496113_0120879 | |||
| 1847 | Ga0496113_0381671 | |||
| 1848 | Ga0496113_0536789 | |||
| 1849 | Ga0496113_0695847 | |||
| 1850 | Ga0496114_0012137 | |||
| 1851 | Ga0496114_0215334 | |||
| 1852 | Ga0496114_0358059 | |||
| 1853 | Ga0496115_0015819 | |||
| 1854 | nmdc:mga0n895_901262_c1 | |||
| 1855 | Ga0587090_014290 | |||
| 1856 | Ga0466962_0006344 | |||
| 1857 | Ga0466962_0013258 | |||
| 1858 | Ga0466962_0015820 | |||
| 1859 | Ga0466962_0044372 | |||
| 1860 | 2885429574 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy