F486015

General Info

Members Datasets Scaffolds Average Seq Length
930 233 1860 343

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100042303|Ga0070662_1000423034
Length 372
Sequence VPQLGAAVRPCASDLRDRRLSDGGAVRLAIAMLRSGRPVRICGGGDLTVAAVETTTAELLAIRDPKRLARLVISGQRAAALKLANEREAADPNAPVVIERADWLDAETALALADPGRDLDRAPSGPLHAVGSSYGEAATAALALARSAGLLPALWIVAPAESDSEVVLDDIVRERRQPSVEMVARAKLPLGDMPPTQIVAFRASDDGQEHVALVVGAFGGRPPLVRLHSECLTGDVFGSLKCDCGPQLREALQIIGREGGGVLLYLRQEGRGIGLANKVRAYALQDRGLDTVDSNRRLGFADDERDYSHAAAMLLALGIDRVRLLTNNPAKVQGLEAAGITVIERVAHQMPANPHNADYLATKRKKSGHLLA

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
227 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
228 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
229 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
230 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 3.87
Rhizosphere 96.02
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100042303 3300005457 Bacteria 3254
2 JGI24741J21665_1012139 3300001915 Bacteria 1488
3 JGI24740J21852_10000953 3300001979 Bacteria 12862
4 JGI24740J21852_10007935 3300001979 Bacteria 4278
5 JGI24740J21852_10013794 3300001979 Bacteria 3003
6 JGI24739J22299_10003826 3300001989 Bacteria 5744
7 JGI24737J22298_10000027 3300001990 Bacteria 43503
8 JGI24737J22298_10002185 3300001990 Bacteria 6965
9 JGI24737J22298_10037434 3300001990 Bacteria 1495
10 JGI24735J21928_10005201 3300002067 Bacteria 4326
11 JGI24738J21930_10000258 3300002075 Bacteria 14424
12 JGI24738J21930_10002624 3300002075 Bacteria 4637
13 JGI24749J21850_1000139 3300002076 Bacteria 11813
14 JGI24744J21845_10001852 3300002077 Bacteria 4247
15 JGI24034J26672_10005163 3300002239 Bacteria 1868
16 Ga0065715_10000357 3300005293 Bacteria 14467
17 Ga0070658_10000177 3300005327 Bacteria 56043
18 Ga0070658_10000256 3300005327 Bacteria 46854
19 Ga0070658_10003990 3300005327 Bacteria 12100
20 Ga0070658_10048647 3300005327 Bacteria 3433
21 Ga0070658_10062537 3300005327 Bacteria 3034
22 Ga0070658_10112387 3300005327 Bacteria 2258
23 Ga0070658_10120884 3300005327 Bacteria 2176
24 Ga0070676_10001421 3300005328 Bacteria 12096
25 Ga0070676_10009377 3300005328 Bacteria 5290
26 Ga0070676_10031796 3300005328 Bacteria 3019
27 Ga0070683_100000686 3300005329 Bacteria 24502
28 Ga0070683_100001183 3300005329 Bacteria 19793
29 Ga0070683_100048255 3300005329 Bacteria 3936
30 Ga0070690_100109135 3300005330 Bacteria 1844
31 Ga0070670_100001378 3300005331 Bacteria 19465
32 Ga0070670_100001565 3300005331 Bacteria 18443
33 Ga0070670_100001825 3300005331 Bacteria 17334
34 Ga0070670_100005336 3300005331 Bacteria 10836
35 Ga0070670_100009519 3300005331 Bacteria 8293
36 Ga0070670_100019419 3300005331 Bacteria 5832
37 Ga0070677_10000652 3300005333 Bacteria 11602
38 Ga0070677_10023740 3300005333 Bacteria 2273
39 Ga0070677_10072372 3300005333 Bacteria 1453
40 Ga0068869_100000085 3300005334 Bacteria 42599
41 Ga0068869_100040443 3300005334 Bacteria 3334
42 Ga0068869_100136023 3300005334 Bacteria 1893
43 Ga0068869_100298650 3300005334 Bacteria 1300
44 Ga0070666_10001574 3300005335 Bacteria 13865
45 Ga0070666_10009095 3300005335 Bacteria 6195
46 Ga0070666_10037078 3300005335 Bacteria 3240
47 Ga0070680_100000105 3300005336 Bacteria 48515
48 Ga0070680_100001387 3300005336 Bacteria 17511
49 Ga0070680_100002431 3300005336 Bacteria 13798
50 Ga0070680_100010471 3300005336 Bacteria 7151
51 Ga0070680_100014221 3300005336 Bacteria 6215
52 Ga0070680_100059804 3300005336 Bacteria 3118
53 Ga0070680_100251848 3300005336 Bacteria 1493
54 Ga0070680_100263124 3300005336 Bacteria 1459
55 Ga0070682_100029303 3300005337 Bacteria 3313
56 Ga0068868_100022326 3300005338 Bacteria 4774
57 Ga0068868_100049892 3300005338 Bacteria 3285
58 Ga0068868_100084988 3300005338 Bacteria 2542
59 Ga0068868_100116159 3300005338 Bacteria 2179
60 Ga0070660_100000064 3300005339 Bacteria 62554
61 Ga0070660_100000065 3300005339 Bacteria 61999
62 Ga0070660_100000881 3300005339 Bacteria 20070
63 Ga0070660_100006285 3300005339 Bacteria 8228
64 Ga0070660_100010356 3300005339 Bacteria 6587
65 Ga0070660_100053717 3300005339 Bacteria 3108
66 Ga0070660_100053986 3300005339 Bacteria 3101
67 Ga0070660_100104677 3300005339 Bacteria 2245
68 Ga0070660_100149531 3300005339 Bacteria 1877
69 Ga0070689_100017045 3300005340 Bacteria 5328
70 Ga0070691_10108303 3300005341 Bacteria 1387
71 Ga0070687_100094452 3300005343 Bacteria 1661
72 Ga0070661_100001118 3300005344 Bacteria 18830
73 Ga0070661_100004948 3300005344 Bacteria 9174
74 Ga0070661_100016496 3300005344 Bacteria 5223
75 Ga0070661_100016702 3300005344 Bacteria 5194
76 Ga0070661_100025998 3300005344 Bacteria 4207
77 Ga0070661_100034495 3300005344 Bacteria 3669
78 Ga0070661_100044590 3300005344 Bacteria 3239
79 Ga0070661_100065354 3300005344 Bacteria 2673
80 Ga0070661_100101230 3300005344 Bacteria 2143
81 Ga0070692_10002705 3300005345 Bacteria 6951
82 Ga0070692_10003379 3300005345 Bacteria 6463
83 Ga0070692_10038909 3300005345 Bacteria 2426
84 Ga0070692_10063956 3300005345 Bacteria 1945
85 Ga0070668_100002805 3300005347 Bacteria 12821
86 Ga0070668_100006099 3300005347 Bacteria 8938
87 Ga0070668_100017955 3300005347 Bacteria 5307
88 Ga0070668_100019021 3300005347 Bacteria 5163
89 Ga0070668_100038501 3300005347 Bacteria 3655
90 Ga0070669_100000693 3300005353 Bacteria 24733
91 Ga0070669_100001859 3300005353 Bacteria 15190
92 Ga0070669_100046367 3300005353 Bacteria 3169
93 Ga0070669_100125445 3300005353 Bacteria 1964
94 Ga0070675_100001753 3300005354 Bacteria 16008
95 Ga0070675_100044835 3300005354 Bacteria 3617
96 Ga0070675_100058441 3300005354 Bacteria 3181
97 Ga0070675_100144971 3300005354 Bacteria 2032
98 Ga0070671_100000372 3300005355 Bacteria 31030
99 Ga0070671_100000892 3300005355 Bacteria 21760
100 Ga0070671_100000918 3300005355 Bacteria 21508
101 Ga0070671_100002617 3300005355 Bacteria 13934
102 Ga0070671_100002782 3300005355 Bacteria 13591
103 Ga0070671_100003487 3300005355 Bacteria 12276
104 Ga0070671_100009913 3300005355 Bacteria 7652
105 Ga0070671_100022379 3300005355 Bacteria 5162
106 Ga0070671_100060397 3300005355 Bacteria 3156
107 Ga0070671_100144897 3300005355 Bacteria 2005
108 Ga0070674_100013485 3300005356 Bacteria 5054
109 Ga0070674_100017630 3300005356 Bacteria 4498
110 Ga0070674_100091189 3300005356 Bacteria 2200
111 Ga0070673_100000158 3300005364 Bacteria 32576
112 Ga0070673_100000450 3300005364 Bacteria 21787
113 Ga0070673_100010076 3300005364 Bacteria 6379
114 Ga0070673_100036691 3300005364 Bacteria 3729
115 Ga0070673_100065550 3300005364 Bacteria 2897
116 Ga0070673_100073231 3300005364 Bacteria 2757
117 Ga0070673_100100229 3300005364 Bacteria 2384
118 Ga0070673_100164346 3300005364 Bacteria 1890
119 Ga0070673_100232895 3300005364 Bacteria 1598
120 Ga0070673_100244000 3300005364 Bacteria 1563
121 Ga0070659_100000525 3300005366 Bacteria 28016
122 Ga0070659_100002462 3300005366 Bacteria 13162
123 Ga0070659_100004006 3300005366 Bacteria 10482
124 Ga0070659_100005879 3300005366 Bacteria 8838
125 Ga0070659_100011332 3300005366 Bacteria 6593
126 Ga0070659_100026730 3300005366 Bacteria 4442
127 Ga0070659_100058872 3300005366 Bacteria 3033
128 Ga0070659_100073491 3300005366 Bacteria 2722
129 Ga0070659_100258017 3300005366 Bacteria 1446
130 Ga0070659_100265768 3300005366 Bacteria 1424
131 Ga0070667_100003025 3300005367 Bacteria 14454
132 Ga0070667_100004176 3300005367 Bacteria 12195
133 Ga0070667_100009800 3300005367 Bacteria 7942
134 Ga0070667_100017076 3300005367 Bacteria 6011
135 Ga0070667_100028404 3300005367 Bacteria 4657
136 Ga0070667_100073251 3300005367 Bacteria 2920
137 Ga0070667_100094135 3300005367 Bacteria 2581
138 Ga0070667_100356299 3300005367 Bacteria 1325
139 Ga0070709_10046307 3300005434 Bacteria 2703
140 Ga0070714_100005441 3300005435 Bacteria 9720
141 Ga0070714_100023219 3300005435 Bacteria 5091
142 Ga0070714_100026273 3300005435 Bacteria 4811
143 Ga0070694_100006539 3300005444 Bacteria 7078
144 Ga0070663_100000033 3300005455 Bacteria 71453
145 Ga0070663_100000701 3300005455 Bacteria 18072
146 Ga0070663_100017911 3300005455 Bacteria 4631
147 Ga0070663_100019600 3300005455 Bacteria 4463
148 Ga0070663_100046441 3300005455 Bacteria 3073
149 Ga0070663_100067481 3300005455 Bacteria 2595
150 Ga0070663_100074279 3300005455 Bacteria 2482
151 Ga0070663_100085725 3300005455 Bacteria 2325
152 Ga0070663_100091131 3300005455 Bacteria 2258
153 Ga0070678_100002162 3300005456 Bacteria 10666
154 Ga0070678_100008323 3300005456 Bacteria 6211
155 Ga0070678_100034435 3300005456 Bacteria 3527
156 Ga0070678_100067449 3300005456 Unclassified 2663
157 Ga0070678_100157488 3300005456 Bacteria 1836
158 Ga0070678_100291324 3300005456 Bacteria 1384
159 Ga0070662_100000017 3300005457 Bacteria 105478
160 Ga0070662_100000337 3300005457 Bacteria 28132
161 Ga0070662_100000350 3300005457 Bacteria 27678
162 Ga0070662_100022257 3300005457 Bacteria 4336
163 Ga0070662_100022394 3300005457 Bacteria 4326
164 Ga0070662_100027014 3300005457 Bacteria 3980
165 Ga0070662_100062823 3300005457 Bacteria 2715
166 Ga0070662_100066634 3300005457 Bacteria 2642
167 Ga0070662_100091494 3300005457 Bacteria 2285
168 Ga0070662_100202163 3300005457 Bacteria 1577
169 Ga0070662_100284648 3300005457 Bacteria 1338
170 Ga0070662_100288578 3300005457 Bacteria 1330
171 Ga0070681_10031395 3300005458 Bacteria 5333
172 Ga0070681_10043476 3300005458 Bacteria 4501
173 Ga0068867_100000661 3300005459 Bacteria 22832
174 Ga0070685_10056992 3300005466 Bacteria 2273
175 Ga0070679_100000125 3300005530 Bacteria 61348
176 Ga0070679_100024833 3300005530 Bacteria 5874
177 Ga0070679_100060612 3300005530 Bacteria 3770
178 Ga0070679_100177183 3300005530 Bacteria 2105
179 Ga0070679_100180946 3300005530 Bacteria 2080
180 Ga0070679_100307975 3300005530 Bacteria 1534
181 Ga0070684_100006201 3300005535 Bacteria 9227
182 Ga0070684_100044912 3300005535 Bacteria 3824
183 Ga0068853_100002108 3300005539 Bacteria 14761
184 Ga0068853_100002421 3300005539 Bacteria 13941
185 Ga0068853_100013782 3300005539 Bacteria 6605
186 Ga0068853_100021859 3300005539 Bacteria 5336
187 Ga0068853_100092772 3300005539 Bacteria 2657
188 Ga0068853_100095088 3300005539 Bacteria 2627
189 Ga0068853_100140180 3300005539 Bacteria 2170
190 Ga0070672_100000476 3300005543 Bacteria 23318
191 Ga0070672_100001526 3300005543 Bacteria 14347
192 Ga0070672_100001606 3300005543 Bacteria 14037
193 Ga0070672_100059726 3300005543 Bacteria 3000
194 Ga0070696_100007107 3300005546 Bacteria 7474
195 Ga0070693_100000820 3300005547 Bacteria 13801
196 Ga0070693_100065620 3300005547 Bacteria 2122
197 Ga0070693_100117209 3300005547 Bacteria 1647
198 Ga0070665_100001860 3300005548 Bacteria 23948
199 Ga0070665_100010457 3300005548 Bacteria 9390
200 Ga0070665_100011993 3300005548 Bacteria 8749
201 Ga0070665_100012945 3300005548 Bacteria 8402
202 Ga0068855_100000194 3300005563 Bacteria 78505
203 Ga0068855_100000660 3300005563 Bacteria 42200
204 Ga0068855_100001289 3300005563 Bacteria 31088
205 Ga0068855_100035406 3300005563 Bacteria 5947
206 Ga0068855_100050604 3300005563 Bacteria 4895
207 Ga0068855_100120840 3300005563 Bacteria 2998
208 Ga0068855_100124229 3300005563 Bacteria 2952
209 Ga0068855_100190394 3300005563 Bacteria 2314
210 Ga0068855_100420701 3300005563 Bacteria 1461
211 Ga0070664_100000098 3300005564 Bacteria 55907
212 Ga0070664_100000564 3300005564 Bacteria 28338
213 Ga0070664_100001922 3300005564 Bacteria 16685
214 Ga0070664_100004372 3300005564 Bacteria 11352
215 Ga0070664_100007488 3300005564 Bacteria 8815
216 Ga0070664_100029046 3300005564 Bacteria 4607
217 Ga0070664_100059758 3300005564 Bacteria 3244
218 Ga0070664_100113479 3300005564 Bacteria 2367
219 Ga0070664_100211519 3300005564 Bacteria 1733
220 Ga0070664_100404943 3300005564 Bacteria 1248
221 Ga0068857_100001000 3300005577 Bacteria 21722
222 Ga0068857_100006167 3300005577 Bacteria 10248
223 Ga0068857_100102053 3300005577 Bacteria 2574
224 Ga0068857_100185765 3300005577 Bacteria 1892
225 Ga0068854_100000173 3300005578 Bacteria 43694
226 Ga0068854_100004556 3300005578 Bacteria 8737
227 Ga0068854_100007880 3300005578 Bacteria 6815
228 Ga0068854_100012893 3300005578 Bacteria 5476
229 Ga0068854_100014644 3300005578 Bacteria 5173
230 Ga0068854_100018336 3300005578 Bacteria 4698
231 Ga0068854_100021062 3300005578 Bacteria 4420
232 Ga0068854_100046087 3300005578 Bacteria 3103
233 Ga0068856_100000098 3300005614 Bacteria 83221
234 Ga0068856_100052216 3300005614 Bacteria 4031
235 Ga0068856_100065582 3300005614 Bacteria 3589
236 Ga0068856_100294648 3300005614 Bacteria 1639
237 Ga0068852_100000305 3300005616 Bacteria 33064
238 Ga0068852_100000953 3300005616 Bacteria 19048
239 Ga0068852_100004187 3300005616 Bacteria 10167
240 Ga0068852_100004399 3300005616 Bacteria 9959
241 Ga0068852_100005309 3300005616 Bacteria 9198
242 Ga0068852_100008945 3300005616 Bacteria 7411
243 Ga0068852_100009153 3300005616 Bacteria 7335
244 Ga0068852_100032966 3300005616 Bacteria 4296
245 Ga0068852_100037479 3300005616 Bacteria 4065
246 Ga0068852_100086485 3300005616 Bacteria 2795
247 Ga0068852_100204489 3300005616 Bacteria 1870
248 Ga0068852_100252542 3300005616 Bacteria 1690
249 Ga0068859_100004043 3300005617 Bacteria 14954
250 Ga0068859_100009943 3300005617 Bacteria 9596
251 Ga0068859_100010015 3300005617 Bacteria 9561
252 Ga0068859_100021936 3300005617 Bacteria 6403
253 Ga0068859_100087262 3300005617 Bacteria 3168
254 Ga0068859_100653857 3300005617 Bacteria 1143
255 Ga0068864_100000797 3300005618 Bacteria 26397
256 Ga0068864_100000956 3300005618 Bacteria 24229
257 Ga0068864_100001870 3300005618 Bacteria 17284
258 Ga0068864_100009821 3300005618 Bacteria 7891
259 Ga0068864_100012378 3300005618 Bacteria 7054
260 Ga0068864_100013351 3300005618 Bacteria 6806
261 Ga0068864_100040839 3300005618 Bacteria 3967
262 Ga0068864_100237859 3300005618 Bacteria 1686
263 Ga0068864_100434664 3300005618 Bacteria 1253
264 Ga0068866_10011564 3300005718 Bacteria 3823
265 Ga0068866_10032105 3300005718 Bacteria 2536
266 Ga0068866_10165127 3300005718 Bacteria 1295
267 Ga0068861_100015774 3300005719 Bacteria 5333
268 Ga0068851_10009876 3300005834 Bacteria 4444
269 Ga0068851_10031399 3300005834 Bacteria 2638
270 Ga0068851_10125658 3300005834 Bacteria 1383
271 Ga0068870_10100143 3300005840 Bacteria 1636
272 Ga0068870_10157596 3300005840 Bacteria 1343
273 Ga0068863_100000948 3300005841 Bacteria 29123
274 Ga0068863_100001401 3300005841 Bacteria 23908
275 Ga0068863_100001870 3300005841 Bacteria 20922
276 Ga0068863_100005844 3300005841 Bacteria 12055
277 Ga0068863_100009868 3300005841 Bacteria 9300
278 Ga0068858_100000537 3300005842 Bacteria 39482
279 Ga0068858_100001052 3300005842 Bacteria 28522
280 Ga0068858_100014347 3300005842 Bacteria 7471
281 Ga0068858_100016762 3300005842 Bacteria 6881
282 Ga0068858_100020175 3300005842 Bacteria 6232
283 Ga0068858_100049547 3300005842 Bacteria 3889
284 Ga0068860_100005038 3300005843 Bacteria 13446
285 Ga0068860_100024302 3300005843 Bacteria 5857
286 Ga0068860_100048457 3300005843 Bacteria 4050
287 Ga0068860_100083785 3300005843 Bacteria 3033
288 Ga0068860_100089418 3300005843 Bacteria 2932
289 Ga0068860_100146173 3300005843 Bacteria 2275
290 Ga0068862_100003962 3300005844 Bacteria 12579
291 Ga0068862_100020001 3300005844 Bacteria 5588
292 Ga0068862_100030372 3300005844 Bacteria 4554
293 Ga0068862_100056642 3300005844 Bacteria 3359
294 Ga0070717_10000958 3300006028 Bacteria 19233
295 Ga0070712_100034459 3300006175 Bacteria 3431
296 Ga0097621_100012478 3300006237 Bacteria 6302
297 Ga0097621_100017230 3300006237 Bacteria 5481
298 Ga0068871_100003349 3300006358 Bacteria 11011
299 Ga0068871_100049865 3300006358 Bacteria 3385
300 Ga0075433_10242344 3300006852 Bacteria 1600
301 Ga0068865_100000263 3300006881 Bacteria 28940
302 Ga0097620_100004043 3300006931 Bacteria 14954
303 Ga0097620_100009944 3300006931 Bacteria 9596
304 Ga0097620_100010015 3300006931 Bacteria 9561
305 Ga0097620_100021936 3300006931 Bacteria 6403
306 Ga0097620_100087261 3300006931 Bacteria 3168
307 Ga0097620_100653872 3300006931 Bacteria 1143
308 Ga0105240_10020205 3300009093 Bacteria 8890
309 Ga0105240_10065302 3300009093 Bacteria 4518
310 Ga0105240_10158858 3300009093 Bacteria 2687
311 Ga0105240_10164083 3300009093 Bacteria 2636
312 Ga0105240_10285164 3300009093 Bacteria 1896
313 Ga0111539_10344938 3300009094 Bacteria 1733
314 Ga0105245_10002629 3300009098 Bacteria 16169
315 Ga0105245_10118220 3300009098 Bacteria 2473
316 Ga0105245_10332038 3300009098 Bacteria 1501
317 Ga0105245_10556342 3300009098 Bacteria 1169
318 Ga0105243_10022150 3300009148 Bacteria 4828
319 Ga0105241_10043105 3300009174 Bacteria 3416
320 Ga0105242_10004126 3300009176 Bacteria 11307
321 Ga0105242_10295761 3300009176 Bacteria 1476
322 Ga0105248_10000206 3300009177 Bacteria 67932
323 Ga0105248_10000626 3300009177 Bacteria 40130
324 Ga0105248_10001473 3300009177 Bacteria 26200
325 Ga0105248_10002857 3300009177 Bacteria 19171
326 Ga0105248_10006340 3300009177 Bacteria 12976
327 Ga0105248_10021255 3300009177 Bacteria 7191
328 Ga0105248_10043821 3300009177 Bacteria 5018
329 Ga0105248_10189990 3300009177 Bacteria 2314
330 Ga0105238_10032471 3300009551 Bacteria 5313
331 Ga0105249_10009551 3300009553 Bacteria 8499
332 Ga0105249_10050376 3300009553 Bacteria 3796
333 Ga0105249_10058549 3300009553 Bacteria 3531
334 Ga0105249_10366046 3300009553 Bacteria 1464
335 Ga0105239_10095083 3300010375 Bacteria 3292
336 Ga0105239_10496052 3300010375 Bacteria 1388
337 Ga0105246_10008846 3300011119 Bacteria 6197
338 Ga0157373_10002479 3300013100 Bacteria 14052
339 Ga0157373_10010481 3300013100 Bacteria 6819
340 Ga0157373_10018098 3300013100 Bacteria 5130
341 Ga0157373_10033533 3300013100 Bacteria 3693
342 Ga0157373_10076006 3300013100 Bacteria 2370
343 Ga0157373_10131651 3300013100 Bacteria 1759
344 Ga0157373_10155316 3300013100 Bacteria 1610
345 Ga0157373_10193988 3300013100 Bacteria 1431
346 Ga0157371_10002538 3300013102 Bacteria 17347
347 Ga0157371_10025658 3300013102 Bacteria 4291
348 Ga0157371_10092499 3300013102 Bacteria 2143
349 Ga0157371_10096642 3300013102 Bacteria 2093
350 Ga0157371_10097216 3300013102 Bacteria 2087
351 Ga0157371_10206468 3300013102 Bacteria 1409
352 Ga0157370_10001780 3300013104 Bacteria 26574
353 Ga0157370_10009396 3300013104 Bacteria 10454
354 Ga0157370_10034504 3300013104 Bacteria 4925
355 Ga0157370_10065193 3300013104 Bacteria 3446
356 Ga0157370_10154626 3300013104 Bacteria 2134
357 Ga0157370_10247091 3300013104 Bacteria 1650
358 Ga0157369_10026494 3300013105 Bacteria 6429
359 Ga0157369_10045685 3300013105 Bacteria 4761
360 Ga0157369_10055713 3300013105 Bacteria 4267
361 Ga0157369_10059230 3300013105 Bacteria 4129
362 Ga0157369_10129675 3300013105 Bacteria 2672
363 Ga0157369_10201021 3300013105 Bacteria 2092
364 Ga0157369_10265850 3300013105 Bacteria 1788
365 Ga0157369_10355173 3300013105 Bacteria 1522
366 Ga0157369_10468918 3300013105 Bacteria 1303
367 Ga0157374_10016481 3300013296 Bacteria 6497
368 Ga0157378_10000540 3300013297 Bacteria 35981
369 Ga0157378_10384192 3300013297 Bacteria 1380
370 Ga0163162_10000299 3300013306 Bacteria 45521
371 Ga0157372_10000935 3300013307 Bacteria 31869
372 Ga0157372_10013593 3300013307 Bacteria 8701
373 Ga0157372_10135250 3300013307 Bacteria 2838
374 Ga0157372_10147633 3300013307 Bacteria 2712
375 Ga0157372_10273391 3300013307 Bacteria 1964
376 Ga0157375_10000899 3300013308 Bacteria 25856
377 Ga0157375_10063875 3300013308 Bacteria 3664
378 Ga0163163_10000454 3300014325 Bacteria 37347
379 Ga0163163_10002078 3300014325 Bacteria 16904
380 Ga0163163_10018039 3300014325 Bacteria 6593
381 Ga0157380_10001142 3300014326 Bacteria 17160
382 Ga0157377_10061465 3300014745 Bacteria 2147
383 Ga0163161_10014569 3300017792 Bacteria 5472
384 Ga0206353_10924596 3300020082 Bacteria 2975
385 Ga0207697_10000072 3300025315 Bacteria 43473
386 Ga0207697_10000333 3300025315 Bacteria 26386
387 Ga0207697_10028050 3300025315 Bacteria 2302
388 Ga0207697_10029042 3300025315 Bacteria 2262
389 Ga0207697_10095087 3300025315 Bacteria 1266
390 Ga0207656_10008136 3300025321 Bacteria 3850
391 Ga0207656_10011647 3300025321 Bacteria 3327
392 Ga0207656_10022022 3300025321 Bacteria 2553
393 Ga0207656_10037936 3300025321 Bacteria 2030
394 Ga0207682_10001225 3300025893 Bacteria 11858
395 Ga0207682_10014189 3300025893 Bacteria 3104
396 Ga0207682_10027008 3300025893 Bacteria 2284
397 Ga0207682_10042985 3300025893 Bacteria 1848
398 Ga0207642_10022236 3300025899 Bacteria 2511
399 Ga0207688_10000289 3300025901 Bacteria 22999
400 Ga0207688_10007318 3300025901 Bacteria 6008
401 Ga0207688_10020634 3300025901 Bacteria 3597
402 Ga0207688_10034424 3300025901 Bacteria 2805
403 Ga0207680_10002206 3300025903 Bacteria 9097
404 Ga0207680_10002981 3300025903 Bacteria 7936
405 Ga0207680_10010570 3300025903 Bacteria 4622
406 Ga0207647_10000629 3300025904 Bacteria 27446
407 Ga0207647_10001021 3300025904 Bacteria 21752
408 Ga0207647_10004235 3300025904 Bacteria 10634
409 Ga0207647_10013750 3300025904 Bacteria 5604
410 Ga0207647_10019225 3300025904 Bacteria 4598
411 Ga0207647_10027834 3300025904 Bacteria 3681
412 Ga0207647_10039753 3300025904 Bacteria 2965
413 Ga0207699_10005276 3300025906 Bacteria 6188
414 Ga0207645_10004731 3300025907 Bacteria 10020
415 Ga0207645_10020201 3300025907 Bacteria 4362
416 Ga0207645_10039726 3300025907 Bacteria 3014
417 Ga0207643_10149850 3300025908 Bacteria 1398
418 Ga0207705_10000067 3300025909 Bacteria 136004
419 Ga0207705_10000137 3300025909 Bacteria 79174
420 Ga0207705_10001117 3300025909 Bacteria 21806
421 Ga0207705_10005814 3300025909 Bacteria 9186
422 Ga0207705_10011969 3300025909 Bacteria 6268
423 Ga0207705_10020858 3300025909 Bacteria 4677
424 Ga0207705_10025067 3300025909 Bacteria 4257
425 Ga0207705_10039639 3300025909 Bacteria 3376
426 Ga0207705_10051871 3300025909 Bacteria 2952
427 Ga0207705_10117530 3300025909 Bacteria 1970
428 Ga0207707_10006775 3300025912 Bacteria 9998
429 Ga0207707_10014289 3300025912 Bacteria 6916
430 Ga0207707_10026795 3300025912 Bacteria 5037
431 Ga0207707_10042558 3300025912 Bacteria 3963
432 Ga0207707_10052949 3300025912 Bacteria 3533
433 Ga0207695_10018686 3300025913 Bacteria 8005
434 Ga0207695_10023986 3300025913 Bacteria 6879
435 Ga0207695_10124804 3300025913 Bacteria 2538
436 Ga0207660_10000099 3300025917 Bacteria 48138
437 Ga0207660_10001083 3300025917 Bacteria 18137
438 Ga0207660_10005519 3300025917 Bacteria 8214
439 Ga0207660_10010968 3300025917 Bacteria 5890
440 Ga0207660_10011564 3300025917 Bacteria 5751
441 Ga0207662_10075465 3300025918 Bacteria 2048
442 Ga0207657_10000508 3300025919 Bacteria 41139
443 Ga0207657_10000552 3300025919 Bacteria 39920
444 Ga0207657_10003558 3300025919 Bacteria 16624
445 Ga0207657_10003964 3300025919 Bacteria 15720
446 Ga0207657_10004943 3300025919 Bacteria 14023
447 Ga0207657_10005670 3300025919 Bacteria 13029
448 Ga0207657_10009327 3300025919 Bacteria 9876
449 Ga0207657_10012299 3300025919 Bacteria 8457
450 Ga0207657_10012422 3300025919 Bacteria 8413
451 Ga0207657_10015848 3300025919 Bacteria 7283
452 Ga0207657_10029528 3300025919 Bacteria 4989
453 Ga0207657_10037871 3300025919 Bacteria 4301
454 Ga0207657_10094116 3300025919 Bacteria 2495
455 Ga0207657_10107499 3300025919 Bacteria 2308
456 Ga0207657_10148560 3300025919 Bacteria 1910
457 Ga0207649_10000186 3300025920 Bacteria 50868
458 Ga0207649_10002184 3300025920 Bacteria 11054
459 Ga0207649_10004786 3300025920 Bacteria 7321
460 Ga0207649_10017132 3300025920 Bacteria 4103
461 Ga0207649_10026236 3300025920 Bacteria 3406
462 Ga0207649_10028135 3300025920 Bacteria 3308
463 Ga0207649_10091780 3300025920 Bacteria 1990
464 Ga0207649_10242477 3300025920 Bacteria 1294
465 Ga0207652_10000058 3300025921 Bacteria 113620
466 Ga0207652_10019707 3300025921 Bacteria 5549
467 Ga0207652_10035955 3300025921 Bacteria 4185
468 Ga0207652_10053467 3300025921 Bacteria 3469
469 Ga0207652_10125212 3300025921 Bacteria 2289
470 Ga0207681_10001146 3300025923 Bacteria 17108
471 Ga0207681_10002252 3300025923 Bacteria 12264
472 Ga0207681_10213861 3300025923 Bacteria 1488
473 Ga0207694_10001654 3300025924 Bacteria 18731
474 Ga0207694_10016299 3300025924 Bacteria 5609
475 Ga0207694_10138228 3300025924 Bacteria 1958
476 Ga0207650_10001160 3300025925 Bacteria 19345
477 Ga0207650_10003924 3300025925 Bacteria 10177
478 Ga0207650_10007663 3300025925 Bacteria 7354
479 Ga0207650_10014936 3300025925 Bacteria 5402
480 Ga0207650_10125933 3300025925 Bacteria 2000
481 Ga0207659_10003531 3300025926 Bacteria 9402
482 Ga0207659_10245096 3300025926 Bacteria 1452
483 Ga0207687_10014389 3300025927 Bacteria 5176
484 Ga0207687_10059258 3300025927 Bacteria 2697
485 Ga0207664_10008427 3300025929 Bacteria 7190
486 Ga0207664_10057537 3300025929 Bacteria 3091
487 Ga0207644_10000138 3300025931 Bacteria 52145
488 Ga0207644_10000484 3300025931 Bacteria 25592
489 Ga0207644_10001682 3300025931 Bacteria 14260
490 Ga0207644_10004429 3300025931 Bacteria 9118
491 Ga0207644_10008323 3300025931 Bacteria 6797
492 Ga0207644_10024229 3300025931 Bacteria 4164
493 Ga0207644_10027527 3300025931 Bacteria 3927
494 Ga0207644_10030209 3300025931 Bacteria 3765
495 Ga0207644_10082510 3300025931 Bacteria 2378
496 Ga0207690_10000573 3300025932 Bacteria 24058
497 Ga0207690_10005311 3300025932 Bacteria 7592
498 Ga0207690_10006573 3300025932 Bacteria 6891
499 Ga0207690_10008262 3300025932 Bacteria 6173
500 Ga0207690_10013831 3300025932 Bacteria 4861
501 Ga0207690_10019726 3300025932 Bacteria 4156
502 Ga0207690_10027486 3300025932 Bacteria 3595
503 Ga0207690_10045111 3300025932 Bacteria 2910
504 Ga0207690_10045352 3300025932 Bacteria 2904
505 Ga0207690_10049806 3300025932 Bacteria 2794
506 Ga0207690_10106950 3300025932 Bacteria 2008
507 Ga0207690_10115917 3300025932 Bacteria 1937
508 Ga0207706_10000222 3300025933 Bacteria 62279
509 Ga0207706_10000276 3300025933 Bacteria 55889
510 Ga0207706_10000514 3300025933 Bacteria 41167
511 Ga0207706_10000816 3300025933 Bacteria 32338
512 Ga0207706_10002779 3300025933 Bacteria 17021
513 Ga0207706_10003931 3300025933 Bacteria 14095
514 Ga0207706_10004258 3300025933 Bacteria 13468
515 Ga0207706_10022035 3300025933 Bacteria 5718
516 Ga0207706_10036980 3300025933 Bacteria 4336
517 Ga0207706_10053101 3300025933 Bacteria 3578
518 Ga0207706_10059642 3300025933 Bacteria 3360
519 Ga0207706_10059746 3300025933 Bacteria 3357
520 Ga0207706_10071788 3300025933 Bacteria 3045
521 Ga0207706_10081149 3300025933 Bacteria 2850
522 Ga0207706_10090064 3300025933 Bacteria 2697
523 Ga0207706_10261992 3300025933 Bacteria 1509
524 Ga0207709_10008108 3300025935 Bacteria 5820
525 Ga0207670_10015021 3300025936 Bacteria 4615
526 Ga0207670_10066359 3300025936 Bacteria 2479
527 Ga0207669_10005678 3300025937 Bacteria 5626
528 Ga0207669_10027152 3300025937 Bacteria 3128
529 Ga0207669_10041250 3300025937 Bacteria 2685
530 Ga0207669_10104238 3300025937 Bacteria 1883
531 Ga0207669_10190115 3300025937 Bacteria 1480
532 Ga0207704_10000514 3300025938 Bacteria 17233
533 Ga0207665_10106796 3300025939 Bacteria 1962
534 Ga0207691_10001562 3300025940 Bacteria 22738
535 Ga0207691_10002265 3300025940 Bacteria 18850
536 Ga0207691_10002789 3300025940 Bacteria 17030
537 Ga0207691_10029602 3300025940 Bacteria 5121
538 Ga0207691_10150731 3300025940 Bacteria 2045
539 Ga0207691_10312467 3300025940 Bacteria 1348
540 Ga0207711_10000389 3300025941 Bacteria 46530
541 Ga0207711_10000413 3300025941 Bacteria 45274
542 Ga0207711_10000777 3300025941 Bacteria 31404
543 Ga0207711_10002223 3300025941 Bacteria 17419
544 Ga0207711_10010462 3300025941 Bacteria 7703
545 Ga0207711_10070657 3300025941 Bacteria 3028
546 Ga0207711_10102838 3300025941 Bacteria 2529
547 Ga0207711_10123912 3300025941 Bacteria 2310
548 Ga0207689_10000051 3300025942 Bacteria 88480
549 Ga0207689_10040570 3300025942 Bacteria 3853
550 Ga0207689_10056052 3300025942 Bacteria 3243
551 Ga0207689_10063940 3300025942 Bacteria 3027
552 Ga0207689_10241849 3300025942 Bacteria 1492
553 Ga0207661_10000315 3300025944 Bacteria 30884
554 Ga0207661_10002683 3300025944 Bacteria 12245
555 Ga0207661_10014571 3300025944 Bacteria 5766
556 Ga0207661_10096086 3300025944 Bacteria 2479
557 Ga0207679_10000114 3300025945 Bacteria 64628
558 Ga0207679_10001985 3300025945 Bacteria 12695
559 Ga0207679_10015858 3300025945 Bacteria 4993
560 Ga0207679_10017044 3300025945 Bacteria 4834
561 Ga0207679_10017477 3300025945 Bacteria 4785
562 Ga0207679_10020494 3300025945 Bacteria 4463
563 Ga0207679_10023297 3300025945 Bacteria 4231
564 Ga0207679_10050283 3300025945 Bacteria 3045
565 Ga0207679_10056267 3300025945 Bacteria 2903
566 Ga0207679_10345988 3300025945 Bacteria 1294
567 Ga0207667_10003951 3300025949 Bacteria 18243
568 Ga0207667_10016310 3300025949 Bacteria 8396
569 Ga0207667_10020116 3300025949 Bacteria 7432
570 Ga0207667_10028184 3300025949 Bacteria 6101
571 Ga0207667_10038174 3300025949 Bacteria 5130
572 Ga0207667_10071637 3300025949 Bacteria 3603
573 Ga0207667_10153524 3300025949 Bacteria 2369
574 Ga0207667_10623293 3300025949 Bacteria 1086
575 Ga0207651_10000768 3300025960 Bacteria 13809
576 Ga0207651_10001046 3300025960 Bacteria 12258
577 Ga0207651_10019464 3300025960 Bacteria 4069
578 Ga0207651_10022854 3300025960 Bacteria 3834
579 Ga0207651_10039112 3300025960 Bacteria 3124
580 Ga0207651_10060652 3300025960 Bacteria 2627
581 Ga0207712_10000783 3300025961 Bacteria 23699
582 Ga0207712_10055413 3300025961 Bacteria 2789
583 Ga0207668_10000847 3300025972 Bacteria 18448
584 Ga0207668_10021143 3300025972 Bacteria 4147
585 Ga0207668_10034584 3300025972 Bacteria 3357
586 Ga0207668_10329947 3300025972 Bacteria 1269
587 Ga0207640_10000473 3300025981 Bacteria 24521
588 Ga0207640_10006787 3300025981 Bacteria 6296
589 Ga0207640_10033972 3300025981 Bacteria 3179
590 Ga0207640_10055646 3300025981 Bacteria 2593
591 Ga0207640_10072116 3300025981 Bacteria 2328
592 Ga0207640_10108354 3300025981 Bacteria 1963
593 Ga0207658_10004856 3300025986 Bacteria 9286
594 Ga0207658_10005868 3300025986 Bacteria 8396
595 Ga0207658_10012599 3300025986 Bacteria 5773
596 Ga0207658_10016959 3300025986 Bacteria 5012
597 Ga0207658_10018055 3300025986 Bacteria 4865
598 Ga0207658_10049529 3300025986 Bacteria 3087
599 Ga0207658_10053536 3300025986 Bacteria 2982
600 Ga0207658_10121471 3300025986 Bacteria 2083
601 Ga0207658_10242730 3300025986 Bacteria 1527
602 Ga0207677_10001971 3300026023 Bacteria 10865
603 Ga0207677_10056858 3300026023 Bacteria 2683
604 Ga0207703_10002918 3300026035 Bacteria 14553
605 Ga0207703_10009327 3300026035 Bacteria 7711
606 Ga0207703_10017958 3300026035 Bacteria 5524
607 Ga0207703_10050832 3300026035 Bacteria 3356
608 Ga0207703_10169709 3300026035 Bacteria 1918
609 Ga0207703_10229527 3300026035 Bacteria 1663
610 Ga0207639_10000139 3300026041 Bacteria 54240
611 Ga0207639_10001196 3300026041 Bacteria 17619
612 Ga0207639_10002646 3300026041 Bacteria 12024
613 Ga0207639_10037135 3300026041 Bacteria 3616
614 Ga0207639_10041110 3300026041 Bacteria 3457
615 Ga0207639_10090026 3300026041 Bacteria 2453
616 Ga0207639_10164427 3300026041 Bacteria 1873
617 Ga0207639_10170519 3300026041 Bacteria 1843
618 Ga0207639_10315428 3300026041 Bacteria 1386
619 Ga0207678_10000278 3300026067 Bacteria 46335
620 Ga0207678_10002094 3300026067 Bacteria 18070
621 Ga0207678_10008682 3300026067 Bacteria 8948
622 Ga0207678_10009178 3300026067 Bacteria 8706
623 Ga0207678_10022047 3300026067 Bacteria 5580
624 Ga0207678_10033320 3300026067 Bacteria 4489
625 Ga0207678_10038333 3300026067 Bacteria 4164
626 Ga0207678_10049428 3300026067 Bacteria 3634
627 Ga0207678_10050812 3300026067 Bacteria 3581
628 Ga0207678_10053921 3300026067 Bacteria 3464
629 Ga0207708_10151722 3300026075 Bacteria 1825
630 Ga0207702_10008022 3300026078 Bacteria 8938
631 Ga0207702_10037724 3300026078 Bacteria 4046
632 Ga0207702_10043774 3300026078 Bacteria 3760
633 Ga0207702_10065953 3300026078 Bacteria 3101
634 Ga0207702_10107066 3300026078 Bacteria 2478
635 Ga0207641_10002378 3300026088 Bacteria 17352
636 Ga0207641_10007670 3300026088 Bacteria 8972
637 Ga0207641_10011259 3300026088 Bacteria 7336
638 Ga0207641_10013936 3300026088 Bacteria 6593
639 Ga0207641_10052224 3300026088 Bacteria 3461
640 Ga0207641_10075051 3300026088 Bacteria 2919
641 Ga0207641_10146707 3300026088 Bacteria 2134
642 Ga0207641_10156615 3300026088 Bacteria 2067
643 Ga0207648_10000221 3300026089 Bacteria 61280
644 Ga0207648_10009488 3300026089 Bacteria 9317
645 Ga0207648_10032415 3300026089 Bacteria 4614
646 Ga0207648_10353465 3300026089 Bacteria 1325
647 Ga0207676_10000898 3300026095 Bacteria 23098
648 Ga0207676_10001685 3300026095 Bacteria 16298
649 Ga0207676_10004539 3300026095 Bacteria 9824
650 Ga0207676_10005080 3300026095 Bacteria 9308
651 Ga0207676_10012769 3300026095 Bacteria 6027
652 Ga0207676_10014344 3300026095 Bacteria 5699
653 Ga0207676_10031329 3300026095 Bacteria 3999
654 Ga0207676_10076617 3300026095 Bacteria 2703
655 Ga0207676_10110300 3300026095 Bacteria 2301
656 Ga0207674_10001223 3300026116 Bacteria 33472
657 Ga0207674_10005766 3300026116 Bacteria 14688
658 Ga0207674_10022143 3300026116 Bacteria 6830
659 Ga0207674_10024784 3300026116 Bacteria 6404
660 Ga0207674_10028640 3300026116 Bacteria 5875
661 Ga0207674_10031283 3300026116 Bacteria 5592
662 Ga0207674_10041206 3300026116 Bacteria 4777
663 Ga0207674_10049277 3300026116 Bacteria 4308
664 Ga0207674_10154038 3300026116 Bacteria 2254
665 Ga0207674_10252464 3300026116 Bacteria 1711
666 Ga0207675_100026668 3300026118 Bacteria 5378
667 Ga0207675_100038515 3300026118 Bacteria 4462
668 Ga0207675_100059132 3300026118 Bacteria 3577
669 Ga0207675_100121589 3300026118 Bacteria 2471
670 Ga0207683_10003627 3300026121 Bacteria 13435
671 Ga0207683_10008118 3300026121 Bacteria 8976
672 Ga0207683_10020656 3300026121 Bacteria 5635
673 Ga0207683_10037519 3300026121 Bacteria 4220
674 Ga0207683_10079873 3300026121 Bacteria 2901
675 Ga0207698_10002860 3300026142 Bacteria 10324
676 Ga0207698_10004194 3300026142 Bacteria 8768
677 Ga0207698_10004411 3300026142 Bacteria 8576
678 Ga0207698_10004557 3300026142 Bacteria 8460
679 Ga0207698_10008424 3300026142 Bacteria 6521
680 Ga0207698_10008490 3300026142 Bacteria 6502
681 Ga0207698_10154988 3300026142 Bacteria 1994
682 Ga0207698_10198608 3300026142 Bacteria 1794
683 Ga0207698_10540015 3300026142 Bacteria 1141
684 Ga0268266_10000200 3300028379 Bacteria 104456
685 Ga0268266_10010037 3300028379 Bacteria 8306
686 Ga0268266_10020207 3300028379 Bacteria 5677
687 Ga0268266_10306584 3300028379 Bacteria 1483
688 Ga0268265_10003443 3300028380 Bacteria 11386
689 Ga0268265_10003672 3300028380 Bacteria 10945
690 Ga0268265_10012876 3300028380 Bacteria 5677
691 Ga0268265_10015220 3300028380 Bacteria 5259
692 Ga0268265_10035629 3300028380 Bacteria 3638
693 Ga0268265_10040921 3300028380 Bacteria 3425
694 Ga0268265_10063339 3300028380 Bacteria 2844
695 Ga0268264_10000268 3300028381 Bacteria 91477
696 Ga0268264_10009700 3300028381 Bacteria 7974
697 Ga0268264_10046258 3300028381 Bacteria 3614
698 Ga0268264_10073661 3300028381 Bacteria 2899
699 Ga0268264_10200502 3300028381 Bacteria 1825
700 Ga0307408_100272106 3300031548 Bacteria 1407
701 Ga0307405_10010054 3300031731 Bacteria 4881
702 Ga0307413_10004817 3300031824 Bacteria 5929
703 Ga0307413_10046417 3300031824 Bacteria 2582
704 Ga0307413_10055299 3300031824 Bacteria 2414
705 Ga0307413_10078594 3300031824 Bacteria 2106
706 Ga0307413_10101184 3300031824 Bacteria 1905
707 Ga0307413_10102432 3300031824 Bacteria 1895
708 Ga0307410_10001234 3300031852 Bacteria 11363
709 Ga0307410_10031077 3300031852 Bacteria 3422
710 Ga0307410_10033374 3300031852 Bacteria 3322
711 Ga0307410_10100458 3300031852 Bacteria 2072
712 Ga0307410_10117142 3300031852 Bacteria 1936
713 Ga0307410_10302027 3300031852 Bacteria 1263
714 Ga0307410_10408635 3300031852 Bacteria 1098
715 Ga0307406_10022905 3300031901 Bacteria 3710
716 Ga0307407_10008525 3300031903 Bacteria 4712
717 Ga0307407_10014373 3300031903 Bacteria 3875
718 Ga0307407_10088415 3300031903 Bacteria 1893
719 Ga0307407_10100322 3300031903 Bacteria 1795
720 Ga0307412_10012467 3300031911 Bacteria 4957
721 Ga0307409_100079958 3300031995 Bacteria 2636
722 Ga0307409_100104898 3300031995 Bacteria 2355
723 Ga0307409_100147026 3300031995 Bacteria 2039
724 Ga0307416_100007293 3300032002 Bacteria 7012
725 Ga0307414_10032264 3300032004 Bacteria 3446
726 Ga0307414_10032921 3300032004 Bacteria 3419
727 Ga0307414_10091704 3300032004 Bacteria 2259
728 Ga0307411_10003959 3300032005 Bacteria 6994
729 Ga0307411_10017036 3300032005 Bacteria 4127
730 Ga0307411_10056227 3300032005 Bacteria 2592
731 Ga0307411_10117503 3300032005 Bacteria 1916
732 Ga0307411_10224323 3300032005 Bacteria 1460
733 Ga0307415_100031813 3300032126 Bacteria 3404
734 Ga0373923_0007512 3300035111 Bacteria 3836
735 Ga0373960_0010142 3300035121 Bacteria 2295
736 Ga0373955_0002057 3300035172 Bacteria 8664
737 Ga0373961_0028034 3300035241 Bacteria 1550
738 Ga0373962_0035539 3300035242 Bacteria 1384
739 Ga0373931_0054975 3300035691 Bacteria 2129
740 Ga0373935_0004839 3300035692 Bacteria 7914
741 Ga0373933_0152179 3300035724 Bacteria 1465
742 Ga0373937_0001769 3300036401 Bacteria 18160
743 Ga0395899_0000157 3300037312 Bacteria 103574
744 Ga0395899_0008289 3300037312 Bacteria 8004
745 Ga0395899_0008991 3300037312 Bacteria 7682
746 Ga0395899_0010294 3300037312 Bacteria 7170
747 Ga0395899_0029506 3300037312 Bacteria 4126
748 Ga0395899_0056186 3300037312 Bacteria 2909
749 Ga0395899_0063664 3300037312 Bacteria 2712
750 Ga0395899_0086728 3300037312 Bacteria 2273
751 Ga0395899_0096499 3300037312 Bacteria 2137
752 Ga0395899_0135347 3300037312 Bacteria 1756
753 Ga0395899_0155574 3300037312 Bacteria 1618
754 Ga0395900_0000296 3300037418 Bacteria 74995
755 Ga0395900_0002159 3300037418 Bacteria 21983
756 Ga0395900_0006365 3300037418 Bacteria 12310
757 Ga0395900_0013948 3300037418 Bacteria 8201
758 Ga0395900_0015667 3300037418 Bacteria 7728
759 Ga0395900_0025022 3300037418 Bacteria 6110
760 Ga0395900_0041432 3300037418 Bacteria 4747
761 Ga0395900_0044771 3300037418 Bacteria 4559
762 Ga0395900_0051449 3300037418 Bacteria 4243
763 Ga0395900_0053774 3300037418 Bacteria 4144
764 Ga0395900_0056185 3300037418 Bacteria 4052
765 Ga0395900_0059097 3300037418 Bacteria 3947
766 Ga0395900_0067966 3300037418 Bacteria 3661
767 Ga0395900_0086192 3300037418 Bacteria 3227
768 Ga0395900_0090689 3300037418 Bacteria 3141
769 Ga0395900_0157206 3300037418 Bacteria 2321
770 Ga0395900_0207700 3300037418 Bacteria 1978
771 Ga0395898_0000054 3300037466 Bacteria 279561
772 Ga0395898_0011784 3300037466 Bacteria 9064
773 Ga0395898_0035400 3300037466 Bacteria 4965
774 Ga0395898_0043823 3300037466 Bacteria 4408
775 Ga0395898_0079971 3300037466 Bacteria 3152
776 Ga0395898_0115391 3300037466 Bacteria 2573
777 Ga0395898_0145721 3300037466 Bacteria 2266
778 Ga0395898_0304392 3300037466 Bacteria 1520
779 Ga0395905_0000046 3300037471 Bacteria 240463
780 Ga0395905_0000232 3300037471 Bacteria 84233
781 Ga0395905_0009999 3300037471 Bacteria 9246
782 Ga0395905_0013772 3300037471 Bacteria 7742
783 Ga0395905_0016443 3300037471 Bacteria 7032
784 Ga0395905_0017293 3300037471 Bacteria 6848
785 Ga0395905_0020751 3300037471 Bacteria 6221
786 Ga0395905_0027028 3300037471 Bacteria 5411
787 Ga0395905_0032043 3300037471 Bacteria 4944
788 Ga0395905_0033213 3300037471 Bacteria 4847
789 Ga0395905_0035133 3300037471 Bacteria 4706
790 Ga0395905_0037956 3300037471 Bacteria 4520
791 Ga0395905_0041151 3300037471 Bacteria 4336
792 Ga0395905_0059848 3300037471 Bacteria 3561
793 Ga0395905_0063527 3300037471 Bacteria 3454
794 Ga0395905_0115923 3300037471 Bacteria 2517
795 Ga0395905_0122293 3300037471 Bacteria 2447
796 Ga0395905_0123779 3300037471 Bacteria 2431
797 Ga0395905_0174323 3300037471 Bacteria 2019
798 Ga0395905_0195662 3300037471 Bacteria 1896
799 Ga0395905_0202268 3300037471 Bacteria 1862
800 Ga0395905_0224178 3300037471 Bacteria 1759
801 Ga0395905_0280421 3300037471 Bacteria 1552
802 Ga0395905_0337733 3300037471 Bacteria 1397
803 Ga0395901_0000102 3300038443 Bacteria 115611
804 Ga0395901_0001796 3300038443 Bacteria 22137
805 Ga0395901_0018555 3300038443 Bacteria 7103
806 Ga0395901_0021016 3300038443 Bacteria 6686
807 Ga0395901_0028003 3300038443 Bacteria 5795
808 Ga0395901_0059382 3300038443 Bacteria 3978
809 Ga0395901_0066141 3300038443 Bacteria 3765
810 Ga0395901_0098799 3300038443 Bacteria 3060
811 Ga0395901_0111929 3300038443 Bacteria 2867
812 Ga0395901_0144481 3300038443 Bacteria 2501
813 Ga0395901_0205145 3300038443 Bacteria 2065
814 Ga0395901_0228080 3300038443 Bacteria 1945
815 Ga0395901_0252596 3300038443 Bacteria 1837
816 Ga0395901_0440035 3300038443 Bacteria 1334
817 Ga0439453_0003861 3300041408 Bacteria 2190
818 Ga0439432_003242 3300042006 Bacteria 6052
819 Ga0439464_0000134 3300042439 Bacteria 11888
820 Ga0439464_0008606 3300042439 Bacteria 2675
821 Ga0466969_0014274 3300044656 Bacteria 4177
822 Ga0466969_0052745 3300044656 Bacteria 1997
823 Ga0466972_0050073 3300044658 Bacteria 2017
824 Ga0466972_0089737 3300044658 Bacteria 1458
825 Ga0466965_0070023 3300044683 Bacteria 1763
826 Ga0466966_0004967 3300044684 Bacteria 8743
827 Ga0466966_0053713 3300044684 Bacteria 2555
828 Ga0466961_0010854 3300044693 Bacteria 5816
829 Ga0466961_0048635 3300044693 Bacteria 2710
830 Ga0466963_0005741 3300044694 Bacteria 7294
831 Ga0466963_0050895 3300044694 Bacteria 2743
832 Ga0466963_0088334 3300044694 Bacteria 2109
833 Ga0466963_0209006 3300044694 Bacteria 1365
834 Ga0466971_0105098 3300044719 Bacteria 1300
835 Ga0466971_0115999 3300044719 Bacteria 1238
836 Ga0466959_0008143 3300045049 Bacteria 7394
837 Ga0466959_0018334 3300045049 Bacteria 5139
838 Ga0466959_0068976 3300045049 Bacteria 2562
839 Ga0466958_0002649 3300045836 Bacteria 9045
840 Ga0466958_0065960 3300045836 Bacteria 2209
841 Ga0466967_0001162 3300045976 Bacteria 14754
842 Ga0466967_0004261 3300045976 Bacteria 9609
843 Ga0466967_0036384 3300045976 Bacteria 4202
844 Ga0466967_0049593 3300045976 Bacteria 3671
845 Ga0466967_0062045 3300045976 Bacteria 3317
846 Ga0466967_0067555 3300045976 Bacteria 3189
847 Ga0466967_0079516 3300045976 Bacteria 2956
848 Ga0466967_0088547 3300045976 Bacteria 2810
849 Ga0466967_0090043 3300045976 Bacteria 2787
850 Ga0466967_0110000 3300045976 Bacteria 2530
851 Ga0466967_0201100 3300045976 Bacteria 1887
852 Ga0466967_0512061 3300045976 Bacteria 1178
853 Ga0495584_0110747 3300046491 Bacteria 1389
854 Ga0495663_0006173 3300046525 Bacteria 3310
855 Ga0495663_0009280 3300046525 Bacteria 2728
856 Ga0495663_0010118 3300046525 Bacteria 2619
857 Ga0495663_0018352 3300046525 Bacteria 1992
858 Ga0495642_0003261 3300046528 Bacteria 6424
859 Ga0495642_0006175 3300046528 Bacteria 4597
860 Ga0495598_0001159 3300046537 Bacteria 5086
861 Ga0495621_0002396 3300046539 Bacteria 5048
862 Ga0495621_0002900 3300046539 Bacteria 4672
863 Ga0495621_0008454 3300046539 Bacteria 3087
864 Ga0495621_0015545 3300046539 Bacteria 2428
865 Ga0495621_0034718 3300046539 Bacteria 1743
866 Ga0495633_0020350 3300046558 Bacteria 3339
867 Ga0495668_0005930 3300046616 Bacteria 8121
868 Ga0495668_0061008 3300046616 Bacteria 2080
869 Ga0495659_0005594 3300046664 Bacteria 3954
870 Ga0495659_0013125 3300046664 Bacteria 2695
871 Ga0495659_0061118 3300046664 Bacteria 1391
872 Ga0495669_0000648 3300046684 Bacteria 15172
873 Ga0495669_0011154 3300046684 Bacteria 3809
874 Ga0495669_0075864 3300046684 Bacteria 1538
875 Ga0495670_0016185 3300046691 Bacteria 3666
876 Ga0495670_0017015 3300046691 Bacteria 3575
877 Ga0495670_0020880 3300046691 Bacteria 3229
878 Ga0495670_0028244 3300046691 Bacteria 2781
879 Ga0495670_0035235 3300046691 Bacteria 2494
880 Ga0495670_0039984 3300046691 Bacteria 2339
881 Ga0495670_0075495 3300046691 Bacteria 1711
882 Ga0495636_0025702 3300047318 Bacteria 2392
883 Ga0495677_0026303 3300047445 Bacteria 2111
884 Ga0496100_0111736 3300048903 Bacteria 1899
885 Ga0496101_0336036 3300048904 Bacteria 1186
886 Ga0496102_0236711 3300048905 Bacteria 1722
887 Ga0496103_0010938 3300048906 Bacteria 5371
888 Ga0496104_0036159 3300048907 Bacteria 4615
889 Ga0496106_0004301 3300048909 Bacteria 10576
890 Ga0496107_0000262 3300048910 Bacteria 27871
891 Ga0496107_0099582 3300048910 Bacteria 2130
892 Ga0496108_0001384 3300048911 Bacteria 19066
893 Ga0496108_0001931 3300048911 Bacteria 16611
894 Ga0496108_0003913 3300048911 Bacteria 11961
895 Ga0496108_0011249 3300048911 Bacteria 7270
896 Ga0496108_0027912 3300048911 Bacteria 4667
897 Ga0496109_0003175 3300048912 Bacteria 13699
898 Ga0496109_0008971 3300048912 Bacteria 8517
899 Ga0496109_0011973 3300048912 Bacteria 7469
900 Ga0496109_0070570 3300048912 Bacteria 3206
901 Ga0496109_0435454 3300048912 Bacteria 1239
902 Ga0496110_0000771 3300048913 Bacteria 22239
903 Ga0496110_0012783 3300048913 Bacteria 6914
904 Ga0496110_0015524 3300048913 Bacteria 6341
905 Ga0496111_0000670 3300048914 Bacteria 18008
906 Ga0496111_0003393 3300048914 Bacteria 9849
907 Ga0496111_0021271 3300048914 Bacteria 4527
908 Ga0496111_0212250 3300048914 Bacteria 1438
909 Ga0496112_0004685 3300048915 Bacteria 11637
910 Ga0496112_0005943 3300048915 Bacteria 10648
911 Ga0496112_0014957 3300048915 Bacteria 7221
912 Ga0496112_0043908 3300048915 Bacteria 4377
913 Ga0496112_0059733 3300048915 Bacteria 3757
914 Ga0496112_0134143 3300048915 Bacteria 2446
915 Ga0496113_0000775 3300048916 Bacteria 16502
916 Ga0496113_0007376 3300048916 Bacteria 7069
917 Ga0496113_0019816 3300048916 Bacteria 4715
918 Ga0496113_0040436 3300048916 Bacteria 3436
919 Ga0496114_0015552 3300048917 Bacteria 6117
920 Ga0501074_0067179 3300049590 Bacteria 2579
921 Ga0501202_002152 3300049652 Bacteria 3277
922 Ga0501209_025921 3300049656 Bacteria 1442
923 Ga0501224_004794 3300049664 Bacteria 1929
924 Ga0501249_003500 3300049679 Bacteria 3153
925 Ga0501268_009895 3300049765 Bacteria 1474
926 Ga0501204_002309 3300049850 Bacteria 1927
927 nmdc:mga0a205_4289_c1 3300050515 Bacteria 12798
928 Ga0500658_0000032 3300053134 Bacteria 90863
929 Ga0466962_0094846 3300061719 Bacteria 1430
930 Ga0466962_0162021 3300061719 Unclassified 1087
931 Ga0070662_100042303
932 JGI24741J21665_1012139
933 JGI24740J21852_10000953
934 JGI24740J21852_10007935
935 JGI24740J21852_10013794
936 JGI24739J22299_10003826
937 JGI24737J22298_10000027
938 JGI24737J22298_10002185
939 JGI24737J22298_10037434
940 JGI24735J21928_10005201
941 JGI24738J21930_10000258
942 JGI24738J21930_10002624
943 JGI24749J21850_1000139
944 JGI24744J21845_10001852
945 JGI24034J26672_10005163
946 Ga0065715_10000357
947 Ga0070658_10000177
948 Ga0070658_10000256
949 Ga0070658_10003990
950 Ga0070658_10048647
951 Ga0070658_10062537
952 Ga0070658_10112387
953 Ga0070658_10120884
954 Ga0070676_10001421
955 Ga0070676_10009377
956 Ga0070676_10031796
957 Ga0070683_100000686
958 Ga0070683_100001183
959 Ga0070683_100048255
960 Ga0070690_100109135
961 Ga0070670_100001378
962 Ga0070670_100001565
963 Ga0070670_100001825
964 Ga0070670_100005336
965 Ga0070670_100009519
966 Ga0070670_100019419
967 Ga0070677_10000652
968 Ga0070677_10023740
969 Ga0070677_10072372
970 Ga0068869_100000085
971 Ga0068869_100040443
972 Ga0068869_100136023
973 Ga0068869_100298650
974 Ga0070666_10001574
975 Ga0070666_10009095
976 Ga0070666_10037078
977 Ga0070680_100000105
978 Ga0070680_100001387
979 Ga0070680_100002431
980 Ga0070680_100010471
981 Ga0070680_100014221
982 Ga0070680_100059804
983 Ga0070680_100251848
984 Ga0070680_100263124
985 Ga0070682_100029303
986 Ga0068868_100022326
987 Ga0068868_100049892
988 Ga0068868_100084988
989 Ga0068868_100116159
990 Ga0070660_100000064
991 Ga0070660_100000065
992 Ga0070660_100000881
993 Ga0070660_100006285
994 Ga0070660_100010356
995 Ga0070660_100053717
996 Ga0070660_100053986
997 Ga0070660_100104677
998 Ga0070660_100149531
999 Ga0070689_100017045
1000 Ga0070691_10108303
1001 Ga0070687_100094452
1002 Ga0070661_100001118
1003 Ga0070661_100004948
1004 Ga0070661_100016496
1005 Ga0070661_100016702
1006 Ga0070661_100025998
1007 Ga0070661_100034495
1008 Ga0070661_100044590
1009 Ga0070661_100065354
1010 Ga0070661_100101230
1011 Ga0070692_10002705
1012 Ga0070692_10003379
1013 Ga0070692_10038909
1014 Ga0070692_10063956
1015 Ga0070668_100002805
1016 Ga0070668_100006099
1017 Ga0070668_100017955
1018 Ga0070668_100019021
1019 Ga0070668_100038501
1020 Ga0070669_100000693
1021 Ga0070669_100001859
1022 Ga0070669_100046367
1023 Ga0070669_100125445
1024 Ga0070675_100001753
1025 Ga0070675_100044835
1026 Ga0070675_100058441
1027 Ga0070675_100144971
1028 Ga0070671_100000372
1029 Ga0070671_100000892
1030 Ga0070671_100000918
1031 Ga0070671_100002617
1032 Ga0070671_100002782
1033 Ga0070671_100003487
1034 Ga0070671_100009913
1035 Ga0070671_100022379
1036 Ga0070671_100060397
1037 Ga0070671_100144897
1038 Ga0070674_100013485
1039 Ga0070674_100017630
1040 Ga0070674_100091189
1041 Ga0070673_100000158
1042 Ga0070673_100000450
1043 Ga0070673_100010076
1044 Ga0070673_100036691
1045 Ga0070673_100065550
1046 Ga0070673_100073231
1047 Ga0070673_100100229
1048 Ga0070673_100164346
1049 Ga0070673_100232895
1050 Ga0070673_100244000
1051 Ga0070659_100000525
1052 Ga0070659_100002462
1053 Ga0070659_100004006
1054 Ga0070659_100005879
1055 Ga0070659_100011332
1056 Ga0070659_100026730
1057 Ga0070659_100058872
1058 Ga0070659_100073491
1059 Ga0070659_100258017
1060 Ga0070659_100265768
1061 Ga0070667_100003025
1062 Ga0070667_100004176
1063 Ga0070667_100009800
1064 Ga0070667_100017076
1065 Ga0070667_100028404
1066 Ga0070667_100073251
1067 Ga0070667_100094135
1068 Ga0070667_100356299
1069 Ga0070709_10046307
1070 Ga0070714_100005441
1071 Ga0070714_100023219
1072 Ga0070714_100026273
1073 Ga0070694_100006539
1074 Ga0070663_100000033
1075 Ga0070663_100000701
1076 Ga0070663_100017911
1077 Ga0070663_100019600
1078 Ga0070663_100046441
1079 Ga0070663_100067481
1080 Ga0070663_100074279
1081 Ga0070663_100085725
1082 Ga0070663_100091131
1083 Ga0070678_100002162
1084 Ga0070678_100008323
1085 Ga0070678_100034435
1086 Ga0070678_100067449
1087 Ga0070678_100157488
1088 Ga0070678_100291324
1089 Ga0070662_100000017
1090 Ga0070662_100000337
1091 Ga0070662_100000350
1092 Ga0070662_100022257
1093 Ga0070662_100022394
1094 Ga0070662_100027014
1095 Ga0070662_100062823
1096 Ga0070662_100066634
1097 Ga0070662_100091494
1098 Ga0070662_100202163
1099 Ga0070662_100284648
1100 Ga0070662_100288578
1101 Ga0070681_10031395
1102 Ga0070681_10043476
1103 Ga0068867_100000661
1104 Ga0070685_10056992
1105 Ga0070679_100000125
1106 Ga0070679_100024833
1107 Ga0070679_100060612
1108 Ga0070679_100177183
1109 Ga0070679_100180946
1110 Ga0070679_100307975
1111 Ga0070684_100006201
1112 Ga0070684_100044912
1113 Ga0068853_100002108
1114 Ga0068853_100002421
1115 Ga0068853_100013782
1116 Ga0068853_100021859
1117 Ga0068853_100092772
1118 Ga0068853_100095088
1119 Ga0068853_100140180
1120 Ga0070672_100000476
1121 Ga0070672_100001526
1122 Ga0070672_100001606
1123 Ga0070672_100059726
1124 Ga0070696_100007107
1125 Ga0070693_100000820
1126 Ga0070693_100065620
1127 Ga0070693_100117209
1128 Ga0070665_100001860
1129 Ga0070665_100010457
1130 Ga0070665_100011993
1131 Ga0070665_100012945
1132 Ga0068855_100000194
1133 Ga0068855_100000660
1134 Ga0068855_100001289
1135 Ga0068855_100035406
1136 Ga0068855_100050604
1137 Ga0068855_100120840
1138 Ga0068855_100124229
1139 Ga0068855_100190394
1140 Ga0068855_100420701
1141 Ga0070664_100000098
1142 Ga0070664_100000564
1143 Ga0070664_100001922
1144 Ga0070664_100004372
1145 Ga0070664_100007488
1146 Ga0070664_100029046
1147 Ga0070664_100059758
1148 Ga0070664_100113479
1149 Ga0070664_100211519
1150 Ga0070664_100404943
1151 Ga0068857_100001000
1152 Ga0068857_100006167
1153 Ga0068857_100102053
1154 Ga0068857_100185765
1155 Ga0068854_100000173
1156 Ga0068854_100004556
1157 Ga0068854_100007880
1158 Ga0068854_100012893
1159 Ga0068854_100014644
1160 Ga0068854_100018336
1161 Ga0068854_100021062
1162 Ga0068854_100046087
1163 Ga0068856_100000098
1164 Ga0068856_100052216
1165 Ga0068856_100065582
1166 Ga0068856_100294648
1167 Ga0068852_100000305
1168 Ga0068852_100000953
1169 Ga0068852_100004187
1170 Ga0068852_100004399
1171 Ga0068852_100005309
1172 Ga0068852_100008945
1173 Ga0068852_100009153
1174 Ga0068852_100032966
1175 Ga0068852_100037479
1176 Ga0068852_100086485
1177 Ga0068852_100204489
1178 Ga0068852_100252542
1179 Ga0068859_100004043
1180 Ga0068859_100009943
1181 Ga0068859_100010015
1182 Ga0068859_100021936
1183 Ga0068859_100087262
1184 Ga0068859_100653857
1185 Ga0068864_100000797
1186 Ga0068864_100000956
1187 Ga0068864_100001870
1188 Ga0068864_100009821
1189 Ga0068864_100012378
1190 Ga0068864_100013351
1191 Ga0068864_100040839
1192 Ga0068864_100237859
1193 Ga0068864_100434664
1194 Ga0068866_10011564
1195 Ga0068866_10032105
1196 Ga0068866_10165127
1197 Ga0068861_100015774
1198 Ga0068851_10009876
1199 Ga0068851_10031399
1200 Ga0068851_10125658
1201 Ga0068870_10100143
1202 Ga0068870_10157596
1203 Ga0068863_100000948
1204 Ga0068863_100001401
1205 Ga0068863_100001870
1206 Ga0068863_100005844
1207 Ga0068863_100009868
1208 Ga0068858_100000537
1209 Ga0068858_100001052
1210 Ga0068858_100014347
1211 Ga0068858_100016762
1212 Ga0068858_100020175
1213 Ga0068858_100049547
1214 Ga0068860_100005038
1215 Ga0068860_100024302
1216 Ga0068860_100048457
1217 Ga0068860_100083785
1218 Ga0068860_100089418
1219 Ga0068860_100146173
1220 Ga0068862_100003962
1221 Ga0068862_100020001
1222 Ga0068862_100030372
1223 Ga0068862_100056642
1224 Ga0070717_10000958
1225 Ga0070712_100034459
1226 Ga0097621_100012478
1227 Ga0097621_100017230
1228 Ga0068871_100003349
1229 Ga0068871_100049865
1230 Ga0075433_10242344
1231 Ga0068865_100000263
1232 Ga0097620_100004043
1233 Ga0097620_100009944
1234 Ga0097620_100010015
1235 Ga0097620_100021936
1236 Ga0097620_100087261
1237 Ga0097620_100653872
1238 Ga0105240_10020205
1239 Ga0105240_10065302
1240 Ga0105240_10158858
1241 Ga0105240_10164083
1242 Ga0105240_10285164
1243 Ga0111539_10344938
1244 Ga0105245_10002629
1245 Ga0105245_10118220
1246 Ga0105245_10332038
1247 Ga0105245_10556342
1248 Ga0105243_10022150
1249 Ga0105241_10043105
1250 Ga0105242_10004126
1251 Ga0105242_10295761
1252 Ga0105248_10000206
1253 Ga0105248_10000626
1254 Ga0105248_10001473
1255 Ga0105248_10002857
1256 Ga0105248_10006340
1257 Ga0105248_10021255
1258 Ga0105248_10043821
1259 Ga0105248_10189990
1260 Ga0105238_10032471
1261 Ga0105249_10009551
1262 Ga0105249_10050376
1263 Ga0105249_10058549
1264 Ga0105249_10366046
1265 Ga0105239_10095083
1266 Ga0105239_10496052
1267 Ga0105246_10008846
1268 Ga0157373_10002479
1269 Ga0157373_10010481
1270 Ga0157373_10018098
1271 Ga0157373_10033533
1272 Ga0157373_10076006
1273 Ga0157373_10131651
1274 Ga0157373_10155316
1275 Ga0157373_10193988
1276 Ga0157371_10002538
1277 Ga0157371_10025658
1278 Ga0157371_10092499
1279 Ga0157371_10096642
1280 Ga0157371_10097216
1281 Ga0157371_10206468
1282 Ga0157370_10001780
1283 Ga0157370_10009396
1284 Ga0157370_10034504
1285 Ga0157370_10065193
1286 Ga0157370_10154626
1287 Ga0157370_10247091
1288 Ga0157369_10026494
1289 Ga0157369_10045685
1290 Ga0157369_10055713
1291 Ga0157369_10059230
1292 Ga0157369_10129675
1293 Ga0157369_10201021
1294 Ga0157369_10265850
1295 Ga0157369_10355173
1296 Ga0157369_10468918
1297 Ga0157374_10016481
1298 Ga0157378_10000540
1299 Ga0157378_10384192
1300 Ga0163162_10000299
1301 Ga0157372_10000935
1302 Ga0157372_10013593
1303 Ga0157372_10135250
1304 Ga0157372_10147633
1305 Ga0157372_10273391
1306 Ga0157375_10000899
1307 Ga0157375_10063875
1308 Ga0163163_10000454
1309 Ga0163163_10002078
1310 Ga0163163_10018039
1311 Ga0157380_10001142
1312 Ga0157377_10061465
1313 Ga0163161_10014569
1314 Ga0206353_10924596
1315 Ga0207697_10000072
1316 Ga0207697_10000333
1317 Ga0207697_10028050
1318 Ga0207697_10029042
1319 Ga0207697_10095087
1320 Ga0207656_10008136
1321 Ga0207656_10011647
1322 Ga0207656_10022022
1323 Ga0207656_10037936
1324 Ga0207682_10001225
1325 Ga0207682_10014189
1326 Ga0207682_10027008
1327 Ga0207682_10042985
1328 Ga0207642_10022236
1329 Ga0207688_10000289
1330 Ga0207688_10007318
1331 Ga0207688_10020634
1332 Ga0207688_10034424
1333 Ga0207680_10002206
1334 Ga0207680_10002981
1335 Ga0207680_10010570
1336 Ga0207647_10000629
1337 Ga0207647_10001021
1338 Ga0207647_10004235
1339 Ga0207647_10013750
1340 Ga0207647_10019225
1341 Ga0207647_10027834
1342 Ga0207647_10039753
1343 Ga0207699_10005276
1344 Ga0207645_10004731
1345 Ga0207645_10020201
1346 Ga0207645_10039726
1347 Ga0207643_10149850
1348 Ga0207705_10000067
1349 Ga0207705_10000137
1350 Ga0207705_10001117
1351 Ga0207705_10005814
1352 Ga0207705_10011969
1353 Ga0207705_10020858
1354 Ga0207705_10025067
1355 Ga0207705_10039639
1356 Ga0207705_10051871
1357 Ga0207705_10117530
1358 Ga0207707_10006775
1359 Ga0207707_10014289
1360 Ga0207707_10026795
1361 Ga0207707_10042558
1362 Ga0207707_10052949
1363 Ga0207695_10018686
1364 Ga0207695_10023986
1365 Ga0207695_10124804
1366 Ga0207660_10000099
1367 Ga0207660_10001083
1368 Ga0207660_10005519
1369 Ga0207660_10010968
1370 Ga0207660_10011564
1371 Ga0207662_10075465
1372 Ga0207657_10000508
1373 Ga0207657_10000552
1374 Ga0207657_10003558
1375 Ga0207657_10003964
1376 Ga0207657_10004943
1377 Ga0207657_10005670
1378 Ga0207657_10009327
1379 Ga0207657_10012299
1380 Ga0207657_10012422
1381 Ga0207657_10015848
1382 Ga0207657_10029528
1383 Ga0207657_10037871
1384 Ga0207657_10094116
1385 Ga0207657_10107499
1386 Ga0207657_10148560
1387 Ga0207649_10000186
1388 Ga0207649_10002184
1389 Ga0207649_10004786
1390 Ga0207649_10017132
1391 Ga0207649_10026236
1392 Ga0207649_10028135
1393 Ga0207649_10091780
1394 Ga0207649_10242477
1395 Ga0207652_10000058
1396 Ga0207652_10019707
1397 Ga0207652_10035955
1398 Ga0207652_10053467
1399 Ga0207652_10125212
1400 Ga0207681_10001146
1401 Ga0207681_10002252
1402 Ga0207681_10213861
1403 Ga0207694_10001654
1404 Ga0207694_10016299
1405 Ga0207694_10138228
1406 Ga0207650_10001160
1407 Ga0207650_10003924
1408 Ga0207650_10007663
1409 Ga0207650_10014936
1410 Ga0207650_10125933
1411 Ga0207659_10003531
1412 Ga0207659_10245096
1413 Ga0207687_10014389
1414 Ga0207687_10059258
1415 Ga0207664_10008427
1416 Ga0207664_10057537
1417 Ga0207644_10000138
1418 Ga0207644_10000484
1419 Ga0207644_10001682
1420 Ga0207644_10004429
1421 Ga0207644_10008323
1422 Ga0207644_10024229
1423 Ga0207644_10027527
1424 Ga0207644_10030209
1425 Ga0207644_10082510
1426 Ga0207690_10000573
1427 Ga0207690_10005311
1428 Ga0207690_10006573
1429 Ga0207690_10008262
1430 Ga0207690_10013831
1431 Ga0207690_10019726
1432 Ga0207690_10027486
1433 Ga0207690_10045111
1434 Ga0207690_10045352
1435 Ga0207690_10049806
1436 Ga0207690_10106950
1437 Ga0207690_10115917
1438 Ga0207706_10000222
1439 Ga0207706_10000276
1440 Ga0207706_10000514
1441 Ga0207706_10000816
1442 Ga0207706_10002779
1443 Ga0207706_10003931
1444 Ga0207706_10004258
1445 Ga0207706_10022035
1446 Ga0207706_10036980
1447 Ga0207706_10053101
1448 Ga0207706_10059642
1449 Ga0207706_10059746
1450 Ga0207706_10071788
1451 Ga0207706_10081149
1452 Ga0207706_10090064
1453 Ga0207706_10261992
1454 Ga0207709_10008108
1455 Ga0207670_10015021
1456 Ga0207670_10066359
1457 Ga0207669_10005678
1458 Ga0207669_10027152
1459 Ga0207669_10041250
1460 Ga0207669_10104238
1461 Ga0207669_10190115
1462 Ga0207704_10000514
1463 Ga0207665_10106796
1464 Ga0207691_10001562
1465 Ga0207691_10002265
1466 Ga0207691_10002789
1467 Ga0207691_10029602
1468 Ga0207691_10150731
1469 Ga0207691_10312467
1470 Ga0207711_10000389
1471 Ga0207711_10000413
1472 Ga0207711_10000777
1473 Ga0207711_10002223
1474 Ga0207711_10010462
1475 Ga0207711_10070657
1476 Ga0207711_10102838
1477 Ga0207711_10123912
1478 Ga0207689_10000051
1479 Ga0207689_10040570
1480 Ga0207689_10056052
1481 Ga0207689_10063940
1482 Ga0207689_10241849
1483 Ga0207661_10000315
1484 Ga0207661_10002683
1485 Ga0207661_10014571
1486 Ga0207661_10096086
1487 Ga0207679_10000114
1488 Ga0207679_10001985
1489 Ga0207679_10015858
1490 Ga0207679_10017044
1491 Ga0207679_10017477
1492 Ga0207679_10020494
1493 Ga0207679_10023297
1494 Ga0207679_10050283
1495 Ga0207679_10056267
1496 Ga0207679_10345988
1497 Ga0207667_10003951
1498 Ga0207667_10016310
1499 Ga0207667_10020116
1500 Ga0207667_10028184
1501 Ga0207667_10038174
1502 Ga0207667_10071637
1503 Ga0207667_10153524
1504 Ga0207667_10623293
1505 Ga0207651_10000768
1506 Ga0207651_10001046
1507 Ga0207651_10019464
1508 Ga0207651_10022854
1509 Ga0207651_10039112
1510 Ga0207651_10060652
1511 Ga0207712_10000783
1512 Ga0207712_10055413
1513 Ga0207668_10000847
1514 Ga0207668_10021143
1515 Ga0207668_10034584
1516 Ga0207668_10329947
1517 Ga0207640_10000473
1518 Ga0207640_10006787
1519 Ga0207640_10033972
1520 Ga0207640_10055646
1521 Ga0207640_10072116
1522 Ga0207640_10108354
1523 Ga0207658_10004856
1524 Ga0207658_10005868
1525 Ga0207658_10012599
1526 Ga0207658_10016959
1527 Ga0207658_10018055
1528 Ga0207658_10049529
1529 Ga0207658_10053536
1530 Ga0207658_10121471
1531 Ga0207658_10242730
1532 Ga0207677_10001971
1533 Ga0207677_10056858
1534 Ga0207703_10002918
1535 Ga0207703_10009327
1536 Ga0207703_10017958
1537 Ga0207703_10050832
1538 Ga0207703_10169709
1539 Ga0207703_10229527
1540 Ga0207639_10000139
1541 Ga0207639_10001196
1542 Ga0207639_10002646
1543 Ga0207639_10037135
1544 Ga0207639_10041110
1545 Ga0207639_10090026
1546 Ga0207639_10164427
1547 Ga0207639_10170519
1548 Ga0207639_10315428
1549 Ga0207678_10000278
1550 Ga0207678_10002094
1551 Ga0207678_10008682
1552 Ga0207678_10009178
1553 Ga0207678_10022047
1554 Ga0207678_10033320
1555 Ga0207678_10038333
1556 Ga0207678_10049428
1557 Ga0207678_10050812
1558 Ga0207678_10053921
1559 Ga0207708_10151722
1560 Ga0207702_10008022
1561 Ga0207702_10037724
1562 Ga0207702_10043774
1563 Ga0207702_10065953
1564 Ga0207702_10107066
1565 Ga0207641_10002378
1566 Ga0207641_10007670
1567 Ga0207641_10011259
1568 Ga0207641_10013936
1569 Ga0207641_10052224
1570 Ga0207641_10075051
1571 Ga0207641_10146707
1572 Ga0207641_10156615
1573 Ga0207648_10000221
1574 Ga0207648_10009488
1575 Ga0207648_10032415
1576 Ga0207648_10353465
1577 Ga0207676_10000898
1578 Ga0207676_10001685
1579 Ga0207676_10004539
1580 Ga0207676_10005080
1581 Ga0207676_10012769
1582 Ga0207676_10014344
1583 Ga0207676_10031329
1584 Ga0207676_10076617
1585 Ga0207676_10110300
1586 Ga0207674_10001223
1587 Ga0207674_10005766
1588 Ga0207674_10022143
1589 Ga0207674_10024784
1590 Ga0207674_10028640
1591 Ga0207674_10031283
1592 Ga0207674_10041206
1593 Ga0207674_10049277
1594 Ga0207674_10154038
1595 Ga0207674_10252464
1596 Ga0207675_100026668
1597 Ga0207675_100038515
1598 Ga0207675_100059132
1599 Ga0207675_100121589
1600 Ga0207683_10003627
1601 Ga0207683_10008118
1602 Ga0207683_10020656
1603 Ga0207683_10037519
1604 Ga0207683_10079873
1605 Ga0207698_10002860
1606 Ga0207698_10004194
1607 Ga0207698_10004411
1608 Ga0207698_10004557
1609 Ga0207698_10008424
1610 Ga0207698_10008490
1611 Ga0207698_10154988
1612 Ga0207698_10198608
1613 Ga0207698_10540015
1614 Ga0268266_10000200
1615 Ga0268266_10010037
1616 Ga0268266_10020207
1617 Ga0268266_10306584
1618 Ga0268265_10003443
1619 Ga0268265_10003672
1620 Ga0268265_10012876
1621 Ga0268265_10015220
1622 Ga0268265_10035629
1623 Ga0268265_10040921
1624 Ga0268265_10063339
1625 Ga0268264_10000268
1626 Ga0268264_10009700
1627 Ga0268264_10046258
1628 Ga0268264_10073661
1629 Ga0268264_10200502
1630 Ga0307408_100272106
1631 Ga0307405_10010054
1632 Ga0307413_10004817
1633 Ga0307413_10046417
1634 Ga0307413_10055299
1635 Ga0307413_10078594
1636 Ga0307413_10101184
1637 Ga0307413_10102432
1638 Ga0307410_10001234
1639 Ga0307410_10031077
1640 Ga0307410_10033374
1641 Ga0307410_10100458
1642 Ga0307410_10117142
1643 Ga0307410_10302027
1644 Ga0307410_10408635
1645 Ga0307406_10022905
1646 Ga0307407_10008525
1647 Ga0307407_10014373
1648 Ga0307407_10088415
1649 Ga0307407_10100322
1650 Ga0307412_10012467
1651 Ga0307409_100079958
1652 Ga0307409_100104898
1653 Ga0307409_100147026
1654 Ga0307416_100007293
1655 Ga0307414_10032264
1656 Ga0307414_10032921
1657 Ga0307414_10091704
1658 Ga0307411_10003959
1659 Ga0307411_10017036
1660 Ga0307411_10056227
1661 Ga0307411_10117503
1662 Ga0307411_10224323
1663 Ga0307415_100031813
1664 Ga0373923_0007512
1665 Ga0373960_0010142
1666 Ga0373955_0002057
1667 Ga0373961_0028034
1668 Ga0373962_0035539
1669 Ga0373931_0054975
1670 Ga0373935_0004839
1671 Ga0373933_0152179
1672 Ga0373937_0001769
1673 Ga0395899_0000157
1674 Ga0395899_0008289
1675 Ga0395899_0008991
1676 Ga0395899_0010294
1677 Ga0395899_0029506
1678 Ga0395899_0056186
1679 Ga0395899_0063664
1680 Ga0395899_0086728
1681 Ga0395899_0096499
1682 Ga0395899_0135347
1683 Ga0395899_0155574
1684 Ga0395900_0000296
1685 Ga0395900_0002159
1686 Ga0395900_0006365
1687 Ga0395900_0013948
1688 Ga0395900_0015667
1689 Ga0395900_0025022
1690 Ga0395900_0041432
1691 Ga0395900_0044771
1692 Ga0395900_0051449
1693 Ga0395900_0053774
1694 Ga0395900_0056185
1695 Ga0395900_0059097
1696 Ga0395900_0067966
1697 Ga0395900_0086192
1698 Ga0395900_0090689
1699 Ga0395900_0157206
1700 Ga0395900_0207700
1701 Ga0395898_0000054
1702 Ga0395898_0011784
1703 Ga0395898_0035400
1704 Ga0395898_0043823
1705 Ga0395898_0079971
1706 Ga0395898_0115391
1707 Ga0395898_0145721
1708 Ga0395898_0304392
1709 Ga0395905_0000046
1710 Ga0395905_0000232
1711 Ga0395905_0009999
1712 Ga0395905_0013772
1713 Ga0395905_0016443
1714 Ga0395905_0017293
1715 Ga0395905_0020751
1716 Ga0395905_0027028
1717 Ga0395905_0032043
1718 Ga0395905_0033213
1719 Ga0395905_0035133
1720 Ga0395905_0037956
1721 Ga0395905_0041151
1722 Ga0395905_0059848
1723 Ga0395905_0063527
1724 Ga0395905_0115923
1725 Ga0395905_0122293
1726 Ga0395905_0123779
1727 Ga0395905_0174323
1728 Ga0395905_0195662
1729 Ga0395905_0202268
1730 Ga0395905_0224178
1731 Ga0395905_0280421
1732 Ga0395905_0337733
1733 Ga0395901_0000102
1734 Ga0395901_0001796
1735 Ga0395901_0018555
1736 Ga0395901_0021016
1737 Ga0395901_0028003
1738 Ga0395901_0059382
1739 Ga0395901_0066141
1740 Ga0395901_0098799
1741 Ga0395901_0111929
1742 Ga0395901_0144481
1743 Ga0395901_0205145
1744 Ga0395901_0228080
1745 Ga0395901_0252596
1746 Ga0395901_0440035
1747 Ga0439453_0003861
1748 Ga0439432_003242
1749 Ga0439464_0000134
1750 Ga0439464_0008606
1751 Ga0466969_0014274
1752 Ga0466969_0052745
1753 Ga0466972_0050073
1754 Ga0466972_0089737
1755 Ga0466965_0070023
1756 Ga0466966_0004967
1757 Ga0466966_0053713
1758 Ga0466961_0010854
1759 Ga0466961_0048635
1760 Ga0466963_0005741
1761 Ga0466963_0050895
1762 Ga0466963_0088334
1763 Ga0466963_0209006
1764 Ga0466971_0105098
1765 Ga0466971_0115999
1766 Ga0466959_0008143
1767 Ga0466959_0018334
1768 Ga0466959_0068976
1769 Ga0466958_0002649
1770 Ga0466958_0065960
1771 Ga0466967_0001162
1772 Ga0466967_0004261
1773 Ga0466967_0036384
1774 Ga0466967_0049593
1775 Ga0466967_0062045
1776 Ga0466967_0067555
1777 Ga0466967_0079516
1778 Ga0466967_0088547
1779 Ga0466967_0090043
1780 Ga0466967_0110000
1781 Ga0466967_0201100
1782 Ga0466967_0512061
1783 Ga0495584_0110747
1784 Ga0495663_0006173
1785 Ga0495663_0009280
1786 Ga0495663_0010118
1787 Ga0495663_0018352
1788 Ga0495642_0003261
1789 Ga0495642_0006175
1790 Ga0495598_0001159
1791 Ga0495621_0002396
1792 Ga0495621_0002900
1793 Ga0495621_0008454
1794 Ga0495621_0015545
1795 Ga0495621_0034718
1796 Ga0495633_0020350
1797 Ga0495668_0005930
1798 Ga0495668_0061008
1799 Ga0495659_0005594
1800 Ga0495659_0013125
1801 Ga0495659_0061118
1802 Ga0495669_0000648
1803 Ga0495669_0011154
1804 Ga0495669_0075864
1805 Ga0495670_0016185
1806 Ga0495670_0017015
1807 Ga0495670_0020880
1808 Ga0495670_0028244
1809 Ga0495670_0035235
1810 Ga0495670_0039984
1811 Ga0495670_0075495
1812 Ga0495636_0025702
1813 Ga0495677_0026303
1814 Ga0496100_0111736
1815 Ga0496101_0336036
1816 Ga0496102_0236711
1817 Ga0496103_0010938
1818 Ga0496104_0036159
1819 Ga0496106_0004301
1820 Ga0496107_0000262
1821 Ga0496107_0099582
1822 Ga0496108_0001384
1823 Ga0496108_0001931
1824 Ga0496108_0003913
1825 Ga0496108_0011249
1826 Ga0496108_0027912
1827 Ga0496109_0003175
1828 Ga0496109_0008971
1829 Ga0496109_0011973
1830 Ga0496109_0070570
1831 Ga0496109_0435454
1832 Ga0496110_0000771
1833 Ga0496110_0012783
1834 Ga0496110_0015524
1835 Ga0496111_0000670
1836 Ga0496111_0003393
1837 Ga0496111_0021271
1838 Ga0496111_0212250
1839 Ga0496112_0004685
1840 Ga0496112_0005943
1841 Ga0496112_0014957
1842 Ga0496112_0043908
1843 Ga0496112_0059733
1844 Ga0496112_0134143
1845 Ga0496113_0000775
1846 Ga0496113_0007376
1847 Ga0496113_0019816
1848 Ga0496113_0040436
1849 Ga0496114_0015552
1850 Ga0501074_0067179
1851 Ga0501202_002152
1852 Ga0501209_025921
1853 Ga0501224_004794
1854 Ga0501249_003500
1855 Ga0501268_009895
1856 Ga0501204_002309
1857 nmdc:mga0a205_4289_c1
1858 Ga0500658_0000032
1859 Ga0466962_0094846
1860 Ga0466962_0162021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00925

GTP_cyclohydro2

GTP cyclohydrolase II

181

347

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bz0-assembly1.cif.gz_A crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc 0.8213 159 327
2bz1-assembly1.cif.gz_A-2 crystal structure of apo e. coli gtp cyclohydrolase ii 0.8184 159 327
2bz0-assembly1.cif.gz_A crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc 0.7996 159 327
2bz1-assembly1.cif.gz_A-2 crystal structure of apo e. coli gtp cyclohydrolase ii 0.7973 159 327
4ok0-assembly1.cif.gz_A crystal structure of putative nucleotidyltransferase from h. pylori 0.7559 159 191
ID Description Score Start End Superfamily
5j3bB01 Mainly Beta;Roll;SH3 type barrels.; 0.8307 160 193 2.30.30.30
4i14B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.8227 161 328 3.40.50.10990
2bz0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.8196 159 331 3.40.50.10990
4i14B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.8111 161 328 3.40.50.10990
2bz0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.8109 159 331 3.40.50.10990
ID Description Score Start End GO Terms
AF-A0A7G9SAI4-F1-model_v4 Uncharacterized protein 0.949 1 152
AF-A0A430BIM5-F1-model_v4 GTP cyclohydrolase-2 (EC 3.5.4.25) (GTP cyclohydrolase II) 0.85 3 351 GO:0003935
GO:0005525
GO:0005829
GO:0008270
GO:0009231
AF-A0A258VF56-F1-model_v4 deleted 0.8383 1 351
AF-A0A2A4B1K4-F1-model_v4 GTP cyclohydrolase-2 (EC 3.5.4.25) (GTP cyclohydrolase II) 0.8362 1 351 GO:0003935
GO:0005525
GO:0005829
GO:0008270
GO:0009231
AF-A0A258VF56-F1-model_v4 deleted 0.834 1 351

Map