F486013
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 930 | 346 | 1860 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10228142|Ga0070666_102281422 |
| Length | 212 |
| Sequence | VKARSAGRNHHPSRVLAVAPITLSDDRVRLEPLALHHEEGLRRAAADGELWQIRVTSVPEPDDTRGYIERALQGFADGHRLAFAVLDAASGEVIGSSSYHDIVPAVERLEIGYTWYAKSRQRTHVNASAKLLLMQHAFETLGARLVGWRTDNFNFASQRAIERLGARKDGVLRHHAVRRDGTIRDTVMYSMTAGEWPEAKAELQARLARPRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 177 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 178 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 190 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 208 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 209 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 210 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 211 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 212 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 213 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 222 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 330 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 335 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 340 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 341 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 342 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 343 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 344 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 345 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 346 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.95 |
| Nodule | 0 |
| Rhizoplane | 4.62 |
| Rhizosphere | 87.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070666_10228142 | 3300005335 | Bacteria | 1315 |
| 2 | JGI25158J39367_1020747 | 3300002739 | Bacteria | 801 |
| 3 | JGI25159J45721_1001812 | 3300002987 | Bacteria | 8567 |
| 4 | JGI25159J45721_1010629 | 3300002987 | Bacteria | 2326 |
| 5 | rootL2_10015574 | 3300003322 | Bacteria | 1061 |
| 6 | JGI25160J50197_1008378 | 3300003354 | Bacteria | 3945 |
| 7 | JGI25161J50226_1003119 | 3300003374 | Bacteria | 3944 |
| 8 | JGI25161J50226_1007562 | 3300003374 | Bacteria | 1802 |
| 9 | Ga0055526_1002157 | 3300003771 | Bacteria | 13486 |
| 10 | Ga0055537_1002292 | 3300003773 | Bacteria | 6551 |
| 11 | Ga0055537_1018071 | 3300003773 | Bacteria | 1138 |
| 12 | Ga0055524_1001269 | 3300003775 | Bacteria | 14790 |
| 13 | Ga0055534_1002606 | 3300003784 | Bacteria | 6151 |
| 14 | Ga0055530_10015821 | 3300003791 | Bacteria | 2441 |
| 15 | Ga0055530_10016700 | 3300003791 | Bacteria | 2328 |
| 16 | Ga0055531_10025864 | 3300003794 | Bacteria | 2115 |
| 17 | Ga0055543_1001061 | 3300004625 | Bacteria | 12167 |
| 18 | Ga0065165_1003149 | 3300005262 | Bacteria | 12167 |
| 19 | Ga0070658_10167090 | 3300005327 | Bacteria | 1847 |
| 20 | Ga0070658_10536862 | 3300005327 | Bacteria | 1012 |
| 21 | Ga0070676_10006179 | 3300005328 | Bacteria | 6394 |
| 22 | Ga0070676_10402641 | 3300005328 | Bacteria | 952 |
| 23 | Ga0070683_100098838 | 3300005329 | Bacteria | 2746 |
| 24 | Ga0070683_100333818 | 3300005329 | Bacteria | 1443 |
| 25 | Ga0070683_100568363 | 3300005329 | Bacteria | 1084 |
| 26 | Ga0070690_100009995 | 3300005330 | Bacteria | 5508 |
| 27 | Ga0070670_100040437 | 3300005331 | Bacteria | 4009 |
| 28 | Ga0070670_100041228 | 3300005331 | Bacteria | 3968 |
| 29 | Ga0070670_100041810 | 3300005331 | Bacteria | 3939 |
| 30 | Ga0070670_100070545 | 3300005331 | Bacteria | 2999 |
| 31 | Ga0070670_100250988 | 3300005331 | Bacteria | 1541 |
| 32 | Ga0070670_100289814 | 3300005331 | Bacteria | 1430 |
| 33 | Ga0070670_100525976 | 3300005331 | Bacteria | 1053 |
| 34 | Ga0070677_10057022 | 3300005333 | Bacteria | 1599 |
| 35 | Ga0070677_10067798 | 3300005333 | Bacteria | 1492 |
| 36 | Ga0070677_10244336 | 3300005333 | Bacteria | 888 |
| 37 | Ga0070677_10300367 | 3300005333 | Bacteria | 815 |
| 38 | Ga0068869_100023042 | 3300005334 | Bacteria | 4295 |
| 39 | Ga0070666_10006509 | 3300005335 | Bacteria | 7174 |
| 40 | Ga0070666_10206569 | 3300005335 | Bacteria | 1382 |
| 41 | Ga0070666_10240260 | 3300005335 | Bacteria | 1281 |
| 42 | Ga0070680_100023635 | 3300005336 | Bacteria | 4904 |
| 43 | Ga0070682_100543651 | 3300005337 | Bacteria | 908 |
| 44 | Ga0068868_100139572 | 3300005338 | Bacteria | 1989 |
| 45 | Ga0068868_100225914 | 3300005338 | Bacteria | 1569 |
| 46 | Ga0068868_100672776 | 3300005338 | Bacteria | 923 |
| 47 | Ga0068868_100797915 | 3300005338 | Bacteria | 852 |
| 48 | Ga0070660_100342381 | 3300005339 | Bacteria | 1230 |
| 49 | Ga0070689_100036157 | 3300005340 | Bacteria | 3777 |
| 50 | Ga0070687_100049285 | 3300005343 | Bacteria | 2169 |
| 51 | Ga0070687_100301400 | 3300005343 | Bacteria | 1017 |
| 52 | Ga0070661_100036668 | 3300005344 | Bacteria | 3564 |
| 53 | Ga0070661_100125964 | 3300005344 | Bacteria | 1922 |
| 54 | Ga0070661_100134924 | 3300005344 | Bacteria | 1856 |
| 55 | Ga0070661_100271965 | 3300005344 | Bacteria | 1312 |
| 56 | Ga0070661_100899479 | 3300005344 | Bacteria | 731 |
| 57 | Ga0070668_100091715 | 3300005347 | Bacteria | 2395 |
| 58 | Ga0070668_100259897 | 3300005347 | Bacteria | 1443 |
| 59 | Ga0070668_100319559 | 3300005347 | Bacteria | 1307 |
| 60 | Ga0070668_100769150 | 3300005347 | Bacteria | 854 |
| 61 | Ga0070669_100001130 | 3300005353 | Bacteria | 19489 |
| 62 | Ga0070669_100116846 | 3300005353 | Bacteria | 2030 |
| 63 | Ga0070669_100256692 | 3300005353 | Bacteria | 1393 |
| 64 | Ga0070669_100343750 | 3300005353 | Bacteria | 1210 |
| 65 | Ga0070675_100003213 | 3300005354 | Bacteria | 12380 |
| 66 | Ga0070675_100008487 | 3300005354 | Bacteria | 7976 |
| 67 | Ga0070675_100009897 | 3300005354 | Bacteria | 7432 |
| 68 | Ga0070675_100156052 | 3300005354 | Bacteria | 1960 |
| 69 | Ga0070675_100219464 | 3300005354 | Bacteria | 1655 |
| 70 | Ga0070675_100220814 | 3300005354 | Bacteria | 1650 |
| 71 | Ga0070675_100359002 | 3300005354 | Bacteria | 1293 |
| 72 | Ga0070671_100011925 | 3300005355 | Bacteria | 6991 |
| 73 | Ga0070671_100118865 | 3300005355 | Bacteria | 2223 |
| 74 | Ga0070671_100124449 | 3300005355 | Bacteria | 2170 |
| 75 | Ga0070671_100189646 | 3300005355 | Bacteria | 1742 |
| 76 | Ga0070671_100233666 | 3300005355 | Bacteria | 1560 |
| 77 | Ga0070671_100268030 | 3300005355 | Bacteria | 1451 |
| 78 | Ga0070671_100313838 | 3300005355 | Bacteria | 1335 |
| 79 | Ga0070671_100756143 | 3300005355 | Bacteria | 845 |
| 80 | Ga0070674_100019990 | 3300005356 | Bacteria | 4267 |
| 81 | Ga0070674_100036075 | 3300005356 | Bacteria | 3316 |
| 82 | Ga0070674_100054491 | 3300005356 | Bacteria | 2766 |
| 83 | Ga0070674_100061868 | 3300005356 | Bacteria | 2614 |
| 84 | Ga0070674_100136079 | 3300005356 | Bacteria | 1838 |
| 85 | Ga0070673_100012933 | 3300005364 | Bacteria | 5750 |
| 86 | Ga0070673_100014182 | 3300005364 | Bacteria | 5539 |
| 87 | Ga0070673_100049904 | 3300005364 | Bacteria | 3269 |
| 88 | Ga0070673_100068785 | 3300005364 | Bacteria | 2836 |
| 89 | Ga0070673_100106844 | 3300005364 | Bacteria | 2315 |
| 90 | Ga0070673_100107138 | 3300005364 | Bacteria | 2311 |
| 91 | Ga0070673_100466491 | 3300005364 | Bacteria | 1138 |
| 92 | Ga0070688_100156585 | 3300005365 | Bacteria | 1561 |
| 93 | Ga0070659_100039683 | 3300005366 | Bacteria | 3676 |
| 94 | Ga0070659_100170292 | 3300005366 | Bacteria | 1783 |
| 95 | Ga0070667_100005407 | 3300005367 | Bacteria | 10668 |
| 96 | Ga0070667_100017232 | 3300005367 | Bacteria | 5984 |
| 97 | Ga0070667_100075666 | 3300005367 | Bacteria | 2874 |
| 98 | Ga0070667_100138856 | 3300005367 | Bacteria | 2126 |
| 99 | Ga0070667_100227038 | 3300005367 | Bacteria | 1664 |
| 100 | Ga0070667_100299990 | 3300005367 | Bacteria | 1446 |
| 101 | Ga0070700_100605743 | 3300005441 | Bacteria | 859 |
| 102 | Ga0070663_100096753 | 3300005455 | Bacteria | 2196 |
| 103 | Ga0070663_100141142 | 3300005455 | Bacteria | 1839 |
| 104 | Ga0070678_100000202 | 3300005456 | Bacteria | 26370 |
| 105 | Ga0070678_100026125 | 3300005456 | Bacteria | 3942 |
| 106 | Ga0070678_100144714 | 3300005456 | Bacteria | 1906 |
| 107 | Ga0070678_100183127 | 3300005456 | Bacteria | 1716 |
| 108 | Ga0070678_100212455 | 3300005456 | Bacteria | 1604 |
| 109 | Ga0070678_100223703 | 3300005456 | Bacteria | 1565 |
| 110 | Ga0070678_100229254 | 3300005456 | Bacteria | 1547 |
| 111 | Ga0070678_100234822 | 3300005456 | Bacteria | 1530 |
| 112 | Ga0070678_100259165 | 3300005456 | Bacteria | 1461 |
| 113 | Ga0070678_100301155 | 3300005456 | Bacteria | 1362 |
| 114 | Ga0070678_100334342 | 3300005456 | Bacteria | 1297 |
| 115 | Ga0070662_100001238 | 3300005457 | Bacteria | 15666 |
| 116 | Ga0070662_100045173 | 3300005457 | Bacteria | 3159 |
| 117 | Ga0070662_100096187 | 3300005457 | Bacteria | 2234 |
| 118 | Ga0070662_100157745 | 3300005457 | Bacteria | 1773 |
| 119 | Ga0070662_100795813 | 3300005457 | Bacteria | 803 |
| 120 | Ga0070681_10017210 | 3300005458 | Bacteria | 7227 |
| 121 | Ga0068867_100000173 | 3300005459 | Bacteria | 42222 |
| 122 | Ga0068867_100048156 | 3300005459 | Bacteria | 3135 |
| 123 | Ga0068867_100280827 | 3300005459 | Bacteria | 1365 |
| 124 | Ga0068867_100324007 | 3300005459 | Bacteria | 1277 |
| 125 | Ga0068867_100491221 | 3300005459 | Bacteria | 1053 |
| 126 | Ga0068867_100929104 | 3300005459 | Bacteria | 785 |
| 127 | Ga0070679_100002880 | 3300005530 | Bacteria | 15636 |
| 128 | Ga0070684_100225458 | 3300005535 | Bacteria | 1710 |
| 129 | Ga0070684_100303343 | 3300005535 | Bacteria | 1466 |
| 130 | Ga0070684_100448397 | 3300005535 | Bacteria | 1192 |
| 131 | Ga0068853_100097511 | 3300005539 | Bacteria | 2595 |
| 132 | Ga0068853_100183825 | 3300005539 | Bacteria | 1897 |
| 133 | Ga0068853_100400553 | 3300005539 | Bacteria | 1284 |
| 134 | Ga0068853_100674768 | 3300005539 | Bacteria | 985 |
| 135 | Ga0068853_100736778 | 3300005539 | Bacteria | 941 |
| 136 | Ga0070672_100008996 | 3300005543 | Bacteria | 6864 |
| 137 | Ga0070672_100023210 | 3300005543 | Bacteria | 4569 |
| 138 | Ga0070672_100035158 | 3300005543 | Bacteria | 3807 |
| 139 | Ga0070672_100073201 | 3300005543 | Bacteria | 2730 |
| 140 | Ga0070672_100076179 | 3300005543 | Bacteria | 2679 |
| 141 | Ga0070672_100077866 | 3300005543 | Bacteria | 2652 |
| 142 | Ga0070672_100155404 | 3300005543 | Bacteria | 1894 |
| 143 | Ga0070672_100367461 | 3300005543 | Bacteria | 1229 |
| 144 | Ga0070672_100456136 | 3300005543 | Bacteria | 1101 |
| 145 | Ga0070693_100068866 | 3300005547 | Bacteria | 2078 |
| 146 | Ga0070665_100220200 | 3300005548 | Bacteria | 1898 |
| 147 | Ga0070665_100433462 | 3300005548 | Bacteria | 1324 |
| 148 | Ga0070664_100037616 | 3300005564 | Bacteria | 4069 |
| 149 | Ga0070664_100227913 | 3300005564 | Bacteria | 1669 |
| 150 | Ga0070664_100297592 | 3300005564 | Bacteria | 1457 |
| 151 | Ga0070664_100458131 | 3300005564 | Bacteria | 1171 |
| 152 | Ga0070664_100581658 | 3300005564 | Bacteria | 1037 |
| 153 | Ga0068857_100061915 | 3300005577 | Bacteria | 3325 |
| 154 | Ga0068854_100099736 | 3300005578 | Bacteria | 2175 |
| 155 | Ga0068854_100185117 | 3300005578 | Bacteria | 1629 |
| 156 | Ga0068856_100104352 | 3300005614 | Bacteria | 2828 |
| 157 | Ga0068856_100165071 | 3300005614 | Bacteria | 2225 |
| 158 | Ga0068856_100802849 | 3300005614 | Bacteria | 961 |
| 159 | Ga0068856_100823349 | 3300005614 | Bacteria | 948 |
| 160 | Ga0070702_100201945 | 3300005615 | Bacteria | 1317 |
| 161 | Ga0068852_100009055 | 3300005616 | Bacteria | 7370 |
| 162 | Ga0068852_100010860 | 3300005616 | Bacteria | 6825 |
| 163 | Ga0068852_100030071 | 3300005616 | Bacteria | 4467 |
| 164 | Ga0068852_100031671 | 3300005616 | Bacteria | 4368 |
| 165 | Ga0068852_100118587 | 3300005616 | Bacteria | 2418 |
| 166 | Ga0068852_100137341 | 3300005616 | Bacteria | 2258 |
| 167 | Ga0068852_100314359 | 3300005616 | Bacteria | 1519 |
| 168 | Ga0068852_100339511 | 3300005616 | Bacteria | 1464 |
| 169 | Ga0068852_100355595 | 3300005616 | Bacteria | 1431 |
| 170 | Ga0068852_100688516 | 3300005616 | Bacteria | 1032 |
| 171 | Ga0068859_100039942 | 3300005617 | Bacteria | 4709 |
| 172 | Ga0068859_100136533 | 3300005617 | Bacteria | 2525 |
| 173 | Ga0068859_100156913 | 3300005617 | Bacteria | 2353 |
| 174 | Ga0068859_100753540 | 3300005617 | Bacteria | 1063 |
| 175 | Ga0068864_100000365 | 3300005618 | Bacteria | 39562 |
| 176 | Ga0068864_100002329 | 3300005618 | Bacteria | 15709 |
| 177 | Ga0068864_100031123 | 3300005618 | Bacteria | 4526 |
| 178 | Ga0068864_100045894 | 3300005618 | Bacteria | 3749 |
| 179 | Ga0068864_100080467 | 3300005618 | Bacteria | 2854 |
| 180 | Ga0068864_100283914 | 3300005618 | Bacteria | 1546 |
| 181 | Ga0068864_100493069 | 3300005618 | Bacteria | 1177 |
| 182 | Ga0068866_10012833 | 3300005718 | Bacteria | 3659 |
| 183 | Ga0068866_10095036 | 3300005718 | Bacteria | 1632 |
| 184 | Ga0068861_100416922 | 3300005719 | Bacteria | 1195 |
| 185 | Ga0068851_10005284 | 3300005834 | Bacteria | 5859 |
| 186 | Ga0068851_10122315 | 3300005834 | Bacteria | 1400 |
| 187 | Ga0068851_10250998 | 3300005834 | Bacteria | 1003 |
| 188 | Ga0068851_10259752 | 3300005834 | Bacteria | 988 |
| 189 | Ga0068870_10165149 | 3300005840 | Bacteria | 1317 |
| 190 | Ga0068870_10190663 | 3300005840 | Bacteria | 1237 |
| 191 | Ga0068863_100025015 | 3300005841 | Bacteria | 5694 |
| 192 | Ga0068863_100063605 | 3300005841 | Bacteria | 3489 |
| 193 | Ga0068863_100114908 | 3300005841 | Bacteria | 2564 |
| 194 | Ga0068863_100212996 | 3300005841 | Bacteria | 1860 |
| 195 | Ga0068863_100236061 | 3300005841 | Bacteria | 1765 |
| 196 | Ga0068863_100263291 | 3300005841 | Bacteria | 1667 |
| 197 | Ga0068863_100269813 | 3300005841 | Bacteria | 1647 |
| 198 | Ga0068863_100698719 | 3300005841 | Bacteria | 1008 |
| 199 | Ga0068858_100001818 | 3300005842 | Bacteria | 21717 |
| 200 | Ga0068858_100003428 | 3300005842 | Bacteria | 15754 |
| 201 | Ga0068858_100003838 | 3300005842 | Bacteria | 14861 |
| 202 | Ga0068858_100015579 | 3300005842 | Bacteria | 7151 |
| 203 | Ga0068860_100004794 | 3300005843 | Bacteria | 13777 |
| 204 | Ga0068860_100005517 | 3300005843 | Bacteria | 12805 |
| 205 | Ga0068860_100093086 | 3300005843 | Bacteria | 2872 |
| 206 | Ga0068862_100039223 | 3300005844 | Bacteria | 4021 |
| 207 | Ga0068862_100093115 | 3300005844 | Bacteria | 2628 |
| 208 | Ga0070717_10022058 | 3300006028 | Bacteria | 5027 |
| 209 | Ga0075365_10005225 | 3300006038 | Bacteria | 6983 |
| 210 | Ga0070715_10196619 | 3300006163 | Bacteria | 1022 |
| 211 | Ga0075367_10029910 | 3300006178 | Bacteria | 3119 |
| 212 | Ga0075366_10231906 | 3300006195 | Bacteria | 1125 |
| 213 | Ga0075366_10301165 | 3300006195 | Bacteria | 981 |
| 214 | Ga0097621_100016159 | 3300006237 | Bacteria | 5635 |
| 215 | Ga0097621_100045361 | 3300006237 | Bacteria | 3550 |
| 216 | Ga0097621_100364826 | 3300006237 | Bacteria | 1287 |
| 217 | Ga0097621_100405989 | 3300006237 | Bacteria | 1220 |
| 218 | Ga0097621_100739939 | 3300006237 | Bacteria | 908 |
| 219 | Ga0068871_100085125 | 3300006358 | Bacteria | 2624 |
| 220 | Ga0068871_100090430 | 3300006358 | Bacteria | 2549 |
| 221 | Ga0068871_100261185 | 3300006358 | Bacteria | 1510 |
| 222 | Ga0068871_100295490 | 3300006358 | Bacteria | 1420 |
| 223 | Ga0068871_100332340 | 3300006358 | Bacteria | 1340 |
| 224 | Ga0068865_100816976 | 3300006881 | Bacteria | 805 |
| 225 | Ga0097620_100039942 | 3300006931 | Bacteria | 4709 |
| 226 | Ga0097620_100136532 | 3300006931 | Bacteria | 2525 |
| 227 | Ga0097620_100156918 | 3300006931 | Bacteria | 2353 |
| 228 | Ga0097620_100753500 | 3300006931 | Bacteria | 1063 |
| 229 | Ga0105240_10002543 | 3300009093 | Bacteria | 29256 |
| 230 | Ga0105240_10160498 | 3300009093 | Bacteria | 2671 |
| 231 | Ga0111539_10557317 | 3300009094 | Bacteria | 1335 |
| 232 | Ga0111539_11910411 | 3300009094 | Bacteria | 688 |
| 233 | Ga0105245_10042059 | 3300009098 | Bacteria | 4076 |
| 234 | Ga0105245_10175268 | 3300009098 | Bacteria | 2045 |
| 235 | Ga0105247_10520875 | 3300009101 | Bacteria | 869 |
| 236 | Ga0105243_10003820 | 3300009148 | Bacteria | 12050 |
| 237 | Ga0105243_10004042 | 3300009148 | Bacteria | 11682 |
| 238 | Ga0105243_10916977 | 3300009148 | Bacteria | 873 |
| 239 | Ga0105241_10369203 | 3300009174 | Bacteria | 1251 |
| 240 | Ga0105241_10560425 | 3300009174 | Bacteria | 1027 |
| 241 | Ga0105242_10073735 | 3300009176 | Bacteria | 2839 |
| 242 | Ga0105242_10617790 | 3300009176 | Bacteria | 1049 |
| 243 | Ga0105248_10020415 | 3300009177 | Bacteria | 7339 |
| 244 | Ga0105248_10044593 | 3300009177 | Bacteria | 4973 |
| 245 | Ga0105248_10109194 | 3300009177 | Bacteria | 3119 |
| 246 | Ga0105248_10662727 | 3300009177 | Bacteria | 1177 |
| 247 | Ga0105248_10672461 | 3300009177 | Bacteria | 1168 |
| 248 | Ga0105248_11182908 | 3300009177 | Bacteria | 864 |
| 249 | Ga0105237_10000518 | 3300009545 | Bacteria | 54382 |
| 250 | Ga0105237_10221725 | 3300009545 | Bacteria | 1891 |
| 251 | Ga0105238_10043782 | 3300009551 | Bacteria | 4528 |
| 252 | Ga0105238_10175558 | 3300009551 | Bacteria | 2119 |
| 253 | Ga0105238_10396108 | 3300009551 | Bacteria | 1373 |
| 254 | Ga0105249_10005277 | 3300009553 | Bacteria | 11155 |
| 255 | Ga0105249_10016583 | 3300009553 | Bacteria | 6537 |
| 256 | Ga0105249_10213870 | 3300009553 | Bacteria | 1893 |
| 257 | Ga0105249_10381685 | 3300009553 | Bacteria | 1435 |
| 258 | Ga0105239_10000872 | 3300010375 | Bacteria | 42900 |
| 259 | Ga0105239_10819287 | 3300010375 | Bacteria | 1067 |
| 260 | Ga0105246_10717380 | 3300011119 | Bacteria | 878 |
| 261 | Ga0157373_10437504 | 3300013100 | Bacteria | 940 |
| 262 | Ga0157371_10057938 | 3300013102 | Bacteria | 2748 |
| 263 | Ga0157370_10270238 | 3300013104 | Bacteria | 1571 |
| 264 | Ga0157370_10707126 | 3300013104 | Bacteria | 920 |
| 265 | Ga0157369_10032613 | 3300013105 | Bacteria | 5727 |
| 266 | Ga0157374_10013203 | 3300013296 | Bacteria | 7205 |
| 267 | Ga0157374_10060546 | 3300013296 | Bacteria | 3543 |
| 268 | Ga0157374_10086510 | 3300013296 | Bacteria | 2982 |
| 269 | Ga0157374_11141907 | 3300013296 | Bacteria | 800 |
| 270 | Ga0157378_10185191 | 3300013297 | Bacteria | 1961 |
| 271 | Ga0157378_10295745 | 3300013297 | Bacteria | 1565 |
| 272 | Ga0163162_10020480 | 3300013306 | Bacteria | 6501 |
| 273 | Ga0163162_10087946 | 3300013306 | Bacteria | 3186 |
| 274 | Ga0163162_10322226 | 3300013306 | Bacteria | 1678 |
| 275 | Ga0163162_10475759 | 3300013306 | Bacteria | 1380 |
| 276 | Ga0163162_10677352 | 3300013306 | Bacteria | 1154 |
| 277 | Ga0163162_10912745 | 3300013306 | Bacteria | 991 |
| 278 | Ga0157372_10078073 | 3300013307 | Bacteria | 3741 |
| 279 | Ga0157372_10253491 | 3300013307 | Bacteria | 2043 |
| 280 | Ga0157372_10293460 | 3300013307 | Bacteria | 1891 |
| 281 | Ga0157375_10027374 | 3300013308 | Bacteria | 5329 |
| 282 | Ga0157375_10137302 | 3300013308 | Bacteria | 2570 |
| 283 | Ga0157375_10149452 | 3300013308 | Bacteria | 2470 |
| 284 | Ga0157375_10154362 | 3300013308 | Bacteria | 2434 |
| 285 | Ga0157375_11398527 | 3300013308 | Bacteria | 824 |
| 286 | Ga0163163_10007645 | 3300014325 | Bacteria | 9547 |
| 287 | Ga0163163_10170102 | 3300014325 | Bacteria | 2226 |
| 288 | Ga0157380_10015990 | 3300014326 | Bacteria | 5524 |
| 289 | Ga0157380_10023234 | 3300014326 | Bacteria | 4675 |
| 290 | Ga0157380_10030254 | 3300014326 | Bacteria | 4146 |
| 291 | Ga0157380_10371249 | 3300014326 | Bacteria | 1346 |
| 292 | Ga0157377_10000039 | 3300014745 | Bacteria | 112711 |
| 293 | Ga0157377_10113708 | 3300014745 | Bacteria | 1630 |
| 294 | Ga0157379_10047857 | 3300014968 | Bacteria | 3816 |
| 295 | Ga0157379_10092877 | 3300014968 | Bacteria | 2707 |
| 296 | Ga0157379_10154924 | 3300014968 | Bacteria | 2067 |
| 297 | Ga0157376_10008913 | 3300014969 | Bacteria | 7263 |
| 298 | Ga0157376_10009644 | 3300014969 | Bacteria | 7025 |
| 299 | Ga0157376_11573919 | 3300014969 | Bacteria | 691 |
| 300 | Ga0163161_10027098 | 3300017792 | Bacteria | 4064 |
| 301 | Ga0163161_10350265 | 3300017792 | Bacteria | 1174 |
| 302 | Ga0163161_10365361 | 3300017792 | Bacteria | 1150 |
| 303 | Ga0163161_10619960 | 3300017792 | Bacteria | 894 |
| 304 | Ga0207425_1000062 | 3300025245 | Bacteria | 136118 |
| 305 | Ga0209677_100960 | 3300025253 | Bacteria | 14017 |
| 306 | Ga0209565_1000622 | 3300025263 | Bacteria | 23367 |
| 307 | Ga0209565_1000784 | 3300025263 | Bacteria | 18444 |
| 308 | Ga0209565_1001080 | 3300025263 | Bacteria | 13621 |
| 309 | Ga0209565_1031342 | 3300025263 | Bacteria | 1033 |
| 310 | Ga0207666_1009379 | 3300025271 | Bacteria | 1322 |
| 311 | Ga0209130_1001152 | 3300025284 | Bacteria | 19177 |
| 312 | Ga0209130_1007249 | 3300025284 | Bacteria | 3455 |
| 313 | Ga0209130_1025357 | 3300025284 | Bacteria | 1285 |
| 314 | Ga0209675_1000280 | 3300025291 | Bacteria | 48644 |
| 315 | Ga0209564_1001080 | 3300025295 | Bacteria | 32728 |
| 316 | Ga0209050_1000064 | 3300025298 | Bacteria | 314803 |
| 317 | Ga0209050_1001144 | 3300025298 | Bacteria | 31864 |
| 318 | Ga0209256_1000507 | 3300025299 | Bacteria | 57359 |
| 319 | Ga0209256_1001972 | 3300025299 | Bacteria | 18495 |
| 320 | Ga0207426_1001027 | 3300025302 | Bacteria | 26714 |
| 321 | Ga0209051_1031078 | 3300025303 | Bacteria | 2060 |
| 322 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 323 | Ga0209257_1003990 | 3300025304 | Bacteria | 11915 |
| 324 | Ga0207697_10042417 | 3300025315 | Bacteria | 1869 |
| 325 | Ga0207656_10023503 | 3300025321 | Bacteria | 2483 |
| 326 | Ga0207656_10072122 | 3300025321 | Bacteria | 1537 |
| 327 | Ga0207656_10117927 | 3300025321 | Bacteria | 1233 |
| 328 | Ga0207656_10150588 | 3300025321 | Bacteria | 1101 |
| 329 | Ga0207656_10167946 | 3300025321 | Bacteria | 1047 |
| 330 | Ga0207656_10200423 | 3300025321 | Bacteria | 964 |
| 331 | Ga0207682_10007351 | 3300025893 | Bacteria | 4393 |
| 332 | Ga0207682_10053057 | 3300025893 | Bacteria | 1681 |
| 333 | Ga0207682_10053985 | 3300025893 | Bacteria | 1668 |
| 334 | Ga0207642_10014634 | 3300025899 | Bacteria | 2900 |
| 335 | Ga0207642_10130694 | 3300025899 | Bacteria | 1310 |
| 336 | Ga0207688_10172200 | 3300025901 | Bacteria | 1288 |
| 337 | Ga0207688_10319948 | 3300025901 | Bacteria | 952 |
| 338 | Ga0207688_10436710 | 3300025901 | Bacteria | 815 |
| 339 | Ga0207688_10480137 | 3300025901 | Bacteria | 777 |
| 340 | Ga0207680_10019580 | 3300025903 | Bacteria | 3622 |
| 341 | Ga0207680_10051951 | 3300025903 | Bacteria | 2453 |
| 342 | Ga0207680_10273463 | 3300025903 | Bacteria | 1172 |
| 343 | Ga0207685_10153763 | 3300025905 | Bacteria | 1044 |
| 344 | Ga0207645_10016617 | 3300025907 | Bacteria | 4868 |
| 345 | Ga0207645_10025026 | 3300025907 | Bacteria | 3865 |
| 346 | Ga0207645_10039259 | 3300025907 | Bacteria | 3034 |
| 347 | Ga0207645_10093958 | 3300025907 | Bacteria | 1930 |
| 348 | Ga0207645_10118016 | 3300025907 | Bacteria | 1721 |
| 349 | Ga0207643_10308284 | 3300025908 | Bacteria | 986 |
| 350 | Ga0207705_10333928 | 3300025909 | Bacteria | 1166 |
| 351 | Ga0207695_10006571 | 3300025913 | Bacteria | 15047 |
| 352 | Ga0207695_10142141 | 3300025913 | Bacteria | 2347 |
| 353 | Ga0207671_10003492 | 3300025914 | Bacteria | 15626 |
| 354 | Ga0207671_10291669 | 3300025914 | Bacteria | 1288 |
| 355 | Ga0207660_10185183 | 3300025917 | Bacteria | 1619 |
| 356 | Ga0207662_10186112 | 3300025918 | Bacteria | 1338 |
| 357 | Ga0207662_10267713 | 3300025918 | Bacteria | 1127 |
| 358 | Ga0207657_10227937 | 3300025919 | Bacteria | 1491 |
| 359 | Ga0207657_10333922 | 3300025919 | Bacteria | 1197 |
| 360 | Ga0207649_10138295 | 3300025920 | Bacteria | 1663 |
| 361 | Ga0207649_10216079 | 3300025920 | Bacteria | 1363 |
| 362 | Ga0207652_10295525 | 3300025921 | Bacteria | 1462 |
| 363 | Ga0207681_10032608 | 3300025923 | Bacteria | 3412 |
| 364 | Ga0207681_10071671 | 3300025923 | Bacteria | 2417 |
| 365 | Ga0207681_10445708 | 3300025923 | Bacteria | 1052 |
| 366 | Ga0207694_10019086 | 3300025924 | Bacteria | 5182 |
| 367 | Ga0207694_10278913 | 3300025924 | Bacteria | 1372 |
| 368 | Ga0207650_10027735 | 3300025925 | Bacteria | 4055 |
| 369 | Ga0207650_10035349 | 3300025925 | Bacteria | 3627 |
| 370 | Ga0207650_10133863 | 3300025925 | Bacteria | 1942 |
| 371 | Ga0207650_10153958 | 3300025925 | Bacteria | 1817 |
| 372 | Ga0207650_10187506 | 3300025925 | Bacteria | 1651 |
| 373 | Ga0207650_10384649 | 3300025925 | Bacteria | 1159 |
| 374 | Ga0207659_10003336 | 3300025926 | Bacteria | 9629 |
| 375 | Ga0207659_10010543 | 3300025926 | Bacteria | 5810 |
| 376 | Ga0207659_10015331 | 3300025926 | Bacteria | 4961 |
| 377 | Ga0207659_10036615 | 3300025926 | Bacteria | 3401 |
| 378 | Ga0207659_10162050 | 3300025926 | Bacteria | 1757 |
| 379 | Ga0207659_10310924 | 3300025926 | Bacteria | 1297 |
| 380 | Ga0207659_10462700 | 3300025926 | Bacteria | 1070 |
| 381 | Ga0207659_10580292 | 3300025926 | Bacteria | 955 |
| 382 | Ga0207687_10034140 | 3300025927 | Bacteria | 3453 |
| 383 | Ga0207687_10236079 | 3300025927 | Bacteria | 1447 |
| 384 | Ga0207644_10002949 | 3300025931 | Bacteria | 10959 |
| 385 | Ga0207644_10027031 | 3300025931 | Bacteria | 3961 |
| 386 | Ga0207644_10193967 | 3300025931 | Bacteria | 1598 |
| 387 | Ga0207644_10289150 | 3300025931 | Bacteria | 1318 |
| 388 | Ga0207644_10290172 | 3300025931 | Bacteria | 1315 |
| 389 | Ga0207644_10437444 | 3300025931 | Bacteria | 1073 |
| 390 | Ga0207690_10122483 | 3300025932 | Bacteria | 1891 |
| 391 | Ga0207706_10001684 | 3300025933 | Bacteria | 21807 |
| 392 | Ga0207706_10069224 | 3300025933 | Bacteria | 3104 |
| 393 | Ga0207706_10162222 | 3300025933 | Bacteria | 1965 |
| 394 | Ga0207706_10762093 | 3300025933 | Bacteria | 824 |
| 395 | Ga0207706_11098358 | 3300025933 | Bacteria | 665 |
| 396 | Ga0207686_10068989 | 3300025934 | Bacteria | 2267 |
| 397 | Ga0207686_10075378 | 3300025934 | Bacteria | 2184 |
| 398 | Ga0207686_10435447 | 3300025934 | Bacteria | 1006 |
| 399 | Ga0207709_10008906 | 3300025935 | Bacteria | 5541 |
| 400 | Ga0207709_10020258 | 3300025935 | Bacteria | 3750 |
| 401 | Ga0207709_10280442 | 3300025935 | Bacteria | 1230 |
| 402 | Ga0207669_10016052 | 3300025937 | Bacteria | 3794 |
| 403 | Ga0207669_10027359 | 3300025937 | Bacteria | 3120 |
| 404 | Ga0207669_10389288 | 3300025937 | Bacteria | 1088 |
| 405 | Ga0207704_10008539 | 3300025938 | Bacteria | 4905 |
| 406 | Ga0207665_10058372 | 3300025939 | Bacteria | 2609 |
| 407 | Ga0207691_10012960 | 3300025940 | Bacteria | 7984 |
| 408 | Ga0207691_10024676 | 3300025940 | Bacteria | 5654 |
| 409 | Ga0207691_10056925 | 3300025940 | Bacteria | 3560 |
| 410 | Ga0207691_10058182 | 3300025940 | Bacteria | 3516 |
| 411 | Ga0207691_10127924 | 3300025940 | Bacteria | 2246 |
| 412 | Ga0207691_10372729 | 3300025940 | Bacteria | 1219 |
| 413 | Ga0207691_10519804 | 3300025940 | Bacteria | 1010 |
| 414 | Ga0207711_10100667 | 3300025941 | Bacteria | 2556 |
| 415 | Ga0207711_10189956 | 3300025941 | Bacteria | 1871 |
| 416 | Ga0207711_10290181 | 3300025941 | Bacteria | 1508 |
| 417 | Ga0207711_10341131 | 3300025941 | Bacteria | 1387 |
| 418 | Ga0207711_10469663 | 3300025941 | Bacteria | 1172 |
| 419 | Ga0207711_11238177 | 3300025941 | Bacteria | 688 |
| 420 | Ga0207689_10000716 | 3300025942 | Bacteria | 31758 |
| 421 | Ga0207689_10002900 | 3300025942 | Bacteria | 15822 |
| 422 | Ga0207689_10069792 | 3300025942 | Bacteria | 2887 |
| 423 | Ga0207661_10026334 | 3300025944 | Bacteria | 4429 |
| 424 | Ga0207679_10200857 | 3300025945 | Bacteria | 1665 |
| 425 | Ga0207679_10369217 | 3300025945 | Bacteria | 1255 |
| 426 | Ga0207679_10488097 | 3300025945 | Bacteria | 1098 |
| 427 | Ga0207679_11275709 | 3300025945 | Bacteria | 674 |
| 428 | Ga0207667_10193259 | 3300025949 | Bacteria | 2088 |
| 429 | Ga0207667_10590591 | 3300025949 | Bacteria | 1120 |
| 430 | Ga0207651_10007527 | 3300025960 | Bacteria | 5807 |
| 431 | Ga0207651_10051280 | 3300025960 | Bacteria | 2806 |
| 432 | Ga0207651_10109031 | 3300025960 | Bacteria | 2073 |
| 433 | Ga0207651_10329320 | 3300025960 | Bacteria | 1279 |
| 434 | Ga0207651_10475087 | 3300025960 | Bacteria | 1076 |
| 435 | Ga0207712_10034313 | 3300025961 | Bacteria | 3438 |
| 436 | Ga0207668_10047946 | 3300025972 | Bacteria | 2928 |
| 437 | Ga0207668_10473502 | 3300025972 | Bacteria | 1073 |
| 438 | Ga0207668_10573537 | 3300025972 | Bacteria | 980 |
| 439 | Ga0207640_10090295 | 3300025981 | Bacteria | 2120 |
| 440 | Ga0207640_10148017 | 3300025981 | Bacteria | 1721 |
| 441 | Ga0207640_10328349 | 3300025981 | Bacteria | 1221 |
| 442 | Ga0207658_10002511 | 3300025986 | Bacteria | 13353 |
| 443 | Ga0207658_10023668 | 3300025986 | Bacteria | 4289 |
| 444 | Ga0207658_10247099 | 3300025986 | Bacteria | 1514 |
| 445 | Ga0207658_10435704 | 3300025986 | Bacteria | 1158 |
| 446 | Ga0207658_10736009 | 3300025986 | Bacteria | 892 |
| 447 | Ga0207677_10000452 | 3300026023 | Bacteria | 27626 |
| 448 | Ga0207677_10020176 | 3300026023 | Bacteria | 4042 |
| 449 | Ga0207677_10087762 | 3300026023 | Bacteria | 2253 |
| 450 | Ga0207677_10219806 | 3300026023 | Bacteria | 1523 |
| 451 | Ga0207677_10450333 | 3300026023 | Bacteria | 1103 |
| 452 | Ga0207677_10950080 | 3300026023 | Bacteria | 777 |
| 453 | Ga0207703_10003257 | 3300026035 | Bacteria | 13652 |
| 454 | Ga0207703_10003262 | 3300026035 | Bacteria | 13624 |
| 455 | Ga0207703_10089492 | 3300026035 | Bacteria | 2585 |
| 456 | Ga0207639_10103265 | 3300026041 | Bacteria | 2309 |
| 457 | Ga0207639_10370436 | 3300026041 | Bacteria | 1284 |
| 458 | Ga0207639_10560087 | 3300026041 | Bacteria | 1050 |
| 459 | Ga0207639_10623268 | 3300026041 | Bacteria | 996 |
| 460 | Ga0207639_10751365 | 3300026041 | Bacteria | 907 |
| 461 | Ga0207678_10008265 | 3300026067 | Bacteria | 9170 |
| 462 | Ga0207678_10042827 | 3300026067 | Bacteria | 3920 |
| 463 | Ga0207678_10437544 | 3300026067 | Bacteria | 1135 |
| 464 | Ga0207702_10017145 | 3300026078 | Bacteria | 5991 |
| 465 | Ga0207702_11202452 | 3300026078 | Bacteria | 752 |
| 466 | Ga0207641_10000923 | 3300026088 | Bacteria | 30321 |
| 467 | Ga0207641_10067624 | 3300026088 | Bacteria | 3061 |
| 468 | Ga0207641_10557982 | 3300026088 | Bacteria | 1117 |
| 469 | Ga0207641_10938236 | 3300026088 | Bacteria | 860 |
| 470 | Ga0207648_10000836 | 3300026089 | Bacteria | 34689 |
| 471 | Ga0207648_10063633 | 3300026089 | Bacteria | 3215 |
| 472 | Ga0207648_10124501 | 3300026089 | Bacteria | 2267 |
| 473 | Ga0207648_10278432 | 3300026089 | Bacteria | 1496 |
| 474 | Ga0207648_10402916 | 3300026089 | Bacteria | 1240 |
| 475 | Ga0207648_10928640 | 3300026089 | Bacteria | 814 |
| 476 | Ga0207676_10004605 | 3300026095 | Bacteria | 9766 |
| 477 | Ga0207676_10027490 | 3300026095 | Bacteria | 4237 |
| 478 | Ga0207676_10028475 | 3300026095 | Bacteria | 4173 |
| 479 | Ga0207676_10111006 | 3300026095 | Bacteria | 2294 |
| 480 | Ga0207676_10189822 | 3300026095 | Bacteria | 1807 |
| 481 | Ga0207676_10448793 | 3300026095 | Bacteria | 1215 |
| 482 | Ga0207676_10620848 | 3300026095 | Bacteria | 1040 |
| 483 | Ga0207674_10093330 | 3300026116 | Bacteria | 2998 |
| 484 | Ga0207675_100024123 | 3300026118 | Bacteria | 5655 |
| 485 | Ga0207675_100043887 | 3300026118 | Bacteria | 4176 |
| 486 | Ga0207675_100772423 | 3300026118 | Bacteria | 973 |
| 487 | Ga0207683_10001865 | 3300026121 | Bacteria | 18641 |
| 488 | Ga0207683_10024876 | 3300026121 | Bacteria | 5160 |
| 489 | Ga0207683_10028889 | 3300026121 | Bacteria | 4798 |
| 490 | Ga0207683_10052952 | 3300026121 | Bacteria | 3557 |
| 491 | Ga0207683_10157193 | 3300026121 | Bacteria | 2054 |
| 492 | Ga0207683_10230223 | 3300026121 | Bacteria | 1690 |
| 493 | Ga0207683_10238480 | 3300026121 | Bacteria | 1659 |
| 494 | Ga0207683_10355924 | 3300026121 | Bacteria | 1344 |
| 495 | Ga0207683_10398368 | 3300026121 | Bacteria | 1266 |
| 496 | Ga0207683_10651174 | 3300026121 | Bacteria | 976 |
| 497 | Ga0207683_10685541 | 3300026121 | Bacteria | 950 |
| 498 | Ga0207698_10017502 | 3300026142 | Bacteria | 4865 |
| 499 | Ga0207698_10047999 | 3300026142 | Bacteria | 3239 |
| 500 | Ga0207698_10048420 | 3300026142 | Bacteria | 3227 |
| 501 | Ga0207698_10059428 | 3300026142 | Bacteria | 2968 |
| 502 | Ga0207698_10078152 | 3300026142 | Bacteria | 2656 |
| 503 | Ga0207698_10152078 | 3300026142 | Bacteria | 2010 |
| 504 | Ga0207698_10278503 | 3300026142 | Bacteria | 1546 |
| 505 | Ga0207698_10680206 | 3300026142 | Bacteria | 1022 |
| 506 | Ga0207698_10976148 | 3300026142 | Bacteria | 857 |
| 507 | Ga0268266_10270974 | 3300028379 | Bacteria | 1576 |
| 508 | Ga0268265_10522666 | 3300028380 | Bacteria | 1122 |
| 509 | Ga0268264_10052499 | 3300028381 | Bacteria | 3399 |
| 510 | Ga0268264_10071675 | 3300028381 | Bacteria | 2936 |
| 511 | Ga0268264_10373113 | 3300028381 | Bacteria | 1364 |
| 512 | Ga0307515_10000030 | 3300028794 | Bacteria | 364482 |
| 513 | Ga0307515_10000221 | 3300028794 | Bacteria | 141099 |
| 514 | Ga0307515_10000777 | 3300028794 | Bacteria | 73454 |
| 515 | Ga0307515_10018037 | 3300028794 | Bacteria | 12810 |
| 516 | Ga0265324_10081879 | 3300029957 | Bacteria | 1098 |
| 517 | Ga0307512_10017030 | 3300030522 | Bacteria | 6686 |
| 518 | Ga0307513_10023763 | 3300031456 | Bacteria | 7152 |
| 519 | Ga0307408_100002803 | 3300031548 | Bacteria | 12100 |
| 520 | Ga0307408_100015501 | 3300031548 | Bacteria | 5075 |
| 521 | Ga0307408_100217674 | 3300031548 | Bacteria | 1556 |
| 522 | Ga0307408_100345150 | 3300031548 | Bacteria | 1261 |
| 523 | Ga0307408_100477666 | 3300031548 | Bacteria | 1087 |
| 524 | Ga0307508_10000141 | 3300031616 | Bacteria | 85739 |
| 525 | Ga0307514_10065597 | 3300031649 | Bacteria | 2749 |
| 526 | Ga0307516_10004531 | 3300031730 | Bacteria | 17090 |
| 527 | Ga0307405_10011385 | 3300031731 | Bacteria | 4659 |
| 528 | Ga0307405_10166719 | 3300031731 | Bacteria | 1566 |
| 529 | Ga0307410_10735064 | 3300031852 | Bacteria | 834 |
| 530 | Ga0307406_10022936 | 3300031901 | Bacteria | 3708 |
| 531 | Ga0307406_10836344 | 3300031901 | Bacteria | 779 |
| 532 | Ga0307407_10120706 | 3300031903 | Bacteria | 1661 |
| 533 | Ga0307412_10003513 | 3300031911 | Bacteria | 8711 |
| 534 | Ga0307412_10095690 | 3300031911 | Bacteria | 2088 |
| 535 | Ga0307409_100025456 | 3300031995 | Bacteria | 4151 |
| 536 | Ga0307409_100869257 | 3300031995 | Bacteria | 913 |
| 537 | Ga0307416_100000974 | 3300032002 | Bacteria | 15139 |
| 538 | Ga0307416_100234092 | 3300032002 | Bacteria | 1773 |
| 539 | Ga0307416_100309525 | 3300032002 | Bacteria | 1575 |
| 540 | Ga0307414_10364022 | 3300032004 | Bacteria | 1245 |
| 541 | Ga0307411_10094900 | 3300032005 | Bacteria | 2092 |
| 542 | Ga0307415_100001962 | 3300032126 | Bacteria | 10127 |
| 543 | Ga0307415_100551641 | 3300032126 | Bacteria | 1017 |
| 544 | Ga0307510_10448412 | 3300033180 | Bacteria | 731 |
| 545 | Ga0373938_0040326 | 3300034957 | Bacteria | 1035 |
| 546 | Ga0373949_0035444 | 3300035090 | Bacteria | 1207 |
| 547 | Ga0373936_0183358 | 3300035113 | Bacteria | 919 |
| 548 | Ga0373931_0003594 | 3300035691 | Bacteria | 6996 |
| 549 | Ga0373931_0262860 | 3300035691 | Bacteria | 1054 |
| 550 | Ga0373927_0123237 | 3300035695 | Bacteria | 1692 |
| 551 | Ga0373937_0037185 | 3300036401 | Bacteria | 4436 |
| 552 | Ga0373925_0170979 | 3300037068 | Bacteria | 1716 |
| 553 | Ga0373925_0253853 | 3300037068 | Bacteria | 1411 |
| 554 | Ga0373925_0672663 | 3300037068 | Bacteria | 853 |
| 555 | Ga0395900_0185157 | 3300037418 | Bacteria | 2114 |
| 556 | Ga0395900_0746435 | 3300037418 | Bacteria | 909 |
| 557 | Ga0395898_0020437 | 3300037466 | Bacteria | 6724 |
| 558 | Ga0395905_0370157 | 3300037471 | Bacteria | 1326 |
| 559 | Ga0395905_1185220 | 3300037471 | Bacteria | 667 |
| 560 | Ga0436364_0571710 | 3300037853 | Bacteria | 4996 |
| 561 | Ga0395901_0158225 | 3300038443 | Bacteria | 2379 |
| 562 | Ga0395901_0381368 | 3300038443 | Bacteria | 1451 |
| 563 | Ga0436365_0482375 | 3300039437 | Bacteria | 7514 |
| 564 | Ga0436363_0390454 | 3300039450 | Bacteria | 2045 |
| 565 | Ga0451793_1915431 | 3300041452 | Bacteria | 1668 |
| 566 | Ga0451797_0142736 | 3300041453 | Bacteria | 907 |
| 567 | Ga0451802_0933167 | 3300041460 | Bacteria | 995 |
| 568 | Ga0451835_0346031 | 3300041492 | Bacteria | 879 |
| 569 | Ga0451837_1554540 | 3300041494 | Bacteria | 953 |
| 570 | Ga0451839_0874313 | 3300041496 | Bacteria | 1455 |
| 571 | Ga0451841_0821959 | 3300041498 | Bacteria | 1130 |
| 572 | Ga0451843_0875436 | 3300041509 | Bacteria | 1223 |
| 573 | Ga0451853_0591653 | 3300041512 | Bacteria | 1143 |
| 574 | Ga0451853_2839646 | 3300041512 | Bacteria | 915 |
| 575 | Ga0439464_0006066 | 3300042439 | Bacteria | 3141 |
| 576 | Ga0451577_0609327 | 3300042876 | Bacteria | 991 |
| 577 | Ga0466972_0029464 | 3300044658 | Bacteria | 2702 |
| 578 | Ga0466965_0019972 | 3300044683 | Bacteria | 3217 |
| 579 | Ga0466961_0135700 | 3300044693 | Bacteria | 1542 |
| 580 | Ga0466963_0253382 | 3300044694 | Bacteria | 1235 |
| 581 | Ga0466964_0000831 | 3300044706 | Bacteria | 10096 |
| 582 | Ga0466964_0046940 | 3300044706 | Bacteria | 1761 |
| 583 | Ga0453684_0746774 | 3300044712 | Bacteria | 1059 |
| 584 | Ga0466968_0005379 | 3300044735 | Bacteria | 4791 |
| 585 | Ga0466970_0411913 | 3300044765 | Bacteria | 772 |
| 586 | Ga0466957_0119546 | 3300044842 | Bacteria | 1678 |
| 587 | Ga0466957_0246141 | 3300044842 | Bacteria | 1187 |
| 588 | Ga0466957_0463066 | 3300044842 | Unclassified | 875 |
| 589 | Ga0466960_0256749 | 3300044901 | Bacteria | 972 |
| 590 | Ga0451576_0553615 | 3300045051 | Bacteria | 1208 |
| 591 | Ga0451576_1410206 | 3300045051 | Bacteria | 725 |
| 592 | Ga0466958_0391881 | 3300045836 | Bacteria | 896 |
| 593 | Ga0466967_0011043 | 3300045976 | Bacteria | 6815 |
| 594 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 595 | Ga0495627_000176 | 3300046453 | Bacteria | 72651 |
| 596 | Ga0495627_005973 | 3300046453 | Bacteria | 4835 |
| 597 | Ga0495603_0235314 | 3300046455 | Bacteria | 1055 |
| 598 | Ga0495603_0426942 | 3300046455 | Bacteria | 759 |
| 599 | Ga0495590_0025210 | 3300046457 | Bacteria | 2091 |
| 600 | Ga0495591_061640 | 3300046458 | Bacteria | 995 |
| 601 | Ga0495629_0021875 | 3300046459 | Bacteria | 4563 |
| 602 | Ga0495629_0026938 | 3300046459 | Bacteria | 4083 |
| 603 | Ga0495629_0515712 | 3300046459 | Bacteria | 805 |
| 604 | Ga0495629_0548413 | 3300046459 | Bacteria | 776 |
| 605 | Ga0495638_0006104 | 3300046460 | Bacteria | 8820 |
| 606 | Ga0495638_0100621 | 3300046460 | Bacteria | 1729 |
| 607 | Ga0495638_0280710 | 3300046460 | Bacteria | 905 |
| 608 | Ga0495653_0099895 | 3300046463 | Bacteria | 2104 |
| 609 | Ga0495580_0479193 | 3300046472 | Bacteria | 832 |
| 610 | Ga0495582_0049455 | 3300046473 | Bacteria | 2315 |
| 611 | Ga0495582_0332348 | 3300046473 | Bacteria | 875 |
| 612 | Ga0495582_0346806 | 3300046473 | Bacteria | 855 |
| 613 | Ga0495605_0000081 | 3300046474 | Bacteria | 125302 |
| 614 | Ga0495605_0000087 | 3300046474 | Bacteria | 120256 |
| 615 | Ga0495605_0014951 | 3300046474 | Bacteria | 4232 |
| 616 | Ga0495605_0054408 | 3300046474 | Bacteria | 1938 |
| 617 | Ga0495605_0054970 | 3300046474 | Bacteria | 1925 |
| 618 | Ga0495605_0096507 | 3300046474 | Bacteria | 1363 |
| 619 | Ga0495639_0119233 | 3300046475 | Bacteria | 1258 |
| 620 | Ga0495664_0135482 | 3300046477 | Bacteria | 1492 |
| 621 | Ga0495664_0470154 | 3300046477 | Bacteria | 752 |
| 622 | Ga0495584_0003309 | 3300046491 | Bacteria | 8932 |
| 623 | Ga0495584_0006863 | 3300046491 | Bacteria | 5951 |
| 624 | Ga0495584_0011832 | 3300046491 | Bacteria | 4461 |
| 625 | Ga0495584_0029616 | 3300046491 | Bacteria | 2775 |
| 626 | Ga0495584_0136281 | 3300046491 | Bacteria | 1246 |
| 627 | Ga0495584_0310848 | 3300046491 | Bacteria | 800 |
| 628 | Ga0495585_0000863 | 3300046492 | Bacteria | 25902 |
| 629 | Ga0495585_0008523 | 3300046492 | Bacteria | 6211 |
| 630 | Ga0495585_0034137 | 3300046492 | Bacteria | 2876 |
| 631 | Ga0495585_0066082 | 3300046492 | Bacteria | 1980 |
| 632 | Ga0495585_0069942 | 3300046492 | Bacteria | 1915 |
| 633 | Ga0495594_0000705 | 3300046499 | Bacteria | 17186 |
| 634 | Ga0495594_0125810 | 3300046499 | Bacteria | 1450 |
| 635 | Ga0495594_0176021 | 3300046499 | Bacteria | 1217 |
| 636 | Ga0495594_0191108 | 3300046499 | Bacteria | 1166 |
| 637 | Ga0495596_0001008 | 3300046500 | Bacteria | 16758 |
| 638 | Ga0495596_0029285 | 3300046500 | Bacteria | 2208 |
| 639 | Ga0495596_0044436 | 3300046500 | Bacteria | 1748 |
| 640 | Ga0495596_0048861 | 3300046500 | Bacteria | 1659 |
| 641 | Ga0495596_0061065 | 3300046500 | Bacteria | 1468 |
| 642 | Ga0495596_0102603 | 3300046500 | Bacteria | 1111 |
| 643 | Ga0495607_0015258 | 3300046501 | Bacteria | 4981 |
| 644 | Ga0495607_0063518 | 3300046501 | Bacteria | 2088 |
| 645 | Ga0495583_0000193 | 3300046506 | Bacteria | 101909 |
| 646 | Ga0495583_0000430 | 3300046506 | Bacteria | 63194 |
| 647 | Ga0495583_0025803 | 3300046506 | Bacteria | 2929 |
| 648 | Ga0495583_0049210 | 3300046506 | Bacteria | 1931 |
| 649 | Ga0495583_0053809 | 3300046506 | Bacteria | 1825 |
| 650 | Ga0495583_0066555 | 3300046506 | Bacteria | 1593 |
| 651 | Ga0495583_0079437 | 3300046506 | Bacteria | 1427 |
| 652 | Ga0495583_0109368 | 3300046506 | Bacteria | 1172 |
| 653 | Ga0495583_0149583 | 3300046506 | Bacteria | 968 |
| 654 | Ga0495583_0209902 | 3300046506 | Bacteria | 789 |
| 655 | Ga0495606_0000007 | 3300046507 | Bacteria | 323713 |
| 656 | Ga0495606_0006338 | 3300046507 | Bacteria | 10944 |
| 657 | Ga0495606_0168583 | 3300046507 | Bacteria | 1272 |
| 658 | Ga0495610_0295824 | 3300046512 | Bacteria | 626 |
| 659 | Ga0495616_0003775 | 3300046513 | Bacteria | 9662 |
| 660 | Ga0495616_0006247 | 3300046513 | Bacteria | 7238 |
| 661 | Ga0495616_0011606 | 3300046513 | Bacteria | 5040 |
| 662 | Ga0495616_0026665 | 3300046513 | Bacteria | 3072 |
| 663 | Ga0495616_0057859 | 3300046513 | Bacteria | 1910 |
| 664 | Ga0495616_0078089 | 3300046513 | Bacteria | 1588 |
| 665 | Ga0495616_0146406 | 3300046513 | Bacteria | 1071 |
| 666 | Ga0495630_0408456 | 3300046517 | Bacteria | 1040 |
| 667 | Ga0495631_0001768 | 3300046518 | Bacteria | 12802 |
| 668 | Ga0495631_0047270 | 3300046518 | Bacteria | 1890 |
| 669 | Ga0495631_0058851 | 3300046518 | Bacteria | 1670 |
| 670 | Ga0495631_0078768 | 3300046518 | Bacteria | 1422 |
| 671 | Ga0495631_0080287 | 3300046518 | Bacteria | 1407 |
| 672 | Ga0495631_0091013 | 3300046518 | Bacteria | 1313 |
| 673 | Ga0495631_0233025 | 3300046518 | Bacteria | 785 |
| 674 | Ga0495632_0000114 | 3300046519 | Bacteria | 82098 |
| 675 | Ga0495643_0026010 | 3300046522 | Bacteria | 3307 |
| 676 | Ga0495643_0122658 | 3300046522 | Bacteria | 1311 |
| 677 | Ga0495643_0162344 | 3300046522 | Bacteria | 1098 |
| 678 | Ga0495644_0024432 | 3300046523 | Bacteria | 2298 |
| 679 | Ga0495644_0174579 | 3300046523 | Bacteria | 825 |
| 680 | Ga0495644_0199043 | 3300046523 | Bacteria | 772 |
| 681 | Ga0495648_0003099 | 3300046524 | Bacteria | 14837 |
| 682 | Ga0495648_0018117 | 3300046524 | Bacteria | 5005 |
| 683 | Ga0495648_0104611 | 3300046524 | Bacteria | 1554 |
| 684 | Ga0495663_0017699 | 3300046525 | Bacteria | 2025 |
| 685 | Ga0495663_0026350 | 3300046525 | Bacteria | 1701 |
| 686 | Ga0495666_0024048 | 3300046526 | Bacteria | 3012 |
| 687 | Ga0495666_0051039 | 3300046526 | Bacteria | 1987 |
| 688 | Ga0495666_0104105 | 3300046526 | Bacteria | 1336 |
| 689 | Ga0495666_0216858 | 3300046526 | Bacteria | 877 |
| 690 | Ga0495642_0000813 | 3300046528 | Bacteria | 15134 |
| 691 | Ga0495642_0002336 | 3300046528 | Bacteria | 7736 |
| 692 | Ga0495642_0063087 | 3300046528 | Bacteria | 1539 |
| 693 | Ga0495642_0086695 | 3300046528 | Bacteria | 1322 |
| 694 | Ga0495642_0092047 | 3300046528 | Bacteria | 1284 |
| 695 | Ga0495642_0117604 | 3300046528 | Bacteria | 1139 |
| 696 | Ga0495642_0119825 | 3300046528 | Bacteria | 1129 |
| 697 | Ga0495642_0142181 | 3300046528 | Bacteria | 1036 |
| 698 | Ga0495642_0146022 | 3300046528 | Bacteria | 1022 |
| 699 | Ga0495642_0243901 | 3300046528 | Bacteria | 785 |
| 700 | Ga0495654_0009914 | 3300046530 | Bacteria | 5207 |
| 701 | Ga0495654_0027808 | 3300046530 | Bacteria | 2894 |
| 702 | Ga0495654_0065381 | 3300046530 | Bacteria | 1736 |
| 703 | Ga0495665_0024195 | 3300046531 | Bacteria | 3262 |
| 704 | Ga0495665_0025475 | 3300046531 | Bacteria | 3177 |
| 705 | Ga0495586_0130831 | 3300046535 | Bacteria | 1405 |
| 706 | Ga0495587_0024560 | 3300046536 | Bacteria | 3691 |
| 707 | Ga0495587_0092009 | 3300046536 | Bacteria | 1751 |
| 708 | Ga0495609_0000096 | 3300046538 | Bacteria | 104135 |
| 709 | Ga0495609_0005065 | 3300046538 | Bacteria | 7029 |
| 710 | Ga0495609_0012026 | 3300046538 | Bacteria | 4108 |
| 711 | Ga0495609_0063112 | 3300046538 | Bacteria | 1635 |
| 712 | Ga0495609_0065576 | 3300046538 | Bacteria | 1600 |
| 713 | Ga0495609_0074786 | 3300046538 | Bacteria | 1485 |
| 714 | Ga0495609_0108656 | 3300046538 | Bacteria | 1198 |
| 715 | Ga0495621_0186868 | 3300046539 | Bacteria | 829 |
| 716 | Ga0495597_0000587 | 3300046542 | Bacteria | 30136 |
| 717 | Ga0495597_0001219 | 3300046542 | Bacteria | 19132 |
| 718 | Ga0495597_0002540 | 3300046542 | Bacteria | 11448 |
| 719 | Ga0495597_0004426 | 3300046542 | Bacteria | 7720 |
| 720 | Ga0495597_0039253 | 3300046542 | Bacteria | 2120 |
| 721 | Ga0495597_0089115 | 3300046542 | Bacteria | 1311 |
| 722 | Ga0495597_0090044 | 3300046542 | Bacteria | 1303 |
| 723 | Ga0495645_0047563 | 3300046543 | Bacteria | 3125 |
| 724 | Ga0495622_0005476 | 3300046557 | Bacteria | 5888 |
| 725 | Ga0495622_0051667 | 3300046557 | Bacteria | 1906 |
| 726 | Ga0495622_0108102 | 3300046557 | Bacteria | 1274 |
| 727 | Ga0495622_0111001 | 3300046557 | Bacteria | 1255 |
| 728 | Ga0495622_0229086 | 3300046557 | Bacteria | 821 |
| 729 | Ga0495633_0062569 | 3300046558 | Bacteria | 1742 |
| 730 | Ga0495633_0070876 | 3300046558 | Bacteria | 1626 |
| 731 | Ga0495633_0123615 | 3300046558 | Bacteria | 1198 |
| 732 | Ga0495633_0180395 | 3300046558 | Bacteria | 972 |
| 733 | Ga0495633_0213343 | 3300046558 | Bacteria | 884 |
| 734 | Ga0495667_0034780 | 3300046559 | Bacteria | 3369 |
| 735 | Ga0495667_0314618 | 3300046559 | Bacteria | 991 |
| 736 | Ga0495656_0064993 | 3300046615 | Bacteria | 1603 |
| 737 | Ga0495656_0070245 | 3300046615 | Bacteria | 1553 |
| 738 | Ga0495656_0107791 | 3300046615 | Bacteria | 1298 |
| 739 | Ga0495656_0144600 | 3300046615 | Bacteria | 1143 |
| 740 | Ga0495656_0493761 | 3300046615 | Bacteria | 649 |
| 741 | Ga0495668_0002567 | 3300046616 | Bacteria | 14753 |
| 742 | Ga0495668_0011047 | 3300046616 | Bacteria | 5429 |
| 743 | Ga0495668_0013816 | 3300046616 | Bacteria | 4749 |
| 744 | Ga0495668_0065700 | 3300046616 | Bacteria | 1996 |
| 745 | Ga0495668_0126435 | 3300046616 | Bacteria | 1399 |
| 746 | Ga0495668_0321688 | 3300046616 | Bacteria | 848 |
| 747 | Ga0495634_0029421 | 3300046642 | Bacteria | 3803 |
| 748 | Ga0495634_0228698 | 3300046642 | Bacteria | 1145 |
| 749 | Ga0495611_0080114 | 3300046648 | Bacteria | 1500 |
| 750 | Ga0495625_0002044 | 3300046660 | Bacteria | 22688 |
| 751 | Ga0495625_0004537 | 3300046660 | Bacteria | 13086 |
| 752 | Ga0495625_0032111 | 3300046660 | Bacteria | 3898 |
| 753 | Ga0495625_0050417 | 3300046660 | Bacteria | 2987 |
| 754 | Ga0495625_0053275 | 3300046660 | Bacteria | 2895 |
| 755 | Ga0495625_0140040 | 3300046660 | Bacteria | 1632 |
| 756 | Ga0495625_0189381 | 3300046660 | Bacteria | 1364 |
| 757 | Ga0495625_0251042 | 3300046660 | Bacteria | 1148 |
| 758 | Ga0495625_0254657 | 3300046660 | Bacteria | 1138 |
| 759 | Ga0495661_0000164 | 3300046665 | Bacteria | 78742 |
| 760 | Ga0495661_0014211 | 3300046665 | Bacteria | 5334 |
| 761 | Ga0495661_0073293 | 3300046665 | Bacteria | 1995 |
| 762 | Ga0495661_0104944 | 3300046665 | Bacteria | 1583 |
| 763 | Ga0495661_0115739 | 3300046665 | Bacteria | 1488 |
| 764 | Ga0495661_0184710 | 3300046665 | Bacteria | 1102 |
| 765 | Ga0495661_0209534 | 3300046665 | Bacteria | 1015 |
| 766 | Ga0495588_0083822 | 3300046674 | Bacteria | 1665 |
| 767 | Ga0495588_0097659 | 3300046674 | Bacteria | 1541 |
| 768 | Ga0495588_0129583 | 3300046674 | Bacteria | 1330 |
| 769 | Ga0495588_0238769 | 3300046674 | Bacteria | 958 |
| 770 | Ga0495588_0240112 | 3300046674 | Bacteria | 956 |
| 771 | Ga0495588_0271647 | 3300046674 | Bacteria | 893 |
| 772 | Ga0495588_0333912 | 3300046674 | Bacteria | 797 |
| 773 | Ga0495623_0016009 | 3300046679 | Bacteria | 4846 |
| 774 | Ga0495623_0142294 | 3300046679 | Bacteria | 1425 |
| 775 | Ga0495623_0152455 | 3300046679 | Bacteria | 1365 |
| 776 | Ga0495647_0016669 | 3300046681 | Bacteria | 2590 |
| 777 | Ga0495647_0196924 | 3300046681 | Bacteria | 882 |
| 778 | Ga0495647_0341001 | 3300046681 | Bacteria | 681 |
| 779 | Ga0495658_0062960 | 3300046683 | Bacteria | 2133 |
| 780 | Ga0495658_0274740 | 3300046683 | Bacteria | 1062 |
| 781 | Ga0495669_0087744 | 3300046684 | Bacteria | 1434 |
| 782 | Ga0495669_0375936 | 3300046684 | Bacteria | 687 |
| 783 | Ga0495613_0138776 | 3300046689 | Bacteria | 1738 |
| 784 | Ga0495613_0199300 | 3300046689 | Bacteria | 1412 |
| 785 | Ga0495613_0516790 | 3300046689 | Bacteria | 802 |
| 786 | Ga0495624_0045126 | 3300046690 | Bacteria | 2807 |
| 787 | Ga0495670_0000604 | 3300046691 | Bacteria | 17142 |
| 788 | Ga0495670_0048641 | 3300046691 | Bacteria | 2121 |
| 789 | Ga0495670_0053624 | 3300046691 | Bacteria | 2019 |
| 790 | Ga0495670_0182906 | 3300046691 | Bacteria | 1107 |
| 791 | Ga0495670_0191468 | 3300046691 | Bacteria | 1081 |
| 792 | Ga0495670_0268326 | 3300046691 | Bacteria | 911 |
| 793 | Ga0495671_0000132 | 3300046692 | Bacteria | 67269 |
| 794 | Ga0495671_0060264 | 3300046692 | Bacteria | 1874 |
| 795 | Ga0495671_0064536 | 3300046692 | Bacteria | 1802 |
| 796 | Ga0495671_0069041 | 3300046692 | Bacteria | 1737 |
| 797 | Ga0495671_0079020 | 3300046692 | Bacteria | 1612 |
| 798 | Ga0495671_0206591 | 3300046692 | Bacteria | 952 |
| 799 | Ga0495649_0073170 | 3300046694 | Bacteria | 1836 |
| 800 | Ga0495649_0098126 | 3300046694 | Bacteria | 1558 |
| 801 | Ga0495649_0172010 | 3300046694 | Bacteria | 1133 |
| 802 | Ga0495589_0000036 | 3300046794 | Bacteria | 153299 |
| 803 | Ga0495589_0000092 | 3300046794 | Bacteria | 85372 |
| 804 | Ga0495589_0001941 | 3300046794 | Bacteria | 11711 |
| 805 | Ga0495589_0047793 | 3300046794 | Bacteria | 2119 |
| 806 | Ga0495589_0083531 | 3300046794 | Bacteria | 1552 |
| 807 | Ga0495600_0026732 | 3300046809 | Bacteria | 3726 |
| 808 | Ga0495600_0550314 | 3300046809 | Bacteria | 705 |
| 809 | Ga0495660_0000117 | 3300046810 | Bacteria | 85237 |
| 810 | Ga0495660_0017138 | 3300046810 | Bacteria | 4172 |
| 811 | Ga0495660_0020826 | 3300046810 | Bacteria | 3759 |
| 812 | Ga0495660_0045575 | 3300046810 | Bacteria | 2406 |
| 813 | Ga0495660_0079012 | 3300046810 | Bacteria | 1728 |
| 814 | Ga0495660_0098586 | 3300046810 | Bacteria | 1507 |
| 815 | Ga0495581_0024612 | 3300047315 | Bacteria | 3489 |
| 816 | Ga0495581_0572309 | 3300047315 | Bacteria | 655 |
| 817 | Ga0495604_0045073 | 3300047317 | Bacteria | 3442 |
| 818 | Ga0495636_0015815 | 3300047318 | Bacteria | 3008 |
| 819 | Ga0495674_0003022 | 3300047319 | Bacteria | 16376 |
| 820 | Ga0495674_0585921 | 3300047319 | Bacteria | 885 |
| 821 | Ga0495672_0000014 | 3300047320 | Bacteria | 505636 |
| 822 | Ga0495672_0002183 | 3300047320 | Bacteria | 18230 |
| 823 | Ga0495672_0003253 | 3300047320 | Bacteria | 14086 |
| 824 | Ga0495676_0007223 | 3300047321 | Bacteria | 10188 |
| 825 | Ga0495676_0009421 | 3300047321 | Bacteria | 8894 |
| 826 | Ga0495676_0070247 | 3300047321 | Bacteria | 2698 |
| 827 | Ga0495676_0242968 | 3300047321 | Bacteria | 1232 |
| 828 | Ga0495683_0000576 | 3300047323 | Bacteria | 27760 |
| 829 | Ga0495683_0007830 | 3300047323 | Bacteria | 5732 |
| 830 | Ga0495683_0019300 | 3300047323 | Bacteria | 3519 |
| 831 | Ga0495683_0058853 | 3300047323 | Bacteria | 1907 |
| 832 | Ga0495687_000074 | 3300047443 | Bacteria | 153464 |
| 833 | Ga0495687_000154 | 3300047443 | Bacteria | 104740 |
| 834 | Ga0495687_002852 | 3300047443 | Bacteria | 13266 |
| 835 | Ga0495687_003354 | 3300047443 | Bacteria | 11695 |
| 836 | Ga0495687_167915 | 3300047443 | Bacteria | 730 |
| 837 | Ga0495675_0065424 | 3300047444 | Bacteria | 2299 |
| 838 | Ga0495675_0133443 | 3300047444 | Bacteria | 1542 |
| 839 | Ga0495677_0000037 | 3300047445 | Bacteria | 78595 |
| 840 | Ga0495677_0033630 | 3300047445 | Bacteria | 1868 |
| 841 | Ga0495677_0105433 | 3300047445 | Bacteria | 1069 |
| 842 | Ga0495679_038807 | 3300047446 | Bacteria | 1489 |
| 843 | Ga0495685_016157 | 3300047447 | Bacteria | 2549 |
| 844 | Ga0495685_039220 | 3300047447 | Bacteria | 1621 |
| 845 | Ga0495681_0006668 | 3300047470 | Bacteria | 7539 |
| 846 | Ga0495681_0017803 | 3300047470 | Bacteria | 3933 |
| 847 | Ga0495681_0061861 | 3300047470 | Bacteria | 1723 |
| 848 | Ga0495686_0001832 | 3300047472 | Bacteria | 21386 |
| 849 | Ga0495686_0002933 | 3300047472 | Bacteria | 15278 |
| 850 | Ga0495686_0050546 | 3300047472 | Bacteria | 2612 |
| 851 | Ga0495686_0109922 | 3300047472 | Bacteria | 1654 |
| 852 | Ga0495686_0178256 | 3300047472 | Bacteria | 1232 |
| 853 | Ga0495593_0056294 | 3300047673 | Bacteria | 2067 |
| 854 | Ga0495602_0033019 | 3300048088 | Bacteria | 4863 |
| 855 | Ga0495602_0170594 | 3300048088 | Bacteria | 1689 |
| 856 | Ga0495615_0027467 | 3300048090 | Bacteria | 1336 |
| 857 | Ga0495626_0000006 | 3300048091 | Bacteria | 284977 |
| 858 | Ga0495626_0004153 | 3300048091 | Bacteria | 8994 |
| 859 | Ga0495626_0044821 | 3300048091 | Bacteria | 2067 |
| 860 | Ga0495626_0069047 | 3300048091 | Bacteria | 1592 |
| 861 | Ga0495626_0147140 | 3300048091 | Bacteria | 995 |
| 862 | Ga0496100_0032816 | 3300048903 | Bacteria | 3242 |
| 863 | Ga0496100_0074915 | 3300048903 | Bacteria | 2268 |
| 864 | Ga0496102_0021103 | 3300048905 | Bacteria | 5760 |
| 865 | Ga0496102_0068969 | 3300048905 | Bacteria | 3245 |
| 866 | Ga0496102_0416302 | 3300048905 | Bacteria | 1262 |
| 867 | Ga0496103_0004341 | 3300048906 | Bacteria | 8609 |
| 868 | Ga0496104_0296569 | 3300048907 | Bacteria | 1529 |
| 869 | Ga0496104_1013963 | 3300048907 | Bacteria | 734 |
| 870 | Ga0496105_0182079 | 3300048908 | Bacteria | 1720 |
| 871 | Ga0496105_0555668 | 3300048908 | Bacteria | 895 |
| 872 | Ga0496106_0004593 | 3300048909 | Bacteria | 10241 |
| 873 | Ga0496107_0608226 | 3300048910 | Bacteria | 807 |
| 874 | Ga0496108_0018843 | 3300048911 | Bacteria | 5659 |
| 875 | Ga0496108_0070054 | 3300048911 | Bacteria | 2959 |
| 876 | Ga0496108_0275744 | 3300048911 | Bacteria | 1464 |
| 877 | Ga0496108_0675345 | 3300048911 | Bacteria | 897 |
| 878 | Ga0496108_0800146 | 3300048911 | Bacteria | 813 |
| 879 | Ga0496108_0858628 | 3300048911 | Bacteria | 781 |
| 880 | Ga0496109_0008838 | 3300048912 | Bacteria | 8578 |
| 881 | Ga0496109_0220311 | 3300048912 | Bacteria | 1784 |
| 882 | Ga0496109_0255942 | 3300048912 | Bacteria | 1649 |
| 883 | Ga0496109_0320416 | 3300048912 | Bacteria | 1463 |
| 884 | Ga0496109_0787890 | 3300048912 | Bacteria | 889 |
| 885 | Ga0496110_0004486 | 3300048913 | Bacteria | 10825 |
| 886 | Ga0496110_0181810 | 3300048913 | Bacteria | 1909 |
| 887 | Ga0496110_0194522 | 3300048913 | Bacteria | 1841 |
| 888 | Ga0496110_0570245 | 3300048913 | Bacteria | 1028 |
| 889 | Ga0496110_0673692 | 3300048913 | Bacteria | 935 |
| 890 | Ga0496111_0130263 | 3300048914 | Bacteria | 1861 |
| 891 | Ga0496111_0212296 | 3300048914 | Bacteria | 1438 |
| 892 | Ga0496111_0273343 | 3300048914 | Bacteria | 1253 |
| 893 | Ga0496112_0191825 | 3300048915 | Bacteria | 2005 |
| 894 | Ga0496112_0268957 | 3300048915 | Bacteria | 1653 |
| 895 | Ga0496113_0087315 | 3300048916 | Bacteria | 2398 |
| 896 | Ga0496113_0158354 | 3300048916 | Bacteria | 1789 |
| 897 | Ga0496113_0478026 | 3300048916 | Bacteria | 1001 |
| 898 | Ga0496114_0669293 | 3300048917 | Bacteria | 912 |
| 899 | Ga0496115_0107553 | 3300048918 | Bacteria | 2290 |
| 900 | Ga0496115_0166792 | 3300048918 | Bacteria | 1821 |
| 901 | Ga0496115_0246375 | 3300048918 | Bacteria | 1472 |
| 902 | Ga0496122_0001315 | 3300048925 | Bacteria | 40732 |
| 903 | Ga0496123_0000851 | 3300048926 | Bacteria | 48703 |
| 904 | Ga0496124_0183530 | 3300048927 | Bacteria | 1608 |
| 905 | Ga0496125_0002377 | 3300048928 | Bacteria | 24572 |
| 906 | Ga0501304_008260 | 3300049160 | Bacteria | 874 |
| 907 | Ga0495678_002660 | 3300049459 | Bacteria | 11833 |
| 908 | Ga0495678_003327 | 3300049459 | Bacteria | 10017 |
| 909 | Ga0495678_003585 | 3300049459 | Bacteria | 9486 |
| 910 | Ga0495682_0000726 | 3300049460 | Bacteria | 21381 |
| 911 | Ga0501198_000038 | 3300049649 | Bacteria | 51689 |
| 912 | Ga0501222_000037 | 3300049662 | Bacteria | 51656 |
| 913 | Ga0501035_0512448 | 3300049822 | Bacteria | 986 |
| 914 | nmdc:mga03683_49370_c1 | 3300050489 | Bacteria | 1751 |
| 915 | nmdc:mga0yw44_380671_c1 | 3300050492 | Bacteria | 953 |
| 916 | nmdc:mga0yw44_399878_c1 | 3300050492 | Bacteria | 929 |
| 917 | nmdc:mga0k408_97396_c1 | 3300050493 | Bacteria | 1732 |
| 918 | nmdc:mga07m45_115522_c1 | 3300050496 | Bacteria | 1548 |
| 919 | nmdc:mga08y16_1054124_c1 | 3300050511 | Bacteria | 790 |
| 920 | nmdc:mga08x19_167622_c1 | 3300050514 | Bacteria | 1494 |
| 921 | Ga0495619_0062013 | 3300053085 | Bacteria | 2489 |
| 922 | Ga0495619_0281616 | 3300053085 | Bacteria | 1152 |
| 923 | Ga0500559_0033920 | 3300053136 | Bacteria | 2199 |
| 924 | Ga0500564_120160 | 3300053138 | Bacteria | 1146 |
| 925 | 2587754357 | 2585428062 | Bacteria | 6842168 |
| 926 | 2643788735 | 2643221554 | Bacteria | 6603920 |
| 927 | 2643797735 | 2643221556 | Bacteria | 7251154 |
| 928 | 2644213242 | 2643221638 | Bacteria | 6579467 |
| 929 | 2644470483 | 2643221684 | Bacteria | 7145183 |
| 930 | 2842711994 | 2842711865 | Bacteria | 7155354 |
| 931 | Ga0070666_10228142 | |||
| 932 | JGI25158J39367_1020747 | |||
| 933 | JGI25159J45721_1001812 | |||
| 934 | JGI25159J45721_1010629 | |||
| 935 | rootL2_10015574 | |||
| 936 | JGI25160J50197_1008378 | |||
| 937 | JGI25161J50226_1003119 | |||
| 938 | JGI25161J50226_1007562 | |||
| 939 | Ga0055526_1002157 | |||
| 940 | Ga0055537_1002292 | |||
| 941 | Ga0055537_1018071 | |||
| 942 | Ga0055524_1001269 | |||
| 943 | Ga0055534_1002606 | |||
| 944 | Ga0055530_10015821 | |||
| 945 | Ga0055530_10016700 | |||
| 946 | Ga0055531_10025864 | |||
| 947 | Ga0055543_1001061 | |||
| 948 | Ga0065165_1003149 | |||
| 949 | Ga0070658_10167090 | |||
| 950 | Ga0070658_10536862 | |||
| 951 | Ga0070676_10006179 | |||
| 952 | Ga0070676_10402641 | |||
| 953 | Ga0070683_100098838 | |||
| 954 | Ga0070683_100333818 | |||
| 955 | Ga0070683_100568363 | |||
| 956 | Ga0070690_100009995 | |||
| 957 | Ga0070670_100040437 | |||
| 958 | Ga0070670_100041228 | |||
| 959 | Ga0070670_100041810 | |||
| 960 | Ga0070670_100070545 | |||
| 961 | Ga0070670_100250988 | |||
| 962 | Ga0070670_100289814 | |||
| 963 | Ga0070670_100525976 | |||
| 964 | Ga0070677_10057022 | |||
| 965 | Ga0070677_10067798 | |||
| 966 | Ga0070677_10244336 | |||
| 967 | Ga0070677_10300367 | |||
| 968 | Ga0068869_100023042 | |||
| 969 | Ga0070666_10006509 | |||
| 970 | Ga0070666_10206569 | |||
| 971 | Ga0070666_10240260 | |||
| 972 | Ga0070680_100023635 | |||
| 973 | Ga0070682_100543651 | |||
| 974 | Ga0068868_100139572 | |||
| 975 | Ga0068868_100225914 | |||
| 976 | Ga0068868_100672776 | |||
| 977 | Ga0068868_100797915 | |||
| 978 | Ga0070660_100342381 | |||
| 979 | Ga0070689_100036157 | |||
| 980 | Ga0070687_100049285 | |||
| 981 | Ga0070687_100301400 | |||
| 982 | Ga0070661_100036668 | |||
| 983 | Ga0070661_100125964 | |||
| 984 | Ga0070661_100134924 | |||
| 985 | Ga0070661_100271965 | |||
| 986 | Ga0070661_100899479 | |||
| 987 | Ga0070668_100091715 | |||
| 988 | Ga0070668_100259897 | |||
| 989 | Ga0070668_100319559 | |||
| 990 | Ga0070668_100769150 | |||
| 991 | Ga0070669_100001130 | |||
| 992 | Ga0070669_100116846 | |||
| 993 | Ga0070669_100256692 | |||
| 994 | Ga0070669_100343750 | |||
| 995 | Ga0070675_100003213 | |||
| 996 | Ga0070675_100008487 | |||
| 997 | Ga0070675_100009897 | |||
| 998 | Ga0070675_100156052 | |||
| 999 | Ga0070675_100219464 | |||
| 1000 | Ga0070675_100220814 | |||
| 1001 | Ga0070675_100359002 | |||
| 1002 | Ga0070671_100011925 | |||
| 1003 | Ga0070671_100118865 | |||
| 1004 | Ga0070671_100124449 | |||
| 1005 | Ga0070671_100189646 | |||
| 1006 | Ga0070671_100233666 | |||
| 1007 | Ga0070671_100268030 | |||
| 1008 | Ga0070671_100313838 | |||
| 1009 | Ga0070671_100756143 | |||
| 1010 | Ga0070674_100019990 | |||
| 1011 | Ga0070674_100036075 | |||
| 1012 | Ga0070674_100054491 | |||
| 1013 | Ga0070674_100061868 | |||
| 1014 | Ga0070674_100136079 | |||
| 1015 | Ga0070673_100012933 | |||
| 1016 | Ga0070673_100014182 | |||
| 1017 | Ga0070673_100049904 | |||
| 1018 | Ga0070673_100068785 | |||
| 1019 | Ga0070673_100106844 | |||
| 1020 | Ga0070673_100107138 | |||
| 1021 | Ga0070673_100466491 | |||
| 1022 | Ga0070688_100156585 | |||
| 1023 | Ga0070659_100039683 | |||
| 1024 | Ga0070659_100170292 | |||
| 1025 | Ga0070667_100005407 | |||
| 1026 | Ga0070667_100017232 | |||
| 1027 | Ga0070667_100075666 | |||
| 1028 | Ga0070667_100138856 | |||
| 1029 | Ga0070667_100227038 | |||
| 1030 | Ga0070667_100299990 | |||
| 1031 | Ga0070700_100605743 | |||
| 1032 | Ga0070663_100096753 | |||
| 1033 | Ga0070663_100141142 | |||
| 1034 | Ga0070678_100000202 | |||
| 1035 | Ga0070678_100026125 | |||
| 1036 | Ga0070678_100144714 | |||
| 1037 | Ga0070678_100183127 | |||
| 1038 | Ga0070678_100212455 | |||
| 1039 | Ga0070678_100223703 | |||
| 1040 | Ga0070678_100229254 | |||
| 1041 | Ga0070678_100234822 | |||
| 1042 | Ga0070678_100259165 | |||
| 1043 | Ga0070678_100301155 | |||
| 1044 | Ga0070678_100334342 | |||
| 1045 | Ga0070662_100001238 | |||
| 1046 | Ga0070662_100045173 | |||
| 1047 | Ga0070662_100096187 | |||
| 1048 | Ga0070662_100157745 | |||
| 1049 | Ga0070662_100795813 | |||
| 1050 | Ga0070681_10017210 | |||
| 1051 | Ga0068867_100000173 | |||
| 1052 | Ga0068867_100048156 | |||
| 1053 | Ga0068867_100280827 | |||
| 1054 | Ga0068867_100324007 | |||
| 1055 | Ga0068867_100491221 | |||
| 1056 | Ga0068867_100929104 | |||
| 1057 | Ga0070679_100002880 | |||
| 1058 | Ga0070684_100225458 | |||
| 1059 | Ga0070684_100303343 | |||
| 1060 | Ga0070684_100448397 | |||
| 1061 | Ga0068853_100097511 | |||
| 1062 | Ga0068853_100183825 | |||
| 1063 | Ga0068853_100400553 | |||
| 1064 | Ga0068853_100674768 | |||
| 1065 | Ga0068853_100736778 | |||
| 1066 | Ga0070672_100008996 | |||
| 1067 | Ga0070672_100023210 | |||
| 1068 | Ga0070672_100035158 | |||
| 1069 | Ga0070672_100073201 | |||
| 1070 | Ga0070672_100076179 | |||
| 1071 | Ga0070672_100077866 | |||
| 1072 | Ga0070672_100155404 | |||
| 1073 | Ga0070672_100367461 | |||
| 1074 | Ga0070672_100456136 | |||
| 1075 | Ga0070693_100068866 | |||
| 1076 | Ga0070665_100220200 | |||
| 1077 | Ga0070665_100433462 | |||
| 1078 | Ga0070664_100037616 | |||
| 1079 | Ga0070664_100227913 | |||
| 1080 | Ga0070664_100297592 | |||
| 1081 | Ga0070664_100458131 | |||
| 1082 | Ga0070664_100581658 | |||
| 1083 | Ga0068857_100061915 | |||
| 1084 | Ga0068854_100099736 | |||
| 1085 | Ga0068854_100185117 | |||
| 1086 | Ga0068856_100104352 | |||
| 1087 | Ga0068856_100165071 | |||
| 1088 | Ga0068856_100802849 | |||
| 1089 | Ga0068856_100823349 | |||
| 1090 | Ga0070702_100201945 | |||
| 1091 | Ga0068852_100009055 | |||
| 1092 | Ga0068852_100010860 | |||
| 1093 | Ga0068852_100030071 | |||
| 1094 | Ga0068852_100031671 | |||
| 1095 | Ga0068852_100118587 | |||
| 1096 | Ga0068852_100137341 | |||
| 1097 | Ga0068852_100314359 | |||
| 1098 | Ga0068852_100339511 | |||
| 1099 | Ga0068852_100355595 | |||
| 1100 | Ga0068852_100688516 | |||
| 1101 | Ga0068859_100039942 | |||
| 1102 | Ga0068859_100136533 | |||
| 1103 | Ga0068859_100156913 | |||
| 1104 | Ga0068859_100753540 | |||
| 1105 | Ga0068864_100000365 | |||
| 1106 | Ga0068864_100002329 | |||
| 1107 | Ga0068864_100031123 | |||
| 1108 | Ga0068864_100045894 | |||
| 1109 | Ga0068864_100080467 | |||
| 1110 | Ga0068864_100283914 | |||
| 1111 | Ga0068864_100493069 | |||
| 1112 | Ga0068866_10012833 | |||
| 1113 | Ga0068866_10095036 | |||
| 1114 | Ga0068861_100416922 | |||
| 1115 | Ga0068851_10005284 | |||
| 1116 | Ga0068851_10122315 | |||
| 1117 | Ga0068851_10250998 | |||
| 1118 | Ga0068851_10259752 | |||
| 1119 | Ga0068870_10165149 | |||
| 1120 | Ga0068870_10190663 | |||
| 1121 | Ga0068863_100025015 | |||
| 1122 | Ga0068863_100063605 | |||
| 1123 | Ga0068863_100114908 | |||
| 1124 | Ga0068863_100212996 | |||
| 1125 | Ga0068863_100236061 | |||
| 1126 | Ga0068863_100263291 | |||
| 1127 | Ga0068863_100269813 | |||
| 1128 | Ga0068863_100698719 | |||
| 1129 | Ga0068858_100001818 | |||
| 1130 | Ga0068858_100003428 | |||
| 1131 | Ga0068858_100003838 | |||
| 1132 | Ga0068858_100015579 | |||
| 1133 | Ga0068860_100004794 | |||
| 1134 | Ga0068860_100005517 | |||
| 1135 | Ga0068860_100093086 | |||
| 1136 | Ga0068862_100039223 | |||
| 1137 | Ga0068862_100093115 | |||
| 1138 | Ga0070717_10022058 | |||
| 1139 | Ga0075365_10005225 | |||
| 1140 | Ga0070715_10196619 | |||
| 1141 | Ga0075367_10029910 | |||
| 1142 | Ga0075366_10231906 | |||
| 1143 | Ga0075366_10301165 | |||
| 1144 | Ga0097621_100016159 | |||
| 1145 | Ga0097621_100045361 | |||
| 1146 | Ga0097621_100364826 | |||
| 1147 | Ga0097621_100405989 | |||
| 1148 | Ga0097621_100739939 | |||
| 1149 | Ga0068871_100085125 | |||
| 1150 | Ga0068871_100090430 | |||
| 1151 | Ga0068871_100261185 | |||
| 1152 | Ga0068871_100295490 | |||
| 1153 | Ga0068871_100332340 | |||
| 1154 | Ga0068865_100816976 | |||
| 1155 | Ga0097620_100039942 | |||
| 1156 | Ga0097620_100136532 | |||
| 1157 | Ga0097620_100156918 | |||
| 1158 | Ga0097620_100753500 | |||
| 1159 | Ga0105240_10002543 | |||
| 1160 | Ga0105240_10160498 | |||
| 1161 | Ga0111539_10557317 | |||
| 1162 | Ga0111539_11910411 | |||
| 1163 | Ga0105245_10042059 | |||
| 1164 | Ga0105245_10175268 | |||
| 1165 | Ga0105247_10520875 | |||
| 1166 | Ga0105243_10003820 | |||
| 1167 | Ga0105243_10004042 | |||
| 1168 | Ga0105243_10916977 | |||
| 1169 | Ga0105241_10369203 | |||
| 1170 | Ga0105241_10560425 | |||
| 1171 | Ga0105242_10073735 | |||
| 1172 | Ga0105242_10617790 | |||
| 1173 | Ga0105248_10020415 | |||
| 1174 | Ga0105248_10044593 | |||
| 1175 | Ga0105248_10109194 | |||
| 1176 | Ga0105248_10662727 | |||
| 1177 | Ga0105248_10672461 | |||
| 1178 | Ga0105248_11182908 | |||
| 1179 | Ga0105237_10000518 | |||
| 1180 | Ga0105237_10221725 | |||
| 1181 | Ga0105238_10043782 | |||
| 1182 | Ga0105238_10175558 | |||
| 1183 | Ga0105238_10396108 | |||
| 1184 | Ga0105249_10005277 | |||
| 1185 | Ga0105249_10016583 | |||
| 1186 | Ga0105249_10213870 | |||
| 1187 | Ga0105249_10381685 | |||
| 1188 | Ga0105239_10000872 | |||
| 1189 | Ga0105239_10819287 | |||
| 1190 | Ga0105246_10717380 | |||
| 1191 | Ga0157373_10437504 | |||
| 1192 | Ga0157371_10057938 | |||
| 1193 | Ga0157370_10270238 | |||
| 1194 | Ga0157370_10707126 | |||
| 1195 | Ga0157369_10032613 | |||
| 1196 | Ga0157374_10013203 | |||
| 1197 | Ga0157374_10060546 | |||
| 1198 | Ga0157374_10086510 | |||
| 1199 | Ga0157374_11141907 | |||
| 1200 | Ga0157378_10185191 | |||
| 1201 | Ga0157378_10295745 | |||
| 1202 | Ga0163162_10020480 | |||
| 1203 | Ga0163162_10087946 | |||
| 1204 | Ga0163162_10322226 | |||
| 1205 | Ga0163162_10475759 | |||
| 1206 | Ga0163162_10677352 | |||
| 1207 | Ga0163162_10912745 | |||
| 1208 | Ga0157372_10078073 | |||
| 1209 | Ga0157372_10253491 | |||
| 1210 | Ga0157372_10293460 | |||
| 1211 | Ga0157375_10027374 | |||
| 1212 | Ga0157375_10137302 | |||
| 1213 | Ga0157375_10149452 | |||
| 1214 | Ga0157375_10154362 | |||
| 1215 | Ga0157375_11398527 | |||
| 1216 | Ga0163163_10007645 | |||
| 1217 | Ga0163163_10170102 | |||
| 1218 | Ga0157380_10015990 | |||
| 1219 | Ga0157380_10023234 | |||
| 1220 | Ga0157380_10030254 | |||
| 1221 | Ga0157380_10371249 | |||
| 1222 | Ga0157377_10000039 | |||
| 1223 | Ga0157377_10113708 | |||
| 1224 | Ga0157379_10047857 | |||
| 1225 | Ga0157379_10092877 | |||
| 1226 | Ga0157379_10154924 | |||
| 1227 | Ga0157376_10008913 | |||
| 1228 | Ga0157376_10009644 | |||
| 1229 | Ga0157376_11573919 | |||
| 1230 | Ga0163161_10027098 | |||
| 1231 | Ga0163161_10350265 | |||
| 1232 | Ga0163161_10365361 | |||
| 1233 | Ga0163161_10619960 | |||
| 1234 | Ga0207425_1000062 | |||
| 1235 | Ga0209677_100960 | |||
| 1236 | Ga0209565_1000622 | |||
| 1237 | Ga0209565_1000784 | |||
| 1238 | Ga0209565_1001080 | |||
| 1239 | Ga0209565_1031342 | |||
| 1240 | Ga0207666_1009379 | |||
| 1241 | Ga0209130_1001152 | |||
| 1242 | Ga0209130_1007249 | |||
| 1243 | Ga0209130_1025357 | |||
| 1244 | Ga0209675_1000280 | |||
| 1245 | Ga0209564_1001080 | |||
| 1246 | Ga0209050_1000064 | |||
| 1247 | Ga0209050_1001144 | |||
| 1248 | Ga0209256_1000507 | |||
| 1249 | Ga0209256_1001972 | |||
| 1250 | Ga0207426_1001027 | |||
| 1251 | Ga0209051_1031078 | |||
| 1252 | Ga0209257_1000010 | |||
| 1253 | Ga0209257_1003990 | |||
| 1254 | Ga0207697_10042417 | |||
| 1255 | Ga0207656_10023503 | |||
| 1256 | Ga0207656_10072122 | |||
| 1257 | Ga0207656_10117927 | |||
| 1258 | Ga0207656_10150588 | |||
| 1259 | Ga0207656_10167946 | |||
| 1260 | Ga0207656_10200423 | |||
| 1261 | Ga0207682_10007351 | |||
| 1262 | Ga0207682_10053057 | |||
| 1263 | Ga0207682_10053985 | |||
| 1264 | Ga0207642_10014634 | |||
| 1265 | Ga0207642_10130694 | |||
| 1266 | Ga0207688_10172200 | |||
| 1267 | Ga0207688_10319948 | |||
| 1268 | Ga0207688_10436710 | |||
| 1269 | Ga0207688_10480137 | |||
| 1270 | Ga0207680_10019580 | |||
| 1271 | Ga0207680_10051951 | |||
| 1272 | Ga0207680_10273463 | |||
| 1273 | Ga0207685_10153763 | |||
| 1274 | Ga0207645_10016617 | |||
| 1275 | Ga0207645_10025026 | |||
| 1276 | Ga0207645_10039259 | |||
| 1277 | Ga0207645_10093958 | |||
| 1278 | Ga0207645_10118016 | |||
| 1279 | Ga0207643_10308284 | |||
| 1280 | Ga0207705_10333928 | |||
| 1281 | Ga0207695_10006571 | |||
| 1282 | Ga0207695_10142141 | |||
| 1283 | Ga0207671_10003492 | |||
| 1284 | Ga0207671_10291669 | |||
| 1285 | Ga0207660_10185183 | |||
| 1286 | Ga0207662_10186112 | |||
| 1287 | Ga0207662_10267713 | |||
| 1288 | Ga0207657_10227937 | |||
| 1289 | Ga0207657_10333922 | |||
| 1290 | Ga0207649_10138295 | |||
| 1291 | Ga0207649_10216079 | |||
| 1292 | Ga0207652_10295525 | |||
| 1293 | Ga0207681_10032608 | |||
| 1294 | Ga0207681_10071671 | |||
| 1295 | Ga0207681_10445708 | |||
| 1296 | Ga0207694_10019086 | |||
| 1297 | Ga0207694_10278913 | |||
| 1298 | Ga0207650_10027735 | |||
| 1299 | Ga0207650_10035349 | |||
| 1300 | Ga0207650_10133863 | |||
| 1301 | Ga0207650_10153958 | |||
| 1302 | Ga0207650_10187506 | |||
| 1303 | Ga0207650_10384649 | |||
| 1304 | Ga0207659_10003336 | |||
| 1305 | Ga0207659_10010543 | |||
| 1306 | Ga0207659_10015331 | |||
| 1307 | Ga0207659_10036615 | |||
| 1308 | Ga0207659_10162050 | |||
| 1309 | Ga0207659_10310924 | |||
| 1310 | Ga0207659_10462700 | |||
| 1311 | Ga0207659_10580292 | |||
| 1312 | Ga0207687_10034140 | |||
| 1313 | Ga0207687_10236079 | |||
| 1314 | Ga0207644_10002949 | |||
| 1315 | Ga0207644_10027031 | |||
| 1316 | Ga0207644_10193967 | |||
| 1317 | Ga0207644_10289150 | |||
| 1318 | Ga0207644_10290172 | |||
| 1319 | Ga0207644_10437444 | |||
| 1320 | Ga0207690_10122483 | |||
| 1321 | Ga0207706_10001684 | |||
| 1322 | Ga0207706_10069224 | |||
| 1323 | Ga0207706_10162222 | |||
| 1324 | Ga0207706_10762093 | |||
| 1325 | Ga0207706_11098358 | |||
| 1326 | Ga0207686_10068989 | |||
| 1327 | Ga0207686_10075378 | |||
| 1328 | Ga0207686_10435447 | |||
| 1329 | Ga0207709_10008906 | |||
| 1330 | Ga0207709_10020258 | |||
| 1331 | Ga0207709_10280442 | |||
| 1332 | Ga0207669_10016052 | |||
| 1333 | Ga0207669_10027359 | |||
| 1334 | Ga0207669_10389288 | |||
| 1335 | Ga0207704_10008539 | |||
| 1336 | Ga0207665_10058372 | |||
| 1337 | Ga0207691_10012960 | |||
| 1338 | Ga0207691_10024676 | |||
| 1339 | Ga0207691_10056925 | |||
| 1340 | Ga0207691_10058182 | |||
| 1341 | Ga0207691_10127924 | |||
| 1342 | Ga0207691_10372729 | |||
| 1343 | Ga0207691_10519804 | |||
| 1344 | Ga0207711_10100667 | |||
| 1345 | Ga0207711_10189956 | |||
| 1346 | Ga0207711_10290181 | |||
| 1347 | Ga0207711_10341131 | |||
| 1348 | Ga0207711_10469663 | |||
| 1349 | Ga0207711_11238177 | |||
| 1350 | Ga0207689_10000716 | |||
| 1351 | Ga0207689_10002900 | |||
| 1352 | Ga0207689_10069792 | |||
| 1353 | Ga0207661_10026334 | |||
| 1354 | Ga0207679_10200857 | |||
| 1355 | Ga0207679_10369217 | |||
| 1356 | Ga0207679_10488097 | |||
| 1357 | Ga0207679_11275709 | |||
| 1358 | Ga0207667_10193259 | |||
| 1359 | Ga0207667_10590591 | |||
| 1360 | Ga0207651_10007527 | |||
| 1361 | Ga0207651_10051280 | |||
| 1362 | Ga0207651_10109031 | |||
| 1363 | Ga0207651_10329320 | |||
| 1364 | Ga0207651_10475087 | |||
| 1365 | Ga0207712_10034313 | |||
| 1366 | Ga0207668_10047946 | |||
| 1367 | Ga0207668_10473502 | |||
| 1368 | Ga0207668_10573537 | |||
| 1369 | Ga0207640_10090295 | |||
| 1370 | Ga0207640_10148017 | |||
| 1371 | Ga0207640_10328349 | |||
| 1372 | Ga0207658_10002511 | |||
| 1373 | Ga0207658_10023668 | |||
| 1374 | Ga0207658_10247099 | |||
| 1375 | Ga0207658_10435704 | |||
| 1376 | Ga0207658_10736009 | |||
| 1377 | Ga0207677_10000452 | |||
| 1378 | Ga0207677_10020176 | |||
| 1379 | Ga0207677_10087762 | |||
| 1380 | Ga0207677_10219806 | |||
| 1381 | Ga0207677_10450333 | |||
| 1382 | Ga0207677_10950080 | |||
| 1383 | Ga0207703_10003257 | |||
| 1384 | Ga0207703_10003262 | |||
| 1385 | Ga0207703_10089492 | |||
| 1386 | Ga0207639_10103265 | |||
| 1387 | Ga0207639_10370436 | |||
| 1388 | Ga0207639_10560087 | |||
| 1389 | Ga0207639_10623268 | |||
| 1390 | Ga0207639_10751365 | |||
| 1391 | Ga0207678_10008265 | |||
| 1392 | Ga0207678_10042827 | |||
| 1393 | Ga0207678_10437544 | |||
| 1394 | Ga0207702_10017145 | |||
| 1395 | Ga0207702_11202452 | |||
| 1396 | Ga0207641_10000923 | |||
| 1397 | Ga0207641_10067624 | |||
| 1398 | Ga0207641_10557982 | |||
| 1399 | Ga0207641_10938236 | |||
| 1400 | Ga0207648_10000836 | |||
| 1401 | Ga0207648_10063633 | |||
| 1402 | Ga0207648_10124501 | |||
| 1403 | Ga0207648_10278432 | |||
| 1404 | Ga0207648_10402916 | |||
| 1405 | Ga0207648_10928640 | |||
| 1406 | Ga0207676_10004605 | |||
| 1407 | Ga0207676_10027490 | |||
| 1408 | Ga0207676_10028475 | |||
| 1409 | Ga0207676_10111006 | |||
| 1410 | Ga0207676_10189822 | |||
| 1411 | Ga0207676_10448793 | |||
| 1412 | Ga0207676_10620848 | |||
| 1413 | Ga0207674_10093330 | |||
| 1414 | Ga0207675_100024123 | |||
| 1415 | Ga0207675_100043887 | |||
| 1416 | Ga0207675_100772423 | |||
| 1417 | Ga0207683_10001865 | |||
| 1418 | Ga0207683_10024876 | |||
| 1419 | Ga0207683_10028889 | |||
| 1420 | Ga0207683_10052952 | |||
| 1421 | Ga0207683_10157193 | |||
| 1422 | Ga0207683_10230223 | |||
| 1423 | Ga0207683_10238480 | |||
| 1424 | Ga0207683_10355924 | |||
| 1425 | Ga0207683_10398368 | |||
| 1426 | Ga0207683_10651174 | |||
| 1427 | Ga0207683_10685541 | |||
| 1428 | Ga0207698_10017502 | |||
| 1429 | Ga0207698_10047999 | |||
| 1430 | Ga0207698_10048420 | |||
| 1431 | Ga0207698_10059428 | |||
| 1432 | Ga0207698_10078152 | |||
| 1433 | Ga0207698_10152078 | |||
| 1434 | Ga0207698_10278503 | |||
| 1435 | Ga0207698_10680206 | |||
| 1436 | Ga0207698_10976148 | |||
| 1437 | Ga0268266_10270974 | |||
| 1438 | Ga0268265_10522666 | |||
| 1439 | Ga0268264_10052499 | |||
| 1440 | Ga0268264_10071675 | |||
| 1441 | Ga0268264_10373113 | |||
| 1442 | Ga0307515_10000030 | |||
| 1443 | Ga0307515_10000221 | |||
| 1444 | Ga0307515_10000777 | |||
| 1445 | Ga0307515_10018037 | |||
| 1446 | Ga0265324_10081879 | |||
| 1447 | Ga0307512_10017030 | |||
| 1448 | Ga0307513_10023763 | |||
| 1449 | Ga0307408_100002803 | |||
| 1450 | Ga0307408_100015501 | |||
| 1451 | Ga0307408_100217674 | |||
| 1452 | Ga0307408_100345150 | |||
| 1453 | Ga0307408_100477666 | |||
| 1454 | Ga0307508_10000141 | |||
| 1455 | Ga0307514_10065597 | |||
| 1456 | Ga0307516_10004531 | |||
| 1457 | Ga0307405_10011385 | |||
| 1458 | Ga0307405_10166719 | |||
| 1459 | Ga0307410_10735064 | |||
| 1460 | Ga0307406_10022936 | |||
| 1461 | Ga0307406_10836344 | |||
| 1462 | Ga0307407_10120706 | |||
| 1463 | Ga0307412_10003513 | |||
| 1464 | Ga0307412_10095690 | |||
| 1465 | Ga0307409_100025456 | |||
| 1466 | Ga0307409_100869257 | |||
| 1467 | Ga0307416_100000974 | |||
| 1468 | Ga0307416_100234092 | |||
| 1469 | Ga0307416_100309525 | |||
| 1470 | Ga0307414_10364022 | |||
| 1471 | Ga0307411_10094900 | |||
| 1472 | Ga0307415_100001962 | |||
| 1473 | Ga0307415_100551641 | |||
| 1474 | Ga0307510_10448412 | |||
| 1475 | Ga0373938_0040326 | |||
| 1476 | Ga0373949_0035444 | |||
| 1477 | Ga0373936_0183358 | |||
| 1478 | Ga0373931_0003594 | |||
| 1479 | Ga0373931_0262860 | |||
| 1480 | Ga0373927_0123237 | |||
| 1481 | Ga0373937_0037185 | |||
| 1482 | Ga0373925_0170979 | |||
| 1483 | Ga0373925_0253853 | |||
| 1484 | Ga0373925_0672663 | |||
| 1485 | Ga0395900_0185157 | |||
| 1486 | Ga0395900_0746435 | |||
| 1487 | Ga0395898_0020437 | |||
| 1488 | Ga0395905_0370157 | |||
| 1489 | Ga0395905_1185220 | |||
| 1490 | Ga0436364_0571710 | |||
| 1491 | Ga0395901_0158225 | |||
| 1492 | Ga0395901_0381368 | |||
| 1493 | Ga0436365_0482375 | |||
| 1494 | Ga0436363_0390454 | |||
| 1495 | Ga0451793_1915431 | |||
| 1496 | Ga0451797_0142736 | |||
| 1497 | Ga0451802_0933167 | |||
| 1498 | Ga0451835_0346031 | |||
| 1499 | Ga0451837_1554540 | |||
| 1500 | Ga0451839_0874313 | |||
| 1501 | Ga0451841_0821959 | |||
| 1502 | Ga0451843_0875436 | |||
| 1503 | Ga0451853_0591653 | |||
| 1504 | Ga0451853_2839646 | |||
| 1505 | Ga0439464_0006066 | |||
| 1506 | Ga0451577_0609327 | |||
| 1507 | Ga0466972_0029464 | |||
| 1508 | Ga0466965_0019972 | |||
| 1509 | Ga0466961_0135700 | |||
| 1510 | Ga0466963_0253382 | |||
| 1511 | Ga0466964_0000831 | |||
| 1512 | Ga0466964_0046940 | |||
| 1513 | Ga0453684_0746774 | |||
| 1514 | Ga0466968_0005379 | |||
| 1515 | Ga0466970_0411913 | |||
| 1516 | Ga0466957_0119546 | |||
| 1517 | Ga0466957_0246141 | |||
| 1518 | Ga0466957_0463066 | |||
| 1519 | Ga0466960_0256749 | |||
| 1520 | Ga0451576_0553615 | |||
| 1521 | Ga0451576_1410206 | |||
| 1522 | Ga0466958_0391881 | |||
| 1523 | Ga0466967_0011043 | |||
| 1524 | Ga0495617_000002 | |||
| 1525 | Ga0495627_000176 | |||
| 1526 | Ga0495627_005973 | |||
| 1527 | Ga0495603_0235314 | |||
| 1528 | Ga0495603_0426942 | |||
| 1529 | Ga0495590_0025210 | |||
| 1530 | Ga0495591_061640 | |||
| 1531 | Ga0495629_0021875 | |||
| 1532 | Ga0495629_0026938 | |||
| 1533 | Ga0495629_0515712 | |||
| 1534 | Ga0495629_0548413 | |||
| 1535 | Ga0495638_0006104 | |||
| 1536 | Ga0495638_0100621 | |||
| 1537 | Ga0495638_0280710 | |||
| 1538 | Ga0495653_0099895 | |||
| 1539 | Ga0495580_0479193 | |||
| 1540 | Ga0495582_0049455 | |||
| 1541 | Ga0495582_0332348 | |||
| 1542 | Ga0495582_0346806 | |||
| 1543 | Ga0495605_0000081 | |||
| 1544 | Ga0495605_0000087 | |||
| 1545 | Ga0495605_0014951 | |||
| 1546 | Ga0495605_0054408 | |||
| 1547 | Ga0495605_0054970 | |||
| 1548 | Ga0495605_0096507 | |||
| 1549 | Ga0495639_0119233 | |||
| 1550 | Ga0495664_0135482 | |||
| 1551 | Ga0495664_0470154 | |||
| 1552 | Ga0495584_0003309 | |||
| 1553 | Ga0495584_0006863 | |||
| 1554 | Ga0495584_0011832 | |||
| 1555 | Ga0495584_0029616 | |||
| 1556 | Ga0495584_0136281 | |||
| 1557 | Ga0495584_0310848 | |||
| 1558 | Ga0495585_0000863 | |||
| 1559 | Ga0495585_0008523 | |||
| 1560 | Ga0495585_0034137 | |||
| 1561 | Ga0495585_0066082 | |||
| 1562 | Ga0495585_0069942 | |||
| 1563 | Ga0495594_0000705 | |||
| 1564 | Ga0495594_0125810 | |||
| 1565 | Ga0495594_0176021 | |||
| 1566 | Ga0495594_0191108 | |||
| 1567 | Ga0495596_0001008 | |||
| 1568 | Ga0495596_0029285 | |||
| 1569 | Ga0495596_0044436 | |||
| 1570 | Ga0495596_0048861 | |||
| 1571 | Ga0495596_0061065 | |||
| 1572 | Ga0495596_0102603 | |||
| 1573 | Ga0495607_0015258 | |||
| 1574 | Ga0495607_0063518 | |||
| 1575 | Ga0495583_0000193 | |||
| 1576 | Ga0495583_0000430 | |||
| 1577 | Ga0495583_0025803 | |||
| 1578 | Ga0495583_0049210 | |||
| 1579 | Ga0495583_0053809 | |||
| 1580 | Ga0495583_0066555 | |||
| 1581 | Ga0495583_0079437 | |||
| 1582 | Ga0495583_0109368 | |||
| 1583 | Ga0495583_0149583 | |||
| 1584 | Ga0495583_0209902 | |||
| 1585 | Ga0495606_0000007 | |||
| 1586 | Ga0495606_0006338 | |||
| 1587 | Ga0495606_0168583 | |||
| 1588 | Ga0495610_0295824 | |||
| 1589 | Ga0495616_0003775 | |||
| 1590 | Ga0495616_0006247 | |||
| 1591 | Ga0495616_0011606 | |||
| 1592 | Ga0495616_0026665 | |||
| 1593 | Ga0495616_0057859 | |||
| 1594 | Ga0495616_0078089 | |||
| 1595 | Ga0495616_0146406 | |||
| 1596 | Ga0495630_0408456 | |||
| 1597 | Ga0495631_0001768 | |||
| 1598 | Ga0495631_0047270 | |||
| 1599 | Ga0495631_0058851 | |||
| 1600 | Ga0495631_0078768 | |||
| 1601 | Ga0495631_0080287 | |||
| 1602 | Ga0495631_0091013 | |||
| 1603 | Ga0495631_0233025 | |||
| 1604 | Ga0495632_0000114 | |||
| 1605 | Ga0495643_0026010 | |||
| 1606 | Ga0495643_0122658 | |||
| 1607 | Ga0495643_0162344 | |||
| 1608 | Ga0495644_0024432 | |||
| 1609 | Ga0495644_0174579 | |||
| 1610 | Ga0495644_0199043 | |||
| 1611 | Ga0495648_0003099 | |||
| 1612 | Ga0495648_0018117 | |||
| 1613 | Ga0495648_0104611 | |||
| 1614 | Ga0495663_0017699 | |||
| 1615 | Ga0495663_0026350 | |||
| 1616 | Ga0495666_0024048 | |||
| 1617 | Ga0495666_0051039 | |||
| 1618 | Ga0495666_0104105 | |||
| 1619 | Ga0495666_0216858 | |||
| 1620 | Ga0495642_0000813 | |||
| 1621 | Ga0495642_0002336 | |||
| 1622 | Ga0495642_0063087 | |||
| 1623 | Ga0495642_0086695 | |||
| 1624 | Ga0495642_0092047 | |||
| 1625 | Ga0495642_0117604 | |||
| 1626 | Ga0495642_0119825 | |||
| 1627 | Ga0495642_0142181 | |||
| 1628 | Ga0495642_0146022 | |||
| 1629 | Ga0495642_0243901 | |||
| 1630 | Ga0495654_0009914 | |||
| 1631 | Ga0495654_0027808 | |||
| 1632 | Ga0495654_0065381 | |||
| 1633 | Ga0495665_0024195 | |||
| 1634 | Ga0495665_0025475 | |||
| 1635 | Ga0495586_0130831 | |||
| 1636 | Ga0495587_0024560 | |||
| 1637 | Ga0495587_0092009 | |||
| 1638 | Ga0495609_0000096 | |||
| 1639 | Ga0495609_0005065 | |||
| 1640 | Ga0495609_0012026 | |||
| 1641 | Ga0495609_0063112 | |||
| 1642 | Ga0495609_0065576 | |||
| 1643 | Ga0495609_0074786 | |||
| 1644 | Ga0495609_0108656 | |||
| 1645 | Ga0495621_0186868 | |||
| 1646 | Ga0495597_0000587 | |||
| 1647 | Ga0495597_0001219 | |||
| 1648 | Ga0495597_0002540 | |||
| 1649 | Ga0495597_0004426 | |||
| 1650 | Ga0495597_0039253 | |||
| 1651 | Ga0495597_0089115 | |||
| 1652 | Ga0495597_0090044 | |||
| 1653 | Ga0495645_0047563 | |||
| 1654 | Ga0495622_0005476 | |||
| 1655 | Ga0495622_0051667 | |||
| 1656 | Ga0495622_0108102 | |||
| 1657 | Ga0495622_0111001 | |||
| 1658 | Ga0495622_0229086 | |||
| 1659 | Ga0495633_0062569 | |||
| 1660 | Ga0495633_0070876 | |||
| 1661 | Ga0495633_0123615 | |||
| 1662 | Ga0495633_0180395 | |||
| 1663 | Ga0495633_0213343 | |||
| 1664 | Ga0495667_0034780 | |||
| 1665 | Ga0495667_0314618 | |||
| 1666 | Ga0495656_0064993 | |||
| 1667 | Ga0495656_0070245 | |||
| 1668 | Ga0495656_0107791 | |||
| 1669 | Ga0495656_0144600 | |||
| 1670 | Ga0495656_0493761 | |||
| 1671 | Ga0495668_0002567 | |||
| 1672 | Ga0495668_0011047 | |||
| 1673 | Ga0495668_0013816 | |||
| 1674 | Ga0495668_0065700 | |||
| 1675 | Ga0495668_0126435 | |||
| 1676 | Ga0495668_0321688 | |||
| 1677 | Ga0495634_0029421 | |||
| 1678 | Ga0495634_0228698 | |||
| 1679 | Ga0495611_0080114 | |||
| 1680 | Ga0495625_0002044 | |||
| 1681 | Ga0495625_0004537 | |||
| 1682 | Ga0495625_0032111 | |||
| 1683 | Ga0495625_0050417 | |||
| 1684 | Ga0495625_0053275 | |||
| 1685 | Ga0495625_0140040 | |||
| 1686 | Ga0495625_0189381 | |||
| 1687 | Ga0495625_0251042 | |||
| 1688 | Ga0495625_0254657 | |||
| 1689 | Ga0495661_0000164 | |||
| 1690 | Ga0495661_0014211 | |||
| 1691 | Ga0495661_0073293 | |||
| 1692 | Ga0495661_0104944 | |||
| 1693 | Ga0495661_0115739 | |||
| 1694 | Ga0495661_0184710 | |||
| 1695 | Ga0495661_0209534 | |||
| 1696 | Ga0495588_0083822 | |||
| 1697 | Ga0495588_0097659 | |||
| 1698 | Ga0495588_0129583 | |||
| 1699 | Ga0495588_0238769 | |||
| 1700 | Ga0495588_0240112 | |||
| 1701 | Ga0495588_0271647 | |||
| 1702 | Ga0495588_0333912 | |||
| 1703 | Ga0495623_0016009 | |||
| 1704 | Ga0495623_0142294 | |||
| 1705 | Ga0495623_0152455 | |||
| 1706 | Ga0495647_0016669 | |||
| 1707 | Ga0495647_0196924 | |||
| 1708 | Ga0495647_0341001 | |||
| 1709 | Ga0495658_0062960 | |||
| 1710 | Ga0495658_0274740 | |||
| 1711 | Ga0495669_0087744 | |||
| 1712 | Ga0495669_0375936 | |||
| 1713 | Ga0495613_0138776 | |||
| 1714 | Ga0495613_0199300 | |||
| 1715 | Ga0495613_0516790 | |||
| 1716 | Ga0495624_0045126 | |||
| 1717 | Ga0495670_0000604 | |||
| 1718 | Ga0495670_0048641 | |||
| 1719 | Ga0495670_0053624 | |||
| 1720 | Ga0495670_0182906 | |||
| 1721 | Ga0495670_0191468 | |||
| 1722 | Ga0495670_0268326 | |||
| 1723 | Ga0495671_0000132 | |||
| 1724 | Ga0495671_0060264 | |||
| 1725 | Ga0495671_0064536 | |||
| 1726 | Ga0495671_0069041 | |||
| 1727 | Ga0495671_0079020 | |||
| 1728 | Ga0495671_0206591 | |||
| 1729 | Ga0495649_0073170 | |||
| 1730 | Ga0495649_0098126 | |||
| 1731 | Ga0495649_0172010 | |||
| 1732 | Ga0495589_0000036 | |||
| 1733 | Ga0495589_0000092 | |||
| 1734 | Ga0495589_0001941 | |||
| 1735 | Ga0495589_0047793 | |||
| 1736 | Ga0495589_0083531 | |||
| 1737 | Ga0495600_0026732 | |||
| 1738 | Ga0495600_0550314 | |||
| 1739 | Ga0495660_0000117 | |||
| 1740 | Ga0495660_0017138 | |||
| 1741 | Ga0495660_0020826 | |||
| 1742 | Ga0495660_0045575 | |||
| 1743 | Ga0495660_0079012 | |||
| 1744 | Ga0495660_0098586 | |||
| 1745 | Ga0495581_0024612 | |||
| 1746 | Ga0495581_0572309 | |||
| 1747 | Ga0495604_0045073 | |||
| 1748 | Ga0495636_0015815 | |||
| 1749 | Ga0495674_0003022 | |||
| 1750 | Ga0495674_0585921 | |||
| 1751 | Ga0495672_0000014 | |||
| 1752 | Ga0495672_0002183 | |||
| 1753 | Ga0495672_0003253 | |||
| 1754 | Ga0495676_0007223 | |||
| 1755 | Ga0495676_0009421 | |||
| 1756 | Ga0495676_0070247 | |||
| 1757 | Ga0495676_0242968 | |||
| 1758 | Ga0495683_0000576 | |||
| 1759 | Ga0495683_0007830 | |||
| 1760 | Ga0495683_0019300 | |||
| 1761 | Ga0495683_0058853 | |||
| 1762 | Ga0495687_000074 | |||
| 1763 | Ga0495687_000154 | |||
| 1764 | Ga0495687_002852 | |||
| 1765 | Ga0495687_003354 | |||
| 1766 | Ga0495687_167915 | |||
| 1767 | Ga0495675_0065424 | |||
| 1768 | Ga0495675_0133443 | |||
| 1769 | Ga0495677_0000037 | |||
| 1770 | Ga0495677_0033630 | |||
| 1771 | Ga0495677_0105433 | |||
| 1772 | Ga0495679_038807 | |||
| 1773 | Ga0495685_016157 | |||
| 1774 | Ga0495685_039220 | |||
| 1775 | Ga0495681_0006668 | |||
| 1776 | Ga0495681_0017803 | |||
| 1777 | Ga0495681_0061861 | |||
| 1778 | Ga0495686_0001832 | |||
| 1779 | Ga0495686_0002933 | |||
| 1780 | Ga0495686_0050546 | |||
| 1781 | Ga0495686_0109922 | |||
| 1782 | Ga0495686_0178256 | |||
| 1783 | Ga0495593_0056294 | |||
| 1784 | Ga0495602_0033019 | |||
| 1785 | Ga0495602_0170594 | |||
| 1786 | Ga0495615_0027467 | |||
| 1787 | Ga0495626_0000006 | |||
| 1788 | Ga0495626_0004153 | |||
| 1789 | Ga0495626_0044821 | |||
| 1790 | Ga0495626_0069047 | |||
| 1791 | Ga0495626_0147140 | |||
| 1792 | Ga0496100_0032816 | |||
| 1793 | Ga0496100_0074915 | |||
| 1794 | Ga0496102_0021103 | |||
| 1795 | Ga0496102_0068969 | |||
| 1796 | Ga0496102_0416302 | |||
| 1797 | Ga0496103_0004341 | |||
| 1798 | Ga0496104_0296569 | |||
| 1799 | Ga0496104_1013963 | |||
| 1800 | Ga0496105_0182079 | |||
| 1801 | Ga0496105_0555668 | |||
| 1802 | Ga0496106_0004593 | |||
| 1803 | Ga0496107_0608226 | |||
| 1804 | Ga0496108_0018843 | |||
| 1805 | Ga0496108_0070054 | |||
| 1806 | Ga0496108_0275744 | |||
| 1807 | Ga0496108_0675345 | |||
| 1808 | Ga0496108_0800146 | |||
| 1809 | Ga0496108_0858628 | |||
| 1810 | Ga0496109_0008838 | |||
| 1811 | Ga0496109_0220311 | |||
| 1812 | Ga0496109_0255942 | |||
| 1813 | Ga0496109_0320416 | |||
| 1814 | Ga0496109_0787890 | |||
| 1815 | Ga0496110_0004486 | |||
| 1816 | Ga0496110_0181810 | |||
| 1817 | Ga0496110_0194522 | |||
| 1818 | Ga0496110_0570245 | |||
| 1819 | Ga0496110_0673692 | |||
| 1820 | Ga0496111_0130263 | |||
| 1821 | Ga0496111_0212296 | |||
| 1822 | Ga0496111_0273343 | |||
| 1823 | Ga0496112_0191825 | |||
| 1824 | Ga0496112_0268957 | |||
| 1825 | Ga0496113_0087315 | |||
| 1826 | Ga0496113_0158354 | |||
| 1827 | Ga0496113_0478026 | |||
| 1828 | Ga0496114_0669293 | |||
| 1829 | Ga0496115_0107553 | |||
| 1830 | Ga0496115_0166792 | |||
| 1831 | Ga0496115_0246375 | |||
| 1832 | Ga0496122_0001315 | |||
| 1833 | Ga0496123_0000851 | |||
| 1834 | Ga0496124_0183530 | |||
| 1835 | Ga0496125_0002377 | |||
| 1836 | Ga0501304_008260 | |||
| 1837 | Ga0495678_002660 | |||
| 1838 | Ga0495678_003327 | |||
| 1839 | Ga0495678_003585 | |||
| 1840 | Ga0495682_0000726 | |||
| 1841 | Ga0501198_000038 | |||
| 1842 | Ga0501222_000037 | |||
| 1843 | Ga0501035_0512448 | |||
| 1844 | nmdc:mga03683_49370_c1 | |||
| 1845 | nmdc:mga0yw44_380671_c1 | |||
| 1846 | nmdc:mga0yw44_399878_c1 | |||
| 1847 | nmdc:mga0k408_97396_c1 | |||
| 1848 | nmdc:mga07m45_115522_c1 | |||
| 1849 | nmdc:mga08y16_1054124_c1 | |||
| 1850 | nmdc:mga08x19_167622_c1 | |||
| 1851 | Ga0495619_0062013 | |||
| 1852 | Ga0495619_0281616 | |||
| 1853 | Ga0500559_0033920 | |||
| 1854 | Ga0500564_120160 | |||
| 1855 | 2587754357 | |||
| 1856 | 2643788735 | |||
| 1857 | 2643797735 | |||
| 1858 | 2644213242 | |||
| 1859 | 2644470483 | |||
| 1860 | 2842711994 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gxf-assembly2.cif.gz_C | pseudomonas flexibilis gcn5 family acetyltransferase | 0.9118 | 4 | 191 |
| 8gxf-assembly2.cif.gz_C | pseudomonas flexibilis gcn5 family acetyltransferase | 0.8935 | 4 | 191 |
| 3tcv-assembly1.cif.gz_A | crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis | 0.8915 | 3 | 191 |
| 8gxj-assembly1.cif.gz_A | pseudomonas aeruginosa n-acetyltransferase domain-containing protein pa3270 | 0.8881 | 1 | 189 |
| 8gxk-assembly2.cif.gz_C | pseudomonas jinjuensis n-acetyltransferase | 0.8876 | 4 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q869N8_82_281_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9702 | 3 | 191 | 3.40.630.30 |
| af_Q869N8_82_281_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9362 | 3 | 191 | 3.40.630.30 |
| 1yreD00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9069 | 4 | 189 | 3.40.630.30 |
| af_P40586_15_233_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8995 | 3 | 191 | 3.40.630.30 |
| 3tcvA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8915 | 3 | 191 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y9SWL4-F1-model_v4 | N-acetyltransferase | 0.9866 | 1 | 194 |
GO:0016747
|
| AF-A0A430HGL1-F1-model_v4 | N-acetyltransferase | 0.9854 | 1 | 194 |
GO:0016747
|
| AF-A0A833KNB9-F1-model_v4 | deleted | 0.9827 | 5 | 134 |
|
| AF-A0A1Q7Q2C2-F1-model_v4 | GNAT family N-acetyltransferase | 0.9783 | 1 | 181 |
GO:0016747
|
| AF-A0A4Y9SWL4-F1-model_v4 | N-acetyltransferase | 0.9766 | 1 | 194 |
GO:0016747
|