F486010

General Info

Members Datasets Scaffolds Average Seq Length
930 223 1860 171

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10240107|Ga0070658_102401072
Length 184
Sequence MIGLGEAGAIPMSDVLLFERAAPSFAASLARRGHHIVYRANESNHCPGCGRSHWYIGRISAECGFCGTAVPLAETSVVEAAPHSSRPKASVTSADQRRFPRMPAKGRKLQLLIDGSPASFALQDISEGGVRGKTAPELVPGAKVHVRFEGGILVPAVVKWAEKGLVGLAFIDPIILDRSAQRQS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.32
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 4.52
Rhizosphere 94.73
Stem 0
Stem Tuber 0.11
Unclassified 14.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10240107 3300005327 Bacteria 1536
2 JGI24740J21852_10001126 3300001979 Bacteria 12102
3 JGI24740J21852_10004688 3300001979 Bacteria 5857
4 JGI24739J22299_10141477 3300001989 Bacteria 713
5 JGI24737J22298_10003380 3300001990 Bacteria 5642
6 JGI24735J21928_10010414 3300002067 Bacteria 2965
7 JGI24735J21928_10017009 3300002067 Bacteria 2251
8 JGI24034J26672_10053221 3300002239 Bacteria 699
9 rootL2_10267806 3300003322 Unclassified 1031
10 rootH1_10278953 3300003323 Bacteria 1737
11 Ga0070658_10009104 3300005327 Bacteria 7985
12 Ga0070658_10012256 3300005327 Bacteria 6882
13 Ga0070658_10018898 3300005327 Bacteria 5521
14 Ga0070658_10050982 3300005327 Bacteria 3354
15 Ga0070658_10126304 3300005327 Bacteria 2129
16 Ga0070658_10137343 3300005327 Bacteria 2041
17 Ga0070658_10144517 3300005327 Unclassified 1988
18 Ga0070658_10189803 3300005327 Bacteria 1732
19 Ga0070658_10214334 3300005327 Bacteria 1627
20 Ga0070658_10292776 3300005327 Bacteria 1387
21 Ga0070658_10318734 3300005327 Bacteria 1327
22 Ga0070658_10669328 3300005327 Bacteria 901
23 Ga0070676_10168981 3300005328 Bacteria 1413
24 Ga0070676_10181160 3300005328 Bacteria 1370
25 Ga0070676_10268988 3300005328 Bacteria 1144
26 Ga0070676_10553910 3300005328 Bacteria 823
27 Ga0070683_100024323 3300005329 Bacteria 5424
28 Ga0070683_100156382 3300005329 Bacteria 2162
29 Ga0070683_100222484 3300005329 Unclassified 1794
30 Ga0070683_100384525 3300005329 Bacteria 1337
31 Ga0070683_100542599 3300005329 Bacteria 1112
32 Ga0070683_100583260 3300005329 Bacteria 1069
33 Ga0070670_100067994 3300005331 Bacteria 3057
34 Ga0070670_100099710 3300005331 Bacteria 2499
35 Ga0070670_100162474 3300005331 Bacteria 1936
36 Ga0070670_100929619 3300005331 Bacteria 789
37 Ga0070670_100996201 3300005331 Bacteria 762
38 Ga0068869_100315233 3300005334 Unclassified 1267
39 Ga0070666_10020324 3300005335 Bacteria 4291
40 Ga0070666_10021333 3300005335 Bacteria 4198
41 Ga0070666_10021757 3300005335 Bacteria 4156
42 Ga0070666_10060975 3300005335 Bacteria 2553
43 Ga0070666_10173313 3300005335 Bacteria 1511
44 Ga0070680_100059955 3300005336 Bacteria 3114
45 Ga0070680_100080167 3300005336 Bacteria 2692
46 Ga0070680_100210135 3300005336 Bacteria 1642
47 Ga0070680_100375654 3300005336 Bacteria 1210
48 Ga0070682_100013855 3300005337 Bacteria 4649
49 Ga0070682_100229221 3300005337 Bacteria 1327
50 Ga0070682_101026883 3300005337 Unclassified 686
51 Ga0070682_101605724 3300005337 Bacteria 562
52 Ga0068868_100033262 3300005338 Bacteria 3973
53 Ga0068868_100051631 3300005338 Bacteria 3236
54 Ga0068868_100078620 3300005338 Bacteria 2641
55 Ga0068868_100129706 3300005338 Bacteria 2062
56 Ga0068868_100308483 3300005338 Bacteria 1346
57 Ga0068868_101100384 3300005338 Bacteria 731
58 Ga0070660_100003053 3300005339 Bacteria 11523
59 Ga0070660_100008261 3300005339 Bacteria 7275
60 Ga0070660_100031936 3300005339 Bacteria 3959
61 Ga0070660_100032328 3300005339 Bacteria 3936
62 Ga0070660_100057071 3300005339 Bacteria 3023
63 Ga0070660_100114235 3300005339 Bacteria 2151
64 Ga0070660_100117222 3300005339 Bacteria 2124
65 Ga0070660_100128950 3300005339 Bacteria 2023
66 Ga0070660_100306813 3300005339 Bacteria 1302
67 Ga0070660_100329855 3300005339 Unclassified 1254
68 Ga0070660_100447868 3300005339 Bacteria 1071
69 Ga0070660_100670327 3300005339 Bacteria 869
70 Ga0070660_100713793 3300005339 Bacteria 841
71 Ga0070689_101016397 3300005340 Unclassified 738
72 Ga0070691_10003582 3300005341 Bacteria 7010
73 Ga0070661_100026533 3300005344 Bacteria 4167
74 Ga0070661_100056051 3300005344 Bacteria 2886
75 Ga0070661_100099815 3300005344 Unclassified 2158
76 Ga0070661_100108040 3300005344 Bacteria 2075
77 Ga0070661_100126363 3300005344 Bacteria 1918
78 Ga0070661_100133516 3300005344 Bacteria 1866
79 Ga0070661_100259356 3300005344 Unclassified 1343
80 Ga0070661_100317045 3300005344 Bacteria 1217
81 Ga0070661_100474986 3300005344 Bacteria 998
82 Ga0070661_100485528 3300005344 Bacteria 987
83 Ga0070661_100598029 3300005344 Bacteria 891
84 Ga0070661_101188688 3300005344 Unclassified 637
85 Ga0070692_10006534 3300005345 Bacteria 5069
86 Ga0070675_100049667 3300005354 Bacteria 3443
87 Ga0070675_100257690 3300005354 Bacteria 1528
88 Ga0070675_100593569 3300005354 Bacteria 1004
89 Ga0070671_100002090 3300005355 Bacteria 15383
90 Ga0070671_100015766 3300005355 Bacteria 6106
91 Ga0070671_100024750 3300005355 Bacteria 4917
92 Ga0070671_100028475 3300005355 Bacteria 4600
93 Ga0070671_100056433 3300005355 Bacteria 3267
94 Ga0070671_100059294 3300005355 Unclassified 3185
95 Ga0070671_100126174 3300005355 Bacteria 2154
96 Ga0070671_100302705 3300005355 Bacteria 1361
97 Ga0070671_100441765 3300005355 Unclassified 1115
98 Ga0070674_100018560 3300005356 Bacteria 4401
99 Ga0070674_100028383 3300005356 Bacteria 3675
100 Ga0070674_100751110 3300005356 Bacteria 838
101 Ga0070673_100030023 3300005364 Bacteria 4062
102 Ga0070673_100039241 3300005364 Bacteria 3622
103 Ga0070673_100039882 3300005364 Bacteria 3598
104 Ga0070673_100324412 3300005364 Unclassified 1361
105 Ga0070659_100004452 3300005366 Bacteria 10009
106 Ga0070659_100009360 3300005366 Bacteria 7195
107 Ga0070659_100041705 3300005366 Bacteria 3588
108 Ga0070659_100050354 3300005366 Bacteria 3274
109 Ga0070659_100086992 3300005366 Bacteria 2502
110 Ga0070659_100095748 3300005366 Bacteria 2384
111 Ga0070659_100160934 3300005366 Bacteria 1835
112 Ga0070659_100202607 3300005366 Bacteria 1634
113 Ga0070659_100297472 3300005366 Unclassified 1345
114 Ga0070659_100341327 3300005366 Bacteria 1255
115 Ga0070659_100381757 3300005366 Bacteria 1187
116 Ga0070659_100730976 3300005366 Unclassified 857
117 Ga0070659_100885051 3300005366 Bacteria 780
118 Ga0070659_101235960 3300005366 Unclassified 661
119 Ga0070659_101331368 3300005366 Unclassified 637
120 Ga0070667_100010677 3300005367 Bacteria 7587
121 Ga0070667_100027546 3300005367 Bacteria 4728
122 Ga0070667_100029232 3300005367 Bacteria 4591
123 Ga0070667_100034693 3300005367 Bacteria 4223
124 Ga0070709_10182391 3300005434 Bacteria 1475
125 Ga0070714_100024648 3300005435 Bacteria 4957
126 Ga0070714_100051350 3300005435 Bacteria 3514
127 Ga0070714_100077427 3300005435 Bacteria 2889
128 Ga0070714_100083682 3300005435 Bacteria 2783
129 Ga0070714_100118908 3300005435 Bacteria 2348
130 Ga0070714_100124451 3300005435 Bacteria 2297
131 Ga0070714_100377650 3300005435 Bacteria 1336
132 Ga0070714_100515657 3300005435 Bacteria 1141
133 Ga0070713_100037787 3300005436 Bacteria 3905
134 Ga0070713_100060401 3300005436 Bacteria 3168
135 Ga0070713_100149553 3300005436 Bacteria 2076
136 Ga0070713_100283377 3300005436 Bacteria 1521
137 Ga0070710_10654621 3300005437 Bacteria 737
138 Ga0070701_10056286 3300005438 Bacteria 2057
139 Ga0070663_100081089 3300005455 Bacteria 2384
140 Ga0070663_100082406 3300005455 Bacteria 2366
141 Ga0070663_100111579 3300005455 Bacteria 2055
142 Ga0070663_100117144 3300005455 Unclassified 2008
143 Ga0070663_100126678 3300005455 Bacteria 1935
144 Ga0070663_100211025 3300005455 Unclassified 1520
145 Ga0070663_100215665 3300005455 Bacteria 1505
146 Ga0070678_100031044 3300005456 Bacteria 3680
147 Ga0070678_100393715 3300005456 Unclassified 1202
148 Ga0070662_100009880 3300005457 Bacteria 6251
149 Ga0070662_100109917 3300005457 Bacteria 2098
150 Ga0070662_100122792 3300005457 Bacteria 1992
151 Ga0070662_100192805 3300005457 Unclassified 1613
152 Ga0070662_100244743 3300005457 Bacteria 1439
153 Ga0070662_100432791 3300005457 Bacteria 1090
154 Ga0070662_100543652 3300005457 Bacteria 973
155 Ga0070681_10226833 3300005458 Bacteria 1783
156 Ga0070681_10242084 3300005458 Unclassified 1717
157 Ga0070681_10313255 3300005458 Bacteria 1479
158 Ga0070681_10356957 3300005458 Bacteria 1372
159 Ga0068867_100107486 3300005459 Bacteria 2138
160 Ga0068867_100296207 3300005459 Bacteria 1332
161 Ga0068867_100549656 3300005459 Bacteria 1000
162 Ga0068867_100758623 3300005459 Bacteria 862
163 Ga0070679_100038807 3300005530 Bacteria 4735
164 Ga0070679_100044440 3300005530 Bacteria 4425
165 Ga0070679_100079195 3300005530 Bacteria 3275
166 Ga0070679_100416136 3300005530 Unclassified 1290
167 Ga0070679_100709016 3300005530 Bacteria 949
168 Ga0070679_100945526 3300005530 Bacteria 805
169 Ga0070684_100002671 3300005535 Bacteria 13167
170 Ga0070684_100034298 3300005535 Bacteria 4338
171 Ga0070684_100353112 3300005535 Bacteria 1352
172 Ga0068853_100025015 3300005539 Bacteria 5010
173 Ga0068853_100095736 3300005539 Bacteria 2618
174 Ga0068853_100164720 3300005539 Bacteria 2003
175 Ga0068853_100275758 3300005539 Bacteria 1549
176 Ga0068853_101403305 3300005539 Bacteria 675
177 Ga0070672_100000461 3300005543 Bacteria 23612
178 Ga0070672_100275877 3300005543 Bacteria 1420
179 Ga0070672_100427333 3300005543 Bacteria 1138
180 Ga0070686_100218439 3300005544 Bacteria 1376
181 Ga0070686_100538375 3300005544 Unclassified 912
182 Ga0070693_100071516 3300005547 Unclassified 2044
183 Ga0070693_100783939 3300005547 Unclassified 705
184 Ga0070665_100012613 3300005548 Bacteria 8508
185 Ga0070665_100040150 3300005548 Bacteria 4704
186 Ga0070665_100169141 3300005548 Bacteria 2187
187 Ga0070665_100190168 3300005548 Bacteria 2054
188 Ga0070665_100680549 3300005548 Unclassified 1042
189 Ga0070665_100957088 3300005548 Bacteria 869
190 Ga0068855_100115015 3300005563 Bacteria 3084
191 Ga0068855_100124450 3300005563 Bacteria 2949
192 Ga0068855_100129420 3300005563 Bacteria 2884
193 Ga0068855_100160692 3300005563 Bacteria 2550
194 Ga0068855_100174522 3300005563 Bacteria 2433
195 Ga0068855_100178434 3300005563 Bacteria 2402
196 Ga0068855_100200788 3300005563 Bacteria 2244
197 Ga0068855_100217838 3300005563 Unclassified 2142
198 Ga0068855_100515666 3300005563 Bacteria 1297
199 Ga0070664_100002518 3300005564 Bacteria 14767
200 Ga0070664_100028887 3300005564 Bacteria 4618
201 Ga0070664_100040831 3300005564 Bacteria 3913
202 Ga0070664_100047412 3300005564 Bacteria 3629
203 Ga0070664_100063374 3300005564 Bacteria 3152
204 Ga0070664_100186882 3300005564 Bacteria 1844
205 Ga0070664_100244736 3300005564 Bacteria 1611
206 Ga0068857_100000489 3300005577 Bacteria 28341
207 Ga0068857_100039427 3300005577 Bacteria 4184
208 Ga0068857_100091002 3300005577 Bacteria 2730
209 Ga0068857_100190905 3300005577 Bacteria 1866
210 Ga0068857_100303721 3300005577 Bacteria 1471
211 Ga0068854_100012018 3300005578 Bacteria 5658
212 Ga0068854_100013400 3300005578 Bacteria 5380
213 Ga0068854_100030482 3300005578 Bacteria 3741
214 Ga0068854_100033456 3300005578 Bacteria 3584
215 Ga0068854_100080454 3300005578 Bacteria 2404
216 Ga0068854_100215840 3300005578 Bacteria 1515
217 Ga0068854_100276267 3300005578 Bacteria 1351
218 Ga0068854_100279508 3300005578 Unclassified 1343
219 Ga0068854_100300388 3300005578 Bacteria 1298
220 Ga0068854_100523488 3300005578 Bacteria 1002
221 Ga0068854_100622269 3300005578 Bacteria 924
222 Ga0068854_100958766 3300005578 Bacteria 755
223 Ga0068856_100013400 3300005614 Bacteria 7938
224 Ga0068856_100053557 3300005614 Bacteria 3978
225 Ga0068856_100067154 3300005614 Bacteria 3544
226 Ga0068856_100107491 3300005614 Bacteria 2785
227 Ga0068856_100116416 3300005614 Bacteria 2673
228 Ga0068856_100137905 3300005614 Bacteria 2445
229 Ga0068856_100242001 3300005614 Bacteria 1819
230 Ga0068856_100244315 3300005614 Bacteria 1810
231 Ga0068856_100359161 3300005614 Bacteria 1475
232 Ga0068856_100402279 3300005614 Bacteria 1389
233 Ga0068856_100543609 3300005614 Bacteria 1183
234 Ga0068856_100674668 3300005614 Bacteria 1054
235 Ga0068856_100706562 3300005614 Bacteria 1028
236 Ga0068856_101128147 3300005614 Bacteria 801
237 Ga0068856_101376511 3300005614 Bacteria 720
238 Ga0068852_100004443 3300005616 Bacteria 9913
239 Ga0068852_100021963 3300005616 Bacteria 5108
240 Ga0068852_100027753 3300005616 Bacteria 4619
241 Ga0068852_100031074 3300005616 Bacteria 4402
242 Ga0068852_100034952 3300005616 Bacteria 4187
243 Ga0068852_100053062 3300005616 Bacteria 3488
244 Ga0068852_100119684 3300005616 Bacteria 2408
245 Ga0068852_100220790 3300005616 Bacteria 1802
246 Ga0068852_100222790 3300005616 Bacteria 1794
247 Ga0068852_100328348 3300005616 Bacteria 1488
248 Ga0068852_100356102 3300005616 Bacteria 1430
249 Ga0068852_100399636 3300005616 Unclassified 1351
250 Ga0068852_100435479 3300005616 Bacteria 1295
251 Ga0068852_100526037 3300005616 Bacteria 1180
252 Ga0068852_100639315 3300005616 Bacteria 1071
253 Ga0068859_100180501 3300005617 Bacteria 2194
254 Ga0068864_100051914 3300005618 Bacteria 3533
255 Ga0068864_100053150 3300005618 Bacteria 3493
256 Ga0068864_100117483 3300005618 Bacteria 2374
257 Ga0068864_100340250 3300005618 Unclassified 1414
258 Ga0068866_10020801 3300005718 Bacteria 3012
259 Ga0068851_10007599 3300005834 Bacteria 4984
260 Ga0068851_10050154 3300005834 Bacteria 2119
261 Ga0068851_10085228 3300005834 Bacteria 1656
262 Ga0068851_10135629 3300005834 Bacteria 1334
263 Ga0068870_10405259 3300005840 Bacteria 888
264 Ga0068863_100029810 3300005841 Bacteria 5210
265 Ga0068863_100034080 3300005841 Bacteria 4850
266 Ga0068863_100046826 3300005841 Bacteria 4105
267 Ga0068863_100092486 3300005841 Unclassified 2869
268 Ga0068858_100013510 3300005842 Bacteria 7704
269 Ga0068858_100041013 3300005842 Bacteria 4293
270 Ga0068858_100193155 3300005842 Bacteria 1923
271 Ga0068860_100429669 3300005843 Bacteria 1310
272 Ga0068860_100615448 3300005843 Bacteria 1092
273 Ga0068862_100203121 3300005844 Bacteria 1788
274 Ga0081539_10030833 3300005985 Bacteria 3320
275 Ga0081539_10042787 3300005985 Bacteria 2634
276 Ga0081539_10101652 3300005985 Unclassified 1464
277 Ga0070717_10012042 3300006028 Bacteria 6589
278 Ga0070717_10832085 3300006028 Unclassified 840
279 Ga0075364_10664963 3300006051 Bacteria 711
280 Ga0070715_10181307 3300006163 Bacteria 1056
281 Ga0070716_100086756 3300006173 Bacteria 1883
282 Ga0075369_10199929 3300006186 Bacteria 922
283 Ga0097621_100209501 3300006237 Bacteria 1695
284 Ga0097621_101211207 3300006237 Bacteria 711
285 Ga0068871_100019390 3300006358 Bacteria 5193
286 Ga0068871_100079789 3300006358 Bacteria 2709
287 Ga0068871_100382945 3300006358 Bacteria 1250
288 Ga0075434_100785517 3300006871 Unclassified 968
289 Ga0068865_100025105 3300006881 Bacteria 3916
290 Ga0068865_100086744 3300006881 Bacteria 2260
291 Ga0068865_100256131 3300006881 Unclassified 1383
292 Ga0097620_100180502 3300006931 Bacteria 2194
293 Ga0105240_10024420 3300009093 Bacteria 7965
294 Ga0105240_10087322 3300009093 Bacteria 3819
295 Ga0105240_10393398 3300009093 Bacteria 1563
296 Ga0105245_10049870 3300009098 Bacteria 3750
297 Ga0105245_10599849 3300009098 Bacteria 1128
298 Ga0105247_10116345 3300009101 Bacteria 1727
299 Ga0105247_10210229 3300009101 Bacteria 1312
300 Ga0105241_10025711 3300009174 Bacteria 4376
301 Ga0105241_10140856 3300009174 Bacteria 1963
302 Ga0105241_10742811 3300009174 Unclassified 899
303 Ga0105242_10016709 3300009176 Bacteria 5708
304 Ga0105242_10579264 3300009176 Unclassified 1080
305 Ga0105248_10026359 3300009177 Bacteria 6465
306 Ga0105248_10038209 3300009177 Bacteria 5372
307 Ga0105248_10104194 3300009177 Bacteria 3198
308 Ga0105248_10114594 3300009177 Bacteria 3040
309 Ga0105248_10228183 3300009177 Bacteria 2096
310 Ga0105248_10490247 3300009177 Unclassified 1385
311 Ga0105248_10961257 3300009177 Bacteria 965
312 Ga0105248_11056138 3300009177 Unclassified 918
313 Ga0105237_10021095 3300009545 Bacteria 6701
314 Ga0105237_10142523 3300009545 Bacteria 2391
315 Ga0105238_10017635 3300009551 Bacteria 7257
316 Ga0105238_10135699 3300009551 Bacteria 2438
317 Ga0105238_10197199 3300009551 Bacteria 1989
318 Ga0105238_10236138 3300009551 Bacteria 1805
319 Ga0105238_10396735 3300009551 Bacteria 1372
320 Ga0105238_10439728 3300009551 Unclassified 1300
321 Ga0105238_10603691 3300009551 Bacteria 1105
322 Ga0105239_10027029 3300010375 Bacteria 6316
323 Ga0105246_10114352 3300011119 Bacteria 1988
324 Ga0105246_10158042 3300011119 Bacteria 1724
325 Ga0157373_10014198 3300013100 Bacteria 5842
326 Ga0157373_10014974 3300013100 Bacteria 5675
327 Ga0157373_10063395 3300013100 Bacteria 2617
328 Ga0157373_10109243 3300013100 Bacteria 1945
329 Ga0157373_10153236 3300013100 Bacteria 1621
330 Ga0157373_10238318 3300013100 Bacteria 1286
331 Ga0157373_10385557 3300013100 Bacteria 1003
332 Ga0157371_10121607 3300013102 Bacteria 1856
333 Ga0157371_10166613 3300013102 Unclassified 1574
334 Ga0157371_10489293 3300013102 Unclassified 908
335 Ga0157371_10996903 3300013102 Unclassified 639
336 Ga0157371_11134935 3300013102 Bacteria 600
337 Ga0157371_11249529 3300013102 Unclassified 573
338 Ga0157370_10002746 3300013104 Bacteria 21034
339 Ga0157370_10050746 3300013104 Bacteria 3964
340 Ga0157370_10069760 3300013104 Bacteria 3319
341 Ga0157370_10095543 3300013104 Bacteria 2788
342 Ga0157370_10133468 3300013104 Bacteria 2315
343 Ga0157370_10203545 3300013104 Unclassified 1836
344 Ga0157370_10476141 3300013104 Bacteria 1147
345 Ga0157370_10487620 3300013104 Unclassified 1132
346 Ga0157370_10530284 3300013104 Unclassified 1080
347 Ga0157369_10004619 3300013105 Bacteria 16188
348 Ga0157369_10023641 3300013105 Bacteria 6846
349 Ga0157369_10030800 3300013105 Bacteria 5914
350 Ga0157369_10034637 3300013105 Bacteria 5539
351 Ga0157369_10063178 3300013105 Bacteria 3990
352 Ga0157369_10102744 3300013105 Bacteria 3045
353 Ga0157369_10117807 3300013105 Bacteria 2819
354 Ga0157369_10160228 3300013105 Bacteria 2375
355 Ga0157369_10165280 3300013105 Bacteria 2334
356 Ga0157369_10186201 3300013105 Bacteria 2183
357 Ga0157369_10214914 3300013105 Bacteria 2014
358 Ga0157369_10303168 3300013105 Bacteria 1661
359 Ga0157369_10333383 3300013105 Bacteria 1576
360 Ga0157369_10850498 3300013105 Bacteria 936
361 Ga0157369_11817098 3300013105 Unclassified 619
362 Ga0157374_10021305 3300013296 Bacteria 5766
363 Ga0157374_10029007 3300013296 Bacteria 5004
364 Ga0157374_10063153 3300013296 Bacteria 3473
365 Ga0157374_10119412 3300013296 Bacteria 2543
366 Ga0157374_10293136 3300013296 Bacteria 1608
367 Ga0157374_10323900 3300013296 Bacteria 1528
368 Ga0157374_10643549 3300013296 Bacteria 1072
369 Ga0157378_10219689 3300013297 Bacteria 1806
370 Ga0157378_10480521 3300013297 Bacteria 1238
371 Ga0157378_10589598 3300013297 Bacteria 1121
372 Ga0163162_10019183 3300013306 Bacteria 6706
373 Ga0163162_10048537 3300013306 Bacteria 4254
374 Ga0163162_10287058 3300013306 Unclassified 1777
375 Ga0157372_10074479 3300013307 Bacteria 3828
376 Ga0157372_10159755 3300013307 Bacteria 2604
377 Ga0157372_10192727 3300013307 Unclassified 2361
378 Ga0157372_10206753 3300013307 Bacteria 2275
379 Ga0157372_10281459 3300013307 Bacteria 1934
380 Ga0157372_10381411 3300013307 Bacteria 1642
381 Ga0157372_10442817 3300013307 Bacteria 1514
382 Ga0157372_10448476 3300013307 Bacteria 1504
383 Ga0157372_11671906 3300013307 Bacteria 733
384 Ga0157375_10024280 3300013308 Bacteria 5607
385 Ga0157375_10052650 3300013308 Bacteria 4003
386 Ga0157375_10439554 3300013308 Bacteria 1470
387 Ga0157375_10832131 3300013308 Bacteria 1070
388 Ga0157375_11882243 3300013308 Unclassified 710
389 Ga0163163_10011842 3300014325 Bacteria 7929
390 Ga0163163_10034598 3300014325 Bacteria 4895
391 Ga0163163_10037142 3300014325 Bacteria 4737
392 Ga0157377_10085863 3300014745 Bacteria 1848
393 Ga0157379_10876979 3300014968 Bacteria 850
394 Ga0157376_10302569 3300014969 Bacteria 1514
395 Ga0206356_11797130 3300020070 Bacteria 2049
396 Ga0206355_1601105 3300020076 Bacteria 2043
397 Ga0213876_10015773 3300021384 Bacteria 3998
398 Ga0207697_10155619 3300025315 Bacteria 996
399 Ga0207656_10025258 3300025321 Bacteria 2410
400 Ga0207656_10113354 3300025321 Bacteria 1255
401 Ga0207656_10223640 3300025321 Bacteria 915
402 Ga0207642_10011605 3300025899 Bacteria 3150
403 Ga0207710_10218595 3300025900 Bacteria 945
404 Ga0207688_10207361 3300025901 Bacteria 1177
405 Ga0207680_10003692 3300025903 Bacteria 7193
406 Ga0207680_10010957 3300025903 Bacteria 4559
407 Ga0207680_10013553 3300025903 Bacteria 4193
408 Ga0207680_10112205 3300025903 Bacteria 1770
409 Ga0207647_10007000 3300025904 Bacteria 8179
410 Ga0207647_10014002 3300025904 Bacteria 5549
411 Ga0207647_10018752 3300025904 Bacteria 4670
412 Ga0207647_10022272 3300025904 Bacteria 4212
413 Ga0207647_10024348 3300025904 Bacteria 3992
414 Ga0207647_10036155 3300025904 Bacteria 3140
415 Ga0207647_10041018 3300025904 Bacteria 2912
416 Ga0207647_10048627 3300025904 Bacteria 2633
417 Ga0207647_10080059 3300025904 Bacteria 1960
418 Ga0207647_10089347 3300025904 Bacteria 1839
419 Ga0207685_10260262 3300025905 Unclassified 843
420 Ga0207699_10048389 3300025906 Bacteria 2498
421 Ga0207645_10051000 3300025907 Bacteria 2644
422 Ga0207645_10110365 3300025907 Bacteria 1780
423 Ga0207705_10000003 3300025909 Bacteria 709270
424 Ga0207705_10000493 3300025909 Bacteria 33656
425 Ga0207705_10001025 3300025909 Bacteria 22684
426 Ga0207705_10009697 3300025909 Bacteria 7003
427 Ga0207705_10019512 3300025909 Unclassified 4848
428 Ga0207705_10027645 3300025909 Bacteria 4046
429 Ga0207705_10028284 3300025909 Bacteria 3996
430 Ga0207705_10037912 3300025909 Bacteria 3449
431 Ga0207705_10042739 3300025909 Bacteria 3254
432 Ga0207705_10097045 3300025909 Bacteria 2164
433 Ga0207705_10255496 3300025909 Bacteria 1337
434 Ga0207705_10268769 3300025909 Bacteria 1304
435 Ga0207705_10356814 3300025909 Bacteria 1127
436 Ga0207707_10017647 3300025912 Bacteria 6225
437 Ga0207707_10077183 3300025912 Bacteria 2908
438 Ga0207707_10209630 3300025912 Bacteria 1698
439 Ga0207695_10008855 3300025913 Bacteria 12532
440 Ga0207695_10009362 3300025913 Bacteria 12112
441 Ga0207695_10057313 3300025913 Bacteria 4048
442 Ga0207695_10315334 3300025913 Bacteria 1454
443 Ga0207671_10024193 3300025914 Bacteria 4570
444 Ga0207671_10028319 3300025914 Bacteria 4186
445 Ga0207660_10000770 3300025917 Bacteria 21320
446 Ga0207660_10003208 3300025917 Bacteria 10700
447 Ga0207660_10382789 3300025917 Bacteria 1131
448 Ga0207660_10521874 3300025917 Unclassified 965
449 Ga0207657_10002261 3300025919 Bacteria 20877
450 Ga0207657_10003123 3300025919 Bacteria 17708
451 Ga0207657_10006107 3300025919 Bacteria 12524
452 Ga0207657_10018368 3300025919 Bacteria 6677
453 Ga0207657_10026360 3300025919 Bacteria 5343
454 Ga0207657_10040433 3300025919 Bacteria 4131
455 Ga0207657_10056349 3300025919 Bacteria 3392
456 Ga0207657_10066200 3300025919 Bacteria 3076
457 Ga0207657_10076653 3300025919 Bacteria 2820
458 Ga0207657_10109570 3300025919 Bacteria 2282
459 Ga0207657_10115485 3300025919 Bacteria 2212
460 Ga0207657_10174288 3300025919 Bacteria 1741
461 Ga0207657_10429289 3300025919 Bacteria 1038
462 Ga0207649_10006255 3300025920 Bacteria 6468
463 Ga0207649_10021154 3300025920 Bacteria 3740
464 Ga0207649_10033502 3300025920 Bacteria 3070
465 Ga0207649_10101062 3300025920 Bacteria 1908
466 Ga0207649_10135803 3300025920 Unclassified 1676
467 Ga0207649_10205843 3300025920 Bacteria 1393
468 Ga0207649_10234168 3300025920 Bacteria 1315
469 Ga0207649_10344207 3300025920 Bacteria 1102
470 Ga0207649_10525587 3300025920 Bacteria 903
471 Ga0207649_10573796 3300025920 Unclassified 865
472 Ga0207649_10603588 3300025920 Unclassified 844
473 Ga0207652_10000034 3300025921 Bacteria 138571
474 Ga0207652_10151864 3300025921 Bacteria 2074
475 Ga0207694_10024170 3300025924 Bacteria 4614
476 Ga0207694_10025296 3300025924 Bacteria 4511
477 Ga0207694_10671482 3300025924 Unclassified 873
478 Ga0207650_10087834 3300025925 Bacteria 2370
479 Ga0207650_10184267 3300025925 Unclassified 1665
480 Ga0207650_10286661 3300025925 Bacteria 1342
481 Ga0207650_10670192 3300025925 Unclassified 875
482 Ga0207659_10207770 3300025926 Bacteria 1567
483 Ga0207659_10274319 3300025926 Bacteria 1376
484 Ga0207687_10083000 3300025927 Bacteria 2319
485 Ga0207700_10037272 3300025928 Bacteria 3519
486 Ga0207700_10053420 3300025928 Bacteria 3027
487 Ga0207700_10118377 3300025928 Bacteria 2143
488 Ga0207664_10036282 3300025929 Bacteria 3810
489 Ga0207664_10252888 3300025929 Bacteria 1538
490 Ga0207644_10000747 3300025931 Bacteria 20633
491 Ga0207644_10006207 3300025931 Bacteria 7793
492 Ga0207644_10015057 3300025931 Bacteria 5188
493 Ga0207644_10016318 3300025931 Bacteria 4996
494 Ga0207644_10016718 3300025931 Bacteria 4939
495 Ga0207644_10023819 3300025931 Bacteria 4197
496 Ga0207644_10156432 3300025931 Bacteria 1768
497 Ga0207644_10702358 3300025931 Bacteria 843
498 Ga0207690_10008784 3300025932 Bacteria 5997
499 Ga0207690_10015093 3300025932 Bacteria 4677
500 Ga0207690_10060505 3300025932 Bacteria 2570
501 Ga0207690_10066579 3300025932 Bacteria 2468
502 Ga0207690_10152704 3300025932 Bacteria 1713
503 Ga0207690_10417273 3300025932 Bacteria 1073
504 Ga0207690_11017128 3300025932 Unclassified 690
505 Ga0207706_10008319 3300025933 Bacteria 9566
506 Ga0207706_10019826 3300025933 Bacteria 6045
507 Ga0207706_10037830 3300025933 Bacteria 4283
508 Ga0207706_10054006 3300025933 Bacteria 3546
509 Ga0207706_10131582 3300025933 Bacteria 2200
510 Ga0207706_10233077 3300025933 Bacteria 1610
511 Ga0207706_10254876 3300025933 Bacteria 1532
512 Ga0207706_10310147 3300025933 Bacteria 1374
513 Ga0207706_10441557 3300025933 Bacteria 1126
514 Ga0207706_10541087 3300025933 Bacteria 1003
515 Ga0207706_10578983 3300025933 Bacteria 965
516 Ga0207686_10064988 3300025934 Bacteria 2324
517 Ga0207670_10644647 3300025936 Bacteria 873
518 Ga0207669_10027200 3300025937 Bacteria 3127
519 Ga0207669_10081406 3300025937 Bacteria 2074
520 Ga0207669_10281606 3300025937 Bacteria 1254
521 Ga0207704_10032107 3300025938 Bacteria 2967
522 Ga0207704_10975778 3300025938 Unclassified 716
523 Ga0207665_10049456 3300025939 Bacteria 2825
524 Ga0207665_10132756 3300025939 Bacteria 1769
525 Ga0207691_10004673 3300025940 Bacteria 13258
526 Ga0207691_10005523 3300025940 Bacteria 12217
527 Ga0207691_10013134 3300025940 Bacteria 7928
528 Ga0207691_10269925 3300025940 Bacteria 1465
529 Ga0207711_10007240 3300025941 Bacteria 9299
530 Ga0207711_10007576 3300025941 Bacteria 9084
531 Ga0207711_10014416 3300025941 Bacteria 6564
532 Ga0207711_10020622 3300025941 Bacteria 5500
533 Ga0207711_10033837 3300025941 Bacteria 4326
534 Ga0207711_10204330 3300025941 Bacteria 1803
535 Ga0207711_10311060 3300025941 Bacteria 1454
536 Ga0207711_10637293 3300025941 Bacteria 994
537 Ga0207711_10827109 3300025941 Unclassified 862
538 Ga0207711_11044215 3300025941 Bacteria 757
539 Ga0207661_10002378 3300025944 Bacteria 12950
540 Ga0207661_10012640 3300025944 Bacteria 6145
541 Ga0207661_10594680 3300025944 Unclassified 1015
542 Ga0207661_10737127 3300025944 Unclassified 907
543 Ga0207679_10007576 3300025945 Bacteria 6892
544 Ga0207679_10020448 3300025945 Bacteria 4467
545 Ga0207679_10059420 3300025945 Bacteria 2837
546 Ga0207679_10069570 3300025945 Bacteria 2649
547 Ga0207679_10117050 3300025945 Bacteria 2114
548 Ga0207679_10125411 3300025945 Bacteria 2051
549 Ga0207679_10299494 3300025945 Bacteria 1386
550 Ga0207679_10478083 3300025945 Bacteria 1109
551 Ga0207679_10798141 3300025945 Bacteria 860
552 Ga0207667_10004710 3300025949 Bacteria 16697
553 Ga0207667_10022167 3300025949 Bacteria 7025
554 Ga0207667_10026666 3300025949 Bacteria 6306
555 Ga0207667_10078827 3300025949 Bacteria 3413
556 Ga0207667_10178420 3300025949 Bacteria 2182
557 Ga0207667_10261594 3300025949 Unclassified 1769
558 Ga0207667_10313539 3300025949 Unclassified 1602
559 Ga0207667_10790375 3300025949 Bacteria 946
560 Ga0207667_10945478 3300025949 Unclassified 851
561 Ga0207667_10948104 3300025949 Bacteria 850
562 Ga0207667_11219828 3300025949 Unclassified 731
563 Ga0207651_10012099 3300025960 Bacteria 4864
564 Ga0207651_10014049 3300025960 Bacteria 4609
565 Ga0207651_10015757 3300025960 Bacteria 4404
566 Ga0207651_10017768 3300025960 Bacteria 4210
567 Ga0207651_10029038 3300025960 Bacteria 3498
568 Ga0207651_10078455 3300025960 Bacteria 2369
569 Ga0207640_10025603 3300025981 Bacteria 3573
570 Ga0207640_10037577 3300025981 Bacteria 3048
571 Ga0207640_10095945 3300025981 Bacteria 2066
572 Ga0207640_10153773 3300025981 Bacteria 1693
573 Ga0207640_10177872 3300025981 Unclassified 1592
574 Ga0207640_10219580 3300025981 Bacteria 1454
575 Ga0207640_10522418 3300025981 Bacteria 992
576 Ga0207640_10707786 3300025981 Bacteria 864
577 Ga0207640_11116681 3300025981 Unclassified 698
578 Ga0207658_10013412 3300025986 Bacteria 5598
579 Ga0207658_10065328 3300025986 Bacteria 2732
580 Ga0207658_10309592 3300025986 Bacteria 1364
581 Ga0207658_10405856 3300025986 Bacteria 1198
582 Ga0207677_10006373 3300026023 Bacteria 6471
583 Ga0207677_10081189 3300026023 Bacteria 2326
584 Ga0207677_10150836 3300026023 Bacteria 1793
585 Ga0207677_10174809 3300026023 Bacteria 1683
586 Ga0207677_11277365 3300026023 Unclassified 674
587 Ga0207703_10012807 3300026035 Bacteria 6538
588 Ga0207703_10028733 3300026035 Bacteria 4386
589 Ga0207703_10112271 3300026035 Bacteria 2328
590 Ga0207703_10288547 3300026035 Unclassified 1492
591 Ga0207639_10000923 3300026041 Bacteria 19909
592 Ga0207639_10001159 3300026041 Bacteria 17877
593 Ga0207639_10706898 3300026041 Bacteria 935
594 Ga0207639_10866551 3300026041 Bacteria 843
595 Ga0207639_10917004 3300026041 Unclassified 819
596 Ga0207678_10006063 3300026067 Bacteria 10752
597 Ga0207678_10009081 3300026067 Bacteria 8752
598 Ga0207678_10046333 3300026067 Bacteria 3760
599 Ga0207678_10053830 3300026067 Bacteria 3467
600 Ga0207678_10055524 3300026067 Bacteria 3412
601 Ga0207678_10138920 3300026067 Bacteria 2073
602 Ga0207678_10143449 3300026067 Bacteria 2038
603 Ga0207678_10164425 3300026067 Unclassified 1895
604 Ga0207678_10558145 3300026067 Unclassified 1002
605 Ga0207678_10617858 3300026067 Bacteria 951
606 Ga0207702_10002063 3300026078 Bacteria 19455
607 Ga0207702_10019681 3300026078 Bacteria 5588
608 Ga0207702_10025645 3300026078 Bacteria 4893
609 Ga0207702_10059906 3300026078 Bacteria 3244
610 Ga0207702_10060514 3300026078 Bacteria 3229
611 Ga0207702_10074449 3300026078 Bacteria 2931
612 Ga0207702_10177756 3300026078 Bacteria 1957
613 Ga0207702_10221564 3300026078 Bacteria 1763
614 Ga0207702_10244287 3300026078 Unclassified 1683
615 Ga0207702_10330691 3300026078 Bacteria 1453
616 Ga0207641_10073824 3300026088 Bacteria 2940
617 Ga0207641_10710167 3300026088 Bacteria 990
618 Ga0207648_10008762 3300026089 Bacteria 9748
619 Ga0207648_10010578 3300026089 Bacteria 8729
620 Ga0207648_10088236 3300026089 Bacteria 2708
621 Ga0207648_10348933 3300026089 Bacteria 1334
622 Ga0207676_10033010 3300026095 Bacteria 3907
623 Ga0207676_10093212 3300026095 Bacteria 2479
624 Ga0207676_10233662 3300026095 Bacteria 1645
625 Ga0207676_10277997 3300026095 Bacteria 1519
626 Ga0207674_10006843 3300026116 Bacteria 13372
627 Ga0207674_10012374 3300026116 Bacteria 9538
628 Ga0207674_10077107 3300026116 Bacteria 3339
629 Ga0207674_10080912 3300026116 Bacteria 3251
630 Ga0207674_10115084 3300026116 Bacteria 2661
631 Ga0207674_10157321 3300026116 Bacteria 2228
632 Ga0207674_10193343 3300026116 Bacteria 1984
633 Ga0207674_10818294 3300026116 Unclassified 899
634 Ga0207674_11400548 3300026116 Unclassified 668
635 Ga0207683_10014680 3300026121 Bacteria 6670
636 Ga0207683_10021530 3300026121 Bacteria 5522
637 Ga0207683_10222611 3300026121 Bacteria 1719
638 Ga0207698_10000896 3300026142 Bacteria 17309
639 Ga0207698_10003271 3300026142 Bacteria 9734
640 Ga0207698_10006737 3300026142 Bacteria 7176
641 Ga0207698_10008977 3300026142 Bacteria 6344
642 Ga0207698_10022783 3300026142 Bacteria 4362
643 Ga0207698_10035355 3300026142 Bacteria 3654
644 Ga0207698_10043850 3300026142 Bacteria 3355
645 Ga0207698_10216528 3300026142 Bacteria 1727
646 Ga0207698_10219416 3300026142 Unclassified 1717
647 Ga0207698_10310425 3300026142 Bacteria 1472
648 Ga0207698_10535537 3300026142 Bacteria 1145
649 Ga0207698_10746658 3300026142 Unclassified 977
650 Ga0207698_10975881 3300026142 Unclassified 857
651 Ga0207698_11139976 3300026142 Unclassified 793
652 Ga0207698_12055493 3300026142 Unclassified 585
653 Ga0268266_10000767 3300028379 Bacteria 42918
654 Ga0268266_10029135 3300028379 Bacteria 4693
655 Ga0268266_10045135 3300028379 Bacteria 3769
656 Ga0268266_10212037 3300028379 Bacteria 1776
657 Ga0268266_10665544 3300028379 Bacteria 1002
658 Ga0268266_11375540 3300028379 Unclassified 681
659 Ga0268265_10363928 3300028380 Bacteria 1325
660 Ga0268264_10266424 3300028381 Bacteria 1599
661 Ga0268264_10399541 3300028381 Bacteria 1320
662 Ga0307408_100039656 3300031548 Bacteria 3331
663 Ga0307405_10148856 3300031731 Bacteria 1643
664 Ga0307413_10014680 3300031824 Bacteria 3988
665 Ga0307413_10035173 3300031824 Bacteria 2870
666 Ga0307410_10010532 3300031852 Bacteria 5244
667 Ga0307410_10031141 3300031852 Bacteria 3419
668 Ga0307410_10128545 3300031852 Bacteria 1858
669 Ga0307406_10101720 3300031901 Bacteria 1959
670 Ga0307406_10547227 3300031901 Bacteria 946
671 Ga0307407_10105882 3300031903 Bacteria 1755
672 Ga0307407_10218692 3300031903 Bacteria 1287
673 Ga0307412_10154743 3300031911 Bacteria 1696
674 Ga0307409_100031493 3300031995 Bacteria 3829
675 Ga0307409_100115218 3300031995 Bacteria 2262
676 Ga0307409_100148144 3300031995 Bacteria 2033
677 Ga0307416_100020756 3300032002 Bacteria 4697
678 Ga0307416_100023349 3300032002 Bacteria 4487
679 Ga0307414_10009432 3300032004 Bacteria 5607
680 Ga0307414_10040743 3300032004 Bacteria 3139
681 Ga0307414_10391625 3300032004 Bacteria 1204
682 Ga0307411_10007591 3300032005 Bacteria 5543
683 Ga0307411_10024440 3300032005 Bacteria 3602
684 Ga0307411_10119092 3300032005 Bacteria 1906
685 Ga0307415_100004410 3300032126 Bacteria 7295
686 Ga0307415_100066475 3300032126 Bacteria 2516
687 Ga0373923_0112263 3300035111 Bacteria 1211
688 Ga0373954_0049544 3300035118 Bacteria 1969
689 Ga0373956_0097486 3300035119 Bacteria 1361
690 Ga0373960_0244112 3300035121 Unclassified 650
691 Ga0373946_0050901 3300035171 Bacteria 1732
692 Ga0373931_0094472 3300035691 Bacteria 1672
693 Ga0373935_0153284 3300035692 Bacteria 1565
694 Ga0373933_0014251 3300035724 Unclassified 4417
695 Ga0373933_0653287 3300035724 Unclassified 691
696 Ga0373947_0577649 3300035725 Unclassified 766
697 Ga0373937_0004829 3300036401 Bacteria 11457
698 Ga0395899_0021048 3300037312 Bacteria 4946
699 Ga0395899_0036604 3300037312 Bacteria 3680
700 Ga0395899_0042007 3300037312 Bacteria 3414
701 Ga0395899_0048839 3300037312 Bacteria 3147
702 Ga0395899_0050645 3300037312 Bacteria 3083
703 Ga0395899_0051337 3300037312 Bacteria 3060
704 Ga0395899_0053501 3300037312 Bacteria 2989
705 Ga0395899_0090055 3300037312 Bacteria 2224
706 Ga0395899_0102274 3300037312 Bacteria 2067
707 Ga0395899_0162413 3300037312 Bacteria 1577
708 Ga0395899_0194735 3300037312 Unclassified 1417
709 Ga0395899_0213622 3300037312 Bacteria 1339
710 Ga0395899_0285816 3300037312 Unclassified 1120
711 Ga0395899_0292103 3300037312 Unclassified 1105
712 Ga0395900_0003085 3300037418 Bacteria 18103
713 Ga0395900_0009276 3300037418 Bacteria 10089
714 Ga0395900_0010484 3300037418 Bacteria 9479
715 Ga0395900_0030431 3300037418 Bacteria 5544
716 Ga0395900_0030498 3300037418 Bacteria 5536
717 Ga0395900_0050997 3300037418 Bacteria 4262
718 Ga0395900_0053926 3300037418 Unclassified 4139
719 Ga0395900_0062637 3300037418 Bacteria 3823
720 Ga0395900_0073419 3300037418 Bacteria 3517
721 Ga0395900_0088171 3300037418 Bacteria 3189
722 Ga0395900_0102036 3300037418 Bacteria 2947
723 Ga0395900_0115343 3300037418 Bacteria 2756
724 Ga0395900_0130385 3300037418 Bacteria 2577
725 Ga0395900_0131903 3300037418 Bacteria 2560
726 Ga0395900_0133413 3300037418 Bacteria 2544
727 Ga0395900_0164577 3300037418 Bacteria 2261
728 Ga0395900_0172571 3300037418 Bacteria 2200
729 Ga0395900_0262255 3300037418 Bacteria 1725
730 Ga0395900_0308123 3300037418 Unclassified 1567
731 Ga0395900_0415743 3300037418 Unclassified 1306
732 Ga0395900_0505633 3300037418 Unclassified 1158
733 Ga0395900_0542483 3300037418 Unclassified 1108
734 Ga0395900_0572365 3300037418 Bacteria 1072
735 Ga0395900_0694432 3300037418 Unclassified 951
736 Ga0395900_1028220 3300037418 Unclassified 743
737 Ga0395900_1333342 3300037418 Unclassified 631
738 Ga0395898_0011721 3300037466 Bacteria 9089
739 Ga0395898_0015329 3300037466 Bacteria 7861
740 Ga0395898_0019188 3300037466 Bacteria 6961
741 Ga0395898_0025785 3300037466 Bacteria 5920
742 Ga0395898_0053789 3300037466 Bacteria 3930
743 Ga0395898_0055306 3300037466 Bacteria 3870
744 Ga0395898_0087550 3300037466 Bacteria 3000
745 Ga0395898_0178684 3300037466 Unclassified 2028
746 Ga0395898_0217297 3300037466 Bacteria 1823
747 Ga0395898_0226204 3300037466 Bacteria 1784
748 Ga0395898_0337753 3300037466 Bacteria 1436
749 Ga0395898_0381880 3300037466 Bacteria 1343
750 Ga0395898_0678779 3300037466 Bacteria 972
751 Ga0395898_0689444 3300037466 Unclassified 963
752 Ga0395905_0001169 3300037471 Bacteria 32772
753 Ga0395905_0001983 3300037471 Bacteria 23389
754 Ga0395905_0006012 3300037471 Bacteria 12289
755 Ga0395905_0006135 3300037471 Bacteria 12132
756 Ga0395905_0008256 3300037471 Bacteria 10285
757 Ga0395905_0028510 3300037471 Bacteria 5263
758 Ga0395905_0033050 3300037471 Bacteria 4863
759 Ga0395905_0033437 3300037471 Bacteria 4830
760 Ga0395905_0034571 3300037471 Bacteria 4746
761 Ga0395905_0037838 3300037471 Bacteria 4527
762 Ga0395905_0045884 3300037471 Bacteria 4099
763 Ga0395905_0051435 3300037471 Bacteria 3859
764 Ga0395905_0057078 3300037471 Bacteria 3651
765 Ga0395905_0062402 3300037471 Bacteria 3486
766 Ga0395905_0084238 3300037471 Bacteria 2978
767 Ga0395905_0092392 3300037471 Bacteria 2838
768 Ga0395905_0128774 3300037471 Bacteria 2380
769 Ga0395905_0144847 3300037471 Bacteria 2235
770 Ga0395905_0212009 3300037471 Bacteria 1814
771 Ga0395905_0294178 3300037471 Bacteria 1511
772 Ga0395905_0413108 3300037471 Bacteria 1245
773 Ga0395905_0433132 3300037471 Bacteria 1212
774 Ga0395905_0543099 3300037471 Unclassified 1063
775 Ga0395905_0647645 3300037471 Bacteria 958
776 Ga0395905_0665994 3300037471 Bacteria 943
777 Ga0395905_0667690 3300037471 Bacteria 941
778 Ga0395905_0945837 3300037471 Unclassified 764
779 Ga0395905_0999755 3300037471 Bacteria 739
780 Ga0395905_1223661 3300037471 Unclassified 654
781 Ga0395901_0006031 3300038443 Bacteria 12280
782 Ga0395901_0028506 3300038443 Bacteria 5742
783 Ga0395901_0050004 3300038443 Bacteria 4344
784 Ga0395901_0067878 3300038443 Bacteria 3714
785 Ga0395901_0082714 3300038443 Bacteria 3354
786 Ga0395901_0101199 3300038443 Bacteria 3024
787 Ga0395901_0106570 3300038443 Bacteria 2941
788 Ga0395901_0115762 3300038443 Bacteria 2816
789 Ga0395901_0116588 3300038443 Bacteria 2805
790 Ga0395901_0121033 3300038443 Bacteria 2750
791 Ga0395901_0125924 3300038443 Bacteria 2692
792 Ga0395901_0130740 3300038443 Bacteria 2638
793 Ga0395901_0133252 3300038443 Bacteria 2611
794 Ga0395901_0175992 3300038443 Bacteria 2244
795 Ga0395901_0230494 3300038443 Bacteria 1933
796 Ga0395901_0319888 3300038443 Bacteria 1605
797 Ga0395901_0347379 3300038443 Bacteria 1531
798 Ga0395901_0440675 3300038443 Unclassified 1333
799 Ga0395901_0495449 3300038443 Bacteria 1244
800 Ga0395901_0508607 3300038443 Unclassified 1225
801 Ga0395901_0554006 3300038443 Unclassified 1165
802 Ga0395901_0602161 3300038443 Bacteria 1108
803 Ga0395901_0642761 3300038443 Bacteria 1065
804 Ga0395901_0777050 3300038443 Bacteria 948
805 Ga0395901_0902722 3300038443 Bacteria 865
806 Ga0436365_0481817 3300039437 Bacteria 15552
807 Ga0439448_0004598 3300042005 Bacteria 3902
808 Ga0439458_0000480 3300042157 Bacteria 10247
809 Ga0439458_0001207 3300042157 Bacteria 6549
810 Ga0439458_0007205 3300042157 Bacteria 2475
811 Ga0466969_0053154 3300044656 Bacteria 1988
812 Ga0466972_0119841 3300044658 Bacteria 1241
813 Ga0466966_0000001 3300044684 Bacteria 410376
814 Ga0466966_0010135 3300044684 Bacteria 6252
815 Ga0466966_0045027 3300044684 Bacteria 2822
816 Ga0466966_0050485 3300044684 Bacteria 2645
817 Ga0466966_0102144 3300044684 Bacteria 1772
818 Ga0466966_0705909 3300044684 Unclassified 608
819 Ga0466961_0009876 3300044693 Bacteria 6080
820 Ga0466961_0168457 3300044693 Bacteria 1363
821 Ga0466963_0006272 3300044694 Bacteria 7029
822 Ga0466963_0010178 3300044694 Bacteria 5686
823 Ga0466963_0150551 3300044694 Unclassified 1615
824 Ga0466963_0378012 3300044694 Bacteria 998
825 Ga0466963_0467005 3300044694 Unclassified 890
826 Ga0466964_0059314 3300044706 Bacteria 1589
827 Ga0466964_0347434 3300044706 Unclassified 761
828 Ga0466971_0064787 3300044719 Unclassified 1654
829 Ga0466971_0241360 3300044719 Unclassified 859
830 Ga0466970_0008343 3300044765 Bacteria 5211
831 Ga0466970_0033889 3300044765 Bacteria 2701
832 Ga0466957_0000183 3300044842 Bacteria 28401
833 Ga0466957_0008937 3300044842 Bacteria 5710
834 Ga0466957_0011371 3300044842 Bacteria 5133
835 Ga0466957_0128657 3300044842 Bacteria 1620
836 Ga0466957_0172057 3300044842 Bacteria 1411
837 Ga0466957_0469958 3300044842 Bacteria 869
838 Ga0466957_0480373 3300044842 Bacteria 859
839 Ga0466957_0560413 3300044842 Unclassified 797
840 Ga0466957_0575264 3300044842 Unclassified 787
841 Ga0466960_0013146 3300044901 Bacteria 3510
842 Ga0466960_0158182 3300044901 Bacteria 1215
843 Ga0466959_0004304 3300045049 Bacteria 9503
844 Ga0466959_0083054 3300045049 Bacteria 2307
845 Ga0466959_0089032 3300045049 Bacteria 2218
846 Ga0466959_0103432 3300045049 Bacteria 2037
847 Ga0466959_0132379 3300045049 Bacteria 1767
848 Ga0466958_0010395 3300045836 Bacteria 5211
849 Ga0466958_0047500 3300045836 Bacteria 2592
850 Ga0466958_0085191 3300045836 Bacteria 1949
851 Ga0466958_0130082 3300045836 Unclassified 1580
852 Ga0466958_0154575 3300045836 Bacteria 1448
853 Ga0466958_0221517 3300045836 Unclassified 1207
854 Ga0466967_0007477 3300045976 Bacteria 7884
855 Ga0466967_0011797 3300045976 Bacteria 6644
856 Ga0466967_0062028 3300045976 Bacteria 3318
857 Ga0466967_0113070 3300045976 Bacteria 2497
858 Ga0466967_0118782 3300045976 Bacteria 2439
859 Ga0466967_0134561 3300045976 Bacteria 2298
860 Ga0466967_0320165 3300045976 Viruses 1495
861 Ga0466967_0402360 3300045976 Bacteria 1332
862 Ga0466967_0520729 3300045976 Bacteria 1168
863 Ga0466967_0578979 3300045976 Bacteria 1106
864 Ga0466967_0724920 3300045976 Unclassified 985
865 Ga0466967_0745784 3300045976 Bacteria 971
866 Ga0466967_0778481 3300045976 Unclassified 949
867 Ga0466967_0786938 3300045976 Unclassified 944
868 Ga0466967_0996193 3300045976 Unclassified 834
869 Ga0495663_0125449 3300046525 Unclassified 862
870 Ga0495586_0392618 3300046535 Unclassified 798
871 Ga0495598_0002244 3300046537 Bacteria 3976
872 Ga0495621_0000972 3300046539 Bacteria 7305
873 Ga0495633_0042594 3300046558 Bacteria 2155
874 Ga0495668_0077275 3300046616 Bacteria 1827
875 Ga0495623_0064093 3300046679 Bacteria 2300
876 Ga0495669_0029165 3300046684 Bacteria 2419
877 Ga0495669_0080319 3300046684 Bacteria 1496
878 Ga0495669_0243949 3300046684 Bacteria 862
879 Ga0495670_0000071 3300046691 Bacteria 45180
880 Ga0495600_0265660 3300046809 Bacteria 1089
881 Ga0495602_0043086 3300048088 Unclassified 4107
882 Ga0496100_0083922 3300048903 Bacteria 2158
883 Ga0496101_0115149 3300048904 Bacteria 2027
884 Ga0496101_0144671 3300048904 Bacteria 1815
885 Ga0496101_0216755 3300048904 Unclassified 1484
886 Ga0496102_0063070 3300048905 Bacteria 3393
887 Ga0496102_0673775 3300048905 Bacteria 957
888 Ga0496104_0065814 3300048907 Bacteria 3440
889 Ga0496105_0039333 3300048908 Bacteria 3898
890 Ga0496105_0137137 3300048908 Bacteria 2015
891 Ga0496106_0017617 3300048909 Bacteria 5284
892 Ga0496106_0705234 3300048909 Unclassified 804
893 Ga0496107_0011494 3300048910 Bacteria 6167
894 Ga0496107_0189121 3300048910 Unclassified 1529
895 Ga0496107_0316958 3300048910 Bacteria 1160
896 Ga0496108_0006177 3300048911 Bacteria 9691
897 Ga0496108_0034647 3300048911 Bacteria 4194
898 Ga0496108_0046784 3300048911 Bacteria 3615
899 Ga0496109_0021950 3300048912 Bacteria 5653
900 Ga0496109_0034955 3300048912 Bacteria 4530
901 Ga0496109_0068968 3300048912 Bacteria 3241
902 Ga0496109_0219805 3300048912 Bacteria 1787
903 Ga0496110_0013619 3300048913 Bacteria 6732
904 Ga0496110_0427452 3300048913 Unclassified 1207
905 Ga0496111_0005193 3300048914 Bacteria 8304
906 Ga0496111_0007572 3300048914 Bacteria 7126
907 Ga0496111_0029259 3300048914 Bacteria 3911
908 Ga0496112_0012266 3300048915 Bacteria 7870
909 Ga0496112_0054746 3300048915 Bacteria 3921
910 Ga0496112_0095037 3300048915 Bacteria 2951
911 Ga0496112_0163559 3300048915 Bacteria 2191
912 Ga0496112_0263820 3300048915 Bacteria 1671
913 Ga0496112_0264652 3300048915 Bacteria 1668
914 Ga0496112_0886951 3300048915 Bacteria 814
915 Ga0496113_0012069 3300048916 Bacteria 5795
916 Ga0496113_0120879 3300048916 Bacteria 2047
917 Ga0496113_0381671 3300048916 Unclassified 1131
918 Ga0496113_0536789 3300048916 Unclassified 938
919 Ga0496113_0695847 3300048916 Bacteria 811
920 Ga0496114_0012137 3300048917 Bacteria 6894
921 Ga0496114_0215334 3300048917 Bacteria 1685
922 Ga0496114_0358059 3300048917 Bacteria 1291
923 Ga0496115_0015819 3300048918 Bacteria 5729
924 nmdc:mga0n895_901262_c1 3300050512 Unclassified 870
925 Ga0587090_014290 3300059510 Unclassified 1159
926 Ga0466962_0006344 3300061719 Bacteria 5677
927 Ga0466962_0013258 3300061719 Bacteria 3964
928 Ga0466962_0015820 3300061719 Bacteria 3640
929 Ga0466962_0044372 3300061719 Bacteria 2126
930 2885429574 2885427238 Bacteria 2291351
931 Ga0070658_10240107
932 JGI24740J21852_10001126
933 JGI24740J21852_10004688
934 JGI24739J22299_10141477
935 JGI24737J22298_10003380
936 JGI24735J21928_10010414
937 JGI24735J21928_10017009
938 JGI24034J26672_10053221
939 rootL2_10267806
940 rootH1_10278953
941 Ga0070658_10009104
942 Ga0070658_10012256
943 Ga0070658_10018898
944 Ga0070658_10050982
945 Ga0070658_10126304
946 Ga0070658_10137343
947 Ga0070658_10144517
948 Ga0070658_10189803
949 Ga0070658_10214334
950 Ga0070658_10292776
951 Ga0070658_10318734
952 Ga0070658_10669328
953 Ga0070676_10168981
954 Ga0070676_10181160
955 Ga0070676_10268988
956 Ga0070676_10553910
957 Ga0070683_100024323
958 Ga0070683_100156382
959 Ga0070683_100222484
960 Ga0070683_100384525
961 Ga0070683_100542599
962 Ga0070683_100583260
963 Ga0070670_100067994
964 Ga0070670_100099710
965 Ga0070670_100162474
966 Ga0070670_100929619
967 Ga0070670_100996201
968 Ga0068869_100315233
969 Ga0070666_10020324
970 Ga0070666_10021333
971 Ga0070666_10021757
972 Ga0070666_10060975
973 Ga0070666_10173313
974 Ga0070680_100059955
975 Ga0070680_100080167
976 Ga0070680_100210135
977 Ga0070680_100375654
978 Ga0070682_100013855
979 Ga0070682_100229221
980 Ga0070682_101026883
981 Ga0070682_101605724
982 Ga0068868_100033262
983 Ga0068868_100051631
984 Ga0068868_100078620
985 Ga0068868_100129706
986 Ga0068868_100308483
987 Ga0068868_101100384
988 Ga0070660_100003053
989 Ga0070660_100008261
990 Ga0070660_100031936
991 Ga0070660_100032328
992 Ga0070660_100057071
993 Ga0070660_100114235
994 Ga0070660_100117222
995 Ga0070660_100128950
996 Ga0070660_100306813
997 Ga0070660_100329855
998 Ga0070660_100447868
999 Ga0070660_100670327
1000 Ga0070660_100713793
1001 Ga0070689_101016397
1002 Ga0070691_10003582
1003 Ga0070661_100026533
1004 Ga0070661_100056051
1005 Ga0070661_100099815
1006 Ga0070661_100108040
1007 Ga0070661_100126363
1008 Ga0070661_100133516
1009 Ga0070661_100259356
1010 Ga0070661_100317045
1011 Ga0070661_100474986
1012 Ga0070661_100485528
1013 Ga0070661_100598029
1014 Ga0070661_101188688
1015 Ga0070692_10006534
1016 Ga0070675_100049667
1017 Ga0070675_100257690
1018 Ga0070675_100593569
1019 Ga0070671_100002090
1020 Ga0070671_100015766
1021 Ga0070671_100024750
1022 Ga0070671_100028475
1023 Ga0070671_100056433
1024 Ga0070671_100059294
1025 Ga0070671_100126174
1026 Ga0070671_100302705
1027 Ga0070671_100441765
1028 Ga0070674_100018560
1029 Ga0070674_100028383
1030 Ga0070674_100751110
1031 Ga0070673_100030023
1032 Ga0070673_100039241
1033 Ga0070673_100039882
1034 Ga0070673_100324412
1035 Ga0070659_100004452
1036 Ga0070659_100009360
1037 Ga0070659_100041705
1038 Ga0070659_100050354
1039 Ga0070659_100086992
1040 Ga0070659_100095748
1041 Ga0070659_100160934
1042 Ga0070659_100202607
1043 Ga0070659_100297472
1044 Ga0070659_100341327
1045 Ga0070659_100381757
1046 Ga0070659_100730976
1047 Ga0070659_100885051
1048 Ga0070659_101235960
1049 Ga0070659_101331368
1050 Ga0070667_100010677
1051 Ga0070667_100027546
1052 Ga0070667_100029232
1053 Ga0070667_100034693
1054 Ga0070709_10182391
1055 Ga0070714_100024648
1056 Ga0070714_100051350
1057 Ga0070714_100077427
1058 Ga0070714_100083682
1059 Ga0070714_100118908
1060 Ga0070714_100124451
1061 Ga0070714_100377650
1062 Ga0070714_100515657
1063 Ga0070713_100037787
1064 Ga0070713_100060401
1065 Ga0070713_100149553
1066 Ga0070713_100283377
1067 Ga0070710_10654621
1068 Ga0070701_10056286
1069 Ga0070663_100081089
1070 Ga0070663_100082406
1071 Ga0070663_100111579
1072 Ga0070663_100117144
1073 Ga0070663_100126678
1074 Ga0070663_100211025
1075 Ga0070663_100215665
1076 Ga0070678_100031044
1077 Ga0070678_100393715
1078 Ga0070662_100009880
1079 Ga0070662_100109917
1080 Ga0070662_100122792
1081 Ga0070662_100192805
1082 Ga0070662_100244743
1083 Ga0070662_100432791
1084 Ga0070662_100543652
1085 Ga0070681_10226833
1086 Ga0070681_10242084
1087 Ga0070681_10313255
1088 Ga0070681_10356957
1089 Ga0068867_100107486
1090 Ga0068867_100296207
1091 Ga0068867_100549656
1092 Ga0068867_100758623
1093 Ga0070679_100038807
1094 Ga0070679_100044440
1095 Ga0070679_100079195
1096 Ga0070679_100416136
1097 Ga0070679_100709016
1098 Ga0070679_100945526
1099 Ga0070684_100002671
1100 Ga0070684_100034298
1101 Ga0070684_100353112
1102 Ga0068853_100025015
1103 Ga0068853_100095736
1104 Ga0068853_100164720
1105 Ga0068853_100275758
1106 Ga0068853_101403305
1107 Ga0070672_100000461
1108 Ga0070672_100275877
1109 Ga0070672_100427333
1110 Ga0070686_100218439
1111 Ga0070686_100538375
1112 Ga0070693_100071516
1113 Ga0070693_100783939
1114 Ga0070665_100012613
1115 Ga0070665_100040150
1116 Ga0070665_100169141
1117 Ga0070665_100190168
1118 Ga0070665_100680549
1119 Ga0070665_100957088
1120 Ga0068855_100115015
1121 Ga0068855_100124450
1122 Ga0068855_100129420
1123 Ga0068855_100160692
1124 Ga0068855_100174522
1125 Ga0068855_100178434
1126 Ga0068855_100200788
1127 Ga0068855_100217838
1128 Ga0068855_100515666
1129 Ga0070664_100002518
1130 Ga0070664_100028887
1131 Ga0070664_100040831
1132 Ga0070664_100047412
1133 Ga0070664_100063374
1134 Ga0070664_100186882
1135 Ga0070664_100244736
1136 Ga0068857_100000489
1137 Ga0068857_100039427
1138 Ga0068857_100091002
1139 Ga0068857_100190905
1140 Ga0068857_100303721
1141 Ga0068854_100012018
1142 Ga0068854_100013400
1143 Ga0068854_100030482
1144 Ga0068854_100033456
1145 Ga0068854_100080454
1146 Ga0068854_100215840
1147 Ga0068854_100276267
1148 Ga0068854_100279508
1149 Ga0068854_100300388
1150 Ga0068854_100523488
1151 Ga0068854_100622269
1152 Ga0068854_100958766
1153 Ga0068856_100013400
1154 Ga0068856_100053557
1155 Ga0068856_100067154
1156 Ga0068856_100107491
1157 Ga0068856_100116416
1158 Ga0068856_100137905
1159 Ga0068856_100242001
1160 Ga0068856_100244315
1161 Ga0068856_100359161
1162 Ga0068856_100402279
1163 Ga0068856_100543609
1164 Ga0068856_100674668
1165 Ga0068856_100706562
1166 Ga0068856_101128147
1167 Ga0068856_101376511
1168 Ga0068852_100004443
1169 Ga0068852_100021963
1170 Ga0068852_100027753
1171 Ga0068852_100031074
1172 Ga0068852_100034952
1173 Ga0068852_100053062
1174 Ga0068852_100119684
1175 Ga0068852_100220790
1176 Ga0068852_100222790
1177 Ga0068852_100328348
1178 Ga0068852_100356102
1179 Ga0068852_100399636
1180 Ga0068852_100435479
1181 Ga0068852_100526037
1182 Ga0068852_100639315
1183 Ga0068859_100180501
1184 Ga0068864_100051914
1185 Ga0068864_100053150
1186 Ga0068864_100117483
1187 Ga0068864_100340250
1188 Ga0068866_10020801
1189 Ga0068851_10007599
1190 Ga0068851_10050154
1191 Ga0068851_10085228
1192 Ga0068851_10135629
1193 Ga0068870_10405259
1194 Ga0068863_100029810
1195 Ga0068863_100034080
1196 Ga0068863_100046826
1197 Ga0068863_100092486
1198 Ga0068858_100013510
1199 Ga0068858_100041013
1200 Ga0068858_100193155
1201 Ga0068860_100429669
1202 Ga0068860_100615448
1203 Ga0068862_100203121
1204 Ga0081539_10030833
1205 Ga0081539_10042787
1206 Ga0081539_10101652
1207 Ga0070717_10012042
1208 Ga0070717_10832085
1209 Ga0075364_10664963
1210 Ga0070715_10181307
1211 Ga0070716_100086756
1212 Ga0075369_10199929
1213 Ga0097621_100209501
1214 Ga0097621_101211207
1215 Ga0068871_100019390
1216 Ga0068871_100079789
1217 Ga0068871_100382945
1218 Ga0075434_100785517
1219 Ga0068865_100025105
1220 Ga0068865_100086744
1221 Ga0068865_100256131
1222 Ga0097620_100180502
1223 Ga0105240_10024420
1224 Ga0105240_10087322
1225 Ga0105240_10393398
1226 Ga0105245_10049870
1227 Ga0105245_10599849
1228 Ga0105247_10116345
1229 Ga0105247_10210229
1230 Ga0105241_10025711
1231 Ga0105241_10140856
1232 Ga0105241_10742811
1233 Ga0105242_10016709
1234 Ga0105242_10579264
1235 Ga0105248_10026359
1236 Ga0105248_10038209
1237 Ga0105248_10104194
1238 Ga0105248_10114594
1239 Ga0105248_10228183
1240 Ga0105248_10490247
1241 Ga0105248_10961257
1242 Ga0105248_11056138
1243 Ga0105237_10021095
1244 Ga0105237_10142523
1245 Ga0105238_10017635
1246 Ga0105238_10135699
1247 Ga0105238_10197199
1248 Ga0105238_10236138
1249 Ga0105238_10396735
1250 Ga0105238_10439728
1251 Ga0105238_10603691
1252 Ga0105239_10027029
1253 Ga0105246_10114352
1254 Ga0105246_10158042
1255 Ga0157373_10014198
1256 Ga0157373_10014974
1257 Ga0157373_10063395
1258 Ga0157373_10109243
1259 Ga0157373_10153236
1260 Ga0157373_10238318
1261 Ga0157373_10385557
1262 Ga0157371_10121607
1263 Ga0157371_10166613
1264 Ga0157371_10489293
1265 Ga0157371_10996903
1266 Ga0157371_11134935
1267 Ga0157371_11249529
1268 Ga0157370_10002746
1269 Ga0157370_10050746
1270 Ga0157370_10069760
1271 Ga0157370_10095543
1272 Ga0157370_10133468
1273 Ga0157370_10203545
1274 Ga0157370_10476141
1275 Ga0157370_10487620
1276 Ga0157370_10530284
1277 Ga0157369_10004619
1278 Ga0157369_10023641
1279 Ga0157369_10030800
1280 Ga0157369_10034637
1281 Ga0157369_10063178
1282 Ga0157369_10102744
1283 Ga0157369_10117807
1284 Ga0157369_10160228
1285 Ga0157369_10165280
1286 Ga0157369_10186201
1287 Ga0157369_10214914
1288 Ga0157369_10303168
1289 Ga0157369_10333383
1290 Ga0157369_10850498
1291 Ga0157369_11817098
1292 Ga0157374_10021305
1293 Ga0157374_10029007
1294 Ga0157374_10063153
1295 Ga0157374_10119412
1296 Ga0157374_10293136
1297 Ga0157374_10323900
1298 Ga0157374_10643549
1299 Ga0157378_10219689
1300 Ga0157378_10480521
1301 Ga0157378_10589598
1302 Ga0163162_10019183
1303 Ga0163162_10048537
1304 Ga0163162_10287058
1305 Ga0157372_10074479
1306 Ga0157372_10159755
1307 Ga0157372_10192727
1308 Ga0157372_10206753
1309 Ga0157372_10281459
1310 Ga0157372_10381411
1311 Ga0157372_10442817
1312 Ga0157372_10448476
1313 Ga0157372_11671906
1314 Ga0157375_10024280
1315 Ga0157375_10052650
1316 Ga0157375_10439554
1317 Ga0157375_10832131
1318 Ga0157375_11882243
1319 Ga0163163_10011842
1320 Ga0163163_10034598
1321 Ga0163163_10037142
1322 Ga0157377_10085863
1323 Ga0157379_10876979
1324 Ga0157376_10302569
1325 Ga0206356_11797130
1326 Ga0206355_1601105
1327 Ga0213876_10015773
1328 Ga0207697_10155619
1329 Ga0207656_10025258
1330 Ga0207656_10113354
1331 Ga0207656_10223640
1332 Ga0207642_10011605
1333 Ga0207710_10218595
1334 Ga0207688_10207361
1335 Ga0207680_10003692
1336 Ga0207680_10010957
1337 Ga0207680_10013553
1338 Ga0207680_10112205
1339 Ga0207647_10007000
1340 Ga0207647_10014002
1341 Ga0207647_10018752
1342 Ga0207647_10022272
1343 Ga0207647_10024348
1344 Ga0207647_10036155
1345 Ga0207647_10041018
1346 Ga0207647_10048627
1347 Ga0207647_10080059
1348 Ga0207647_10089347
1349 Ga0207685_10260262
1350 Ga0207699_10048389
1351 Ga0207645_10051000
1352 Ga0207645_10110365
1353 Ga0207705_10000003
1354 Ga0207705_10000493
1355 Ga0207705_10001025
1356 Ga0207705_10009697
1357 Ga0207705_10019512
1358 Ga0207705_10027645
1359 Ga0207705_10028284
1360 Ga0207705_10037912
1361 Ga0207705_10042739
1362 Ga0207705_10097045
1363 Ga0207705_10255496
1364 Ga0207705_10268769
1365 Ga0207705_10356814
1366 Ga0207707_10017647
1367 Ga0207707_10077183
1368 Ga0207707_10209630
1369 Ga0207695_10008855
1370 Ga0207695_10009362
1371 Ga0207695_10057313
1372 Ga0207695_10315334
1373 Ga0207671_10024193
1374 Ga0207671_10028319
1375 Ga0207660_10000770
1376 Ga0207660_10003208
1377 Ga0207660_10382789
1378 Ga0207660_10521874
1379 Ga0207657_10002261
1380 Ga0207657_10003123
1381 Ga0207657_10006107
1382 Ga0207657_10018368
1383 Ga0207657_10026360
1384 Ga0207657_10040433
1385 Ga0207657_10056349
1386 Ga0207657_10066200
1387 Ga0207657_10076653
1388 Ga0207657_10109570
1389 Ga0207657_10115485
1390 Ga0207657_10174288
1391 Ga0207657_10429289
1392 Ga0207649_10006255
1393 Ga0207649_10021154
1394 Ga0207649_10033502
1395 Ga0207649_10101062
1396 Ga0207649_10135803
1397 Ga0207649_10205843
1398 Ga0207649_10234168
1399 Ga0207649_10344207
1400 Ga0207649_10525587
1401 Ga0207649_10573796
1402 Ga0207649_10603588
1403 Ga0207652_10000034
1404 Ga0207652_10151864
1405 Ga0207694_10024170
1406 Ga0207694_10025296
1407 Ga0207694_10671482
1408 Ga0207650_10087834
1409 Ga0207650_10184267
1410 Ga0207650_10286661
1411 Ga0207650_10670192
1412 Ga0207659_10207770
1413 Ga0207659_10274319
1414 Ga0207687_10083000
1415 Ga0207700_10037272
1416 Ga0207700_10053420
1417 Ga0207700_10118377
1418 Ga0207664_10036282
1419 Ga0207664_10252888
1420 Ga0207644_10000747
1421 Ga0207644_10006207
1422 Ga0207644_10015057
1423 Ga0207644_10016318
1424 Ga0207644_10016718
1425 Ga0207644_10023819
1426 Ga0207644_10156432
1427 Ga0207644_10702358
1428 Ga0207690_10008784
1429 Ga0207690_10015093
1430 Ga0207690_10060505
1431 Ga0207690_10066579
1432 Ga0207690_10152704
1433 Ga0207690_10417273
1434 Ga0207690_11017128
1435 Ga0207706_10008319
1436 Ga0207706_10019826
1437 Ga0207706_10037830
1438 Ga0207706_10054006
1439 Ga0207706_10131582
1440 Ga0207706_10233077
1441 Ga0207706_10254876
1442 Ga0207706_10310147
1443 Ga0207706_10441557
1444 Ga0207706_10541087
1445 Ga0207706_10578983
1446 Ga0207686_10064988
1447 Ga0207670_10644647
1448 Ga0207669_10027200
1449 Ga0207669_10081406
1450 Ga0207669_10281606
1451 Ga0207704_10032107
1452 Ga0207704_10975778
1453 Ga0207665_10049456
1454 Ga0207665_10132756
1455 Ga0207691_10004673
1456 Ga0207691_10005523
1457 Ga0207691_10013134
1458 Ga0207691_10269925
1459 Ga0207711_10007240
1460 Ga0207711_10007576
1461 Ga0207711_10014416
1462 Ga0207711_10020622
1463 Ga0207711_10033837
1464 Ga0207711_10204330
1465 Ga0207711_10311060
1466 Ga0207711_10637293
1467 Ga0207711_10827109
1468 Ga0207711_11044215
1469 Ga0207661_10002378
1470 Ga0207661_10012640
1471 Ga0207661_10594680
1472 Ga0207661_10737127
1473 Ga0207679_10007576
1474 Ga0207679_10020448
1475 Ga0207679_10059420
1476 Ga0207679_10069570
1477 Ga0207679_10117050
1478 Ga0207679_10125411
1479 Ga0207679_10299494
1480 Ga0207679_10478083
1481 Ga0207679_10798141
1482 Ga0207667_10004710
1483 Ga0207667_10022167
1484 Ga0207667_10026666
1485 Ga0207667_10078827
1486 Ga0207667_10178420
1487 Ga0207667_10261594
1488 Ga0207667_10313539
1489 Ga0207667_10790375
1490 Ga0207667_10945478
1491 Ga0207667_10948104
1492 Ga0207667_11219828
1493 Ga0207651_10012099
1494 Ga0207651_10014049
1495 Ga0207651_10015757
1496 Ga0207651_10017768
1497 Ga0207651_10029038
1498 Ga0207651_10078455
1499 Ga0207640_10025603
1500 Ga0207640_10037577
1501 Ga0207640_10095945
1502 Ga0207640_10153773
1503 Ga0207640_10177872
1504 Ga0207640_10219580
1505 Ga0207640_10522418
1506 Ga0207640_10707786
1507 Ga0207640_11116681
1508 Ga0207658_10013412
1509 Ga0207658_10065328
1510 Ga0207658_10309592
1511 Ga0207658_10405856
1512 Ga0207677_10006373
1513 Ga0207677_10081189
1514 Ga0207677_10150836
1515 Ga0207677_10174809
1516 Ga0207677_11277365
1517 Ga0207703_10012807
1518 Ga0207703_10028733
1519 Ga0207703_10112271
1520 Ga0207703_10288547
1521 Ga0207639_10000923
1522 Ga0207639_10001159
1523 Ga0207639_10706898
1524 Ga0207639_10866551
1525 Ga0207639_10917004
1526 Ga0207678_10006063
1527 Ga0207678_10009081
1528 Ga0207678_10046333
1529 Ga0207678_10053830
1530 Ga0207678_10055524
1531 Ga0207678_10138920
1532 Ga0207678_10143449
1533 Ga0207678_10164425
1534 Ga0207678_10558145
1535 Ga0207678_10617858
1536 Ga0207702_10002063
1537 Ga0207702_10019681
1538 Ga0207702_10025645
1539 Ga0207702_10059906
1540 Ga0207702_10060514
1541 Ga0207702_10074449
1542 Ga0207702_10177756
1543 Ga0207702_10221564
1544 Ga0207702_10244287
1545 Ga0207702_10330691
1546 Ga0207641_10073824
1547 Ga0207641_10710167
1548 Ga0207648_10008762
1549 Ga0207648_10010578
1550 Ga0207648_10088236
1551 Ga0207648_10348933
1552 Ga0207676_10033010
1553 Ga0207676_10093212
1554 Ga0207676_10233662
1555 Ga0207676_10277997
1556 Ga0207674_10006843
1557 Ga0207674_10012374
1558 Ga0207674_10077107
1559 Ga0207674_10080912
1560 Ga0207674_10115084
1561 Ga0207674_10157321
1562 Ga0207674_10193343
1563 Ga0207674_10818294
1564 Ga0207674_11400548
1565 Ga0207683_10014680
1566 Ga0207683_10021530
1567 Ga0207683_10222611
1568 Ga0207698_10000896
1569 Ga0207698_10003271
1570 Ga0207698_10006737
1571 Ga0207698_10008977
1572 Ga0207698_10022783
1573 Ga0207698_10035355
1574 Ga0207698_10043850
1575 Ga0207698_10216528
1576 Ga0207698_10219416
1577 Ga0207698_10310425
1578 Ga0207698_10535537
1579 Ga0207698_10746658
1580 Ga0207698_10975881
1581 Ga0207698_11139976
1582 Ga0207698_12055493
1583 Ga0268266_10000767
1584 Ga0268266_10029135
1585 Ga0268266_10045135
1586 Ga0268266_10212037
1587 Ga0268266_10665544
1588 Ga0268266_11375540
1589 Ga0268265_10363928
1590 Ga0268264_10266424
1591 Ga0268264_10399541
1592 Ga0307408_100039656
1593 Ga0307405_10148856
1594 Ga0307413_10014680
1595 Ga0307413_10035173
1596 Ga0307410_10010532
1597 Ga0307410_10031141
1598 Ga0307410_10128545
1599 Ga0307406_10101720
1600 Ga0307406_10547227
1601 Ga0307407_10105882
1602 Ga0307407_10218692
1603 Ga0307412_10154743
1604 Ga0307409_100031493
1605 Ga0307409_100115218
1606 Ga0307409_100148144
1607 Ga0307416_100020756
1608 Ga0307416_100023349
1609 Ga0307414_10009432
1610 Ga0307414_10040743
1611 Ga0307414_10391625
1612 Ga0307411_10007591
1613 Ga0307411_10024440
1614 Ga0307411_10119092
1615 Ga0307415_100004410
1616 Ga0307415_100066475
1617 Ga0373923_0112263
1618 Ga0373954_0049544
1619 Ga0373956_0097486
1620 Ga0373960_0244112
1621 Ga0373946_0050901
1622 Ga0373931_0094472
1623 Ga0373935_0153284
1624 Ga0373933_0014251
1625 Ga0373933_0653287
1626 Ga0373947_0577649
1627 Ga0373937_0004829
1628 Ga0395899_0021048
1629 Ga0395899_0036604
1630 Ga0395899_0042007
1631 Ga0395899_0048839
1632 Ga0395899_0050645
1633 Ga0395899_0051337
1634 Ga0395899_0053501
1635 Ga0395899_0090055
1636 Ga0395899_0102274
1637 Ga0395899_0162413
1638 Ga0395899_0194735
1639 Ga0395899_0213622
1640 Ga0395899_0285816
1641 Ga0395899_0292103
1642 Ga0395900_0003085
1643 Ga0395900_0009276
1644 Ga0395900_0010484
1645 Ga0395900_0030431
1646 Ga0395900_0030498
1647 Ga0395900_0050997
1648 Ga0395900_0053926
1649 Ga0395900_0062637
1650 Ga0395900_0073419
1651 Ga0395900_0088171
1652 Ga0395900_0102036
1653 Ga0395900_0115343
1654 Ga0395900_0130385
1655 Ga0395900_0131903
1656 Ga0395900_0133413
1657 Ga0395900_0164577
1658 Ga0395900_0172571
1659 Ga0395900_0262255
1660 Ga0395900_0308123
1661 Ga0395900_0415743
1662 Ga0395900_0505633
1663 Ga0395900_0542483
1664 Ga0395900_0572365
1665 Ga0395900_0694432
1666 Ga0395900_1028220
1667 Ga0395900_1333342
1668 Ga0395898_0011721
1669 Ga0395898_0015329
1670 Ga0395898_0019188
1671 Ga0395898_0025785
1672 Ga0395898_0053789
1673 Ga0395898_0055306
1674 Ga0395898_0087550
1675 Ga0395898_0178684
1676 Ga0395898_0217297
1677 Ga0395898_0226204
1678 Ga0395898_0337753
1679 Ga0395898_0381880
1680 Ga0395898_0678779
1681 Ga0395898_0689444
1682 Ga0395905_0001169
1683 Ga0395905_0001983
1684 Ga0395905_0006012
1685 Ga0395905_0006135
1686 Ga0395905_0008256
1687 Ga0395905_0028510
1688 Ga0395905_0033050
1689 Ga0395905_0033437
1690 Ga0395905_0034571
1691 Ga0395905_0037838
1692 Ga0395905_0045884
1693 Ga0395905_0051435
1694 Ga0395905_0057078
1695 Ga0395905_0062402
1696 Ga0395905_0084238
1697 Ga0395905_0092392
1698 Ga0395905_0128774
1699 Ga0395905_0144847
1700 Ga0395905_0212009
1701 Ga0395905_0294178
1702 Ga0395905_0413108
1703 Ga0395905_0433132
1704 Ga0395905_0543099
1705 Ga0395905_0647645
1706 Ga0395905_0665994
1707 Ga0395905_0667690
1708 Ga0395905_0945837
1709 Ga0395905_0999755
1710 Ga0395905_1223661
1711 Ga0395901_0006031
1712 Ga0395901_0028506
1713 Ga0395901_0050004
1714 Ga0395901_0067878
1715 Ga0395901_0082714
1716 Ga0395901_0101199
1717 Ga0395901_0106570
1718 Ga0395901_0115762
1719 Ga0395901_0116588
1720 Ga0395901_0121033
1721 Ga0395901_0125924
1722 Ga0395901_0130740
1723 Ga0395901_0133252
1724 Ga0395901_0175992
1725 Ga0395901_0230494
1726 Ga0395901_0319888
1727 Ga0395901_0347379
1728 Ga0395901_0440675
1729 Ga0395901_0495449
1730 Ga0395901_0508607
1731 Ga0395901_0554006
1732 Ga0395901_0602161
1733 Ga0395901_0642761
1734 Ga0395901_0777050
1735 Ga0395901_0902722
1736 Ga0436365_0481817
1737 Ga0439448_0004598
1738 Ga0439458_0000480
1739 Ga0439458_0001207
1740 Ga0439458_0007205
1741 Ga0466969_0053154
1742 Ga0466972_0119841
1743 Ga0466966_0000001
1744 Ga0466966_0010135
1745 Ga0466966_0045027
1746 Ga0466966_0050485
1747 Ga0466966_0102144
1748 Ga0466966_0705909
1749 Ga0466961_0009876
1750 Ga0466961_0168457
1751 Ga0466963_0006272
1752 Ga0466963_0010178
1753 Ga0466963_0150551
1754 Ga0466963_0378012
1755 Ga0466963_0467005
1756 Ga0466964_0059314
1757 Ga0466964_0347434
1758 Ga0466971_0064787
1759 Ga0466971_0241360
1760 Ga0466970_0008343
1761 Ga0466970_0033889
1762 Ga0466957_0000183
1763 Ga0466957_0008937
1764 Ga0466957_0011371
1765 Ga0466957_0128657
1766 Ga0466957_0172057
1767 Ga0466957_0469958
1768 Ga0466957_0480373
1769 Ga0466957_0560413
1770 Ga0466957_0575264
1771 Ga0466960_0013146
1772 Ga0466960_0158182
1773 Ga0466959_0004304
1774 Ga0466959_0083054
1775 Ga0466959_0089032
1776 Ga0466959_0103432
1777 Ga0466959_0132379
1778 Ga0466958_0010395
1779 Ga0466958_0047500
1780 Ga0466958_0085191
1781 Ga0466958_0130082
1782 Ga0466958_0154575
1783 Ga0466958_0221517
1784 Ga0466967_0007477
1785 Ga0466967_0011797
1786 Ga0466967_0062028
1787 Ga0466967_0113070
1788 Ga0466967_0118782
1789 Ga0466967_0134561
1790 Ga0466967_0320165
1791 Ga0466967_0402360
1792 Ga0466967_0520729
1793 Ga0466967_0578979
1794 Ga0466967_0724920
1795 Ga0466967_0745784
1796 Ga0466967_0778481
1797 Ga0466967_0786938
1798 Ga0466967_0996193
1799 Ga0495663_0125449
1800 Ga0495586_0392618
1801 Ga0495598_0002244
1802 Ga0495621_0000972
1803 Ga0495633_0042594
1804 Ga0495668_0077275
1805 Ga0495623_0064093
1806 Ga0495669_0029165
1807 Ga0495669_0080319
1808 Ga0495669_0243949
1809 Ga0495670_0000071
1810 Ga0495600_0265660
1811 Ga0495602_0043086
1812 Ga0496100_0083922
1813 Ga0496101_0115149
1814 Ga0496101_0144671
1815 Ga0496101_0216755
1816 Ga0496102_0063070
1817 Ga0496102_0673775
1818 Ga0496104_0065814
1819 Ga0496105_0039333
1820 Ga0496105_0137137
1821 Ga0496106_0017617
1822 Ga0496106_0705234
1823 Ga0496107_0011494
1824 Ga0496107_0189121
1825 Ga0496107_0316958
1826 Ga0496108_0006177
1827 Ga0496108_0034647
1828 Ga0496108_0046784
1829 Ga0496109_0021950
1830 Ga0496109_0034955
1831 Ga0496109_0068968
1832 Ga0496109_0219805
1833 Ga0496110_0013619
1834 Ga0496110_0427452
1835 Ga0496111_0005193
1836 Ga0496111_0007572
1837 Ga0496111_0029259
1838 Ga0496112_0012266
1839 Ga0496112_0054746
1840 Ga0496112_0095037
1841 Ga0496112_0163559
1842 Ga0496112_0263820
1843 Ga0496112_0264652
1844 Ga0496112_0886951
1845 Ga0496113_0012069
1846 Ga0496113_0120879
1847 Ga0496113_0381671
1848 Ga0496113_0536789
1849 Ga0496113_0695847
1850 Ga0496114_0012137
1851 Ga0496114_0215334
1852 Ga0496114_0358059
1853 Ga0496115_0015819
1854 nmdc:mga0n895_901262_c1
1855 Ga0587090_014290
1856 Ga0466962_0006344
1857 Ga0466962_0013258
1858 Ga0466962_0015820
1859 Ga0466962_0044372
1860 2885429574

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

95

182

0.88

Map