F486014

General Info

Members Datasets Scaffolds Average Seq Length
930 446 1860 130

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100397599|Ga0070708_1003975992
Length 123
Sequence MIHIIKSFTLWEFVKAHWLTLKYFFKPKATINYPFEKNPISPRFRGEHALRRYPNGEERCIACKLCEAVCPAQAITIESEGPNFEFATETREELLYDKAKLLANGDKWERVIAANLAADAPYR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
136 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
140 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
157 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
158 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
224 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
225 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
227 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
233 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
282 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
283 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
284 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
294 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
305 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
306 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
320 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
339 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
340 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
385 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
386 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
387 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
388 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
389 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
390 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
391 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
392 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
395 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
396 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
397 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
409 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
410 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
418 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
419 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
420 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
421 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
422 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
423 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
424 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
425 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
426 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
427 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
428 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
429 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
430 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
431 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
432 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
433 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
434 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
435 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
436 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
437 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
438 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
439 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
440 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
441 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
442 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
443 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
444 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
445 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
446 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.31
Nodule 0.54
Rhizoplane 8.92
Rhizosphere 79.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100397599 3300005445 Bacteria 1299
2 SwRhRL2b_contig_1308435 2162886007 Bacteria 1244
3 JGI24736J21556_1000469 3300001904 Bacteria 7572
4 JGI24746J21847_1002318 3300001977 Bacteria 3043
5 JGI24747J21853_1026391 3300001978 Bacteria 650
6 JGI24740J21852_10049680 3300001979 Bacteria 1210
7 JGI24737J22298_10004151 3300001990 Bacteria 5062
8 JGI24737J22298_10148771 3300001990 Bacteria 691
9 JGI24735J21928_10004647 3300002067 Bacteria 4593
10 JGI24750J21931_1000848 3300002070 Bacteria 4217
11 JGI24745J21846_1017104 3300002073 Bacteria 843
12 JGI24748J21848_1001096 3300002074 Bacteria 2949
13 JGI24738J21930_10000674 3300002075 Bacteria 9899
14 JGI24749J21850_1002350 3300002076 Bacteria 2661
15 JGI24744J21845_10000459 3300002077 Bacteria 7189
16 JGI24033J26618_1001826 3300002155 Bacteria 2128
17 JGI24742J22300_10003845 3300002244 Bacteria 2442
18 JGI24742J22300_10032263 3300002244 Bacteria 918
19 JGI24751J29686_10003221 3300002459 Bacteria 3283
20 JGI25406J46586_10004353 3300003203 Bacteria 6608
21 JGI25165J46597_1000041 3300003214 Bacteria 272566
22 JGI25407J50210_10124764 3300003373 Bacteria 634
23 Ga0055530_10001188 3300003791 Bacteria 20133
24 Ga0055531_10001182 3300003794 Bacteria 20057
25 JGI25405J52794_10001004 3300003911 Bacteria 4469
26 Ga0065165_1003786 3300005262 Bacteria 10124
27 Ga0065704_10002136 3300005289 Bacteria 6784
28 Ga0065712_10076047 3300005290 Bacteria 3737
29 Ga0065715_10096277 3300005293 Bacteria 3911
30 Ga0070690_100231859 3300005330 Bacteria 1298
31 Ga0070670_100061841 3300005331 Bacteria 3214
32 Ga0070670_100186711 3300005331 Bacteria 1800
33 Ga0068869_100994939 3300005334 Bacteria 730
34 Ga0070666_10023515 3300005335 Bacteria 4012
35 Ga0070666_10145194 3300005335 Bacteria 1654
36 Ga0070666_10309560 3300005335 Bacteria 1126
37 Ga0070680_100409186 3300005336 Bacteria 1157
38 Ga0070680_100743222 3300005336 Bacteria 845
39 Ga0070682_100024507 3300005337 Bacteria 3592
40 Ga0068868_100053715 3300005338 Bacteria 3174
41 Ga0068868_101315834 3300005338 Bacteria 672
42 Ga0070660_100092540 3300005339 Bacteria 2386
43 Ga0070660_100106546 3300005339 Bacteria 2226
44 Ga0070689_100004610 3300005340 Bacteria 9339
45 Ga0070689_101253761 3300005340 Bacteria 667
46 Ga0070691_10079831 3300005341 Bacteria 1600
47 Ga0070691_10248118 3300005341 Bacteria 954
48 Ga0070687_100007225 3300005343 Bacteria 4611
49 Ga0070661_100023471 3300005344 Bacteria 4421
50 Ga0070661_100112141 3300005344 Bacteria 2037
51 Ga0070692_10022848 3300005345 Bacteria 3059
52 Ga0070668_100000010 3300005347 Bacteria 132833
53 Ga0070668_100016202 3300005347 Bacteria 5577
54 Ga0070668_100087407 3300005347 Bacteria 2453
55 Ga0070668_100122212 3300005347 Bacteria 2082
56 Ga0070668_100145088 3300005347 Bacteria 1915
57 Ga0070669_100015953 3300005353 Bacteria 5359
58 Ga0070669_100275541 3300005353 Bacteria 1347
59 Ga0070669_101818405 3300005353 Bacteria 532
60 Ga0070675_100039194 3300005354 Bacteria 3865
61 Ga0070675_100275452 3300005354 Bacteria 1478
62 Ga0070671_100018333 3300005355 Bacteria 5684
63 Ga0070671_100166306 3300005355 Bacteria 1865
64 Ga0070671_100642197 3300005355 Bacteria 919
65 Ga0070674_100001953 3300005356 Bacteria 11251
66 Ga0070674_100011062 3300005356 Bacteria 5476
67 Ga0070674_101554764 3300005356 Bacteria 596
68 Ga0070673_100033931 3300005364 Bacteria 3856
69 Ga0070688_100191034 3300005365 Bacteria 1427
70 Ga0070688_100604313 3300005365 Bacteria 840
71 Ga0070659_100029462 3300005366 Bacteria 4243
72 Ga0070659_100517441 3300005366 Bacteria 1018
73 Ga0070659_100992794 3300005366 Bacteria 737
74 Ga0070667_100000013 3300005367 Bacteria 255674
75 Ga0070667_100059106 3300005367 Bacteria 3243
76 Ga0070709_11088539 3300005434 Bacteria 639
77 Ga0070713_100112794 3300005436 Bacteria 2373
78 Ga0070710_10032843 3300005437 Bacteria 2814
79 Ga0070701_10014832 3300005438 Bacteria 3582
80 Ga0070711_100054944 3300005439 Bacteria 2749
81 Ga0070711_101049494 3300005439 Bacteria 701
82 Ga0070711_101528692 3300005439 Bacteria 583
83 Ga0070705_100012708 3300005440 Bacteria 4288
84 Ga0070705_100076984 3300005440 Bacteria 2036
85 Ga0070700_100051429 3300005441 Bacteria 2564
86 Ga0070694_100148281 3300005444 Bacteria 1711
87 Ga0070663_100017388 3300005455 Bacteria 4692
88 Ga0070663_100045120 3300005455 Bacteria 3112
89 Ga0070663_100069461 3300005455 Bacteria 2559
90 Ga0070678_100168505 3300005456 Bacteria 1781
91 Ga0070662_100003080 3300005457 Bacteria 10344
92 Ga0070662_100175324 3300005457 Bacteria 1686
93 Ga0070662_101008481 3300005457 Bacteria 713
94 Ga0070681_11184557 3300005458 Bacteria 686
95 Ga0068867_100038190 3300005459 Bacteria 3495
96 Ga0070685_10002290 3300005466 Bacteria 9880
97 Ga0070707_101066339 3300005468 Bacteria 774
98 Ga0070698_100280396 3300005471 Bacteria 1598
99 Ga0070698_100311316 3300005471 Bacteria 1505
100 Ga0070679_100370783 3300005530 Bacteria 1379
101 Ga0070679_100498457 3300005530 Bacteria 1162
102 Ga0070684_100043853 3300005535 Bacteria 3865
103 Ga0068853_100038701 3300005539 Bacteria 4063
104 Ga0068853_100583716 3300005539 Bacteria 1061
105 Ga0068853_100704133 3300005539 Bacteria 964
106 Ga0070672_100001270 3300005543 Bacteria 15500
107 Ga0070686_100005738 3300005544 Bacteria 6881
108 Ga0070695_100378240 3300005545 Bacteria 1068
109 Ga0070696_100048816 3300005546 Bacteria 2939
110 Ga0070696_100113008 3300005546 Bacteria 1958
111 Ga0070696_100732098 3300005546 Bacteria 809
112 Ga0070693_100048051 3300005547 Bacteria 2429
113 Ga0070665_100108729 3300005548 Bacteria 2775
114 Ga0070665_100114000 3300005548 Bacteria 2706
115 Ga0070665_100775494 3300005548 Bacteria 972
116 Ga0070665_102169407 3300005548 Bacteria 560
117 Ga0070704_100037328 3300005549 Bacteria 3319
118 Ga0070704_100301477 3300005549 Bacteria 1335
119 Ga0068855_100939750 3300005563 Bacteria 911
120 Ga0070664_100030051 3300005564 Bacteria 4531
121 Ga0070664_100122682 3300005564 Bacteria 2276
122 Ga0070664_101131941 3300005564 Bacteria 738
123 Ga0070664_101523869 3300005564 Bacteria 633
124 Ga0068857_100448519 3300005577 Bacteria 1206
125 Ga0068854_100025737 3300005578 Bacteria 4037
126 Ga0068854_100423270 3300005578 Bacteria 1107
127 Ga0068856_100009471 3300005614 Bacteria 9458
128 Ga0068856_100037704 3300005614 Bacteria 4743
129 Ga0068856_100102901 3300005614 Bacteria 2850
130 Ga0068856_100347030 3300005614 Bacteria 1503
131 Ga0068856_101329519 3300005614 Bacteria 734
132 Ga0070702_100009964 3300005615 Bacteria 4664
133 Ga0070702_100380961 3300005615 Bacteria 1003
134 Ga0068852_100023635 3300005616 Bacteria 4950
135 Ga0068852_100237795 3300005616 Bacteria 1739
136 Ga0068859_100033400 3300005617 Bacteria 5166
137 Ga0068859_100035480 3300005617 Bacteria 5003
138 Ga0068859_101086847 3300005617 Bacteria 880
139 Ga0068864_100021549 3300005618 Bacteria 5398
140 Ga0068866_10098752 3300005718 Bacteria 1606
141 Ga0068866_10125379 3300005718 Bacteria 1453
142 Ga0068861_100086054 3300005719 Bacteria 2470
143 Ga0068861_100126163 3300005719 Bacteria 2071
144 Ga0068851_10002776 3300005834 Bacteria 7716
145 Ga0068851_10022475 3300005834 Bacteria 3073
146 Ga0068851_10077392 3300005834 Bacteria 1732
147 Ga0068870_10001959 3300005840 Bacteria 8514
148 Ga0068863_100000130 3300005841 Bacteria 79433
149 Ga0068863_100001004 3300005841 Bacteria 28270
150 Ga0068858_100002907 3300005842 Bacteria 17232
151 Ga0068858_100039732 3300005842 Bacteria 4362
152 Ga0068858_100547849 3300005842 Bacteria 1120
153 Ga0068860_100021228 3300005843 Bacteria 6290
154 Ga0068860_100042367 3300005843 Bacteria 4348
155 Ga0068862_100096039 3300005844 Bacteria 2586
156 Ga0068862_100562227 3300005844 Bacteria 1090
157 Ga0068862_100666574 3300005844 Bacteria 1005
158 Ga0081455_10012820 3300005937 Bacteria 8327
159 Ga0081455_10018926 3300005937 Bacteria 6531
160 Ga0081538_10006183 3300005981 Bacteria 10617
161 Ga0081538_10087746 3300005981 Bacteria 1622
162 Ga0081540_1006467 3300005983 Bacteria 8525
163 Ga0081540_1031025 3300005983 Bacteria 2948
164 Ga0081540_1126403 3300005983 Bacteria 1051
165 Ga0070717_10015726 3300006028 Bacteria 5848
166 Ga0070717_10103663 3300006028 Bacteria 2419
167 Ga0070717_10174380 3300006028 Bacteria 1872
168 Ga0070717_10752757 3300006028 Bacteria 886
169 Ga0075365_10080553 3300006038 Bacteria 2205
170 Ga0075365_10248907 3300006038 Bacteria 1249
171 Ga0075365_10471635 3300006038 Bacteria 887
172 Ga0075365_10625046 3300006038 Bacteria 761
173 Ga0075365_10890589 3300006038 Bacteria 627
174 Ga0075368_10000432 3300006042 Bacteria 12392
175 Ga0075368_10094419 3300006042 Bacteria 1225
176 Ga0075363_100041327 3300006048 Bacteria 2432
177 Ga0075363_100206408 3300006048 Bacteria 1124
178 Ga0075364_10076564 3300006051 Bacteria 2208
179 Ga0075364_10146185 3300006051 Bacteria 1592
180 Ga0070715_10001746 3300006163 Bacteria 6467
181 Ga0070716_100003116 3300006173 Bacteria 7747
182 Ga0070712_100388040 3300006175 Bacteria 1151
183 Ga0075362_10004001 3300006177 Bacteria 5243
184 Ga0075362_10058451 3300006177 Bacteria 1739
185 Ga0075367_10008152 3300006178 Bacteria 5412
186 Ga0075366_10047067 3300006195 Bacteria 2556
187 Ga0075370_10014545 3300006353 Bacteria 4201
188 Ga0075370_10088087 3300006353 Bacteria 1789
189 Ga0068871_100089003 3300006358 Bacteria 2569
190 Ga0075428_100164358 3300006844 Bacteria 2408
191 Ga0075430_100541980 3300006846 Bacteria 960
192 Ga0075431_100004484 3300006847 Bacteria 13700
193 Ga0075433_10373469 3300006852 Bacteria 1259
194 Ga0075433_10425777 3300006852 Bacteria 1170
195 Ga0075434_100057055 3300006871 Bacteria 3881
196 Ga0075434_100082600 3300006871 Bacteria 3210
197 Ga0075434_100127891 3300006871 Bacteria 2558
198 Ga0075429_100212269 3300006880 Bacteria 1696
199 Ga0068865_100816311 3300006881 Bacteria 806
200 Ga0075436_100149175 3300006914 Bacteria 1645
201 Ga0075436_100213385 3300006914 Bacteria 1369
202 Ga0097620_100033400 3300006931 Bacteria 5166
203 Ga0097620_100035479 3300006931 Bacteria 5003
204 Ga0097620_101086905 3300006931 Bacteria 880
205 Ga0099823_1137254 3300006944 Bacteria 568
206 Ga0075435_100735609 3300007076 Bacteria 858
207 Ga0075435_101004216 3300007076 Bacteria 729
208 Ga0099794_10265146 3300007265 Bacteria 887
209 Ga0105251_10128139 3300009011 Bacteria 1151
210 Ga0105250_10065091 3300009092 Bacteria 1469
211 Ga0105250_10072108 3300009092 Bacteria 1396
212 Ga0105240_10134042 3300009093 Bacteria 2967
213 Ga0105240_10139458 3300009093 Bacteria 2900
214 Ga0111539_10045279 3300009094 Bacteria 5267
215 Ga0111539_10068395 3300009094 Bacteria 4193
216 Ga0111539_10428944 3300009094 Bacteria 1539
217 Ga0105245_10775797 3300009098 Bacteria 996
218 Ga0105245_11029036 3300009098 Bacteria 869
219 Ga0105247_10008832 3300009101 Bacteria 6143
220 Ga0105247_10019109 3300009101 Bacteria 4115
221 Ga0105247_10631438 3300009101 Bacteria 798
222 Ga0114129_10006400 3300009147 Bacteria 16696
223 Ga0114129_10020510 3300009147 Bacteria 9400
224 Ga0114129_10252747 3300009147 Bacteria 2365
225 Ga0105243_10301107 3300009148 Bacteria 1453
226 Ga0105243_10625964 3300009148 Bacteria 1039
227 Ga0105243_11503365 3300009148 Bacteria 697
228 Ga0105241_10017640 3300009174 Bacteria 5249
229 Ga0105241_10535360 3300009174 Bacteria 1049
230 Ga0105242_10188649 3300009176 Bacteria 1824
231 Ga0105242_10298627 3300009176 Bacteria 1469
232 Ga0105248_10007785 3300009177 Bacteria 11756
233 Ga0105237_10025821 3300009545 Bacteria 6006
234 Ga0105237_10029660 3300009545 Bacteria 5558
235 Ga0105238_10097867 3300009551 Bacteria 2919
236 Ga0105238_10220857 3300009551 Bacteria 1871
237 Ga0105238_10605894 3300009551 Bacteria 1103
238 Ga0105249_10156420 3300009553 Bacteria 2199
239 Ga0105249_10169198 3300009553 Bacteria 2118
240 Ga0105249_10406957 3300009553 Bacteria 1392
241 Ga0105148_100189 3300009978 Bacteria 9023
242 Ga0105148_109326 3300009978 Bacteria 740
243 Ga0105029_115183 3300009984 Bacteria 616
244 Ga0105239_10023131 3300010375 Bacteria 6848
245 Ga0105239_10049433 3300010375 Bacteria 4611
246 Ga0105239_10211691 3300010375 Bacteria 2173
247 Ga0105239_10379929 3300010375 Bacteria 1597
248 Ga0105239_10684780 3300010375 Bacteria 1172
249 Ga0105239_10905337 3300010375 Bacteria 1013
250 Ga0105239_11921223 3300010375 Bacteria 687
251 Ga0105246_10032111 3300011119 Bacteria 3480
252 Ga0157329_1002162 3300012491 Bacteria 1093
253 Ga0157326_1016607 3300012513 Bacteria 873
254 Ga0157373_10007215 3300013100 Bacteria 8288
255 Ga0157370_10034345 3300013104 Bacteria 4940
256 Ga0157369_10017317 3300013105 Bacteria 8100
257 Ga0157369_10609394 3300013105 Bacteria 1127
258 Ga0157369_11288208 3300013105 Bacteria 745
259 Ga0157369_11507961 3300013105 Bacteria 684
260 Ga0157374_10070540 3300013296 Bacteria 3293
261 Ga0157378_10077023 3300013297 Bacteria 3006
262 Ga0157378_11332991 3300013297 Bacteria 759
263 Ga0163162_10053399 3300013306 Bacteria 4061
264 Ga0163162_10515365 3300013306 Bacteria 1326
265 Ga0163162_10840959 3300013306 Bacteria 1033
266 Ga0157372_10385746 3300013307 Bacteria 1632
267 Ga0157375_10935391 3300013308 Bacteria 1009
268 Ga0163163_10029540 3300014325 Bacteria 5275
269 Ga0163163_10065220 3300014325 Bacteria 3614
270 Ga0157380_10278459 3300014326 Bacteria 1529
271 Ga0157380_11051269 3300014326 Bacteria 851
272 Ga0182008_10275455 3300014497 Bacteria 874
273 Ga0157377_10075482 3300014745 Bacteria 1958
274 Ga0157379_10137482 3300014968 Bacteria 2202
275 Ga0157379_11281546 3300014968 Bacteria 707
276 Ga0157379_11295323 3300014968 Bacteria 703
277 Ga0163161_10099861 3300017792 Bacteria 2159
278 Ga0206353_11317483 3300020082 Bacteria 643
279 Ga0213872_10318372 3300021361 Bacteria 643
280 Ga0213876_10273087 3300021384 Bacteria 898
281 Ga0213871_10192442 3300021441 Bacteria 634
282 Ga0209233_1000104 3300025261 Bacteria 272675
283 Ga0209233_1049297 3300025261 Bacteria 865
284 Ga0209050_1000010 3300025298 Bacteria 980454
285 Ga0209257_1000009 3300025304 Bacteria 1205047
286 Ga0209257_1047629 3300025304 Bacteria 1231
287 Ga0207697_10369020 3300025315 Bacteria 637
288 Ga0207656_10003231 3300025321 Bacteria 5575
289 Ga0207656_10009468 3300025321 Bacteria 3620
290 Ga0207656_10094294 3300025321 Bacteria 1363
291 Ga0207655_1129677 3300025728 Bacteria 823
292 Ga0207713_1092144 3300025735 Bacteria 1062
293 Ga0207692_10345294 3300025898 Bacteria 916
294 Ga0207642_10114881 3300025899 Bacteria 1378
295 Ga0207710_10004436 3300025900 Bacteria 6128
296 Ga0207688_10000309 3300025901 Bacteria 22442
297 Ga0207680_10269243 3300025903 Bacteria 1181
298 Ga0207647_10003672 3300025904 Bacteria 11482
299 Ga0207647_10007308 3300025904 Bacteria 7993
300 Ga0207647_10223516 3300025904 Bacteria 1084
301 Ga0207645_10025338 3300025907 Bacteria 3838
302 Ga0207643_10000977 3300025908 Bacteria 17154
303 Ga0207705_10393622 3300025909 Bacteria 1071
304 Ga0207654_10101092 3300025911 Bacteria 1777
305 Ga0207654_10111908 3300025911 Bacteria 1700
306 Ga0207695_10233082 3300025913 Bacteria 1745
307 Ga0207671_10203563 3300025914 Bacteria 1546
308 Ga0207693_10003085 3300025915 Bacteria 14364
309 Ga0207693_10005179 3300025915 Bacteria 10915
310 Ga0207693_10030227 3300025915 Bacteria 4277
311 Ga0207693_10138714 3300025915 Bacteria 1912
312 Ga0207663_10015712 3300025916 Bacteria 4184
313 Ga0207663_10074846 3300025916 Bacteria 2196
314 Ga0207660_10360889 3300025917 Bacteria 1166
315 Ga0207660_10777082 3300025917 Bacteria 781
316 Ga0207662_10002752 3300025918 Bacteria 8879
317 Ga0207657_10005125 3300025919 Bacteria 13731
318 Ga0207657_10023905 3300025919 Bacteria 5675
319 Ga0207657_10032339 3300025919 Bacteria 4728
320 Ga0207649_10031037 3300025920 Bacteria 3172
321 Ga0207649_10391254 3300025920 Bacteria 1038
322 Ga0207646_10199890 3300025922 Bacteria 1805
323 Ga0207681_10034578 3300025923 Bacteria 3324
324 Ga0207681_10045824 3300025923 Bacteria 2939
325 Ga0207681_10391546 3300025923 Bacteria 1121
326 Ga0207681_10454590 3300025923 Bacteria 1042
327 Ga0207694_10091602 3300025924 Bacteria 2399
328 Ga0207694_10419035 3300025924 Bacteria 1115
329 Ga0207650_10043385 3300025925 Bacteria 3301
330 Ga0207650_10066890 3300025925 Bacteria 2695
331 Ga0207650_10359840 3300025925 Bacteria 1199
332 Ga0207650_10524974 3300025925 Bacteria 991
333 Ga0207659_10134242 3300025926 Bacteria 1914
334 Ga0207687_10015506 3300025927 Bacteria 4998
335 Ga0207700_10024217 3300025928 Bacteria 4197
336 Ga0207700_10040473 3300025928 Bacteria 3403
337 Ga0207700_10345608 3300025928 Bacteria 1294
338 Ga0207700_11532370 3300025928 Bacteria 591
339 Ga0207664_10017451 3300025929 Bacteria 5263
340 Ga0207644_10009744 3300025931 Bacteria 6317
341 Ga0207644_10265595 3300025931 Bacteria 1373
342 Ga0207644_10528042 3300025931 Bacteria 975
343 Ga0207690_10085841 3300025932 Bacteria 2210
344 Ga0207690_10708846 3300025932 Bacteria 828
345 Ga0207706_10001119 3300025933 Bacteria 27270
346 Ga0207706_10200113 3300025933 Bacteria 1752
347 Ga0207706_10336963 3300025933 Bacteria 1312
348 Ga0207706_10354075 3300025933 Bacteria 1276
349 Ga0207686_10116969 3300025934 Bacteria 1808
350 Ga0207686_10276502 3300025934 Bacteria 1238
351 Ga0207709_10265067 3300025935 Bacteria 1262
352 Ga0207669_10000474 3300025937 Bacteria 17534
353 Ga0207669_10003188 3300025937 Bacteria 7082
354 Ga0207704_10429667 3300025938 Bacteria 1049
355 Ga0207665_10004939 3300025939 Bacteria 8896
356 Ga0207691_10000977 3300025940 Bacteria 28402
357 Ga0207711_10072460 3300025941 Bacteria 2993
358 Ga0207711_10278403 3300025941 Bacteria 1540
359 Ga0207689_10034184 3300025942 Bacteria 4222
360 Ga0207689_11188676 3300025942 Bacteria 642
361 Ga0207679_10061522 3300025945 Bacteria 2795
362 Ga0207679_11130228 3300025945 Bacteria 719
363 Ga0207667_10082355 3300025949 Bacteria 3333
364 Ga0207667_10193949 3300025949 Bacteria 2084
365 Ga0207667_10393007 3300025949 Bacteria 1412
366 Ga0207651_10041578 3300025960 Bacteria 3052
367 Ga0207712_10060821 3300025961 Bacteria 2679
368 Ga0207712_10467543 3300025961 Bacteria 1072
369 Ga0207712_10587557 3300025961 Bacteria 962
370 Ga0207668_10000020 3300025972 Bacteria 140737
371 Ga0207668_10006027 3300025972 Bacteria 7146
372 Ga0207668_10070587 3300025972 Bacteria 2491
373 Ga0207668_10114456 3300025972 Bacteria 2030
374 Ga0207668_10431009 3300025972 Bacteria 1121
375 Ga0207640_10289725 3300025981 Bacteria 1290
376 Ga0207640_10372769 3300025981 Bacteria 1154
377 Ga0207640_11259317 3300025981 Bacteria 659
378 Ga0207658_10000068 3300025986 Bacteria 113745
379 Ga0207658_10005041 3300025986 Bacteria 9093
380 Ga0207677_10004567 3300026023 Bacteria 7447
381 Ga0207703_10000749 3300026035 Bacteria 32046
382 Ga0207703_10005346 3300026035 Bacteria 10340
383 Ga0207703_10456074 3300026035 Bacteria 1195
384 Ga0207639_10001534 3300026041 Bacteria 15510
385 Ga0207639_10002085 3300026041 Bacteria 13453
386 Ga0207639_10021737 3300026041 Bacteria 4611
387 Ga0207639_10302192 3300026041 Bacteria 1415
388 Ga0207639_11222292 3300026041 Bacteria 705
389 Ga0207678_10007310 3300026067 Bacteria 9786
390 Ga0207678_10014829 3300026067 Bacteria 6856
391 Ga0207678_10032842 3300026067 Bacteria 4523
392 Ga0207708_10002666 3300026075 Bacteria 13108
393 Ga0207702_10033718 3300026078 Bacteria 4277
394 Ga0207702_10085430 3300026078 Bacteria 2750
395 Ga0207702_11453487 3300026078 Bacteria 679
396 Ga0207641_10000074 3300026088 Bacteria 145908
397 Ga0207641_10007573 3300026088 Bacteria 9031
398 Ga0207648_10007429 3300026089 Bacteria 10781
399 Ga0207676_10001141 3300026095 Bacteria 20032
400 Ga0207674_10024815 3300026116 Bacteria 6400
401 Ga0207674_10088570 3300026116 Bacteria 3088
402 Ga0207675_100000366 3300026118 Bacteria 43270
403 Ga0207683_10001415 3300026121 Bacteria 21693
404 Ga0207698_10004010 3300026142 Bacteria 8935
405 Ga0207698_10023774 3300026142 Bacteria 4288
406 Ga0209389_1016020 3300027296 Bacteria 6806
407 Ga0209589_1000022 3300027357 Bacteria 180757
408 Ga0209489_120539 3300027361 Bacteria 1872
409 Ga0209700_100021 3300027363 Bacteria 230859
410 Ga0209813_10000071 3300027866 Bacteria 37829
411 Ga0209974_10035634 3300027876 Bacteria 1653
412 Ga0268266_10076211 3300028379 Bacteria 2914
413 Ga0268266_10105981 3300028379 Bacteria 2484
414 Ga0268266_10197813 3300028379 Bacteria 1838
415 Ga0268266_10757939 3300028379 Bacteria 937
416 Ga0268266_11761137 3300028379 Bacteria 594
417 Ga0268265_10067813 3300028380 Bacteria 2763
418 Ga0268265_10538623 3300028380 Bacteria 1106
419 Ga0268265_10575851 3300028380 Bacteria 1072
420 Ga0268264_10008769 3300028381 Bacteria 8389
421 Ga0268264_10016330 3300028381 Bacteria 6080
422 Ga0268264_11715319 3300028381 Bacteria 638
423 Ga0268264_11854518 3300028381 Bacteria 613
424 Ga0307517_10041988 3300028786 Bacteria 4921
425 Ga0316179_1029619 3300030734 Bacteria 619
426 Ga0265325_10016146 3300031241 Bacteria 4178
427 Ga0265325_10123893 3300031241 Bacteria 1243
428 Ga0265325_10134613 3300031241 Bacteria 1180
429 Ga0265340_10000121 3300031247 Bacteria 38466
430 Ga0265340_10398794 3300031247 Bacteria 607
431 Ga0265339_10000777 3300031249 Bacteria 24679
432 Ga0265339_10056840 3300031249 Bacteria 2117
433 Ga0265316_10008812 3300031344 Bacteria 9322
434 Ga0265316_10324546 3300031344 Bacteria 1118
435 Ga0265316_10771321 3300031344 Bacteria 675
436 Ga0307513_10179159 3300031456 Bacteria 1985
437 Ga0307513_10753582 3300031456 Bacteria 679
438 Ga0307513_11026165 3300031456 Bacteria 535
439 Ga0307509_10158201 3300031507 Bacteria 2168
440 Ga0307408_100059593 3300031548 Bacteria 2778
441 Ga0307408_100102136 3300031548 Bacteria 2186
442 Ga0307408_100207781 3300031548 Bacteria 1589
443 Ga0307408_100754174 3300031548 Bacteria 879
444 Ga0307408_101563225 3300031548 Bacteria 625
445 Ga0265313_10003092 3300031595 Bacteria 13805
446 Ga0307508_10000231 3300031616 Bacteria 67806
447 Ga0265314_10192760 3300031711 Bacteria 1211
448 Ga0265314_10577547 3300031711 Bacteria 582
449 Ga0265342_10011115 3300031712 Bacteria 6179
450 Ga0265342_10153568 3300031712 Bacteria 1277
451 Ga0265342_10341933 3300031712 Bacteria 781
452 Ga0316576_10075593 3300031727 Bacteria 2492
453 Ga0316576_10381507 3300031727 Bacteria 1046
454 Ga0307516_10072447 3300031730 Bacteria 3305
455 Ga0307405_10000513 3300031731 Bacteria 14592
456 Ga0307405_10064635 3300031731 Bacteria 2326
457 Ga0307405_10132893 3300031731 Bacteria 1722
458 Ga0307405_10294204 3300031731 Bacteria 1228
459 Ga0307405_10692929 3300031731 Bacteria 843
460 Ga0307405_11218191 3300031731 Bacteria 652
461 Ga0316577_10116717 3300031733 Bacteria 1499
462 Ga0307410_10258304 3300031852 Bacteria 1357
463 Ga0307410_11037888 3300031852 Bacteria 708
464 Ga0307406_10068819 3300031901 Bacteria 2312
465 Ga0307406_10146574 3300031901 Bacteria 1678
466 Ga0307406_10907312 3300031901 Bacteria 750
467 Ga0307412_10001044 3300031911 Bacteria 15823
468 Ga0307412_10017584 3300031911 Bacteria 4281
469 Ga0307412_10046050 3300031911 Bacteria 2855
470 Ga0307412_10069434 3300031911 Bacteria 2398
471 Ga0307412_10152344 3300031911 Bacteria 1708
472 Ga0307412_10513760 3300031911 Bacteria 999
473 Ga0307409_100417314 3300031995 Bacteria 1286
474 Ga0307416_100063784 3300032002 Bacteria 3019
475 Ga0307416_100171021 3300032002 Bacteria 2022
476 Ga0307416_100240573 3300032002 Bacteria 1753
477 Ga0307416_100575118 3300032002 Bacteria 1203
478 Ga0307414_10000144 3300032004 Bacteria 48442
479 Ga0307411_10668480 3300032005 Bacteria 901
480 Ga0307415_100372186 3300032126 Bacteria 1210
481 Ga0307510_10009032 3300033180 Bacteria 11869
482 Ga0316596_1027815 3300033541 Bacteria 1460
483 Ga0373944_0035769 3300035089 Bacteria 1515
484 Ga0373953_0041552 3300035117 Bacteria 1830
485 Ga0373956_0349754 3300035119 Bacteria 704
486 Ga0373955_0316542 3300035172 Bacteria 942
487 Ga0373962_0176425 3300035242 Bacteria 712
488 Ga0316574_0000378 3300035398 Bacteria 17299
489 Ga0316574_0014560 3300035398 Bacteria 4547
490 Ga0316574_0350241 3300035398 Bacteria 934
491 Ga0373931_0027302 3300035691 Bacteria 2914
492 Ga0373931_0060596 3300035691 Bacteria 2038
493 Ga0373927_0451143 3300035695 Bacteria 849
494 Ga0373933_0158858 3300035724 Bacteria 1435
495 Ga0373937_0460722 3300036401 Bacteria 1207
496 Ga0373937_0870066 3300036401 Bacteria 850
497 Ga0316584_0045154 3300036712 Bacteria 3288
498 Ga0316584_0112334 3300036712 Bacteria 2039
499 Ga0373925_0020370 3300037068 Bacteria 4828
500 Ga0373925_0075831 3300037068 Bacteria 2549
501 Ga0373925_1344119 3300037068 Bacteria 586
502 Ga0395899_0009726 3300037312 Bacteria 7380
503 Ga0395899_0207424 3300037312 Bacteria 1363
504 Ga0395900_0018719 3300037418 Bacteria 7062
505 Ga0395900_0044529 3300037418 Bacteria 4572
506 Ga0395900_0105682 3300037418 Bacteria 2892
507 Ga0395900_0211011 3300037418 Bacteria 1961
508 Ga0395900_0462872 3300037418 Bacteria 1223
509 Ga0395900_0545803 3300037418 Bacteria 1104
510 Ga0395900_0752058 3300037418 Bacteria 905
511 Ga0395900_1065253 3300037418 Bacteria 726
512 Ga0395898_0008316 3300037466 Bacteria 10971
513 Ga0395898_0013963 3300037466 Bacteria 8254
514 Ga0395898_0018445 3300037466 Bacteria 7115
515 Ga0395898_0077993 3300037466 Bacteria 3197
516 Ga0395898_0133062 3300037466 Bacteria 2381
517 Ga0395898_0386796 3300037466 Bacteria 1334
518 Ga0395905_0617609 3300037471 Bacteria 986
519 Ga0395901_0005378 3300038443 Bacteria 12951
520 Ga0395901_0048533 3300038443 Bacteria 4409
521 Ga0395901_0055412 3300038443 Bacteria 4123
522 Ga0395901_0131330 3300038443 Bacteria 2632
523 Ga0395901_0320981 3300038443 Bacteria 1602
524 Ga0395901_0590738 3300038443 Bacteria 1121
525 Ga0400489_52572 3300039093 Bacteria 2105
526 Ga0436365_0249655 3300039437 Bacteria 887
527 Ga0436365_1209249 3300039437 Bacteria 8241
528 Ga0436365_1348843 3300039437 Bacteria 841
529 Ga0436360_0152696 3300039438 Bacteria 942
530 Ga0436360_0155171 3300039438 Bacteria 644
531 Ga0436360_0225540 3300039438 Bacteria 634
532 Ga0436360_0289570 3300039438 Bacteria 973
533 Ga0436360_0510880 3300039438 Bacteria 4739
534 Ga0436360_0700499 3300039438 Bacteria 557
535 Ga0436360_0722024 3300039438 Bacteria 2404
536 Ga0436360_0768310 3300039438 Bacteria 1152
537 Ga0436361_0208690 3300039447 Bacteria 2168
538 Ga0436361_0891828 3300039447 Bacteria 716
539 Ga0436361_0974856 3300039447 Bacteria 778
540 Ga0436363_0043667 3300039450 Bacteria 698
541 Ga0436363_0848488 3300039450 Bacteria 1830
542 Ga0436363_1289101 3300039450 Bacteria 738
543 Ga0436362_0337065 3300039453 Bacteria 1951
544 Ga0436362_0724793 3300039453 Bacteria 1083
545 Ga0436362_1145969 3300039453 Bacteria 1331
546 Ga0439466_0220801 3300041411 Bacteria 575
547 Ga0439465_0182860 3300041413 Bacteria 759
548 Ga0451797_1497932 3300041453 Bacteria 722
549 Ga0451853_2582518 3300041512 Bacteria 895
550 Ga0439460_0247836 3300042461 Bacteria 615
551 Ga0451577_0350291 3300042876 Bacteria 1340
552 Ga0466966_0158171 3300044684 Bacteria 1380
553 Ga0466963_0317275 3300044694 Bacteria 1096
554 Ga0466963_0855021 3300044694 Bacteria 641
555 Ga0466964_0268438 3300044706 Bacteria 848
556 Ga0466957_0078717 3300044842 Bacteria 2050
557 Ga0466957_0235959 3300044842 Bacteria 1212
558 Ga0466957_0809692 3300044842 Bacteria 666
559 Ga0451576_1782262 3300045051 Bacteria 637
560 Ga0466958_0026210 3300045836 Bacteria 3444
561 Ga0466958_0295754 3300045836 Bacteria 1039
562 Ga0466958_0718263 3300045836 Bacteria 651
563 Ga0495627_058172 3300046453 Bacteria 1149
564 Ga0495592_0561332 3300046454 Bacteria 701
565 Ga0495603_0099964 3300046455 Bacteria 1694
566 Ga0495590_0136758 3300046457 Bacteria 883
567 Ga0495629_0068181 3300046459 Bacteria 2482
568 Ga0495638_0000018 3300046460 Bacteria 389696
569 Ga0495638_0013078 3300046460 Bacteria 5666
570 Ga0495641_0076951 3300046461 Bacteria 1496
571 Ga0495651_0104502 3300046462 Bacteria 2103
572 Ga0495653_0720274 3300046463 Bacteria 605
573 Ga0495650_0004591 3300046471 Bacteria 9387
574 Ga0495662_0264893 3300046476 Bacteria 846
575 Ga0495584_0133858 3300046491 Bacteria 1258
576 Ga0495585_0053054 3300046492 Bacteria 2244
577 Ga0495607_0475942 3300046501 Bacteria 557
578 Ga0495616_0124137 3300046513 Bacteria 1189
579 Ga0495620_0090829 3300046515 Bacteria 1225
580 Ga0495632_0000049 3300046519 Bacteria 134597
581 Ga0495632_0008303 3300046519 Bacteria 6395
582 Ga0495637_0003069 3300046520 Bacteria 8917
583 Ga0495643_0000061 3300046522 Bacteria 185933
584 Ga0495643_0011319 3300046522 Bacteria 5437
585 Ga0495644_0192941 3300046523 Bacteria 784
586 Ga0495648_0001815 3300046524 Bacteria 20563
587 Ga0495663_0000009 3300046525 Bacteria 256308
588 Ga0495652_0389848 3300046529 Bacteria 989
589 Ga0495640_0119778 3300046533 Bacteria 1712
590 Ga0495587_0233734 3300046536 Bacteria 1036
591 Ga0495598_0023066 3300046537 Bacteria 1672
592 Ga0495609_0129536 3300046538 Bacteria 1081
593 Ga0495633_0000264 3300046558 Bacteria 62296
594 Ga0495633_0000862 3300046558 Bacteria 26407
595 Ga0495633_0011582 3300046558 Bacteria 4746
596 Ga0495633_0042454 3300046558 Bacteria 2159
597 Ga0495667_0129988 3300046559 Bacteria 1625
598 Ga0495668_0300888 3300046616 Bacteria 879
599 Ga0495634_0483307 3300046642 Bacteria 727
600 Ga0495625_0000583 3300046660 Bacteria 53056
601 Ga0495625_0011321 3300046660 Bacteria 7283
602 Ga0495625_0327018 3300046660 Bacteria 975
603 Ga0495635_0627422 3300046663 Bacteria 700
604 Ga0495661_0178253 3300046665 Bacteria 1128
605 Ga0495657_0085909 3300046675 Bacteria 2028
606 Ga0495670_0002209 3300046691 Bacteria 9614
607 Ga0495671_0000011 3300046692 Bacteria 365582
608 Ga0495671_0000036 3300046692 Bacteria 181192
609 Ga0495649_0156476 3300046694 Bacteria 1196
610 Ga0495589_0233741 3300046794 Bacteria 861
611 Ga0495600_0028150 3300046809 Bacteria 3635
612 Ga0495660_0136192 3300046810 Bacteria 1227
613 Ga0495604_0479136 3300047317 Bacteria 810
614 Ga0495676_0103330 3300047321 Bacteria 2104
615 Ga0495676_0365182 3300047321 Bacteria 963
616 Ga0495680_0760628 3300047322 Bacteria 636
617 Ga0495687_000224 3300047443 Bacteria 79719
618 Ga0495673_0000088 3300047469 Bacteria 189812
619 Ga0495681_0014061 3300047470 Bacteria 4612
620 Ga0495684_0086184 3300047471 Bacteria 2381
621 Ga0495686_0008764 3300047472 Bacteria 7373
622 Ga0495686_0070254 3300047472 Bacteria 2158
623 Ga0495602_0109610 3300048088 Bacteria 2245
624 Ga0495602_0244915 3300048088 Bacteria 1339
625 Ga0495626_0338852 3300048091 Bacteria 588
626 Ga0496100_0035676 3300048903 Bacteria 3130
627 Ga0496100_0180625 3300048903 Bacteria 1526
628 Ga0496100_0223598 3300048903 Bacteria 1382
629 Ga0496100_0606847 3300048903 Bacteria 850
630 Ga0496101_0009057 3300048904 Bacteria 6528
631 Ga0496101_0025933 3300048904 Bacteria 4071
632 Ga0496101_0038167 3300048904 Bacteria 3410
633 Ga0496101_0099473 3300048904 Bacteria 2174
634 Ga0496101_1216513 3300048904 Bacteria 590
635 Ga0496102_0002315 3300048905 Bacteria 16265
636 Ga0496102_0018363 3300048905 Bacteria 6144
637 Ga0496102_0068148 3300048905 Bacteria 3265
638 Ga0496102_0088926 3300048905 Bacteria 2856
639 Ga0496102_0097500 3300048905 Bacteria 2727
640 Ga0496102_0301447 3300048905 Bacteria 1510
641 Ga0496102_0996383 3300048905 Bacteria 758
642 Ga0496103_0005448 3300048906 Bacteria 7611
643 Ga0496103_0420569 3300048906 Bacteria 858
644 Ga0496103_0548184 3300048906 Bacteria 738
645 Ga0496104_0013577 3300048907 Bacteria 7341
646 Ga0496104_0017311 3300048907 Bacteria 6560
647 Ga0496104_0018021 3300048907 Bacteria 6438
648 Ga0496104_0177350 3300048907 Bacteria 2041
649 Ga0496104_0626938 3300048907 Bacteria 985
650 Ga0496105_0010623 3300048908 Bacteria 7243
651 Ga0496105_0057105 3300048908 Bacteria 3223
652 Ga0496105_0068273 3300048908 Bacteria 2936
653 Ga0496105_0979838 3300048908 Bacteria 633
654 Ga0496106_0003091 3300048909 Bacteria 12419
655 Ga0496106_0007079 3300048909 Bacteria 8288
656 Ga0496106_0021813 3300048909 Bacteria 4757
657 Ga0496106_0040065 3300048909 Bacteria 3507
658 Ga0496107_0004660 3300048910 Bacteria 9306
659 Ga0496107_0011907 3300048910 Bacteria 6075
660 Ga0496107_0046850 3300048910 Bacteria 3112
661 Ga0496107_0103468 3300048910 Bacteria 2089
662 Ga0496108_0013809 3300048911 Bacteria 6588
663 Ga0496108_0025155 3300048911 Bacteria 4904
664 Ga0496108_0034366 3300048911 Bacteria 4212
665 Ga0496108_0037603 3300048911 Bacteria 4033
666 Ga0496108_0119130 3300048911 Bacteria 2263
667 Ga0496108_0132772 3300048911 Bacteria 2140
668 Ga0496108_0156716 3300048911 Bacteria 1967
669 Ga0496108_0179741 3300048911 Bacteria 1832
670 Ga0496108_0181726 3300048911 Bacteria 1821
671 Ga0496108_1683940 3300048911 Bacteria 522
672 Ga0496109_0005494 3300048912 Bacteria 10610
673 Ga0496109_0014810 3300048912 Bacteria 6786
674 Ga0496109_0016058 3300048912 Bacteria 6543
675 Ga0496109_0019497 3300048912 Bacteria 5985
676 Ga0496109_0056139 3300048912 Bacteria 3593
677 Ga0496109_0214301 3300048912 Bacteria 1811
678 Ga0496109_0944506 3300048912 Bacteria 800
679 Ga0496110_0028061 3300048913 Bacteria 4830
680 Ga0496110_0030497 3300048913 Bacteria 4649
681 Ga0496110_0043503 3300048913 Bacteria 3921
682 Ga0496110_0045137 3300048913 Bacteria 3850
683 Ga0496110_0057057 3300048913 Bacteria 3437
684 Ga0496110_0084076 3300048913 Bacteria 2840
685 Ga0496110_0326120 3300048913 Bacteria 1398
686 Ga0496110_0503692 3300048913 Bacteria 1102
687 Ga0496111_0000494 3300048914 Bacteria 20303
688 Ga0496111_0078615 3300048914 Bacteria 2405
689 Ga0496111_0346461 3300048914 Bacteria 1100
690 Ga0496111_0358962 3300048914 Bacteria 1078
691 Ga0496112_0004889 3300048915 Bacteria 11460
692 Ga0496112_0005811 3300048915 Bacteria 10736
693 Ga0496112_0018775 3300048915 Bacteria 6516
694 Ga0496112_0042754 3300048915 Bacteria 4434
695 Ga0496112_0047785 3300048915 Bacteria 4198
696 Ga0496112_0499660 3300048915 Bacteria 1152
697 Ga0496113_0000564 3300048916 Bacteria 18422
698 Ga0496113_0004958 3300048916 Bacteria 8246
699 Ga0496113_0014413 3300048916 Bacteria 5391
700 Ga0496113_0029541 3300048916 Bacteria 3960
701 Ga0496114_0062341 3300048917 Bacteria 3120
702 Ga0496114_0100809 3300048917 Bacteria 2464
703 Ga0496114_0373693 3300048917 Bacteria 1262
704 Ga0496114_1026726 3300048917 Bacteria 708
705 Ga0496115_0005148 3300048918 Bacteria 9512
706 Ga0496115_0019809 3300048918 Bacteria 5182
707 Ga0496115_0021939 3300048918 Bacteria 4938
708 Ga0496118_0091571 3300048921 Bacteria 2091
709 Ga0496119_0000289 3300048922 Bacteria 70660
710 Ga0496121_0017735 3300048924 Bacteria 7243
711 Ga0496122_0009301 3300048925 Bacteria 10387
712 Ga0496122_0009638 3300048925 Bacteria 10111
713 Ga0496122_0076669 3300048925 Bacteria 2352
714 Ga0496122_0138127 3300048925 Bacteria 1531
715 Ga0496123_0000210 3300048926 Bacteria 118956
716 Ga0496123_0013341 3300048926 Bacteria 6909
717 Ga0496124_0083993 3300048927 Bacteria 2612
718 Ga0496124_0148948 3300048927 Bacteria 1838
719 Ga0496125_0002768 3300048928 Bacteria 22192
720 Ga0496125_0049956 3300048928 Bacteria 3468
721 Ga0496125_0286231 3300048928 Bacteria 1018
722 Ga0496126_0003507 3300048929 Bacteria 19762
723 Ga0496126_0050477 3300048929 Bacteria 3790
724 Ga0501031_0027805 3300049568 Bacteria 3687
725 Ga0501032_0009941 3300049569 Bacteria 6868
726 Ga0501032_0022734 3300049569 Bacteria 4344
727 Ga0501032_0081002 3300049569 Bacteria 2160
728 Ga0501033_0043064 3300049570 Bacteria 3363
729 Ga0501034_0000013 3300049571 Bacteria 297898
730 Ga0501034_0022049 3300049571 Bacteria 6488
731 Ga0501034_0056146 3300049571 Bacteria 3963
732 Ga0501034_0073901 3300049571 Bacteria 3418
733 Ga0501034_0086697 3300049571 Bacteria 3131
734 Ga0501034_0139124 3300049571 Bacteria 2408
735 Ga0501034_0166299 3300049571 Bacteria 2174
736 Ga0501034_0276555 3300049571 Bacteria 1619
737 Ga0501034_0358334 3300049571 Bacteria 1386
738 Ga0501034_0439697 3300049571 Bacteria 1223
739 Ga0501034_0500931 3300049571 Bacteria 1128
740 Ga0501036_0199757 3300049572 Bacteria 1682
741 Ga0501036_0620113 3300049572 Bacteria 896
742 Ga0501036_1029732 3300049572 Bacteria 673
743 Ga0501037_0031279 3300049573 Bacteria 3929
744 Ga0501037_0215217 3300049573 Bacteria 1354
745 Ga0501037_0448206 3300049573 Bacteria 881
746 Ga0501038_0027985 3300049574 Bacteria 5008
747 Ga0501038_0067518 3300049574 Bacteria 3042
748 Ga0501038_0303037 3300049574 Bacteria 1254
749 Ga0501039_0016701 3300049575 Bacteria 5624
750 Ga0501039_1052149 3300049575 Bacteria 631
751 Ga0501040_0497323 3300049576 Bacteria 879
752 Ga0501040_0632286 3300049576 Bacteria 773
753 Ga0501041_0074735 3300049577 Bacteria 2083
754 Ga0501042_0880278 3300049578 Bacteria 652
755 Ga0501043_0043209 3300049579 Bacteria 3542
756 Ga0501046_0000592 3300049580 Bacteria 35637
757 Ga0501046_0001115 3300049580 Bacteria 26209
758 Ga0501046_0003713 3300049580 Bacteria 13974
759 Ga0501046_0322593 3300049580 Bacteria 1125
760 Ga0501047_0000290 3300049581 Bacteria 57649
761 Ga0501047_0106810 3300049581 Bacteria 2680
762 Ga0501047_0177055 3300049581 Bacteria 2000
763 Ga0501047_0464977 3300049581 Bacteria 1093
764 Ga0501047_0522900 3300049581 Bacteria 1012
765 Ga0501047_0556999 3300049581 Bacteria 970
766 Ga0501048_0031001 3300049582 Bacteria 3870
767 Ga0501048_0374745 3300049582 Bacteria 1016
768 Ga0501048_0422287 3300049582 Bacteria 954
769 Ga0501048_0572248 3300049582 Bacteria 811
770 Ga0501067_0000905 3300049583 Bacteria 15942
771 Ga0501067_0001682 3300049583 Bacteria 12159
772 Ga0501067_0011601 3300049583 Bacteria 4881
773 Ga0501067_0038503 3300049583 Bacteria 2655
774 Ga0501067_0311226 3300049583 Bacteria 877
775 Ga0501067_0395251 3300049583 Bacteria 771
776 Ga0501068_0193043 3300049584 Bacteria 1290
777 Ga0501068_0217536 3300049584 Bacteria 1214
778 Ga0501068_0572046 3300049584 Bacteria 735
779 Ga0501069_0058754 3300049585 Bacteria 2145
780 Ga0501070_0006581 3300049586 Bacteria 9891
781 Ga0501070_0018455 3300049586 Bacteria 5852
782 Ga0501070_0159733 3300049586 Bacteria 1858
783 Ga0501070_0251047 3300049586 Bacteria 1447
784 Ga0501070_0360258 3300049586 Bacteria 1180
785 Ga0501070_0519848 3300049586 Bacteria 955
786 Ga0501070_0739244 3300049586 Bacteria 776
787 Ga0501071_0088372 3300049587 Bacteria 2274
788 Ga0501072_0101282 3300049588 Bacteria 2289
789 Ga0501072_0175643 3300049588 Bacteria 1709
790 Ga0501072_0195973 3300049588 Bacteria 1611
791 Ga0501073_0030029 3300049589 Bacteria 3882
792 Ga0501073_0038480 3300049589 Bacteria 3392
793 Ga0501073_0041744 3300049589 Bacteria 3241
794 Ga0501073_0111206 3300049589 Bacteria 1900
795 Ga0501073_0397629 3300049589 Bacteria 952
796 Ga0501074_0283913 3300049590 Bacteria 1177
797 Ga0501074_0438352 3300049590 Bacteria 926
798 Ga0501075_0218519 3300049591 Bacteria 1454
799 Ga0501075_0292736 3300049591 Bacteria 1240
800 Ga0501075_0395782 3300049591 Bacteria 1053
801 Ga0501076_0122692 3300049592 Bacteria 2104
802 Ga0501076_0216193 3300049592 Bacteria 1567
803 Ga0501076_0285055 3300049592 Bacteria 1353
804 Ga0501076_0351930 3300049592 Bacteria 1210
805 Ga0501077_0163160 3300049593 Bacteria 1415
806 Ga0501223_001272 3300049663 Bacteria 5865
807 Ga0501225_0001724 3300049705 Bacteria 6846
808 Ga0501079_0289942 3300049741 Bacteria 1280
809 Ga0501079_0474767 3300049741 Bacteria 983
810 Ga0501080_0000003 3300049742 Bacteria 214890
811 Ga0501080_0027908 3300049742 Bacteria 5249
812 Ga0501080_0040117 3300049742 Bacteria 4368
813 Ga0501080_0124785 3300049742 Bacteria 2385
814 Ga0501080_0132656 3300049742 Bacteria 2306
815 Ga0501080_0486532 3300049742 Bacteria 1104
816 Ga0501080_0504464 3300049742 Bacteria 1081
817 Ga0501080_0645869 3300049742 Bacteria 937
818 Ga0501081_0020121 3300049743 Bacteria 4449
819 Ga0501081_0280779 3300049743 Bacteria 1219
820 Ga0501083_0022378 3300049744 Bacteria 4387
821 Ga0501083_0124156 3300049744 Bacteria 1692
822 Ga0501083_0183606 3300049744 Bacteria 1365
823 Ga0501083_0558867 3300049744 Bacteria 745
824 Ga0501035_0000384 3300049822 Bacteria 50737
825 Ga0501035_0084267 3300049822 Bacteria 2803
826 Ga0501035_0918629 3300049822 Bacteria 692
827 Ga0501044_0000570 3300049823 Bacteria 44794
828 Ga0501044_0025210 3300049823 Bacteria 6305
829 Ga0501044_0031555 3300049823 Bacteria 5576
830 Ga0501044_0035407 3300049823 Bacteria 5228
831 Ga0501044_0152904 3300049823 Bacteria 2289
832 Ga0501044_0289359 3300049823 Bacteria 1570
833 Ga0501044_0535068 3300049823 Bacteria 1070
834 Ga0501045_0548708 3300049824 Bacteria 857
835 Ga0501045_0882223 3300049824 Bacteria 657
836 nmdc:mga03683_108270_c1 3300050489 Bacteria 1226
837 nmdc:mga03683_40402_c1 3300050489 Bacteria 1913
838 nmdc:mga03683_73469_c1 3300050489 Bacteria 1466
839 nmdc:mga00v17_41449_c1 3300050491 Bacteria 2765
840 nmdc:mga00v17_805241_c1 3300050491 Bacteria 598
841 nmdc:mga0yw44_21491_c1 3300050492 Bacteria 3601
842 nmdc:mga0yw44_217329_c1 3300050492 Bacteria 1266
843 nmdc:mga0yw44_5612_c1 3300050492 Bacteria 5963
844 nmdc:mga0yw44_95785_c1 3300050492 Bacteria 1883
845 nmdc:mga06z11_115394_c1 3300050494 Bacteria 1492
846 nmdc:mga06z11_25_c1 3300050494 Bacteria 65281
847 nmdc:mga06z11_489065_c1 3300050494 Bacteria 745
848 nmdc:mga05p37_127965_c1 3300050507 Bacteria 3118
849 nmdc:mga05p37_17127_c1 3300050507 Bacteria 8743
850 nmdc:mga05p37_239692_c1 3300050507 Bacteria 2181
851 nmdc:mga05p37_88120_c1 3300050507 Bacteria 3826
852 nmdc:mga09592_297517_c1 3300050508 Bacteria 1399
853 nmdc:mga09592_633844_c1 3300050508 Bacteria 914
854 nmdc:mga0qj67_46923_c1 3300050509 Bacteria 3411
855 nmdc:mga06r32_130904_c1 3300050510 Bacteria 2481
856 nmdc:mga06r32_245502_c1 3300050510 Bacteria 1778
857 nmdc:mga06r32_4388_c1 3300050510 Bacteria 12616
858 nmdc:mga06r32_761788_c1 3300050510 Bacteria 931
859 nmdc:mga08y16_479610_c1 3300050511 Bacteria 1266
860 nmdc:mga0n895_103401_c1 3300050512 Bacteria 2860
861 nmdc:mga0n895_144251_c1 3300050512 Bacteria 2410
862 nmdc:mga0n895_364655_c1 3300050512 Bacteria 1463
863 nmdc:mga0n895_581178_c1 3300050512 Bacteria 1124
864 nmdc:mga0n895_72373_c2 3300050512 Bacteria 2949
865 nmdc:mga0rr50_114657_c1 3300050513 Bacteria 2137
866 nmdc:mga0rr50_1525825_c1 3300050513 Bacteria 565
867 nmdc:mga0rr50_771632_c1 3300050513 Bacteria 820
868 nmdc:mga08x19_236991_c1 3300050514 Bacteria 1257
869 nmdc:mga0a205_171087_c1 3300050515 Bacteria 2068
870 nmdc:mga0a205_21217_c1 3300050515 Bacteria 6142
871 nmdc:mga0a205_265388_c1 3300050515 Bacteria 1594
872 nmdc:mga0a205_53061_c1 3300050515 Bacteria 3912
873 Ga0495601_0044662 3300053077 Bacteria 2785
874 Ga0495601_0685312 3300053077 Bacteria 654
875 Ga0495612_0055835 3300053078 Bacteria 1629
876 Ga0500635_0053863 3300053080 Bacteria 1385
877 Ga0495655_0032310 3300053083 Bacteria 1279
878 Ga0495595_0028737 3300053084 Bacteria 2485
879 Ga0495595_0094409 3300053084 Bacteria 1438
880 Ga0495619_0104291 3300053085 Bacteria 1932
881 Ga0495619_0120672 3300053085 Bacteria 1797
882 Ga0495619_0137487 3300053085 Bacteria 1681
883 Ga0500643_014103 3300053087 Bacteria 2792
884 Ga0500643_042874 3300053087 Bacteria 1321
885 Ga0500643_087793 3300053087 Bacteria 850
886 Ga0500566_0019670 3300053094 Bacteria 3965
887 Ga0500640_256626 3300053095 Bacteria 556
888 Ga0500555_052461 3300053103 Bacteria 1113
889 Ga0500556_0000009 3300053104 Bacteria 288111
890 Ga0500556_0000040 3300053104 Bacteria 137489
891 Ga0500562_006970 3300053108 Bacteria 2850
892 Ga0500572_002705 3300053111 Bacteria 4198
893 Ga0500595_013801 3300053119 Bacteria 3086
894 Ga0500608_009850 3300053122 Bacteria 4076
895 Ga0500614_177525 3300053123 Bacteria 650
896 Ga0500642_0000003 3300053130 Bacteria 544899
897 Ga0500652_063656 3300053131 Bacteria 1522
898 Ga0500559_0045548 3300053136 Bacteria 1921
899 Ga0500573_0001876 3300053140 Bacteria 10257
900 Ga0500616_0041627 3300053153 Bacteria 2464
901 Ga0500616_0068808 3300053153 Bacteria 1812
902 Ga0500624_000045 3300053157 Bacteria 89838
903 Ga0500624_000049 3300053157 Bacteria 81103
904 Ga0500627_0049624 3300053158 Bacteria 1826
905 Ga0500630_025728 3300053159 Bacteria 2903
906 Ga0500639_001271 3300053163 Bacteria 12769
907 Ga0500636_0017859 3300053177 Bacteria 4192
908 Ga0500636_0030741 3300053177 Bacteria 3178
909 Ga0500645_024129 3300053730 Bacteria 1860
910 Ga0500645_054489 3300053730 Bacteria 1163
911 Ga0501084_0008472 3300054114 Bacteria 8504
912 Ga0501084_0222497 3300054114 Bacteria 1592
913 Ga0501084_0387471 3300054114 Bacteria 1181
914 Ga0501084_0483026 3300054114 Bacteria 1047
915 Ga0501084_0605467 3300054114 Bacteria 926
916 Ga0501084_1188474 3300054114 Bacteria 640
917 Ga0501084_1273046 3300054114 Bacteria 617
918 Ga0501082_0022108 3300060353 Bacteria 5482
919 Ga0501082_0025530 3300060353 Bacteria 5091
920 Ga0501082_0062191 3300060353 Bacteria 3213
921 Ga0501082_0168253 3300060353 Bacteria 1905
922 Ga0501082_0192668 3300060353 Bacteria 1773
923 Ga0501082_1012158 3300060353 Bacteria 726
924 Ga0501082_1055990 3300060353 Bacteria 710
925 Ga0530510_0014972 3300061734 Bacteria 5477
926 Ga0530510_0088348 3300061734 Bacteria 2259
927 Ga0530510_0112336 3300061734 Bacteria 1996
928 Ga0530510_0202283 3300061734 Bacteria 1475
929 Ga0530510_0248657 3300061734 Bacteria 1325
930 Ga0530510_0391688 3300061734 Bacteria 1046
931 Ga0070708_100397599
932 SwRhRL2b_contig_1308435
933 JGI24736J21556_1000469
934 JGI24746J21847_1002318
935 JGI24747J21853_1026391
936 JGI24740J21852_10049680
937 JGI24737J22298_10004151
938 JGI24737J22298_10148771
939 JGI24735J21928_10004647
940 JGI24750J21931_1000848
941 JGI24745J21846_1017104
942 JGI24748J21848_1001096
943 JGI24738J21930_10000674
944 JGI24749J21850_1002350
945 JGI24744J21845_10000459
946 JGI24033J26618_1001826
947 JGI24742J22300_10003845
948 JGI24742J22300_10032263
949 JGI24751J29686_10003221
950 JGI25406J46586_10004353
951 JGI25165J46597_1000041
952 JGI25407J50210_10124764
953 Ga0055530_10001188
954 Ga0055531_10001182
955 JGI25405J52794_10001004
956 Ga0065165_1003786
957 Ga0065704_10002136
958 Ga0065712_10076047
959 Ga0065715_10096277
960 Ga0070690_100231859
961 Ga0070670_100061841
962 Ga0070670_100186711
963 Ga0068869_100994939
964 Ga0070666_10023515
965 Ga0070666_10145194
966 Ga0070666_10309560
967 Ga0070680_100409186
968 Ga0070680_100743222
969 Ga0070682_100024507
970 Ga0068868_100053715
971 Ga0068868_101315834
972 Ga0070660_100092540
973 Ga0070660_100106546
974 Ga0070689_100004610
975 Ga0070689_101253761
976 Ga0070691_10079831
977 Ga0070691_10248118
978 Ga0070687_100007225
979 Ga0070661_100023471
980 Ga0070661_100112141
981 Ga0070692_10022848
982 Ga0070668_100000010
983 Ga0070668_100016202
984 Ga0070668_100087407
985 Ga0070668_100122212
986 Ga0070668_100145088
987 Ga0070669_100015953
988 Ga0070669_100275541
989 Ga0070669_101818405
990 Ga0070675_100039194
991 Ga0070675_100275452
992 Ga0070671_100018333
993 Ga0070671_100166306
994 Ga0070671_100642197
995 Ga0070674_100001953
996 Ga0070674_100011062
997 Ga0070674_101554764
998 Ga0070673_100033931
999 Ga0070688_100191034
1000 Ga0070688_100604313
1001 Ga0070659_100029462
1002 Ga0070659_100517441
1003 Ga0070659_100992794
1004 Ga0070667_100000013
1005 Ga0070667_100059106
1006 Ga0070709_11088539
1007 Ga0070713_100112794
1008 Ga0070710_10032843
1009 Ga0070701_10014832
1010 Ga0070711_100054944
1011 Ga0070711_101049494
1012 Ga0070711_101528692
1013 Ga0070705_100012708
1014 Ga0070705_100076984
1015 Ga0070700_100051429
1016 Ga0070694_100148281
1017 Ga0070663_100017388
1018 Ga0070663_100045120
1019 Ga0070663_100069461
1020 Ga0070678_100168505
1021 Ga0070662_100003080
1022 Ga0070662_100175324
1023 Ga0070662_101008481
1024 Ga0070681_11184557
1025 Ga0068867_100038190
1026 Ga0070685_10002290
1027 Ga0070707_101066339
1028 Ga0070698_100280396
1029 Ga0070698_100311316
1030 Ga0070679_100370783
1031 Ga0070679_100498457
1032 Ga0070684_100043853
1033 Ga0068853_100038701
1034 Ga0068853_100583716
1035 Ga0068853_100704133
1036 Ga0070672_100001270
1037 Ga0070686_100005738
1038 Ga0070695_100378240
1039 Ga0070696_100048816
1040 Ga0070696_100113008
1041 Ga0070696_100732098
1042 Ga0070693_100048051
1043 Ga0070665_100108729
1044 Ga0070665_100114000
1045 Ga0070665_100775494
1046 Ga0070665_102169407
1047 Ga0070704_100037328
1048 Ga0070704_100301477
1049 Ga0068855_100939750
1050 Ga0070664_100030051
1051 Ga0070664_100122682
1052 Ga0070664_101131941
1053 Ga0070664_101523869
1054 Ga0068857_100448519
1055 Ga0068854_100025737
1056 Ga0068854_100423270
1057 Ga0068856_100009471
1058 Ga0068856_100037704
1059 Ga0068856_100102901
1060 Ga0068856_100347030
1061 Ga0068856_101329519
1062 Ga0070702_100009964
1063 Ga0070702_100380961
1064 Ga0068852_100023635
1065 Ga0068852_100237795
1066 Ga0068859_100033400
1067 Ga0068859_100035480
1068 Ga0068859_101086847
1069 Ga0068864_100021549
1070 Ga0068866_10098752
1071 Ga0068866_10125379
1072 Ga0068861_100086054
1073 Ga0068861_100126163
1074 Ga0068851_10002776
1075 Ga0068851_10022475
1076 Ga0068851_10077392
1077 Ga0068870_10001959
1078 Ga0068863_100000130
1079 Ga0068863_100001004
1080 Ga0068858_100002907
1081 Ga0068858_100039732
1082 Ga0068858_100547849
1083 Ga0068860_100021228
1084 Ga0068860_100042367
1085 Ga0068862_100096039
1086 Ga0068862_100562227
1087 Ga0068862_100666574
1088 Ga0081455_10012820
1089 Ga0081455_10018926
1090 Ga0081538_10006183
1091 Ga0081538_10087746
1092 Ga0081540_1006467
1093 Ga0081540_1031025
1094 Ga0081540_1126403
1095 Ga0070717_10015726
1096 Ga0070717_10103663
1097 Ga0070717_10174380
1098 Ga0070717_10752757
1099 Ga0075365_10080553
1100 Ga0075365_10248907
1101 Ga0075365_10471635
1102 Ga0075365_10625046
1103 Ga0075365_10890589
1104 Ga0075368_10000432
1105 Ga0075368_10094419
1106 Ga0075363_100041327
1107 Ga0075363_100206408
1108 Ga0075364_10076564
1109 Ga0075364_10146185
1110 Ga0070715_10001746
1111 Ga0070716_100003116
1112 Ga0070712_100388040
1113 Ga0075362_10004001
1114 Ga0075362_10058451
1115 Ga0075367_10008152
1116 Ga0075366_10047067
1117 Ga0075370_10014545
1118 Ga0075370_10088087
1119 Ga0068871_100089003
1120 Ga0075428_100164358
1121 Ga0075430_100541980
1122 Ga0075431_100004484
1123 Ga0075433_10373469
1124 Ga0075433_10425777
1125 Ga0075434_100057055
1126 Ga0075434_100082600
1127 Ga0075434_100127891
1128 Ga0075429_100212269
1129 Ga0068865_100816311
1130 Ga0075436_100149175
1131 Ga0075436_100213385
1132 Ga0097620_100033400
1133 Ga0097620_100035479
1134 Ga0097620_101086905
1135 Ga0099823_1137254
1136 Ga0075435_100735609
1137 Ga0075435_101004216
1138 Ga0099794_10265146
1139 Ga0105251_10128139
1140 Ga0105250_10065091
1141 Ga0105250_10072108
1142 Ga0105240_10134042
1143 Ga0105240_10139458
1144 Ga0111539_10045279
1145 Ga0111539_10068395
1146 Ga0111539_10428944
1147 Ga0105245_10775797
1148 Ga0105245_11029036
1149 Ga0105247_10008832
1150 Ga0105247_10019109
1151 Ga0105247_10631438
1152 Ga0114129_10006400
1153 Ga0114129_10020510
1154 Ga0114129_10252747
1155 Ga0105243_10301107
1156 Ga0105243_10625964
1157 Ga0105243_11503365
1158 Ga0105241_10017640
1159 Ga0105241_10535360
1160 Ga0105242_10188649
1161 Ga0105242_10298627
1162 Ga0105248_10007785
1163 Ga0105237_10025821
1164 Ga0105237_10029660
1165 Ga0105238_10097867
1166 Ga0105238_10220857
1167 Ga0105238_10605894
1168 Ga0105249_10156420
1169 Ga0105249_10169198
1170 Ga0105249_10406957
1171 Ga0105148_100189
1172 Ga0105148_109326
1173 Ga0105029_115183
1174 Ga0105239_10023131
1175 Ga0105239_10049433
1176 Ga0105239_10211691
1177 Ga0105239_10379929
1178 Ga0105239_10684780
1179 Ga0105239_10905337
1180 Ga0105239_11921223
1181 Ga0105246_10032111
1182 Ga0157329_1002162
1183 Ga0157326_1016607
1184 Ga0157373_10007215
1185 Ga0157370_10034345
1186 Ga0157369_10017317
1187 Ga0157369_10609394
1188 Ga0157369_11288208
1189 Ga0157369_11507961
1190 Ga0157374_10070540
1191 Ga0157378_10077023
1192 Ga0157378_11332991
1193 Ga0163162_10053399
1194 Ga0163162_10515365
1195 Ga0163162_10840959
1196 Ga0157372_10385746
1197 Ga0157375_10935391
1198 Ga0163163_10029540
1199 Ga0163163_10065220
1200 Ga0157380_10278459
1201 Ga0157380_11051269
1202 Ga0182008_10275455
1203 Ga0157377_10075482
1204 Ga0157379_10137482
1205 Ga0157379_11281546
1206 Ga0157379_11295323
1207 Ga0163161_10099861
1208 Ga0206353_11317483
1209 Ga0213872_10318372
1210 Ga0213876_10273087
1211 Ga0213871_10192442
1212 Ga0209233_1000104
1213 Ga0209233_1049297
1214 Ga0209050_1000010
1215 Ga0209257_1000009
1216 Ga0209257_1047629
1217 Ga0207697_10369020
1218 Ga0207656_10003231
1219 Ga0207656_10009468
1220 Ga0207656_10094294
1221 Ga0207655_1129677
1222 Ga0207713_1092144
1223 Ga0207692_10345294
1224 Ga0207642_10114881
1225 Ga0207710_10004436
1226 Ga0207688_10000309
1227 Ga0207680_10269243
1228 Ga0207647_10003672
1229 Ga0207647_10007308
1230 Ga0207647_10223516
1231 Ga0207645_10025338
1232 Ga0207643_10000977
1233 Ga0207705_10393622
1234 Ga0207654_10101092
1235 Ga0207654_10111908
1236 Ga0207695_10233082
1237 Ga0207671_10203563
1238 Ga0207693_10003085
1239 Ga0207693_10005179
1240 Ga0207693_10030227
1241 Ga0207693_10138714
1242 Ga0207663_10015712
1243 Ga0207663_10074846
1244 Ga0207660_10360889
1245 Ga0207660_10777082
1246 Ga0207662_10002752
1247 Ga0207657_10005125
1248 Ga0207657_10023905
1249 Ga0207657_10032339
1250 Ga0207649_10031037
1251 Ga0207649_10391254
1252 Ga0207646_10199890
1253 Ga0207681_10034578
1254 Ga0207681_10045824
1255 Ga0207681_10391546
1256 Ga0207681_10454590
1257 Ga0207694_10091602
1258 Ga0207694_10419035
1259 Ga0207650_10043385
1260 Ga0207650_10066890
1261 Ga0207650_10359840
1262 Ga0207650_10524974
1263 Ga0207659_10134242
1264 Ga0207687_10015506
1265 Ga0207700_10024217
1266 Ga0207700_10040473
1267 Ga0207700_10345608
1268 Ga0207700_11532370
1269 Ga0207664_10017451
1270 Ga0207644_10009744
1271 Ga0207644_10265595
1272 Ga0207644_10528042
1273 Ga0207690_10085841
1274 Ga0207690_10708846
1275 Ga0207706_10001119
1276 Ga0207706_10200113
1277 Ga0207706_10336963
1278 Ga0207706_10354075
1279 Ga0207686_10116969
1280 Ga0207686_10276502
1281 Ga0207709_10265067
1282 Ga0207669_10000474
1283 Ga0207669_10003188
1284 Ga0207704_10429667
1285 Ga0207665_10004939
1286 Ga0207691_10000977
1287 Ga0207711_10072460
1288 Ga0207711_10278403
1289 Ga0207689_10034184
1290 Ga0207689_11188676
1291 Ga0207679_10061522
1292 Ga0207679_11130228
1293 Ga0207667_10082355
1294 Ga0207667_10193949
1295 Ga0207667_10393007
1296 Ga0207651_10041578
1297 Ga0207712_10060821
1298 Ga0207712_10467543
1299 Ga0207712_10587557
1300 Ga0207668_10000020
1301 Ga0207668_10006027
1302 Ga0207668_10070587
1303 Ga0207668_10114456
1304 Ga0207668_10431009
1305 Ga0207640_10289725
1306 Ga0207640_10372769
1307 Ga0207640_11259317
1308 Ga0207658_10000068
1309 Ga0207658_10005041
1310 Ga0207677_10004567
1311 Ga0207703_10000749
1312 Ga0207703_10005346
1313 Ga0207703_10456074
1314 Ga0207639_10001534
1315 Ga0207639_10002085
1316 Ga0207639_10021737
1317 Ga0207639_10302192
1318 Ga0207639_11222292
1319 Ga0207678_10007310
1320 Ga0207678_10014829
1321 Ga0207678_10032842
1322 Ga0207708_10002666
1323 Ga0207702_10033718
1324 Ga0207702_10085430
1325 Ga0207702_11453487
1326 Ga0207641_10000074
1327 Ga0207641_10007573
1328 Ga0207648_10007429
1329 Ga0207676_10001141
1330 Ga0207674_10024815
1331 Ga0207674_10088570
1332 Ga0207675_100000366
1333 Ga0207683_10001415
1334 Ga0207698_10004010
1335 Ga0207698_10023774
1336 Ga0209389_1016020
1337 Ga0209589_1000022
1338 Ga0209489_120539
1339 Ga0209700_100021
1340 Ga0209813_10000071
1341 Ga0209974_10035634
1342 Ga0268266_10076211
1343 Ga0268266_10105981
1344 Ga0268266_10197813
1345 Ga0268266_10757939
1346 Ga0268266_11761137
1347 Ga0268265_10067813
1348 Ga0268265_10538623
1349 Ga0268265_10575851
1350 Ga0268264_10008769
1351 Ga0268264_10016330
1352 Ga0268264_11715319
1353 Ga0268264_11854518
1354 Ga0307517_10041988
1355 Ga0316179_1029619
1356 Ga0265325_10016146
1357 Ga0265325_10123893
1358 Ga0265325_10134613
1359 Ga0265340_10000121
1360 Ga0265340_10398794
1361 Ga0265339_10000777
1362 Ga0265339_10056840
1363 Ga0265316_10008812
1364 Ga0265316_10324546
1365 Ga0265316_10771321
1366 Ga0307513_10179159
1367 Ga0307513_10753582
1368 Ga0307513_11026165
1369 Ga0307509_10158201
1370 Ga0307408_100059593
1371 Ga0307408_100102136
1372 Ga0307408_100207781
1373 Ga0307408_100754174
1374 Ga0307408_101563225
1375 Ga0265313_10003092
1376 Ga0307508_10000231
1377 Ga0265314_10192760
1378 Ga0265314_10577547
1379 Ga0265342_10011115
1380 Ga0265342_10153568
1381 Ga0265342_10341933
1382 Ga0316576_10075593
1383 Ga0316576_10381507
1384 Ga0307516_10072447
1385 Ga0307405_10000513
1386 Ga0307405_10064635
1387 Ga0307405_10132893
1388 Ga0307405_10294204
1389 Ga0307405_10692929
1390 Ga0307405_11218191
1391 Ga0316577_10116717
1392 Ga0307410_10258304
1393 Ga0307410_11037888
1394 Ga0307406_10068819
1395 Ga0307406_10146574
1396 Ga0307406_10907312
1397 Ga0307412_10001044
1398 Ga0307412_10017584
1399 Ga0307412_10046050
1400 Ga0307412_10069434
1401 Ga0307412_10152344
1402 Ga0307412_10513760
1403 Ga0307409_100417314
1404 Ga0307416_100063784
1405 Ga0307416_100171021
1406 Ga0307416_100240573
1407 Ga0307416_100575118
1408 Ga0307414_10000144
1409 Ga0307411_10668480
1410 Ga0307415_100372186
1411 Ga0307510_10009032
1412 Ga0316596_1027815
1413 Ga0373944_0035769
1414 Ga0373953_0041552
1415 Ga0373956_0349754
1416 Ga0373955_0316542
1417 Ga0373962_0176425
1418 Ga0316574_0000378
1419 Ga0316574_0014560
1420 Ga0316574_0350241
1421 Ga0373931_0027302
1422 Ga0373931_0060596
1423 Ga0373927_0451143
1424 Ga0373933_0158858
1425 Ga0373937_0460722
1426 Ga0373937_0870066
1427 Ga0316584_0045154
1428 Ga0316584_0112334
1429 Ga0373925_0020370
1430 Ga0373925_0075831
1431 Ga0373925_1344119
1432 Ga0395899_0009726
1433 Ga0395899_0207424
1434 Ga0395900_0018719
1435 Ga0395900_0044529
1436 Ga0395900_0105682
1437 Ga0395900_0211011
1438 Ga0395900_0462872
1439 Ga0395900_0545803
1440 Ga0395900_0752058
1441 Ga0395900_1065253
1442 Ga0395898_0008316
1443 Ga0395898_0013963
1444 Ga0395898_0018445
1445 Ga0395898_0077993
1446 Ga0395898_0133062
1447 Ga0395898_0386796
1448 Ga0395905_0617609
1449 Ga0395901_0005378
1450 Ga0395901_0048533
1451 Ga0395901_0055412
1452 Ga0395901_0131330
1453 Ga0395901_0320981
1454 Ga0395901_0590738
1455 Ga0400489_52572
1456 Ga0436365_0249655
1457 Ga0436365_1209249
1458 Ga0436365_1348843
1459 Ga0436360_0152696
1460 Ga0436360_0155171
1461 Ga0436360_0225540
1462 Ga0436360_0289570
1463 Ga0436360_0510880
1464 Ga0436360_0700499
1465 Ga0436360_0722024
1466 Ga0436360_0768310
1467 Ga0436361_0208690
1468 Ga0436361_0891828
1469 Ga0436361_0974856
1470 Ga0436363_0043667
1471 Ga0436363_0848488
1472 Ga0436363_1289101
1473 Ga0436362_0337065
1474 Ga0436362_0724793
1475 Ga0436362_1145969
1476 Ga0439466_0220801
1477 Ga0439465_0182860
1478 Ga0451797_1497932
1479 Ga0451853_2582518
1480 Ga0439460_0247836
1481 Ga0451577_0350291
1482 Ga0466966_0158171
1483 Ga0466963_0317275
1484 Ga0466963_0855021
1485 Ga0466964_0268438
1486 Ga0466957_0078717
1487 Ga0466957_0235959
1488 Ga0466957_0809692
1489 Ga0451576_1782262
1490 Ga0466958_0026210
1491 Ga0466958_0295754
1492 Ga0466958_0718263
1493 Ga0495627_058172
1494 Ga0495592_0561332
1495 Ga0495603_0099964
1496 Ga0495590_0136758
1497 Ga0495629_0068181
1498 Ga0495638_0000018
1499 Ga0495638_0013078
1500 Ga0495641_0076951
1501 Ga0495651_0104502
1502 Ga0495653_0720274
1503 Ga0495650_0004591
1504 Ga0495662_0264893
1505 Ga0495584_0133858
1506 Ga0495585_0053054
1507 Ga0495607_0475942
1508 Ga0495616_0124137
1509 Ga0495620_0090829
1510 Ga0495632_0000049
1511 Ga0495632_0008303
1512 Ga0495637_0003069
1513 Ga0495643_0000061
1514 Ga0495643_0011319
1515 Ga0495644_0192941
1516 Ga0495648_0001815
1517 Ga0495663_0000009
1518 Ga0495652_0389848
1519 Ga0495640_0119778
1520 Ga0495587_0233734
1521 Ga0495598_0023066
1522 Ga0495609_0129536
1523 Ga0495633_0000264
1524 Ga0495633_0000862
1525 Ga0495633_0011582
1526 Ga0495633_0042454
1527 Ga0495667_0129988
1528 Ga0495668_0300888
1529 Ga0495634_0483307
1530 Ga0495625_0000583
1531 Ga0495625_0011321
1532 Ga0495625_0327018
1533 Ga0495635_0627422
1534 Ga0495661_0178253
1535 Ga0495657_0085909
1536 Ga0495670_0002209
1537 Ga0495671_0000011
1538 Ga0495671_0000036
1539 Ga0495649_0156476
1540 Ga0495589_0233741
1541 Ga0495600_0028150
1542 Ga0495660_0136192
1543 Ga0495604_0479136
1544 Ga0495676_0103330
1545 Ga0495676_0365182
1546 Ga0495680_0760628
1547 Ga0495687_000224
1548 Ga0495673_0000088
1549 Ga0495681_0014061
1550 Ga0495684_0086184
1551 Ga0495686_0008764
1552 Ga0495686_0070254
1553 Ga0495602_0109610
1554 Ga0495602_0244915
1555 Ga0495626_0338852
1556 Ga0496100_0035676
1557 Ga0496100_0180625
1558 Ga0496100_0223598
1559 Ga0496100_0606847
1560 Ga0496101_0009057
1561 Ga0496101_0025933
1562 Ga0496101_0038167
1563 Ga0496101_0099473
1564 Ga0496101_1216513
1565 Ga0496102_0002315
1566 Ga0496102_0018363
1567 Ga0496102_0068148
1568 Ga0496102_0088926
1569 Ga0496102_0097500
1570 Ga0496102_0301447
1571 Ga0496102_0996383
1572 Ga0496103_0005448
1573 Ga0496103_0420569
1574 Ga0496103_0548184
1575 Ga0496104_0013577
1576 Ga0496104_0017311
1577 Ga0496104_0018021
1578 Ga0496104_0177350
1579 Ga0496104_0626938
1580 Ga0496105_0010623
1581 Ga0496105_0057105
1582 Ga0496105_0068273
1583 Ga0496105_0979838
1584 Ga0496106_0003091
1585 Ga0496106_0007079
1586 Ga0496106_0021813
1587 Ga0496106_0040065
1588 Ga0496107_0004660
1589 Ga0496107_0011907
1590 Ga0496107_0046850
1591 Ga0496107_0103468
1592 Ga0496108_0013809
1593 Ga0496108_0025155
1594 Ga0496108_0034366
1595 Ga0496108_0037603
1596 Ga0496108_0119130
1597 Ga0496108_0132772
1598 Ga0496108_0156716
1599 Ga0496108_0179741
1600 Ga0496108_0181726
1601 Ga0496108_1683940
1602 Ga0496109_0005494
1603 Ga0496109_0014810
1604 Ga0496109_0016058
1605 Ga0496109_0019497
1606 Ga0496109_0056139
1607 Ga0496109_0214301
1608 Ga0496109_0944506
1609 Ga0496110_0028061
1610 Ga0496110_0030497
1611 Ga0496110_0043503
1612 Ga0496110_0045137
1613 Ga0496110_0057057
1614 Ga0496110_0084076
1615 Ga0496110_0326120
1616 Ga0496110_0503692
1617 Ga0496111_0000494
1618 Ga0496111_0078615
1619 Ga0496111_0346461
1620 Ga0496111_0358962
1621 Ga0496112_0004889
1622 Ga0496112_0005811
1623 Ga0496112_0018775
1624 Ga0496112_0042754
1625 Ga0496112_0047785
1626 Ga0496112_0499660
1627 Ga0496113_0000564
1628 Ga0496113_0004958
1629 Ga0496113_0014413
1630 Ga0496113_0029541
1631 Ga0496114_0062341
1632 Ga0496114_0100809
1633 Ga0496114_0373693
1634 Ga0496114_1026726
1635 Ga0496115_0005148
1636 Ga0496115_0019809
1637 Ga0496115_0021939
1638 Ga0496118_0091571
1639 Ga0496119_0000289
1640 Ga0496121_0017735
1641 Ga0496122_0009301
1642 Ga0496122_0009638
1643 Ga0496122_0076669
1644 Ga0496122_0138127
1645 Ga0496123_0000210
1646 Ga0496123_0013341
1647 Ga0496124_0083993
1648 Ga0496124_0148948
1649 Ga0496125_0002768
1650 Ga0496125_0049956
1651 Ga0496125_0286231
1652 Ga0496126_0003507
1653 Ga0496126_0050477
1654 Ga0501031_0027805
1655 Ga0501032_0009941
1656 Ga0501032_0022734
1657 Ga0501032_0081002
1658 Ga0501033_0043064
1659 Ga0501034_0000013
1660 Ga0501034_0022049
1661 Ga0501034_0056146
1662 Ga0501034_0073901
1663 Ga0501034_0086697
1664 Ga0501034_0139124
1665 Ga0501034_0166299
1666 Ga0501034_0276555
1667 Ga0501034_0358334
1668 Ga0501034_0439697
1669 Ga0501034_0500931
1670 Ga0501036_0199757
1671 Ga0501036_0620113
1672 Ga0501036_1029732
1673 Ga0501037_0031279
1674 Ga0501037_0215217
1675 Ga0501037_0448206
1676 Ga0501038_0027985
1677 Ga0501038_0067518
1678 Ga0501038_0303037
1679 Ga0501039_0016701
1680 Ga0501039_1052149
1681 Ga0501040_0497323
1682 Ga0501040_0632286
1683 Ga0501041_0074735
1684 Ga0501042_0880278
1685 Ga0501043_0043209
1686 Ga0501046_0000592
1687 Ga0501046_0001115
1688 Ga0501046_0003713
1689 Ga0501046_0322593
1690 Ga0501047_0000290
1691 Ga0501047_0106810
1692 Ga0501047_0177055
1693 Ga0501047_0464977
1694 Ga0501047_0522900
1695 Ga0501047_0556999
1696 Ga0501048_0031001
1697 Ga0501048_0374745
1698 Ga0501048_0422287
1699 Ga0501048_0572248
1700 Ga0501067_0000905
1701 Ga0501067_0001682
1702 Ga0501067_0011601
1703 Ga0501067_0038503
1704 Ga0501067_0311226
1705 Ga0501067_0395251
1706 Ga0501068_0193043
1707 Ga0501068_0217536
1708 Ga0501068_0572046
1709 Ga0501069_0058754
1710 Ga0501070_0006581
1711 Ga0501070_0018455
1712 Ga0501070_0159733
1713 Ga0501070_0251047
1714 Ga0501070_0360258
1715 Ga0501070_0519848
1716 Ga0501070_0739244
1717 Ga0501071_0088372
1718 Ga0501072_0101282
1719 Ga0501072_0175643
1720 Ga0501072_0195973
1721 Ga0501073_0030029
1722 Ga0501073_0038480
1723 Ga0501073_0041744
1724 Ga0501073_0111206
1725 Ga0501073_0397629
1726 Ga0501074_0283913
1727 Ga0501074_0438352
1728 Ga0501075_0218519
1729 Ga0501075_0292736
1730 Ga0501075_0395782
1731 Ga0501076_0122692
1732 Ga0501076_0216193
1733 Ga0501076_0285055
1734 Ga0501076_0351930
1735 Ga0501077_0163160
1736 Ga0501223_001272
1737 Ga0501225_0001724
1738 Ga0501079_0289942
1739 Ga0501079_0474767
1740 Ga0501080_0000003
1741 Ga0501080_0027908
1742 Ga0501080_0040117
1743 Ga0501080_0124785
1744 Ga0501080_0132656
1745 Ga0501080_0486532
1746 Ga0501080_0504464
1747 Ga0501080_0645869
1748 Ga0501081_0020121
1749 Ga0501081_0280779
1750 Ga0501083_0022378
1751 Ga0501083_0124156
1752 Ga0501083_0183606
1753 Ga0501083_0558867
1754 Ga0501035_0000384
1755 Ga0501035_0084267
1756 Ga0501035_0918629
1757 Ga0501044_0000570
1758 Ga0501044_0025210
1759 Ga0501044_0031555
1760 Ga0501044_0035407
1761 Ga0501044_0152904
1762 Ga0501044_0289359
1763 Ga0501044_0535068
1764 Ga0501045_0548708
1765 Ga0501045_0882223
1766 nmdc:mga03683_108270_c1
1767 nmdc:mga03683_40402_c1
1768 nmdc:mga03683_73469_c1
1769 nmdc:mga00v17_41449_c1
1770 nmdc:mga00v17_805241_c1
1771 nmdc:mga0yw44_21491_c1
1772 nmdc:mga0yw44_217329_c1
1773 nmdc:mga0yw44_5612_c1
1774 nmdc:mga0yw44_95785_c1
1775 nmdc:mga06z11_115394_c1
1776 nmdc:mga06z11_25_c1
1777 nmdc:mga06z11_489065_c1
1778 nmdc:mga05p37_127965_c1
1779 nmdc:mga05p37_17127_c1
1780 nmdc:mga05p37_239692_c1
1781 nmdc:mga05p37_88120_c1
1782 nmdc:mga09592_297517_c1
1783 nmdc:mga09592_633844_c1
1784 nmdc:mga0qj67_46923_c1
1785 nmdc:mga06r32_130904_c1
1786 nmdc:mga06r32_245502_c1
1787 nmdc:mga06r32_4388_c1
1788 nmdc:mga06r32_761788_c1
1789 nmdc:mga08y16_479610_c1
1790 nmdc:mga0n895_103401_c1
1791 nmdc:mga0n895_144251_c1
1792 nmdc:mga0n895_364655_c1
1793 nmdc:mga0n895_581178_c1
1794 nmdc:mga0n895_72373_c2
1795 nmdc:mga0rr50_114657_c1
1796 nmdc:mga0rr50_1525825_c1
1797 nmdc:mga0rr50_771632_c1
1798 nmdc:mga08x19_236991_c1
1799 nmdc:mga0a205_171087_c1
1800 nmdc:mga0a205_21217_c1
1801 nmdc:mga0a205_265388_c1
1802 nmdc:mga0a205_53061_c1
1803 Ga0495601_0044662
1804 Ga0495601_0685312
1805 Ga0495612_0055835
1806 Ga0500635_0053863
1807 Ga0495655_0032310
1808 Ga0495595_0028737
1809 Ga0495595_0094409
1810 Ga0495619_0104291
1811 Ga0495619_0120672
1812 Ga0495619_0137487
1813 Ga0500643_014103
1814 Ga0500643_042874
1815 Ga0500643_087793
1816 Ga0500566_0019670
1817 Ga0500640_256626
1818 Ga0500555_052461
1819 Ga0500556_0000009
1820 Ga0500556_0000040
1821 Ga0500562_006970
1822 Ga0500572_002705
1823 Ga0500595_013801
1824 Ga0500608_009850
1825 Ga0500614_177525
1826 Ga0500642_0000003
1827 Ga0500652_063656
1828 Ga0500559_0045548
1829 Ga0500573_0001876
1830 Ga0500616_0041627
1831 Ga0500616_0068808
1832 Ga0500624_000045
1833 Ga0500624_000049
1834 Ga0500627_0049624
1835 Ga0500630_025728
1836 Ga0500639_001271
1837 Ga0500636_0017859
1838 Ga0500636_0030741
1839 Ga0500645_024129
1840 Ga0500645_054489
1841 Ga0501084_0008472
1842 Ga0501084_0222497
1843 Ga0501084_0387471
1844 Ga0501084_0483026
1845 Ga0501084_0605467
1846 Ga0501084_1188474
1847 Ga0501084_1273046
1848 Ga0501082_0022108
1849 Ga0501082_0025530
1850 Ga0501082_0062191
1851 Ga0501082_0168253
1852 Ga0501082_0192668
1853 Ga0501082_1012158
1854 Ga0501082_1055990
1855 Ga0530510_0014972
1856 Ga0530510_0088348
1857 Ga0530510_0112336
1858 Ga0530510_0202283
1859 Ga0530510_0248657
1860 Ga0530510_0391688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

56

76

0.96

Map