F486013

General Info

Members Datasets Scaffolds Average Seq Length
930 346 1860 194

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10228142|Ga0070666_102281422
Length 212
Sequence VKARSAGRNHHPSRVLAVAPITLSDDRVRLEPLALHHEEGLRRAAADGELWQIRVTSVPEPDDTRGYIERALQGFADGHRLAFAVLDAASGEVIGSSSYHDIVPAVERLEIGYTWYAKSRQRTHVNASAKLLLMQHAFETLGARLVGWRTDNFNFASQRAIERLGARKDGVLRHHAVRRDGTIRDTVMYSMTAGEWPEAKAELQARLARPRD

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
208 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
209 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
210 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
211 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
229 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
299 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
300 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
328 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
329 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
330 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
333 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
334 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
340 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
341 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
342 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
343 2643221556 Massilia sp. Root1485 Isolate Unclassified
344 2643221638 Duganella sp. Root336D2 Isolate Unclassified
345 2643221684 Massilia sp. Root133 Isolate Unclassified
346 2842711865 Duganella sp. R-73148 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.11
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.95
Nodule 0
Rhizoplane 4.62
Rhizosphere 87.2
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10228142 3300005335 Bacteria 1315
2 JGI25158J39367_1020747 3300002739 Bacteria 801
3 JGI25159J45721_1001812 3300002987 Bacteria 8567
4 JGI25159J45721_1010629 3300002987 Bacteria 2326
5 rootL2_10015574 3300003322 Bacteria 1061
6 JGI25160J50197_1008378 3300003354 Bacteria 3945
7 JGI25161J50226_1003119 3300003374 Bacteria 3944
8 JGI25161J50226_1007562 3300003374 Bacteria 1802
9 Ga0055526_1002157 3300003771 Bacteria 13486
10 Ga0055537_1002292 3300003773 Bacteria 6551
11 Ga0055537_1018071 3300003773 Bacteria 1138
12 Ga0055524_1001269 3300003775 Bacteria 14790
13 Ga0055534_1002606 3300003784 Bacteria 6151
14 Ga0055530_10015821 3300003791 Bacteria 2441
15 Ga0055530_10016700 3300003791 Bacteria 2328
16 Ga0055531_10025864 3300003794 Bacteria 2115
17 Ga0055543_1001061 3300004625 Bacteria 12167
18 Ga0065165_1003149 3300005262 Bacteria 12167
19 Ga0070658_10167090 3300005327 Bacteria 1847
20 Ga0070658_10536862 3300005327 Bacteria 1012
21 Ga0070676_10006179 3300005328 Bacteria 6394
22 Ga0070676_10402641 3300005328 Bacteria 952
23 Ga0070683_100098838 3300005329 Bacteria 2746
24 Ga0070683_100333818 3300005329 Bacteria 1443
25 Ga0070683_100568363 3300005329 Bacteria 1084
26 Ga0070690_100009995 3300005330 Bacteria 5508
27 Ga0070670_100040437 3300005331 Bacteria 4009
28 Ga0070670_100041228 3300005331 Bacteria 3968
29 Ga0070670_100041810 3300005331 Bacteria 3939
30 Ga0070670_100070545 3300005331 Bacteria 2999
31 Ga0070670_100250988 3300005331 Bacteria 1541
32 Ga0070670_100289814 3300005331 Bacteria 1430
33 Ga0070670_100525976 3300005331 Bacteria 1053
34 Ga0070677_10057022 3300005333 Bacteria 1599
35 Ga0070677_10067798 3300005333 Bacteria 1492
36 Ga0070677_10244336 3300005333 Bacteria 888
37 Ga0070677_10300367 3300005333 Bacteria 815
38 Ga0068869_100023042 3300005334 Bacteria 4295
39 Ga0070666_10006509 3300005335 Bacteria 7174
40 Ga0070666_10206569 3300005335 Bacteria 1382
41 Ga0070666_10240260 3300005335 Bacteria 1281
42 Ga0070680_100023635 3300005336 Bacteria 4904
43 Ga0070682_100543651 3300005337 Bacteria 908
44 Ga0068868_100139572 3300005338 Bacteria 1989
45 Ga0068868_100225914 3300005338 Bacteria 1569
46 Ga0068868_100672776 3300005338 Bacteria 923
47 Ga0068868_100797915 3300005338 Bacteria 852
48 Ga0070660_100342381 3300005339 Bacteria 1230
49 Ga0070689_100036157 3300005340 Bacteria 3777
50 Ga0070687_100049285 3300005343 Bacteria 2169
51 Ga0070687_100301400 3300005343 Bacteria 1017
52 Ga0070661_100036668 3300005344 Bacteria 3564
53 Ga0070661_100125964 3300005344 Bacteria 1922
54 Ga0070661_100134924 3300005344 Bacteria 1856
55 Ga0070661_100271965 3300005344 Bacteria 1312
56 Ga0070661_100899479 3300005344 Bacteria 731
57 Ga0070668_100091715 3300005347 Bacteria 2395
58 Ga0070668_100259897 3300005347 Bacteria 1443
59 Ga0070668_100319559 3300005347 Bacteria 1307
60 Ga0070668_100769150 3300005347 Bacteria 854
61 Ga0070669_100001130 3300005353 Bacteria 19489
62 Ga0070669_100116846 3300005353 Bacteria 2030
63 Ga0070669_100256692 3300005353 Bacteria 1393
64 Ga0070669_100343750 3300005353 Bacteria 1210
65 Ga0070675_100003213 3300005354 Bacteria 12380
66 Ga0070675_100008487 3300005354 Bacteria 7976
67 Ga0070675_100009897 3300005354 Bacteria 7432
68 Ga0070675_100156052 3300005354 Bacteria 1960
69 Ga0070675_100219464 3300005354 Bacteria 1655
70 Ga0070675_100220814 3300005354 Bacteria 1650
71 Ga0070675_100359002 3300005354 Bacteria 1293
72 Ga0070671_100011925 3300005355 Bacteria 6991
73 Ga0070671_100118865 3300005355 Bacteria 2223
74 Ga0070671_100124449 3300005355 Bacteria 2170
75 Ga0070671_100189646 3300005355 Bacteria 1742
76 Ga0070671_100233666 3300005355 Bacteria 1560
77 Ga0070671_100268030 3300005355 Bacteria 1451
78 Ga0070671_100313838 3300005355 Bacteria 1335
79 Ga0070671_100756143 3300005355 Bacteria 845
80 Ga0070674_100019990 3300005356 Bacteria 4267
81 Ga0070674_100036075 3300005356 Bacteria 3316
82 Ga0070674_100054491 3300005356 Bacteria 2766
83 Ga0070674_100061868 3300005356 Bacteria 2614
84 Ga0070674_100136079 3300005356 Bacteria 1838
85 Ga0070673_100012933 3300005364 Bacteria 5750
86 Ga0070673_100014182 3300005364 Bacteria 5539
87 Ga0070673_100049904 3300005364 Bacteria 3269
88 Ga0070673_100068785 3300005364 Bacteria 2836
89 Ga0070673_100106844 3300005364 Bacteria 2315
90 Ga0070673_100107138 3300005364 Bacteria 2311
91 Ga0070673_100466491 3300005364 Bacteria 1138
92 Ga0070688_100156585 3300005365 Bacteria 1561
93 Ga0070659_100039683 3300005366 Bacteria 3676
94 Ga0070659_100170292 3300005366 Bacteria 1783
95 Ga0070667_100005407 3300005367 Bacteria 10668
96 Ga0070667_100017232 3300005367 Bacteria 5984
97 Ga0070667_100075666 3300005367 Bacteria 2874
98 Ga0070667_100138856 3300005367 Bacteria 2126
99 Ga0070667_100227038 3300005367 Bacteria 1664
100 Ga0070667_100299990 3300005367 Bacteria 1446
101 Ga0070700_100605743 3300005441 Bacteria 859
102 Ga0070663_100096753 3300005455 Bacteria 2196
103 Ga0070663_100141142 3300005455 Bacteria 1839
104 Ga0070678_100000202 3300005456 Bacteria 26370
105 Ga0070678_100026125 3300005456 Bacteria 3942
106 Ga0070678_100144714 3300005456 Bacteria 1906
107 Ga0070678_100183127 3300005456 Bacteria 1716
108 Ga0070678_100212455 3300005456 Bacteria 1604
109 Ga0070678_100223703 3300005456 Bacteria 1565
110 Ga0070678_100229254 3300005456 Bacteria 1547
111 Ga0070678_100234822 3300005456 Bacteria 1530
112 Ga0070678_100259165 3300005456 Bacteria 1461
113 Ga0070678_100301155 3300005456 Bacteria 1362
114 Ga0070678_100334342 3300005456 Bacteria 1297
115 Ga0070662_100001238 3300005457 Bacteria 15666
116 Ga0070662_100045173 3300005457 Bacteria 3159
117 Ga0070662_100096187 3300005457 Bacteria 2234
118 Ga0070662_100157745 3300005457 Bacteria 1773
119 Ga0070662_100795813 3300005457 Bacteria 803
120 Ga0070681_10017210 3300005458 Bacteria 7227
121 Ga0068867_100000173 3300005459 Bacteria 42222
122 Ga0068867_100048156 3300005459 Bacteria 3135
123 Ga0068867_100280827 3300005459 Bacteria 1365
124 Ga0068867_100324007 3300005459 Bacteria 1277
125 Ga0068867_100491221 3300005459 Bacteria 1053
126 Ga0068867_100929104 3300005459 Bacteria 785
127 Ga0070679_100002880 3300005530 Bacteria 15636
128 Ga0070684_100225458 3300005535 Bacteria 1710
129 Ga0070684_100303343 3300005535 Bacteria 1466
130 Ga0070684_100448397 3300005535 Bacteria 1192
131 Ga0068853_100097511 3300005539 Bacteria 2595
132 Ga0068853_100183825 3300005539 Bacteria 1897
133 Ga0068853_100400553 3300005539 Bacteria 1284
134 Ga0068853_100674768 3300005539 Bacteria 985
135 Ga0068853_100736778 3300005539 Bacteria 941
136 Ga0070672_100008996 3300005543 Bacteria 6864
137 Ga0070672_100023210 3300005543 Bacteria 4569
138 Ga0070672_100035158 3300005543 Bacteria 3807
139 Ga0070672_100073201 3300005543 Bacteria 2730
140 Ga0070672_100076179 3300005543 Bacteria 2679
141 Ga0070672_100077866 3300005543 Bacteria 2652
142 Ga0070672_100155404 3300005543 Bacteria 1894
143 Ga0070672_100367461 3300005543 Bacteria 1229
144 Ga0070672_100456136 3300005543 Bacteria 1101
145 Ga0070693_100068866 3300005547 Bacteria 2078
146 Ga0070665_100220200 3300005548 Bacteria 1898
147 Ga0070665_100433462 3300005548 Bacteria 1324
148 Ga0070664_100037616 3300005564 Bacteria 4069
149 Ga0070664_100227913 3300005564 Bacteria 1669
150 Ga0070664_100297592 3300005564 Bacteria 1457
151 Ga0070664_100458131 3300005564 Bacteria 1171
152 Ga0070664_100581658 3300005564 Bacteria 1037
153 Ga0068857_100061915 3300005577 Bacteria 3325
154 Ga0068854_100099736 3300005578 Bacteria 2175
155 Ga0068854_100185117 3300005578 Bacteria 1629
156 Ga0068856_100104352 3300005614 Bacteria 2828
157 Ga0068856_100165071 3300005614 Bacteria 2225
158 Ga0068856_100802849 3300005614 Bacteria 961
159 Ga0068856_100823349 3300005614 Bacteria 948
160 Ga0070702_100201945 3300005615 Bacteria 1317
161 Ga0068852_100009055 3300005616 Bacteria 7370
162 Ga0068852_100010860 3300005616 Bacteria 6825
163 Ga0068852_100030071 3300005616 Bacteria 4467
164 Ga0068852_100031671 3300005616 Bacteria 4368
165 Ga0068852_100118587 3300005616 Bacteria 2418
166 Ga0068852_100137341 3300005616 Bacteria 2258
167 Ga0068852_100314359 3300005616 Bacteria 1519
168 Ga0068852_100339511 3300005616 Bacteria 1464
169 Ga0068852_100355595 3300005616 Bacteria 1431
170 Ga0068852_100688516 3300005616 Bacteria 1032
171 Ga0068859_100039942 3300005617 Bacteria 4709
172 Ga0068859_100136533 3300005617 Bacteria 2525
173 Ga0068859_100156913 3300005617 Bacteria 2353
174 Ga0068859_100753540 3300005617 Bacteria 1063
175 Ga0068864_100000365 3300005618 Bacteria 39562
176 Ga0068864_100002329 3300005618 Bacteria 15709
177 Ga0068864_100031123 3300005618 Bacteria 4526
178 Ga0068864_100045894 3300005618 Bacteria 3749
179 Ga0068864_100080467 3300005618 Bacteria 2854
180 Ga0068864_100283914 3300005618 Bacteria 1546
181 Ga0068864_100493069 3300005618 Bacteria 1177
182 Ga0068866_10012833 3300005718 Bacteria 3659
183 Ga0068866_10095036 3300005718 Bacteria 1632
184 Ga0068861_100416922 3300005719 Bacteria 1195
185 Ga0068851_10005284 3300005834 Bacteria 5859
186 Ga0068851_10122315 3300005834 Bacteria 1400
187 Ga0068851_10250998 3300005834 Bacteria 1003
188 Ga0068851_10259752 3300005834 Bacteria 988
189 Ga0068870_10165149 3300005840 Bacteria 1317
190 Ga0068870_10190663 3300005840 Bacteria 1237
191 Ga0068863_100025015 3300005841 Bacteria 5694
192 Ga0068863_100063605 3300005841 Bacteria 3489
193 Ga0068863_100114908 3300005841 Bacteria 2564
194 Ga0068863_100212996 3300005841 Bacteria 1860
195 Ga0068863_100236061 3300005841 Bacteria 1765
196 Ga0068863_100263291 3300005841 Bacteria 1667
197 Ga0068863_100269813 3300005841 Bacteria 1647
198 Ga0068863_100698719 3300005841 Bacteria 1008
199 Ga0068858_100001818 3300005842 Bacteria 21717
200 Ga0068858_100003428 3300005842 Bacteria 15754
201 Ga0068858_100003838 3300005842 Bacteria 14861
202 Ga0068858_100015579 3300005842 Bacteria 7151
203 Ga0068860_100004794 3300005843 Bacteria 13777
204 Ga0068860_100005517 3300005843 Bacteria 12805
205 Ga0068860_100093086 3300005843 Bacteria 2872
206 Ga0068862_100039223 3300005844 Bacteria 4021
207 Ga0068862_100093115 3300005844 Bacteria 2628
208 Ga0070717_10022058 3300006028 Bacteria 5027
209 Ga0075365_10005225 3300006038 Bacteria 6983
210 Ga0070715_10196619 3300006163 Bacteria 1022
211 Ga0075367_10029910 3300006178 Bacteria 3119
212 Ga0075366_10231906 3300006195 Bacteria 1125
213 Ga0075366_10301165 3300006195 Bacteria 981
214 Ga0097621_100016159 3300006237 Bacteria 5635
215 Ga0097621_100045361 3300006237 Bacteria 3550
216 Ga0097621_100364826 3300006237 Bacteria 1287
217 Ga0097621_100405989 3300006237 Bacteria 1220
218 Ga0097621_100739939 3300006237 Bacteria 908
219 Ga0068871_100085125 3300006358 Bacteria 2624
220 Ga0068871_100090430 3300006358 Bacteria 2549
221 Ga0068871_100261185 3300006358 Bacteria 1510
222 Ga0068871_100295490 3300006358 Bacteria 1420
223 Ga0068871_100332340 3300006358 Bacteria 1340
224 Ga0068865_100816976 3300006881 Bacteria 805
225 Ga0097620_100039942 3300006931 Bacteria 4709
226 Ga0097620_100136532 3300006931 Bacteria 2525
227 Ga0097620_100156918 3300006931 Bacteria 2353
228 Ga0097620_100753500 3300006931 Bacteria 1063
229 Ga0105240_10002543 3300009093 Bacteria 29256
230 Ga0105240_10160498 3300009093 Bacteria 2671
231 Ga0111539_10557317 3300009094 Bacteria 1335
232 Ga0111539_11910411 3300009094 Bacteria 688
233 Ga0105245_10042059 3300009098 Bacteria 4076
234 Ga0105245_10175268 3300009098 Bacteria 2045
235 Ga0105247_10520875 3300009101 Bacteria 869
236 Ga0105243_10003820 3300009148 Bacteria 12050
237 Ga0105243_10004042 3300009148 Bacteria 11682
238 Ga0105243_10916977 3300009148 Bacteria 873
239 Ga0105241_10369203 3300009174 Bacteria 1251
240 Ga0105241_10560425 3300009174 Bacteria 1027
241 Ga0105242_10073735 3300009176 Bacteria 2839
242 Ga0105242_10617790 3300009176 Bacteria 1049
243 Ga0105248_10020415 3300009177 Bacteria 7339
244 Ga0105248_10044593 3300009177 Bacteria 4973
245 Ga0105248_10109194 3300009177 Bacteria 3119
246 Ga0105248_10662727 3300009177 Bacteria 1177
247 Ga0105248_10672461 3300009177 Bacteria 1168
248 Ga0105248_11182908 3300009177 Bacteria 864
249 Ga0105237_10000518 3300009545 Bacteria 54382
250 Ga0105237_10221725 3300009545 Bacteria 1891
251 Ga0105238_10043782 3300009551 Bacteria 4528
252 Ga0105238_10175558 3300009551 Bacteria 2119
253 Ga0105238_10396108 3300009551 Bacteria 1373
254 Ga0105249_10005277 3300009553 Bacteria 11155
255 Ga0105249_10016583 3300009553 Bacteria 6537
256 Ga0105249_10213870 3300009553 Bacteria 1893
257 Ga0105249_10381685 3300009553 Bacteria 1435
258 Ga0105239_10000872 3300010375 Bacteria 42900
259 Ga0105239_10819287 3300010375 Bacteria 1067
260 Ga0105246_10717380 3300011119 Bacteria 878
261 Ga0157373_10437504 3300013100 Bacteria 940
262 Ga0157371_10057938 3300013102 Bacteria 2748
263 Ga0157370_10270238 3300013104 Bacteria 1571
264 Ga0157370_10707126 3300013104 Bacteria 920
265 Ga0157369_10032613 3300013105 Bacteria 5727
266 Ga0157374_10013203 3300013296 Bacteria 7205
267 Ga0157374_10060546 3300013296 Bacteria 3543
268 Ga0157374_10086510 3300013296 Bacteria 2982
269 Ga0157374_11141907 3300013296 Bacteria 800
270 Ga0157378_10185191 3300013297 Bacteria 1961
271 Ga0157378_10295745 3300013297 Bacteria 1565
272 Ga0163162_10020480 3300013306 Bacteria 6501
273 Ga0163162_10087946 3300013306 Bacteria 3186
274 Ga0163162_10322226 3300013306 Bacteria 1678
275 Ga0163162_10475759 3300013306 Bacteria 1380
276 Ga0163162_10677352 3300013306 Bacteria 1154
277 Ga0163162_10912745 3300013306 Bacteria 991
278 Ga0157372_10078073 3300013307 Bacteria 3741
279 Ga0157372_10253491 3300013307 Bacteria 2043
280 Ga0157372_10293460 3300013307 Bacteria 1891
281 Ga0157375_10027374 3300013308 Bacteria 5329
282 Ga0157375_10137302 3300013308 Bacteria 2570
283 Ga0157375_10149452 3300013308 Bacteria 2470
284 Ga0157375_10154362 3300013308 Bacteria 2434
285 Ga0157375_11398527 3300013308 Bacteria 824
286 Ga0163163_10007645 3300014325 Bacteria 9547
287 Ga0163163_10170102 3300014325 Bacteria 2226
288 Ga0157380_10015990 3300014326 Bacteria 5524
289 Ga0157380_10023234 3300014326 Bacteria 4675
290 Ga0157380_10030254 3300014326 Bacteria 4146
291 Ga0157380_10371249 3300014326 Bacteria 1346
292 Ga0157377_10000039 3300014745 Bacteria 112711
293 Ga0157377_10113708 3300014745 Bacteria 1630
294 Ga0157379_10047857 3300014968 Bacteria 3816
295 Ga0157379_10092877 3300014968 Bacteria 2707
296 Ga0157379_10154924 3300014968 Bacteria 2067
297 Ga0157376_10008913 3300014969 Bacteria 7263
298 Ga0157376_10009644 3300014969 Bacteria 7025
299 Ga0157376_11573919 3300014969 Bacteria 691
300 Ga0163161_10027098 3300017792 Bacteria 4064
301 Ga0163161_10350265 3300017792 Bacteria 1174
302 Ga0163161_10365361 3300017792 Bacteria 1150
303 Ga0163161_10619960 3300017792 Bacteria 894
304 Ga0207425_1000062 3300025245 Bacteria 136118
305 Ga0209677_100960 3300025253 Bacteria 14017
306 Ga0209565_1000622 3300025263 Bacteria 23367
307 Ga0209565_1000784 3300025263 Bacteria 18444
308 Ga0209565_1001080 3300025263 Bacteria 13621
309 Ga0209565_1031342 3300025263 Bacteria 1033
310 Ga0207666_1009379 3300025271 Bacteria 1322
311 Ga0209130_1001152 3300025284 Bacteria 19177
312 Ga0209130_1007249 3300025284 Bacteria 3455
313 Ga0209130_1025357 3300025284 Bacteria 1285
314 Ga0209675_1000280 3300025291 Bacteria 48644
315 Ga0209564_1001080 3300025295 Bacteria 32728
316 Ga0209050_1000064 3300025298 Bacteria 314803
317 Ga0209050_1001144 3300025298 Bacteria 31864
318 Ga0209256_1000507 3300025299 Bacteria 57359
319 Ga0209256_1001972 3300025299 Bacteria 18495
320 Ga0207426_1001027 3300025302 Bacteria 26714
321 Ga0209051_1031078 3300025303 Bacteria 2060
322 Ga0209257_1000010 3300025304 Bacteria 1158682
323 Ga0209257_1003990 3300025304 Bacteria 11915
324 Ga0207697_10042417 3300025315 Bacteria 1869
325 Ga0207656_10023503 3300025321 Bacteria 2483
326 Ga0207656_10072122 3300025321 Bacteria 1537
327 Ga0207656_10117927 3300025321 Bacteria 1233
328 Ga0207656_10150588 3300025321 Bacteria 1101
329 Ga0207656_10167946 3300025321 Bacteria 1047
330 Ga0207656_10200423 3300025321 Bacteria 964
331 Ga0207682_10007351 3300025893 Bacteria 4393
332 Ga0207682_10053057 3300025893 Bacteria 1681
333 Ga0207682_10053985 3300025893 Bacteria 1668
334 Ga0207642_10014634 3300025899 Bacteria 2900
335 Ga0207642_10130694 3300025899 Bacteria 1310
336 Ga0207688_10172200 3300025901 Bacteria 1288
337 Ga0207688_10319948 3300025901 Bacteria 952
338 Ga0207688_10436710 3300025901 Bacteria 815
339 Ga0207688_10480137 3300025901 Bacteria 777
340 Ga0207680_10019580 3300025903 Bacteria 3622
341 Ga0207680_10051951 3300025903 Bacteria 2453
342 Ga0207680_10273463 3300025903 Bacteria 1172
343 Ga0207685_10153763 3300025905 Bacteria 1044
344 Ga0207645_10016617 3300025907 Bacteria 4868
345 Ga0207645_10025026 3300025907 Bacteria 3865
346 Ga0207645_10039259 3300025907 Bacteria 3034
347 Ga0207645_10093958 3300025907 Bacteria 1930
348 Ga0207645_10118016 3300025907 Bacteria 1721
349 Ga0207643_10308284 3300025908 Bacteria 986
350 Ga0207705_10333928 3300025909 Bacteria 1166
351 Ga0207695_10006571 3300025913 Bacteria 15047
352 Ga0207695_10142141 3300025913 Bacteria 2347
353 Ga0207671_10003492 3300025914 Bacteria 15626
354 Ga0207671_10291669 3300025914 Bacteria 1288
355 Ga0207660_10185183 3300025917 Bacteria 1619
356 Ga0207662_10186112 3300025918 Bacteria 1338
357 Ga0207662_10267713 3300025918 Bacteria 1127
358 Ga0207657_10227937 3300025919 Bacteria 1491
359 Ga0207657_10333922 3300025919 Bacteria 1197
360 Ga0207649_10138295 3300025920 Bacteria 1663
361 Ga0207649_10216079 3300025920 Bacteria 1363
362 Ga0207652_10295525 3300025921 Bacteria 1462
363 Ga0207681_10032608 3300025923 Bacteria 3412
364 Ga0207681_10071671 3300025923 Bacteria 2417
365 Ga0207681_10445708 3300025923 Bacteria 1052
366 Ga0207694_10019086 3300025924 Bacteria 5182
367 Ga0207694_10278913 3300025924 Bacteria 1372
368 Ga0207650_10027735 3300025925 Bacteria 4055
369 Ga0207650_10035349 3300025925 Bacteria 3627
370 Ga0207650_10133863 3300025925 Bacteria 1942
371 Ga0207650_10153958 3300025925 Bacteria 1817
372 Ga0207650_10187506 3300025925 Bacteria 1651
373 Ga0207650_10384649 3300025925 Bacteria 1159
374 Ga0207659_10003336 3300025926 Bacteria 9629
375 Ga0207659_10010543 3300025926 Bacteria 5810
376 Ga0207659_10015331 3300025926 Bacteria 4961
377 Ga0207659_10036615 3300025926 Bacteria 3401
378 Ga0207659_10162050 3300025926 Bacteria 1757
379 Ga0207659_10310924 3300025926 Bacteria 1297
380 Ga0207659_10462700 3300025926 Bacteria 1070
381 Ga0207659_10580292 3300025926 Bacteria 955
382 Ga0207687_10034140 3300025927 Bacteria 3453
383 Ga0207687_10236079 3300025927 Bacteria 1447
384 Ga0207644_10002949 3300025931 Bacteria 10959
385 Ga0207644_10027031 3300025931 Bacteria 3961
386 Ga0207644_10193967 3300025931 Bacteria 1598
387 Ga0207644_10289150 3300025931 Bacteria 1318
388 Ga0207644_10290172 3300025931 Bacteria 1315
389 Ga0207644_10437444 3300025931 Bacteria 1073
390 Ga0207690_10122483 3300025932 Bacteria 1891
391 Ga0207706_10001684 3300025933 Bacteria 21807
392 Ga0207706_10069224 3300025933 Bacteria 3104
393 Ga0207706_10162222 3300025933 Bacteria 1965
394 Ga0207706_10762093 3300025933 Bacteria 824
395 Ga0207706_11098358 3300025933 Bacteria 665
396 Ga0207686_10068989 3300025934 Bacteria 2267
397 Ga0207686_10075378 3300025934 Bacteria 2184
398 Ga0207686_10435447 3300025934 Bacteria 1006
399 Ga0207709_10008906 3300025935 Bacteria 5541
400 Ga0207709_10020258 3300025935 Bacteria 3750
401 Ga0207709_10280442 3300025935 Bacteria 1230
402 Ga0207669_10016052 3300025937 Bacteria 3794
403 Ga0207669_10027359 3300025937 Bacteria 3120
404 Ga0207669_10389288 3300025937 Bacteria 1088
405 Ga0207704_10008539 3300025938 Bacteria 4905
406 Ga0207665_10058372 3300025939 Bacteria 2609
407 Ga0207691_10012960 3300025940 Bacteria 7984
408 Ga0207691_10024676 3300025940 Bacteria 5654
409 Ga0207691_10056925 3300025940 Bacteria 3560
410 Ga0207691_10058182 3300025940 Bacteria 3516
411 Ga0207691_10127924 3300025940 Bacteria 2246
412 Ga0207691_10372729 3300025940 Bacteria 1219
413 Ga0207691_10519804 3300025940 Bacteria 1010
414 Ga0207711_10100667 3300025941 Bacteria 2556
415 Ga0207711_10189956 3300025941 Bacteria 1871
416 Ga0207711_10290181 3300025941 Bacteria 1508
417 Ga0207711_10341131 3300025941 Bacteria 1387
418 Ga0207711_10469663 3300025941 Bacteria 1172
419 Ga0207711_11238177 3300025941 Bacteria 688
420 Ga0207689_10000716 3300025942 Bacteria 31758
421 Ga0207689_10002900 3300025942 Bacteria 15822
422 Ga0207689_10069792 3300025942 Bacteria 2887
423 Ga0207661_10026334 3300025944 Bacteria 4429
424 Ga0207679_10200857 3300025945 Bacteria 1665
425 Ga0207679_10369217 3300025945 Bacteria 1255
426 Ga0207679_10488097 3300025945 Bacteria 1098
427 Ga0207679_11275709 3300025945 Bacteria 674
428 Ga0207667_10193259 3300025949 Bacteria 2088
429 Ga0207667_10590591 3300025949 Bacteria 1120
430 Ga0207651_10007527 3300025960 Bacteria 5807
431 Ga0207651_10051280 3300025960 Bacteria 2806
432 Ga0207651_10109031 3300025960 Bacteria 2073
433 Ga0207651_10329320 3300025960 Bacteria 1279
434 Ga0207651_10475087 3300025960 Bacteria 1076
435 Ga0207712_10034313 3300025961 Bacteria 3438
436 Ga0207668_10047946 3300025972 Bacteria 2928
437 Ga0207668_10473502 3300025972 Bacteria 1073
438 Ga0207668_10573537 3300025972 Bacteria 980
439 Ga0207640_10090295 3300025981 Bacteria 2120
440 Ga0207640_10148017 3300025981 Bacteria 1721
441 Ga0207640_10328349 3300025981 Bacteria 1221
442 Ga0207658_10002511 3300025986 Bacteria 13353
443 Ga0207658_10023668 3300025986 Bacteria 4289
444 Ga0207658_10247099 3300025986 Bacteria 1514
445 Ga0207658_10435704 3300025986 Bacteria 1158
446 Ga0207658_10736009 3300025986 Bacteria 892
447 Ga0207677_10000452 3300026023 Bacteria 27626
448 Ga0207677_10020176 3300026023 Bacteria 4042
449 Ga0207677_10087762 3300026023 Bacteria 2253
450 Ga0207677_10219806 3300026023 Bacteria 1523
451 Ga0207677_10450333 3300026023 Bacteria 1103
452 Ga0207677_10950080 3300026023 Bacteria 777
453 Ga0207703_10003257 3300026035 Bacteria 13652
454 Ga0207703_10003262 3300026035 Bacteria 13624
455 Ga0207703_10089492 3300026035 Bacteria 2585
456 Ga0207639_10103265 3300026041 Bacteria 2309
457 Ga0207639_10370436 3300026041 Bacteria 1284
458 Ga0207639_10560087 3300026041 Bacteria 1050
459 Ga0207639_10623268 3300026041 Bacteria 996
460 Ga0207639_10751365 3300026041 Bacteria 907
461 Ga0207678_10008265 3300026067 Bacteria 9170
462 Ga0207678_10042827 3300026067 Bacteria 3920
463 Ga0207678_10437544 3300026067 Bacteria 1135
464 Ga0207702_10017145 3300026078 Bacteria 5991
465 Ga0207702_11202452 3300026078 Bacteria 752
466 Ga0207641_10000923 3300026088 Bacteria 30321
467 Ga0207641_10067624 3300026088 Bacteria 3061
468 Ga0207641_10557982 3300026088 Bacteria 1117
469 Ga0207641_10938236 3300026088 Bacteria 860
470 Ga0207648_10000836 3300026089 Bacteria 34689
471 Ga0207648_10063633 3300026089 Bacteria 3215
472 Ga0207648_10124501 3300026089 Bacteria 2267
473 Ga0207648_10278432 3300026089 Bacteria 1496
474 Ga0207648_10402916 3300026089 Bacteria 1240
475 Ga0207648_10928640 3300026089 Bacteria 814
476 Ga0207676_10004605 3300026095 Bacteria 9766
477 Ga0207676_10027490 3300026095 Bacteria 4237
478 Ga0207676_10028475 3300026095 Bacteria 4173
479 Ga0207676_10111006 3300026095 Bacteria 2294
480 Ga0207676_10189822 3300026095 Bacteria 1807
481 Ga0207676_10448793 3300026095 Bacteria 1215
482 Ga0207676_10620848 3300026095 Bacteria 1040
483 Ga0207674_10093330 3300026116 Bacteria 2998
484 Ga0207675_100024123 3300026118 Bacteria 5655
485 Ga0207675_100043887 3300026118 Bacteria 4176
486 Ga0207675_100772423 3300026118 Bacteria 973
487 Ga0207683_10001865 3300026121 Bacteria 18641
488 Ga0207683_10024876 3300026121 Bacteria 5160
489 Ga0207683_10028889 3300026121 Bacteria 4798
490 Ga0207683_10052952 3300026121 Bacteria 3557
491 Ga0207683_10157193 3300026121 Bacteria 2054
492 Ga0207683_10230223 3300026121 Bacteria 1690
493 Ga0207683_10238480 3300026121 Bacteria 1659
494 Ga0207683_10355924 3300026121 Bacteria 1344
495 Ga0207683_10398368 3300026121 Bacteria 1266
496 Ga0207683_10651174 3300026121 Bacteria 976
497 Ga0207683_10685541 3300026121 Bacteria 950
498 Ga0207698_10017502 3300026142 Bacteria 4865
499 Ga0207698_10047999 3300026142 Bacteria 3239
500 Ga0207698_10048420 3300026142 Bacteria 3227
501 Ga0207698_10059428 3300026142 Bacteria 2968
502 Ga0207698_10078152 3300026142 Bacteria 2656
503 Ga0207698_10152078 3300026142 Bacteria 2010
504 Ga0207698_10278503 3300026142 Bacteria 1546
505 Ga0207698_10680206 3300026142 Bacteria 1022
506 Ga0207698_10976148 3300026142 Bacteria 857
507 Ga0268266_10270974 3300028379 Bacteria 1576
508 Ga0268265_10522666 3300028380 Bacteria 1122
509 Ga0268264_10052499 3300028381 Bacteria 3399
510 Ga0268264_10071675 3300028381 Bacteria 2936
511 Ga0268264_10373113 3300028381 Bacteria 1364
512 Ga0307515_10000030 3300028794 Bacteria 364482
513 Ga0307515_10000221 3300028794 Bacteria 141099
514 Ga0307515_10000777 3300028794 Bacteria 73454
515 Ga0307515_10018037 3300028794 Bacteria 12810
516 Ga0265324_10081879 3300029957 Bacteria 1098
517 Ga0307512_10017030 3300030522 Bacteria 6686
518 Ga0307513_10023763 3300031456 Bacteria 7152
519 Ga0307408_100002803 3300031548 Bacteria 12100
520 Ga0307408_100015501 3300031548 Bacteria 5075
521 Ga0307408_100217674 3300031548 Bacteria 1556
522 Ga0307408_100345150 3300031548 Bacteria 1261
523 Ga0307408_100477666 3300031548 Bacteria 1087
524 Ga0307508_10000141 3300031616 Bacteria 85739
525 Ga0307514_10065597 3300031649 Bacteria 2749
526 Ga0307516_10004531 3300031730 Bacteria 17090
527 Ga0307405_10011385 3300031731 Bacteria 4659
528 Ga0307405_10166719 3300031731 Bacteria 1566
529 Ga0307410_10735064 3300031852 Bacteria 834
530 Ga0307406_10022936 3300031901 Bacteria 3708
531 Ga0307406_10836344 3300031901 Bacteria 779
532 Ga0307407_10120706 3300031903 Bacteria 1661
533 Ga0307412_10003513 3300031911 Bacteria 8711
534 Ga0307412_10095690 3300031911 Bacteria 2088
535 Ga0307409_100025456 3300031995 Bacteria 4151
536 Ga0307409_100869257 3300031995 Bacteria 913
537 Ga0307416_100000974 3300032002 Bacteria 15139
538 Ga0307416_100234092 3300032002 Bacteria 1773
539 Ga0307416_100309525 3300032002 Bacteria 1575
540 Ga0307414_10364022 3300032004 Bacteria 1245
541 Ga0307411_10094900 3300032005 Bacteria 2092
542 Ga0307415_100001962 3300032126 Bacteria 10127
543 Ga0307415_100551641 3300032126 Bacteria 1017
544 Ga0307510_10448412 3300033180 Bacteria 731
545 Ga0373938_0040326 3300034957 Bacteria 1035
546 Ga0373949_0035444 3300035090 Bacteria 1207
547 Ga0373936_0183358 3300035113 Bacteria 919
548 Ga0373931_0003594 3300035691 Bacteria 6996
549 Ga0373931_0262860 3300035691 Bacteria 1054
550 Ga0373927_0123237 3300035695 Bacteria 1692
551 Ga0373937_0037185 3300036401 Bacteria 4436
552 Ga0373925_0170979 3300037068 Bacteria 1716
553 Ga0373925_0253853 3300037068 Bacteria 1411
554 Ga0373925_0672663 3300037068 Bacteria 853
555 Ga0395900_0185157 3300037418 Bacteria 2114
556 Ga0395900_0746435 3300037418 Bacteria 909
557 Ga0395898_0020437 3300037466 Bacteria 6724
558 Ga0395905_0370157 3300037471 Bacteria 1326
559 Ga0395905_1185220 3300037471 Bacteria 667
560 Ga0436364_0571710 3300037853 Bacteria 4996
561 Ga0395901_0158225 3300038443 Bacteria 2379
562 Ga0395901_0381368 3300038443 Bacteria 1451
563 Ga0436365_0482375 3300039437 Bacteria 7514
564 Ga0436363_0390454 3300039450 Bacteria 2045
565 Ga0451793_1915431 3300041452 Bacteria 1668
566 Ga0451797_0142736 3300041453 Bacteria 907
567 Ga0451802_0933167 3300041460 Bacteria 995
568 Ga0451835_0346031 3300041492 Bacteria 879
569 Ga0451837_1554540 3300041494 Bacteria 953
570 Ga0451839_0874313 3300041496 Bacteria 1455
571 Ga0451841_0821959 3300041498 Bacteria 1130
572 Ga0451843_0875436 3300041509 Bacteria 1223
573 Ga0451853_0591653 3300041512 Bacteria 1143
574 Ga0451853_2839646 3300041512 Bacteria 915
575 Ga0439464_0006066 3300042439 Bacteria 3141
576 Ga0451577_0609327 3300042876 Bacteria 991
577 Ga0466972_0029464 3300044658 Bacteria 2702
578 Ga0466965_0019972 3300044683 Bacteria 3217
579 Ga0466961_0135700 3300044693 Bacteria 1542
580 Ga0466963_0253382 3300044694 Bacteria 1235
581 Ga0466964_0000831 3300044706 Bacteria 10096
582 Ga0466964_0046940 3300044706 Bacteria 1761
583 Ga0453684_0746774 3300044712 Bacteria 1059
584 Ga0466968_0005379 3300044735 Bacteria 4791
585 Ga0466970_0411913 3300044765 Bacteria 772
586 Ga0466957_0119546 3300044842 Bacteria 1678
587 Ga0466957_0246141 3300044842 Bacteria 1187
588 Ga0466957_0463066 3300044842 Unclassified 875
589 Ga0466960_0256749 3300044901 Bacteria 972
590 Ga0451576_0553615 3300045051 Bacteria 1208
591 Ga0451576_1410206 3300045051 Bacteria 725
592 Ga0466958_0391881 3300045836 Bacteria 896
593 Ga0466967_0011043 3300045976 Bacteria 6815
594 Ga0495617_000002 3300046452 Bacteria 710121
595 Ga0495627_000176 3300046453 Bacteria 72651
596 Ga0495627_005973 3300046453 Bacteria 4835
597 Ga0495603_0235314 3300046455 Bacteria 1055
598 Ga0495603_0426942 3300046455 Bacteria 759
599 Ga0495590_0025210 3300046457 Bacteria 2091
600 Ga0495591_061640 3300046458 Bacteria 995
601 Ga0495629_0021875 3300046459 Bacteria 4563
602 Ga0495629_0026938 3300046459 Bacteria 4083
603 Ga0495629_0515712 3300046459 Bacteria 805
604 Ga0495629_0548413 3300046459 Bacteria 776
605 Ga0495638_0006104 3300046460 Bacteria 8820
606 Ga0495638_0100621 3300046460 Bacteria 1729
607 Ga0495638_0280710 3300046460 Bacteria 905
608 Ga0495653_0099895 3300046463 Bacteria 2104
609 Ga0495580_0479193 3300046472 Bacteria 832
610 Ga0495582_0049455 3300046473 Bacteria 2315
611 Ga0495582_0332348 3300046473 Bacteria 875
612 Ga0495582_0346806 3300046473 Bacteria 855
613 Ga0495605_0000081 3300046474 Bacteria 125302
614 Ga0495605_0000087 3300046474 Bacteria 120256
615 Ga0495605_0014951 3300046474 Bacteria 4232
616 Ga0495605_0054408 3300046474 Bacteria 1938
617 Ga0495605_0054970 3300046474 Bacteria 1925
618 Ga0495605_0096507 3300046474 Bacteria 1363
619 Ga0495639_0119233 3300046475 Bacteria 1258
620 Ga0495664_0135482 3300046477 Bacteria 1492
621 Ga0495664_0470154 3300046477 Bacteria 752
622 Ga0495584_0003309 3300046491 Bacteria 8932
623 Ga0495584_0006863 3300046491 Bacteria 5951
624 Ga0495584_0011832 3300046491 Bacteria 4461
625 Ga0495584_0029616 3300046491 Bacteria 2775
626 Ga0495584_0136281 3300046491 Bacteria 1246
627 Ga0495584_0310848 3300046491 Bacteria 800
628 Ga0495585_0000863 3300046492 Bacteria 25902
629 Ga0495585_0008523 3300046492 Bacteria 6211
630 Ga0495585_0034137 3300046492 Bacteria 2876
631 Ga0495585_0066082 3300046492 Bacteria 1980
632 Ga0495585_0069942 3300046492 Bacteria 1915
633 Ga0495594_0000705 3300046499 Bacteria 17186
634 Ga0495594_0125810 3300046499 Bacteria 1450
635 Ga0495594_0176021 3300046499 Bacteria 1217
636 Ga0495594_0191108 3300046499 Bacteria 1166
637 Ga0495596_0001008 3300046500 Bacteria 16758
638 Ga0495596_0029285 3300046500 Bacteria 2208
639 Ga0495596_0044436 3300046500 Bacteria 1748
640 Ga0495596_0048861 3300046500 Bacteria 1659
641 Ga0495596_0061065 3300046500 Bacteria 1468
642 Ga0495596_0102603 3300046500 Bacteria 1111
643 Ga0495607_0015258 3300046501 Bacteria 4981
644 Ga0495607_0063518 3300046501 Bacteria 2088
645 Ga0495583_0000193 3300046506 Bacteria 101909
646 Ga0495583_0000430 3300046506 Bacteria 63194
647 Ga0495583_0025803 3300046506 Bacteria 2929
648 Ga0495583_0049210 3300046506 Bacteria 1931
649 Ga0495583_0053809 3300046506 Bacteria 1825
650 Ga0495583_0066555 3300046506 Bacteria 1593
651 Ga0495583_0079437 3300046506 Bacteria 1427
652 Ga0495583_0109368 3300046506 Bacteria 1172
653 Ga0495583_0149583 3300046506 Bacteria 968
654 Ga0495583_0209902 3300046506 Bacteria 789
655 Ga0495606_0000007 3300046507 Bacteria 323713
656 Ga0495606_0006338 3300046507 Bacteria 10944
657 Ga0495606_0168583 3300046507 Bacteria 1272
658 Ga0495610_0295824 3300046512 Bacteria 626
659 Ga0495616_0003775 3300046513 Bacteria 9662
660 Ga0495616_0006247 3300046513 Bacteria 7238
661 Ga0495616_0011606 3300046513 Bacteria 5040
662 Ga0495616_0026665 3300046513 Bacteria 3072
663 Ga0495616_0057859 3300046513 Bacteria 1910
664 Ga0495616_0078089 3300046513 Bacteria 1588
665 Ga0495616_0146406 3300046513 Bacteria 1071
666 Ga0495630_0408456 3300046517 Bacteria 1040
667 Ga0495631_0001768 3300046518 Bacteria 12802
668 Ga0495631_0047270 3300046518 Bacteria 1890
669 Ga0495631_0058851 3300046518 Bacteria 1670
670 Ga0495631_0078768 3300046518 Bacteria 1422
671 Ga0495631_0080287 3300046518 Bacteria 1407
672 Ga0495631_0091013 3300046518 Bacteria 1313
673 Ga0495631_0233025 3300046518 Bacteria 785
674 Ga0495632_0000114 3300046519 Bacteria 82098
675 Ga0495643_0026010 3300046522 Bacteria 3307
676 Ga0495643_0122658 3300046522 Bacteria 1311
677 Ga0495643_0162344 3300046522 Bacteria 1098
678 Ga0495644_0024432 3300046523 Bacteria 2298
679 Ga0495644_0174579 3300046523 Bacteria 825
680 Ga0495644_0199043 3300046523 Bacteria 772
681 Ga0495648_0003099 3300046524 Bacteria 14837
682 Ga0495648_0018117 3300046524 Bacteria 5005
683 Ga0495648_0104611 3300046524 Bacteria 1554
684 Ga0495663_0017699 3300046525 Bacteria 2025
685 Ga0495663_0026350 3300046525 Bacteria 1701
686 Ga0495666_0024048 3300046526 Bacteria 3012
687 Ga0495666_0051039 3300046526 Bacteria 1987
688 Ga0495666_0104105 3300046526 Bacteria 1336
689 Ga0495666_0216858 3300046526 Bacteria 877
690 Ga0495642_0000813 3300046528 Bacteria 15134
691 Ga0495642_0002336 3300046528 Bacteria 7736
692 Ga0495642_0063087 3300046528 Bacteria 1539
693 Ga0495642_0086695 3300046528 Bacteria 1322
694 Ga0495642_0092047 3300046528 Bacteria 1284
695 Ga0495642_0117604 3300046528 Bacteria 1139
696 Ga0495642_0119825 3300046528 Bacteria 1129
697 Ga0495642_0142181 3300046528 Bacteria 1036
698 Ga0495642_0146022 3300046528 Bacteria 1022
699 Ga0495642_0243901 3300046528 Bacteria 785
700 Ga0495654_0009914 3300046530 Bacteria 5207
701 Ga0495654_0027808 3300046530 Bacteria 2894
702 Ga0495654_0065381 3300046530 Bacteria 1736
703 Ga0495665_0024195 3300046531 Bacteria 3262
704 Ga0495665_0025475 3300046531 Bacteria 3177
705 Ga0495586_0130831 3300046535 Bacteria 1405
706 Ga0495587_0024560 3300046536 Bacteria 3691
707 Ga0495587_0092009 3300046536 Bacteria 1751
708 Ga0495609_0000096 3300046538 Bacteria 104135
709 Ga0495609_0005065 3300046538 Bacteria 7029
710 Ga0495609_0012026 3300046538 Bacteria 4108
711 Ga0495609_0063112 3300046538 Bacteria 1635
712 Ga0495609_0065576 3300046538 Bacteria 1600
713 Ga0495609_0074786 3300046538 Bacteria 1485
714 Ga0495609_0108656 3300046538 Bacteria 1198
715 Ga0495621_0186868 3300046539 Bacteria 829
716 Ga0495597_0000587 3300046542 Bacteria 30136
717 Ga0495597_0001219 3300046542 Bacteria 19132
718 Ga0495597_0002540 3300046542 Bacteria 11448
719 Ga0495597_0004426 3300046542 Bacteria 7720
720 Ga0495597_0039253 3300046542 Bacteria 2120
721 Ga0495597_0089115 3300046542 Bacteria 1311
722 Ga0495597_0090044 3300046542 Bacteria 1303
723 Ga0495645_0047563 3300046543 Bacteria 3125
724 Ga0495622_0005476 3300046557 Bacteria 5888
725 Ga0495622_0051667 3300046557 Bacteria 1906
726 Ga0495622_0108102 3300046557 Bacteria 1274
727 Ga0495622_0111001 3300046557 Bacteria 1255
728 Ga0495622_0229086 3300046557 Bacteria 821
729 Ga0495633_0062569 3300046558 Bacteria 1742
730 Ga0495633_0070876 3300046558 Bacteria 1626
731 Ga0495633_0123615 3300046558 Bacteria 1198
732 Ga0495633_0180395 3300046558 Bacteria 972
733 Ga0495633_0213343 3300046558 Bacteria 884
734 Ga0495667_0034780 3300046559 Bacteria 3369
735 Ga0495667_0314618 3300046559 Bacteria 991
736 Ga0495656_0064993 3300046615 Bacteria 1603
737 Ga0495656_0070245 3300046615 Bacteria 1553
738 Ga0495656_0107791 3300046615 Bacteria 1298
739 Ga0495656_0144600 3300046615 Bacteria 1143
740 Ga0495656_0493761 3300046615 Bacteria 649
741 Ga0495668_0002567 3300046616 Bacteria 14753
742 Ga0495668_0011047 3300046616 Bacteria 5429
743 Ga0495668_0013816 3300046616 Bacteria 4749
744 Ga0495668_0065700 3300046616 Bacteria 1996
745 Ga0495668_0126435 3300046616 Bacteria 1399
746 Ga0495668_0321688 3300046616 Bacteria 848
747 Ga0495634_0029421 3300046642 Bacteria 3803
748 Ga0495634_0228698 3300046642 Bacteria 1145
749 Ga0495611_0080114 3300046648 Bacteria 1500
750 Ga0495625_0002044 3300046660 Bacteria 22688
751 Ga0495625_0004537 3300046660 Bacteria 13086
752 Ga0495625_0032111 3300046660 Bacteria 3898
753 Ga0495625_0050417 3300046660 Bacteria 2987
754 Ga0495625_0053275 3300046660 Bacteria 2895
755 Ga0495625_0140040 3300046660 Bacteria 1632
756 Ga0495625_0189381 3300046660 Bacteria 1364
757 Ga0495625_0251042 3300046660 Bacteria 1148
758 Ga0495625_0254657 3300046660 Bacteria 1138
759 Ga0495661_0000164 3300046665 Bacteria 78742
760 Ga0495661_0014211 3300046665 Bacteria 5334
761 Ga0495661_0073293 3300046665 Bacteria 1995
762 Ga0495661_0104944 3300046665 Bacteria 1583
763 Ga0495661_0115739 3300046665 Bacteria 1488
764 Ga0495661_0184710 3300046665 Bacteria 1102
765 Ga0495661_0209534 3300046665 Bacteria 1015
766 Ga0495588_0083822 3300046674 Bacteria 1665
767 Ga0495588_0097659 3300046674 Bacteria 1541
768 Ga0495588_0129583 3300046674 Bacteria 1330
769 Ga0495588_0238769 3300046674 Bacteria 958
770 Ga0495588_0240112 3300046674 Bacteria 956
771 Ga0495588_0271647 3300046674 Bacteria 893
772 Ga0495588_0333912 3300046674 Bacteria 797
773 Ga0495623_0016009 3300046679 Bacteria 4846
774 Ga0495623_0142294 3300046679 Bacteria 1425
775 Ga0495623_0152455 3300046679 Bacteria 1365
776 Ga0495647_0016669 3300046681 Bacteria 2590
777 Ga0495647_0196924 3300046681 Bacteria 882
778 Ga0495647_0341001 3300046681 Bacteria 681
779 Ga0495658_0062960 3300046683 Bacteria 2133
780 Ga0495658_0274740 3300046683 Bacteria 1062
781 Ga0495669_0087744 3300046684 Bacteria 1434
782 Ga0495669_0375936 3300046684 Bacteria 687
783 Ga0495613_0138776 3300046689 Bacteria 1738
784 Ga0495613_0199300 3300046689 Bacteria 1412
785 Ga0495613_0516790 3300046689 Bacteria 802
786 Ga0495624_0045126 3300046690 Bacteria 2807
787 Ga0495670_0000604 3300046691 Bacteria 17142
788 Ga0495670_0048641 3300046691 Bacteria 2121
789 Ga0495670_0053624 3300046691 Bacteria 2019
790 Ga0495670_0182906 3300046691 Bacteria 1107
791 Ga0495670_0191468 3300046691 Bacteria 1081
792 Ga0495670_0268326 3300046691 Bacteria 911
793 Ga0495671_0000132 3300046692 Bacteria 67269
794 Ga0495671_0060264 3300046692 Bacteria 1874
795 Ga0495671_0064536 3300046692 Bacteria 1802
796 Ga0495671_0069041 3300046692 Bacteria 1737
797 Ga0495671_0079020 3300046692 Bacteria 1612
798 Ga0495671_0206591 3300046692 Bacteria 952
799 Ga0495649_0073170 3300046694 Bacteria 1836
800 Ga0495649_0098126 3300046694 Bacteria 1558
801 Ga0495649_0172010 3300046694 Bacteria 1133
802 Ga0495589_0000036 3300046794 Bacteria 153299
803 Ga0495589_0000092 3300046794 Bacteria 85372
804 Ga0495589_0001941 3300046794 Bacteria 11711
805 Ga0495589_0047793 3300046794 Bacteria 2119
806 Ga0495589_0083531 3300046794 Bacteria 1552
807 Ga0495600_0026732 3300046809 Bacteria 3726
808 Ga0495600_0550314 3300046809 Bacteria 705
809 Ga0495660_0000117 3300046810 Bacteria 85237
810 Ga0495660_0017138 3300046810 Bacteria 4172
811 Ga0495660_0020826 3300046810 Bacteria 3759
812 Ga0495660_0045575 3300046810 Bacteria 2406
813 Ga0495660_0079012 3300046810 Bacteria 1728
814 Ga0495660_0098586 3300046810 Bacteria 1507
815 Ga0495581_0024612 3300047315 Bacteria 3489
816 Ga0495581_0572309 3300047315 Bacteria 655
817 Ga0495604_0045073 3300047317 Bacteria 3442
818 Ga0495636_0015815 3300047318 Bacteria 3008
819 Ga0495674_0003022 3300047319 Bacteria 16376
820 Ga0495674_0585921 3300047319 Bacteria 885
821 Ga0495672_0000014 3300047320 Bacteria 505636
822 Ga0495672_0002183 3300047320 Bacteria 18230
823 Ga0495672_0003253 3300047320 Bacteria 14086
824 Ga0495676_0007223 3300047321 Bacteria 10188
825 Ga0495676_0009421 3300047321 Bacteria 8894
826 Ga0495676_0070247 3300047321 Bacteria 2698
827 Ga0495676_0242968 3300047321 Bacteria 1232
828 Ga0495683_0000576 3300047323 Bacteria 27760
829 Ga0495683_0007830 3300047323 Bacteria 5732
830 Ga0495683_0019300 3300047323 Bacteria 3519
831 Ga0495683_0058853 3300047323 Bacteria 1907
832 Ga0495687_000074 3300047443 Bacteria 153464
833 Ga0495687_000154 3300047443 Bacteria 104740
834 Ga0495687_002852 3300047443 Bacteria 13266
835 Ga0495687_003354 3300047443 Bacteria 11695
836 Ga0495687_167915 3300047443 Bacteria 730
837 Ga0495675_0065424 3300047444 Bacteria 2299
838 Ga0495675_0133443 3300047444 Bacteria 1542
839 Ga0495677_0000037 3300047445 Bacteria 78595
840 Ga0495677_0033630 3300047445 Bacteria 1868
841 Ga0495677_0105433 3300047445 Bacteria 1069
842 Ga0495679_038807 3300047446 Bacteria 1489
843 Ga0495685_016157 3300047447 Bacteria 2549
844 Ga0495685_039220 3300047447 Bacteria 1621
845 Ga0495681_0006668 3300047470 Bacteria 7539
846 Ga0495681_0017803 3300047470 Bacteria 3933
847 Ga0495681_0061861 3300047470 Bacteria 1723
848 Ga0495686_0001832 3300047472 Bacteria 21386
849 Ga0495686_0002933 3300047472 Bacteria 15278
850 Ga0495686_0050546 3300047472 Bacteria 2612
851 Ga0495686_0109922 3300047472 Bacteria 1654
852 Ga0495686_0178256 3300047472 Bacteria 1232
853 Ga0495593_0056294 3300047673 Bacteria 2067
854 Ga0495602_0033019 3300048088 Bacteria 4863
855 Ga0495602_0170594 3300048088 Bacteria 1689
856 Ga0495615_0027467 3300048090 Bacteria 1336
857 Ga0495626_0000006 3300048091 Bacteria 284977
858 Ga0495626_0004153 3300048091 Bacteria 8994
859 Ga0495626_0044821 3300048091 Bacteria 2067
860 Ga0495626_0069047 3300048091 Bacteria 1592
861 Ga0495626_0147140 3300048091 Bacteria 995
862 Ga0496100_0032816 3300048903 Bacteria 3242
863 Ga0496100_0074915 3300048903 Bacteria 2268
864 Ga0496102_0021103 3300048905 Bacteria 5760
865 Ga0496102_0068969 3300048905 Bacteria 3245
866 Ga0496102_0416302 3300048905 Bacteria 1262
867 Ga0496103_0004341 3300048906 Bacteria 8609
868 Ga0496104_0296569 3300048907 Bacteria 1529
869 Ga0496104_1013963 3300048907 Bacteria 734
870 Ga0496105_0182079 3300048908 Bacteria 1720
871 Ga0496105_0555668 3300048908 Bacteria 895
872 Ga0496106_0004593 3300048909 Bacteria 10241
873 Ga0496107_0608226 3300048910 Bacteria 807
874 Ga0496108_0018843 3300048911 Bacteria 5659
875 Ga0496108_0070054 3300048911 Bacteria 2959
876 Ga0496108_0275744 3300048911 Bacteria 1464
877 Ga0496108_0675345 3300048911 Bacteria 897
878 Ga0496108_0800146 3300048911 Bacteria 813
879 Ga0496108_0858628 3300048911 Bacteria 781
880 Ga0496109_0008838 3300048912 Bacteria 8578
881 Ga0496109_0220311 3300048912 Bacteria 1784
882 Ga0496109_0255942 3300048912 Bacteria 1649
883 Ga0496109_0320416 3300048912 Bacteria 1463
884 Ga0496109_0787890 3300048912 Bacteria 889
885 Ga0496110_0004486 3300048913 Bacteria 10825
886 Ga0496110_0181810 3300048913 Bacteria 1909
887 Ga0496110_0194522 3300048913 Bacteria 1841
888 Ga0496110_0570245 3300048913 Bacteria 1028
889 Ga0496110_0673692 3300048913 Bacteria 935
890 Ga0496111_0130263 3300048914 Bacteria 1861
891 Ga0496111_0212296 3300048914 Bacteria 1438
892 Ga0496111_0273343 3300048914 Bacteria 1253
893 Ga0496112_0191825 3300048915 Bacteria 2005
894 Ga0496112_0268957 3300048915 Bacteria 1653
895 Ga0496113_0087315 3300048916 Bacteria 2398
896 Ga0496113_0158354 3300048916 Bacteria 1789
897 Ga0496113_0478026 3300048916 Bacteria 1001
898 Ga0496114_0669293 3300048917 Bacteria 912
899 Ga0496115_0107553 3300048918 Bacteria 2290
900 Ga0496115_0166792 3300048918 Bacteria 1821
901 Ga0496115_0246375 3300048918 Bacteria 1472
902 Ga0496122_0001315 3300048925 Bacteria 40732
903 Ga0496123_0000851 3300048926 Bacteria 48703
904 Ga0496124_0183530 3300048927 Bacteria 1608
905 Ga0496125_0002377 3300048928 Bacteria 24572
906 Ga0501304_008260 3300049160 Bacteria 874
907 Ga0495678_002660 3300049459 Bacteria 11833
908 Ga0495678_003327 3300049459 Bacteria 10017
909 Ga0495678_003585 3300049459 Bacteria 9486
910 Ga0495682_0000726 3300049460 Bacteria 21381
911 Ga0501198_000038 3300049649 Bacteria 51689
912 Ga0501222_000037 3300049662 Bacteria 51656
913 Ga0501035_0512448 3300049822 Bacteria 986
914 nmdc:mga03683_49370_c1 3300050489 Bacteria 1751
915 nmdc:mga0yw44_380671_c1 3300050492 Bacteria 953
916 nmdc:mga0yw44_399878_c1 3300050492 Bacteria 929
917 nmdc:mga0k408_97396_c1 3300050493 Bacteria 1732
918 nmdc:mga07m45_115522_c1 3300050496 Bacteria 1548
919 nmdc:mga08y16_1054124_c1 3300050511 Bacteria 790
920 nmdc:mga08x19_167622_c1 3300050514 Bacteria 1494
921 Ga0495619_0062013 3300053085 Bacteria 2489
922 Ga0495619_0281616 3300053085 Bacteria 1152
923 Ga0500559_0033920 3300053136 Bacteria 2199
924 Ga0500564_120160 3300053138 Bacteria 1146
925 2587754357 2585428062 Bacteria 6842168
926 2643788735 2643221554 Bacteria 6603920
927 2643797735 2643221556 Bacteria 7251154
928 2644213242 2643221638 Bacteria 6579467
929 2644470483 2643221684 Bacteria 7145183
930 2842711994 2842711865 Bacteria 7155354
931 Ga0070666_10228142
932 JGI25158J39367_1020747
933 JGI25159J45721_1001812
934 JGI25159J45721_1010629
935 rootL2_10015574
936 JGI25160J50197_1008378
937 JGI25161J50226_1003119
938 JGI25161J50226_1007562
939 Ga0055526_1002157
940 Ga0055537_1002292
941 Ga0055537_1018071
942 Ga0055524_1001269
943 Ga0055534_1002606
944 Ga0055530_10015821
945 Ga0055530_10016700
946 Ga0055531_10025864
947 Ga0055543_1001061
948 Ga0065165_1003149
949 Ga0070658_10167090
950 Ga0070658_10536862
951 Ga0070676_10006179
952 Ga0070676_10402641
953 Ga0070683_100098838
954 Ga0070683_100333818
955 Ga0070683_100568363
956 Ga0070690_100009995
957 Ga0070670_100040437
958 Ga0070670_100041228
959 Ga0070670_100041810
960 Ga0070670_100070545
961 Ga0070670_100250988
962 Ga0070670_100289814
963 Ga0070670_100525976
964 Ga0070677_10057022
965 Ga0070677_10067798
966 Ga0070677_10244336
967 Ga0070677_10300367
968 Ga0068869_100023042
969 Ga0070666_10006509
970 Ga0070666_10206569
971 Ga0070666_10240260
972 Ga0070680_100023635
973 Ga0070682_100543651
974 Ga0068868_100139572
975 Ga0068868_100225914
976 Ga0068868_100672776
977 Ga0068868_100797915
978 Ga0070660_100342381
979 Ga0070689_100036157
980 Ga0070687_100049285
981 Ga0070687_100301400
982 Ga0070661_100036668
983 Ga0070661_100125964
984 Ga0070661_100134924
985 Ga0070661_100271965
986 Ga0070661_100899479
987 Ga0070668_100091715
988 Ga0070668_100259897
989 Ga0070668_100319559
990 Ga0070668_100769150
991 Ga0070669_100001130
992 Ga0070669_100116846
993 Ga0070669_100256692
994 Ga0070669_100343750
995 Ga0070675_100003213
996 Ga0070675_100008487
997 Ga0070675_100009897
998 Ga0070675_100156052
999 Ga0070675_100219464
1000 Ga0070675_100220814
1001 Ga0070675_100359002
1002 Ga0070671_100011925
1003 Ga0070671_100118865
1004 Ga0070671_100124449
1005 Ga0070671_100189646
1006 Ga0070671_100233666
1007 Ga0070671_100268030
1008 Ga0070671_100313838
1009 Ga0070671_100756143
1010 Ga0070674_100019990
1011 Ga0070674_100036075
1012 Ga0070674_100054491
1013 Ga0070674_100061868
1014 Ga0070674_100136079
1015 Ga0070673_100012933
1016 Ga0070673_100014182
1017 Ga0070673_100049904
1018 Ga0070673_100068785
1019 Ga0070673_100106844
1020 Ga0070673_100107138
1021 Ga0070673_100466491
1022 Ga0070688_100156585
1023 Ga0070659_100039683
1024 Ga0070659_100170292
1025 Ga0070667_100005407
1026 Ga0070667_100017232
1027 Ga0070667_100075666
1028 Ga0070667_100138856
1029 Ga0070667_100227038
1030 Ga0070667_100299990
1031 Ga0070700_100605743
1032 Ga0070663_100096753
1033 Ga0070663_100141142
1034 Ga0070678_100000202
1035 Ga0070678_100026125
1036 Ga0070678_100144714
1037 Ga0070678_100183127
1038 Ga0070678_100212455
1039 Ga0070678_100223703
1040 Ga0070678_100229254
1041 Ga0070678_100234822
1042 Ga0070678_100259165
1043 Ga0070678_100301155
1044 Ga0070678_100334342
1045 Ga0070662_100001238
1046 Ga0070662_100045173
1047 Ga0070662_100096187
1048 Ga0070662_100157745
1049 Ga0070662_100795813
1050 Ga0070681_10017210
1051 Ga0068867_100000173
1052 Ga0068867_100048156
1053 Ga0068867_100280827
1054 Ga0068867_100324007
1055 Ga0068867_100491221
1056 Ga0068867_100929104
1057 Ga0070679_100002880
1058 Ga0070684_100225458
1059 Ga0070684_100303343
1060 Ga0070684_100448397
1061 Ga0068853_100097511
1062 Ga0068853_100183825
1063 Ga0068853_100400553
1064 Ga0068853_100674768
1065 Ga0068853_100736778
1066 Ga0070672_100008996
1067 Ga0070672_100023210
1068 Ga0070672_100035158
1069 Ga0070672_100073201
1070 Ga0070672_100076179
1071 Ga0070672_100077866
1072 Ga0070672_100155404
1073 Ga0070672_100367461
1074 Ga0070672_100456136
1075 Ga0070693_100068866
1076 Ga0070665_100220200
1077 Ga0070665_100433462
1078 Ga0070664_100037616
1079 Ga0070664_100227913
1080 Ga0070664_100297592
1081 Ga0070664_100458131
1082 Ga0070664_100581658
1083 Ga0068857_100061915
1084 Ga0068854_100099736
1085 Ga0068854_100185117
1086 Ga0068856_100104352
1087 Ga0068856_100165071
1088 Ga0068856_100802849
1089 Ga0068856_100823349
1090 Ga0070702_100201945
1091 Ga0068852_100009055
1092 Ga0068852_100010860
1093 Ga0068852_100030071
1094 Ga0068852_100031671
1095 Ga0068852_100118587
1096 Ga0068852_100137341
1097 Ga0068852_100314359
1098 Ga0068852_100339511
1099 Ga0068852_100355595
1100 Ga0068852_100688516
1101 Ga0068859_100039942
1102 Ga0068859_100136533
1103 Ga0068859_100156913
1104 Ga0068859_100753540
1105 Ga0068864_100000365
1106 Ga0068864_100002329
1107 Ga0068864_100031123
1108 Ga0068864_100045894
1109 Ga0068864_100080467
1110 Ga0068864_100283914
1111 Ga0068864_100493069
1112 Ga0068866_10012833
1113 Ga0068866_10095036
1114 Ga0068861_100416922
1115 Ga0068851_10005284
1116 Ga0068851_10122315
1117 Ga0068851_10250998
1118 Ga0068851_10259752
1119 Ga0068870_10165149
1120 Ga0068870_10190663
1121 Ga0068863_100025015
1122 Ga0068863_100063605
1123 Ga0068863_100114908
1124 Ga0068863_100212996
1125 Ga0068863_100236061
1126 Ga0068863_100263291
1127 Ga0068863_100269813
1128 Ga0068863_100698719
1129 Ga0068858_100001818
1130 Ga0068858_100003428
1131 Ga0068858_100003838
1132 Ga0068858_100015579
1133 Ga0068860_100004794
1134 Ga0068860_100005517
1135 Ga0068860_100093086
1136 Ga0068862_100039223
1137 Ga0068862_100093115
1138 Ga0070717_10022058
1139 Ga0075365_10005225
1140 Ga0070715_10196619
1141 Ga0075367_10029910
1142 Ga0075366_10231906
1143 Ga0075366_10301165
1144 Ga0097621_100016159
1145 Ga0097621_100045361
1146 Ga0097621_100364826
1147 Ga0097621_100405989
1148 Ga0097621_100739939
1149 Ga0068871_100085125
1150 Ga0068871_100090430
1151 Ga0068871_100261185
1152 Ga0068871_100295490
1153 Ga0068871_100332340
1154 Ga0068865_100816976
1155 Ga0097620_100039942
1156 Ga0097620_100136532
1157 Ga0097620_100156918
1158 Ga0097620_100753500
1159 Ga0105240_10002543
1160 Ga0105240_10160498
1161 Ga0111539_10557317
1162 Ga0111539_11910411
1163 Ga0105245_10042059
1164 Ga0105245_10175268
1165 Ga0105247_10520875
1166 Ga0105243_10003820
1167 Ga0105243_10004042
1168 Ga0105243_10916977
1169 Ga0105241_10369203
1170 Ga0105241_10560425
1171 Ga0105242_10073735
1172 Ga0105242_10617790
1173 Ga0105248_10020415
1174 Ga0105248_10044593
1175 Ga0105248_10109194
1176 Ga0105248_10662727
1177 Ga0105248_10672461
1178 Ga0105248_11182908
1179 Ga0105237_10000518
1180 Ga0105237_10221725
1181 Ga0105238_10043782
1182 Ga0105238_10175558
1183 Ga0105238_10396108
1184 Ga0105249_10005277
1185 Ga0105249_10016583
1186 Ga0105249_10213870
1187 Ga0105249_10381685
1188 Ga0105239_10000872
1189 Ga0105239_10819287
1190 Ga0105246_10717380
1191 Ga0157373_10437504
1192 Ga0157371_10057938
1193 Ga0157370_10270238
1194 Ga0157370_10707126
1195 Ga0157369_10032613
1196 Ga0157374_10013203
1197 Ga0157374_10060546
1198 Ga0157374_10086510
1199 Ga0157374_11141907
1200 Ga0157378_10185191
1201 Ga0157378_10295745
1202 Ga0163162_10020480
1203 Ga0163162_10087946
1204 Ga0163162_10322226
1205 Ga0163162_10475759
1206 Ga0163162_10677352
1207 Ga0163162_10912745
1208 Ga0157372_10078073
1209 Ga0157372_10253491
1210 Ga0157372_10293460
1211 Ga0157375_10027374
1212 Ga0157375_10137302
1213 Ga0157375_10149452
1214 Ga0157375_10154362
1215 Ga0157375_11398527
1216 Ga0163163_10007645
1217 Ga0163163_10170102
1218 Ga0157380_10015990
1219 Ga0157380_10023234
1220 Ga0157380_10030254
1221 Ga0157380_10371249
1222 Ga0157377_10000039
1223 Ga0157377_10113708
1224 Ga0157379_10047857
1225 Ga0157379_10092877
1226 Ga0157379_10154924
1227 Ga0157376_10008913
1228 Ga0157376_10009644
1229 Ga0157376_11573919
1230 Ga0163161_10027098
1231 Ga0163161_10350265
1232 Ga0163161_10365361
1233 Ga0163161_10619960
1234 Ga0207425_1000062
1235 Ga0209677_100960
1236 Ga0209565_1000622
1237 Ga0209565_1000784
1238 Ga0209565_1001080
1239 Ga0209565_1031342
1240 Ga0207666_1009379
1241 Ga0209130_1001152
1242 Ga0209130_1007249
1243 Ga0209130_1025357
1244 Ga0209675_1000280
1245 Ga0209564_1001080
1246 Ga0209050_1000064
1247 Ga0209050_1001144
1248 Ga0209256_1000507
1249 Ga0209256_1001972
1250 Ga0207426_1001027
1251 Ga0209051_1031078
1252 Ga0209257_1000010
1253 Ga0209257_1003990
1254 Ga0207697_10042417
1255 Ga0207656_10023503
1256 Ga0207656_10072122
1257 Ga0207656_10117927
1258 Ga0207656_10150588
1259 Ga0207656_10167946
1260 Ga0207656_10200423
1261 Ga0207682_10007351
1262 Ga0207682_10053057
1263 Ga0207682_10053985
1264 Ga0207642_10014634
1265 Ga0207642_10130694
1266 Ga0207688_10172200
1267 Ga0207688_10319948
1268 Ga0207688_10436710
1269 Ga0207688_10480137
1270 Ga0207680_10019580
1271 Ga0207680_10051951
1272 Ga0207680_10273463
1273 Ga0207685_10153763
1274 Ga0207645_10016617
1275 Ga0207645_10025026
1276 Ga0207645_10039259
1277 Ga0207645_10093958
1278 Ga0207645_10118016
1279 Ga0207643_10308284
1280 Ga0207705_10333928
1281 Ga0207695_10006571
1282 Ga0207695_10142141
1283 Ga0207671_10003492
1284 Ga0207671_10291669
1285 Ga0207660_10185183
1286 Ga0207662_10186112
1287 Ga0207662_10267713
1288 Ga0207657_10227937
1289 Ga0207657_10333922
1290 Ga0207649_10138295
1291 Ga0207649_10216079
1292 Ga0207652_10295525
1293 Ga0207681_10032608
1294 Ga0207681_10071671
1295 Ga0207681_10445708
1296 Ga0207694_10019086
1297 Ga0207694_10278913
1298 Ga0207650_10027735
1299 Ga0207650_10035349
1300 Ga0207650_10133863
1301 Ga0207650_10153958
1302 Ga0207650_10187506
1303 Ga0207650_10384649
1304 Ga0207659_10003336
1305 Ga0207659_10010543
1306 Ga0207659_10015331
1307 Ga0207659_10036615
1308 Ga0207659_10162050
1309 Ga0207659_10310924
1310 Ga0207659_10462700
1311 Ga0207659_10580292
1312 Ga0207687_10034140
1313 Ga0207687_10236079
1314 Ga0207644_10002949
1315 Ga0207644_10027031
1316 Ga0207644_10193967
1317 Ga0207644_10289150
1318 Ga0207644_10290172
1319 Ga0207644_10437444
1320 Ga0207690_10122483
1321 Ga0207706_10001684
1322 Ga0207706_10069224
1323 Ga0207706_10162222
1324 Ga0207706_10762093
1325 Ga0207706_11098358
1326 Ga0207686_10068989
1327 Ga0207686_10075378
1328 Ga0207686_10435447
1329 Ga0207709_10008906
1330 Ga0207709_10020258
1331 Ga0207709_10280442
1332 Ga0207669_10016052
1333 Ga0207669_10027359
1334 Ga0207669_10389288
1335 Ga0207704_10008539
1336 Ga0207665_10058372
1337 Ga0207691_10012960
1338 Ga0207691_10024676
1339 Ga0207691_10056925
1340 Ga0207691_10058182
1341 Ga0207691_10127924
1342 Ga0207691_10372729
1343 Ga0207691_10519804
1344 Ga0207711_10100667
1345 Ga0207711_10189956
1346 Ga0207711_10290181
1347 Ga0207711_10341131
1348 Ga0207711_10469663
1349 Ga0207711_11238177
1350 Ga0207689_10000716
1351 Ga0207689_10002900
1352 Ga0207689_10069792
1353 Ga0207661_10026334
1354 Ga0207679_10200857
1355 Ga0207679_10369217
1356 Ga0207679_10488097
1357 Ga0207679_11275709
1358 Ga0207667_10193259
1359 Ga0207667_10590591
1360 Ga0207651_10007527
1361 Ga0207651_10051280
1362 Ga0207651_10109031
1363 Ga0207651_10329320
1364 Ga0207651_10475087
1365 Ga0207712_10034313
1366 Ga0207668_10047946
1367 Ga0207668_10473502
1368 Ga0207668_10573537
1369 Ga0207640_10090295
1370 Ga0207640_10148017
1371 Ga0207640_10328349
1372 Ga0207658_10002511
1373 Ga0207658_10023668
1374 Ga0207658_10247099
1375 Ga0207658_10435704
1376 Ga0207658_10736009
1377 Ga0207677_10000452
1378 Ga0207677_10020176
1379 Ga0207677_10087762
1380 Ga0207677_10219806
1381 Ga0207677_10450333
1382 Ga0207677_10950080
1383 Ga0207703_10003257
1384 Ga0207703_10003262
1385 Ga0207703_10089492
1386 Ga0207639_10103265
1387 Ga0207639_10370436
1388 Ga0207639_10560087
1389 Ga0207639_10623268
1390 Ga0207639_10751365
1391 Ga0207678_10008265
1392 Ga0207678_10042827
1393 Ga0207678_10437544
1394 Ga0207702_10017145
1395 Ga0207702_11202452
1396 Ga0207641_10000923
1397 Ga0207641_10067624
1398 Ga0207641_10557982
1399 Ga0207641_10938236
1400 Ga0207648_10000836
1401 Ga0207648_10063633
1402 Ga0207648_10124501
1403 Ga0207648_10278432
1404 Ga0207648_10402916
1405 Ga0207648_10928640
1406 Ga0207676_10004605
1407 Ga0207676_10027490
1408 Ga0207676_10028475
1409 Ga0207676_10111006
1410 Ga0207676_10189822
1411 Ga0207676_10448793
1412 Ga0207676_10620848
1413 Ga0207674_10093330
1414 Ga0207675_100024123
1415 Ga0207675_100043887
1416 Ga0207675_100772423
1417 Ga0207683_10001865
1418 Ga0207683_10024876
1419 Ga0207683_10028889
1420 Ga0207683_10052952
1421 Ga0207683_10157193
1422 Ga0207683_10230223
1423 Ga0207683_10238480
1424 Ga0207683_10355924
1425 Ga0207683_10398368
1426 Ga0207683_10651174
1427 Ga0207683_10685541
1428 Ga0207698_10017502
1429 Ga0207698_10047999
1430 Ga0207698_10048420
1431 Ga0207698_10059428
1432 Ga0207698_10078152
1433 Ga0207698_10152078
1434 Ga0207698_10278503
1435 Ga0207698_10680206
1436 Ga0207698_10976148
1437 Ga0268266_10270974
1438 Ga0268265_10522666
1439 Ga0268264_10052499
1440 Ga0268264_10071675
1441 Ga0268264_10373113
1442 Ga0307515_10000030
1443 Ga0307515_10000221
1444 Ga0307515_10000777
1445 Ga0307515_10018037
1446 Ga0265324_10081879
1447 Ga0307512_10017030
1448 Ga0307513_10023763
1449 Ga0307408_100002803
1450 Ga0307408_100015501
1451 Ga0307408_100217674
1452 Ga0307408_100345150
1453 Ga0307408_100477666
1454 Ga0307508_10000141
1455 Ga0307514_10065597
1456 Ga0307516_10004531
1457 Ga0307405_10011385
1458 Ga0307405_10166719
1459 Ga0307410_10735064
1460 Ga0307406_10022936
1461 Ga0307406_10836344
1462 Ga0307407_10120706
1463 Ga0307412_10003513
1464 Ga0307412_10095690
1465 Ga0307409_100025456
1466 Ga0307409_100869257
1467 Ga0307416_100000974
1468 Ga0307416_100234092
1469 Ga0307416_100309525
1470 Ga0307414_10364022
1471 Ga0307411_10094900
1472 Ga0307415_100001962
1473 Ga0307415_100551641
1474 Ga0307510_10448412
1475 Ga0373938_0040326
1476 Ga0373949_0035444
1477 Ga0373936_0183358
1478 Ga0373931_0003594
1479 Ga0373931_0262860
1480 Ga0373927_0123237
1481 Ga0373937_0037185
1482 Ga0373925_0170979
1483 Ga0373925_0253853
1484 Ga0373925_0672663
1485 Ga0395900_0185157
1486 Ga0395900_0746435
1487 Ga0395898_0020437
1488 Ga0395905_0370157
1489 Ga0395905_1185220
1490 Ga0436364_0571710
1491 Ga0395901_0158225
1492 Ga0395901_0381368
1493 Ga0436365_0482375
1494 Ga0436363_0390454
1495 Ga0451793_1915431
1496 Ga0451797_0142736
1497 Ga0451802_0933167
1498 Ga0451835_0346031
1499 Ga0451837_1554540
1500 Ga0451839_0874313
1501 Ga0451841_0821959
1502 Ga0451843_0875436
1503 Ga0451853_0591653
1504 Ga0451853_2839646
1505 Ga0439464_0006066
1506 Ga0451577_0609327
1507 Ga0466972_0029464
1508 Ga0466965_0019972
1509 Ga0466961_0135700
1510 Ga0466963_0253382
1511 Ga0466964_0000831
1512 Ga0466964_0046940
1513 Ga0453684_0746774
1514 Ga0466968_0005379
1515 Ga0466970_0411913
1516 Ga0466957_0119546
1517 Ga0466957_0246141
1518 Ga0466957_0463066
1519 Ga0466960_0256749
1520 Ga0451576_0553615
1521 Ga0451576_1410206
1522 Ga0466958_0391881
1523 Ga0466967_0011043
1524 Ga0495617_000002
1525 Ga0495627_000176
1526 Ga0495627_005973
1527 Ga0495603_0235314
1528 Ga0495603_0426942
1529 Ga0495590_0025210
1530 Ga0495591_061640
1531 Ga0495629_0021875
1532 Ga0495629_0026938
1533 Ga0495629_0515712
1534 Ga0495629_0548413
1535 Ga0495638_0006104
1536 Ga0495638_0100621
1537 Ga0495638_0280710
1538 Ga0495653_0099895
1539 Ga0495580_0479193
1540 Ga0495582_0049455
1541 Ga0495582_0332348
1542 Ga0495582_0346806
1543 Ga0495605_0000081
1544 Ga0495605_0000087
1545 Ga0495605_0014951
1546 Ga0495605_0054408
1547 Ga0495605_0054970
1548 Ga0495605_0096507
1549 Ga0495639_0119233
1550 Ga0495664_0135482
1551 Ga0495664_0470154
1552 Ga0495584_0003309
1553 Ga0495584_0006863
1554 Ga0495584_0011832
1555 Ga0495584_0029616
1556 Ga0495584_0136281
1557 Ga0495584_0310848
1558 Ga0495585_0000863
1559 Ga0495585_0008523
1560 Ga0495585_0034137
1561 Ga0495585_0066082
1562 Ga0495585_0069942
1563 Ga0495594_0000705
1564 Ga0495594_0125810
1565 Ga0495594_0176021
1566 Ga0495594_0191108
1567 Ga0495596_0001008
1568 Ga0495596_0029285
1569 Ga0495596_0044436
1570 Ga0495596_0048861
1571 Ga0495596_0061065
1572 Ga0495596_0102603
1573 Ga0495607_0015258
1574 Ga0495607_0063518
1575 Ga0495583_0000193
1576 Ga0495583_0000430
1577 Ga0495583_0025803
1578 Ga0495583_0049210
1579 Ga0495583_0053809
1580 Ga0495583_0066555
1581 Ga0495583_0079437
1582 Ga0495583_0109368
1583 Ga0495583_0149583
1584 Ga0495583_0209902
1585 Ga0495606_0000007
1586 Ga0495606_0006338
1587 Ga0495606_0168583
1588 Ga0495610_0295824
1589 Ga0495616_0003775
1590 Ga0495616_0006247
1591 Ga0495616_0011606
1592 Ga0495616_0026665
1593 Ga0495616_0057859
1594 Ga0495616_0078089
1595 Ga0495616_0146406
1596 Ga0495630_0408456
1597 Ga0495631_0001768
1598 Ga0495631_0047270
1599 Ga0495631_0058851
1600 Ga0495631_0078768
1601 Ga0495631_0080287
1602 Ga0495631_0091013
1603 Ga0495631_0233025
1604 Ga0495632_0000114
1605 Ga0495643_0026010
1606 Ga0495643_0122658
1607 Ga0495643_0162344
1608 Ga0495644_0024432
1609 Ga0495644_0174579
1610 Ga0495644_0199043
1611 Ga0495648_0003099
1612 Ga0495648_0018117
1613 Ga0495648_0104611
1614 Ga0495663_0017699
1615 Ga0495663_0026350
1616 Ga0495666_0024048
1617 Ga0495666_0051039
1618 Ga0495666_0104105
1619 Ga0495666_0216858
1620 Ga0495642_0000813
1621 Ga0495642_0002336
1622 Ga0495642_0063087
1623 Ga0495642_0086695
1624 Ga0495642_0092047
1625 Ga0495642_0117604
1626 Ga0495642_0119825
1627 Ga0495642_0142181
1628 Ga0495642_0146022
1629 Ga0495642_0243901
1630 Ga0495654_0009914
1631 Ga0495654_0027808
1632 Ga0495654_0065381
1633 Ga0495665_0024195
1634 Ga0495665_0025475
1635 Ga0495586_0130831
1636 Ga0495587_0024560
1637 Ga0495587_0092009
1638 Ga0495609_0000096
1639 Ga0495609_0005065
1640 Ga0495609_0012026
1641 Ga0495609_0063112
1642 Ga0495609_0065576
1643 Ga0495609_0074786
1644 Ga0495609_0108656
1645 Ga0495621_0186868
1646 Ga0495597_0000587
1647 Ga0495597_0001219
1648 Ga0495597_0002540
1649 Ga0495597_0004426
1650 Ga0495597_0039253
1651 Ga0495597_0089115
1652 Ga0495597_0090044
1653 Ga0495645_0047563
1654 Ga0495622_0005476
1655 Ga0495622_0051667
1656 Ga0495622_0108102
1657 Ga0495622_0111001
1658 Ga0495622_0229086
1659 Ga0495633_0062569
1660 Ga0495633_0070876
1661 Ga0495633_0123615
1662 Ga0495633_0180395
1663 Ga0495633_0213343
1664 Ga0495667_0034780
1665 Ga0495667_0314618
1666 Ga0495656_0064993
1667 Ga0495656_0070245
1668 Ga0495656_0107791
1669 Ga0495656_0144600
1670 Ga0495656_0493761
1671 Ga0495668_0002567
1672 Ga0495668_0011047
1673 Ga0495668_0013816
1674 Ga0495668_0065700
1675 Ga0495668_0126435
1676 Ga0495668_0321688
1677 Ga0495634_0029421
1678 Ga0495634_0228698
1679 Ga0495611_0080114
1680 Ga0495625_0002044
1681 Ga0495625_0004537
1682 Ga0495625_0032111
1683 Ga0495625_0050417
1684 Ga0495625_0053275
1685 Ga0495625_0140040
1686 Ga0495625_0189381
1687 Ga0495625_0251042
1688 Ga0495625_0254657
1689 Ga0495661_0000164
1690 Ga0495661_0014211
1691 Ga0495661_0073293
1692 Ga0495661_0104944
1693 Ga0495661_0115739
1694 Ga0495661_0184710
1695 Ga0495661_0209534
1696 Ga0495588_0083822
1697 Ga0495588_0097659
1698 Ga0495588_0129583
1699 Ga0495588_0238769
1700 Ga0495588_0240112
1701 Ga0495588_0271647
1702 Ga0495588_0333912
1703 Ga0495623_0016009
1704 Ga0495623_0142294
1705 Ga0495623_0152455
1706 Ga0495647_0016669
1707 Ga0495647_0196924
1708 Ga0495647_0341001
1709 Ga0495658_0062960
1710 Ga0495658_0274740
1711 Ga0495669_0087744
1712 Ga0495669_0375936
1713 Ga0495613_0138776
1714 Ga0495613_0199300
1715 Ga0495613_0516790
1716 Ga0495624_0045126
1717 Ga0495670_0000604
1718 Ga0495670_0048641
1719 Ga0495670_0053624
1720 Ga0495670_0182906
1721 Ga0495670_0191468
1722 Ga0495670_0268326
1723 Ga0495671_0000132
1724 Ga0495671_0060264
1725 Ga0495671_0064536
1726 Ga0495671_0069041
1727 Ga0495671_0079020
1728 Ga0495671_0206591
1729 Ga0495649_0073170
1730 Ga0495649_0098126
1731 Ga0495649_0172010
1732 Ga0495589_0000036
1733 Ga0495589_0000092
1734 Ga0495589_0001941
1735 Ga0495589_0047793
1736 Ga0495589_0083531
1737 Ga0495600_0026732
1738 Ga0495600_0550314
1739 Ga0495660_0000117
1740 Ga0495660_0017138
1741 Ga0495660_0020826
1742 Ga0495660_0045575
1743 Ga0495660_0079012
1744 Ga0495660_0098586
1745 Ga0495581_0024612
1746 Ga0495581_0572309
1747 Ga0495604_0045073
1748 Ga0495636_0015815
1749 Ga0495674_0003022
1750 Ga0495674_0585921
1751 Ga0495672_0000014
1752 Ga0495672_0002183
1753 Ga0495672_0003253
1754 Ga0495676_0007223
1755 Ga0495676_0009421
1756 Ga0495676_0070247
1757 Ga0495676_0242968
1758 Ga0495683_0000576
1759 Ga0495683_0007830
1760 Ga0495683_0019300
1761 Ga0495683_0058853
1762 Ga0495687_000074
1763 Ga0495687_000154
1764 Ga0495687_002852
1765 Ga0495687_003354
1766 Ga0495687_167915
1767 Ga0495675_0065424
1768 Ga0495675_0133443
1769 Ga0495677_0000037
1770 Ga0495677_0033630
1771 Ga0495677_0105433
1772 Ga0495679_038807
1773 Ga0495685_016157
1774 Ga0495685_039220
1775 Ga0495681_0006668
1776 Ga0495681_0017803
1777 Ga0495681_0061861
1778 Ga0495686_0001832
1779 Ga0495686_0002933
1780 Ga0495686_0050546
1781 Ga0495686_0109922
1782 Ga0495686_0178256
1783 Ga0495593_0056294
1784 Ga0495602_0033019
1785 Ga0495602_0170594
1786 Ga0495615_0027467
1787 Ga0495626_0000006
1788 Ga0495626_0004153
1789 Ga0495626_0044821
1790 Ga0495626_0069047
1791 Ga0495626_0147140
1792 Ga0496100_0032816
1793 Ga0496100_0074915
1794 Ga0496102_0021103
1795 Ga0496102_0068969
1796 Ga0496102_0416302
1797 Ga0496103_0004341
1798 Ga0496104_0296569
1799 Ga0496104_1013963
1800 Ga0496105_0182079
1801 Ga0496105_0555668
1802 Ga0496106_0004593
1803 Ga0496107_0608226
1804 Ga0496108_0018843
1805 Ga0496108_0070054
1806 Ga0496108_0275744
1807 Ga0496108_0675345
1808 Ga0496108_0800146
1809 Ga0496108_0858628
1810 Ga0496109_0008838
1811 Ga0496109_0220311
1812 Ga0496109_0255942
1813 Ga0496109_0320416
1814 Ga0496109_0787890
1815 Ga0496110_0004486
1816 Ga0496110_0181810
1817 Ga0496110_0194522
1818 Ga0496110_0570245
1819 Ga0496110_0673692
1820 Ga0496111_0130263
1821 Ga0496111_0212296
1822 Ga0496111_0273343
1823 Ga0496112_0191825
1824 Ga0496112_0268957
1825 Ga0496113_0087315
1826 Ga0496113_0158354
1827 Ga0496113_0478026
1828 Ga0496114_0669293
1829 Ga0496115_0107553
1830 Ga0496115_0166792
1831 Ga0496115_0246375
1832 Ga0496122_0001315
1833 Ga0496123_0000851
1834 Ga0496124_0183530
1835 Ga0496125_0002377
1836 Ga0501304_008260
1837 Ga0495678_002660
1838 Ga0495678_003327
1839 Ga0495678_003585
1840 Ga0495682_0000726
1841 Ga0501198_000038
1842 Ga0501222_000037
1843 Ga0501035_0512448
1844 nmdc:mga03683_49370_c1
1845 nmdc:mga0yw44_380671_c1
1846 nmdc:mga0yw44_399878_c1
1847 nmdc:mga0k408_97396_c1
1848 nmdc:mga07m45_115522_c1
1849 nmdc:mga08y16_1054124_c1
1850 nmdc:mga08x19_167622_c1
1851 Ga0495619_0062013
1852 Ga0495619_0281616
1853 Ga0500559_0033920
1854 Ga0500564_120160
1855 2587754357
1856 2643788735
1857 2643797735
1858 2644213242
1859 2644470483
1860 2842711994

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

27

167

0.93

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

48

166

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gxf-assembly2.cif.gz_C pseudomonas flexibilis gcn5 family acetyltransferase 0.9118 4 191
8gxf-assembly2.cif.gz_C pseudomonas flexibilis gcn5 family acetyltransferase 0.8935 4 191
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.8915 3 191
8gxj-assembly1.cif.gz_A pseudomonas aeruginosa n-acetyltransferase domain-containing protein pa3270 0.8881 1 189
8gxk-assembly2.cif.gz_C pseudomonas jinjuensis n-acetyltransferase 0.8876 4 189
ID Description Score Start End Superfamily
af_Q869N8_82_281_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9702 3 191 3.40.630.30
af_Q869N8_82_281_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9362 3 191 3.40.630.30
1yreD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9069 4 189 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8995 3 191 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8915 3 191 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Y9SWL4-F1-model_v4 N-acetyltransferase 0.9866 1 194 GO:0016747
AF-A0A430HGL1-F1-model_v4 N-acetyltransferase 0.9854 1 194 GO:0016747
AF-A0A833KNB9-F1-model_v4 deleted 0.9827 5 134
AF-A0A1Q7Q2C2-F1-model_v4 GNAT family N-acetyltransferase 0.9783 1 181 GO:0016747
AF-A0A4Y9SWL4-F1-model_v4 N-acetyltransferase 0.9766 1 194 GO:0016747

Map