F486016
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 930 | 375 | 1860 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10063501|Ga0070717_100635013 |
| Length | 359 |
| Sequence | MTTDKPMQLGMIGLGRMGANLSRRLMRDGHRVVVYDHTPDHVKQLAGEGATGALTLEEFVAKLEKPRAAWLMLPAAVTGPVLERLAVLLEPGDIVIDGGNTYYRDDIDRAKELMPRQLHYVDVGTSGGIFGLERGFCLMIGGEDGPVEHLDPIFKSIAPGAGTAEPTPGRSRSDTGTAQDGYLHCGPSGSGHFVKMVHNGIEYGMMAAIAEGLSIIKHANVGQDEVQSDDAETTPLRDPQYYQYDIDVAEVAEVWRRGSVISSWLIDLTADALARSPQLDNFGGHVSDSGEGRWTVIAAVDEGVPAPVITAALIERFESRGLGEFGDKVLSALRSEFGGHAEKESDNSGRILPADPTGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 191 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 192 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 230 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 310 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 311 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 312 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 353 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 354 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 357 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 358 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 361 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 362 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 363 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 364 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 365 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 366 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 367 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 368 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 369 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 370 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 371 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 372 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 373 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 374 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 375 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.63 |
| Metatranscriptomes | 0.65 |
| Isolates | 1.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.61 |
| Nodule | 0.22 |
| Rhizoplane | 5.7 |
| Rhizosphere | 90.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070717_10063501 | 3300006028 | Bacteria | 3065 |
| 2 | JGI24742J22300_10012159 | 3300002244 | Bacteria | 1432 |
| 3 | JGI25407J50210_10041359 | 3300003373 | Bacteria | 1180 |
| 4 | Ga0055536_1024561 | 3300003781 | Bacteria | 1742 |
| 5 | Ga0070658_10046996 | 3300005327 | Bacteria | 3493 |
| 6 | Ga0070683_100000226 | 3300005329 | Bacteria | 38469 |
| 7 | Ga0070683_100029490 | 3300005329 | Bacteria | 4968 |
| 8 | Ga0070683_100179933 | 3300005329 | Bacteria | 2007 |
| 9 | Ga0070690_100003251 | 3300005330 | Bacteria | 8869 |
| 10 | Ga0070690_100074855 | 3300005330 | Bacteria | 2206 |
| 11 | Ga0070690_100278915 | 3300005330 | Bacteria | 1191 |
| 12 | Ga0070670_100166035 | 3300005331 | Bacteria | 1914 |
| 13 | Ga0070666_10028275 | 3300005335 | Bacteria | 3678 |
| 14 | Ga0070666_10035693 | 3300005335 | Bacteria | 3298 |
| 15 | Ga0070680_100137959 | 3300005336 | Bacteria | 2044 |
| 16 | Ga0070682_100000072 | 3300005337 | Bacteria | 93808 |
| 17 | Ga0070682_100053977 | 3300005337 | Bacteria | 2520 |
| 18 | Ga0068868_100012247 | 3300005338 | Bacteria | 6265 |
| 19 | Ga0068868_100015708 | 3300005338 | Bacteria | 5608 |
| 20 | Ga0068868_100345383 | 3300005338 | Bacteria | 1273 |
| 21 | Ga0070660_100418869 | 3300005339 | Bacteria | 1109 |
| 22 | Ga0070689_100001617 | 3300005340 | Bacteria | 14384 |
| 23 | Ga0070689_100009128 | 3300005340 | Bacteria | 7021 |
| 24 | Ga0070691_10009274 | 3300005341 | Bacteria | 4497 |
| 25 | Ga0070692_10156612 | 3300005345 | Bacteria | 1302 |
| 26 | Ga0070668_100002229 | 3300005347 | Bacteria | 14246 |
| 27 | Ga0070668_100024108 | 3300005347 | Bacteria | 4608 |
| 28 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 29 | Ga0070675_100037489 | 3300005354 | Bacteria | 3949 |
| 30 | Ga0070671_100091773 | 3300005355 | Bacteria | 2544 |
| 31 | Ga0070674_100008015 | 3300005356 | Bacteria | 6261 |
| 32 | Ga0070688_100000018 | 3300005365 | Bacteria | 72357 |
| 33 | Ga0070688_100000364 | 3300005365 | Bacteria | 22986 |
| 34 | Ga0070688_100038405 | 3300005365 | Bacteria | 2924 |
| 35 | Ga0070659_100048610 | 3300005366 | Bacteria | 3333 |
| 36 | Ga0070659_100052543 | 3300005366 | Bacteria | 3206 |
| 37 | Ga0070667_100001736 | 3300005367 | Bacteria | 19468 |
| 38 | Ga0070667_100002459 | 3300005367 | Bacteria | 16172 |
| 39 | Ga0070709_10005538 | 3300005434 | Bacteria | 6836 |
| 40 | Ga0070709_10096587 | 3300005434 | Bacteria | 1960 |
| 41 | Ga0070709_10255817 | 3300005434 | Bacteria | 1263 |
| 42 | Ga0070714_100074268 | 3300005435 | Bacteria | 2947 |
| 43 | Ga0070713_100000061 | 3300005436 | Bacteria | 68662 |
| 44 | Ga0070713_100000246 | 3300005436 | Bacteria | 35790 |
| 45 | Ga0070713_100070690 | 3300005436 | Bacteria | 2947 |
| 46 | Ga0070713_100098808 | 3300005436 | Bacteria | 2525 |
| 47 | Ga0070713_100124655 | 3300005436 | Bacteria | 2264 |
| 48 | Ga0070713_100230126 | 3300005436 | Bacteria | 1685 |
| 49 | Ga0070710_10003126 | 3300005437 | Bacteria | 7843 |
| 50 | Ga0070710_10003839 | 3300005437 | Bacteria | 7109 |
| 51 | Ga0070710_10024104 | 3300005437 | Bacteria | 3206 |
| 52 | Ga0070710_10114119 | 3300005437 | Bacteria | 1627 |
| 53 | Ga0070701_10004227 | 3300005438 | Bacteria | 5785 |
| 54 | Ga0070701_10004840 | 3300005438 | Bacteria | 5505 |
| 55 | Ga0070701_10057040 | 3300005438 | Bacteria | 2046 |
| 56 | Ga0070711_100001099 | 3300005439 | Bacteria | 14425 |
| 57 | Ga0070711_100009291 | 3300005439 | Bacteria | 6048 |
| 58 | Ga0070711_100052841 | 3300005439 | Bacteria | 2797 |
| 59 | Ga0070711_100056556 | 3300005439 | Bacteria | 2713 |
| 60 | Ga0070711_100092238 | 3300005439 | Bacteria | 2185 |
| 61 | Ga0070705_100017856 | 3300005440 | Bacteria | 3710 |
| 62 | Ga0070705_100018185 | 3300005440 | Bacteria | 3680 |
| 63 | Ga0070705_100020873 | 3300005440 | Bacteria | 3476 |
| 64 | Ga0070705_100040100 | 3300005440 | Bacteria | 2661 |
| 65 | Ga0070700_100008540 | 3300005441 | Bacteria | 5576 |
| 66 | Ga0070694_100003172 | 3300005444 | Bacteria | 9807 |
| 67 | Ga0070694_100196659 | 3300005444 | Bacteria | 1500 |
| 68 | Ga0070708_100005178 | 3300005445 | Bacteria | 10323 |
| 69 | Ga0070708_100039880 | 3300005445 | Bacteria | 4111 |
| 70 | Ga0070708_100088458 | 3300005445 | Bacteria | 2816 |
| 71 | Ga0070708_100157043 | 3300005445 | Bacteria | 2118 |
| 72 | Ga0070708_100396995 | 3300005445 | Bacteria | 1300 |
| 73 | Ga0070663_100008138 | 3300005455 | Bacteria | 6431 |
| 74 | Ga0070663_100437850 | 3300005455 | Bacteria | 1075 |
| 75 | Ga0070678_100002322 | 3300005456 | Bacteria | 10386 |
| 76 | Ga0070678_100033632 | 3300005456 | Bacteria | 3562 |
| 77 | Ga0070662_100001811 | 3300005457 | Bacteria | 13140 |
| 78 | Ga0070681_10019014 | 3300005458 | Bacteria | 6875 |
| 79 | Ga0070681_10062806 | 3300005458 | Bacteria | 3687 |
| 80 | Ga0070681_10086096 | 3300005458 | Bacteria | 3095 |
| 81 | Ga0068867_100003850 | 3300005459 | Bacteria | 10550 |
| 82 | Ga0070685_10000114 | 3300005466 | Bacteria | 51524 |
| 83 | Ga0070685_10000437 | 3300005466 | Bacteria | 24303 |
| 84 | Ga0070685_10032457 | 3300005466 | Bacteria | 2924 |
| 85 | Ga0070685_10110372 | 3300005466 | Bacteria | 1693 |
| 86 | Ga0070706_100002130 | 3300005467 | Bacteria | 20170 |
| 87 | Ga0070706_100024697 | 3300005467 | Bacteria | 5533 |
| 88 | Ga0070706_100051856 | 3300005467 | Bacteria | 3787 |
| 89 | Ga0070706_100339049 | 3300005467 | Bacteria | 1401 |
| 90 | Ga0070707_100005579 | 3300005468 | Bacteria | 11755 |
| 91 | Ga0070707_100008372 | 3300005468 | Bacteria | 9603 |
| 92 | Ga0070707_100009418 | 3300005468 | Bacteria | 9066 |
| 93 | Ga0070707_100038877 | 3300005468 | Bacteria | 4546 |
| 94 | Ga0070707_100154595 | 3300005468 | Bacteria | 2234 |
| 95 | Ga0070698_100000231 | 3300005471 | Bacteria | 55183 |
| 96 | Ga0070698_100002524 | 3300005471 | Bacteria | 20162 |
| 97 | Ga0070698_100003478 | 3300005471 | Bacteria | 17336 |
| 98 | Ga0070698_100036108 | 3300005471 | Bacteria | 5108 |
| 99 | Ga0070699_100004142 | 3300005518 | Bacteria | 12813 |
| 100 | Ga0070679_100321696 | 3300005530 | Bacteria | 1496 |
| 101 | Ga0070684_100068355 | 3300005535 | Bacteria | 3122 |
| 102 | Ga0070697_100087337 | 3300005536 | Bacteria | 2575 |
| 103 | Ga0068853_100003312 | 3300005539 | Bacteria | 12323 |
| 104 | Ga0068853_100068965 | 3300005539 | Bacteria | 3075 |
| 105 | Ga0070672_100000018 | 3300005543 | Bacteria | 70205 |
| 106 | Ga0070672_100151192 | 3300005543 | Bacteria | 1920 |
| 107 | Ga0070686_100022148 | 3300005544 | Bacteria | 3782 |
| 108 | Ga0070695_100022929 | 3300005545 | Bacteria | 3832 |
| 109 | Ga0070695_100066903 | 3300005545 | Bacteria | 2342 |
| 110 | Ga0070696_100001452 | 3300005546 | Bacteria | 15503 |
| 111 | Ga0070696_100045297 | 3300005546 | Bacteria | 3048 |
| 112 | Ga0070696_100139539 | 3300005546 | Bacteria | 1770 |
| 113 | Ga0070693_100068640 | 3300005547 | Bacteria | 2081 |
| 114 | Ga0070665_100019446 | 3300005548 | Bacteria | 6816 |
| 115 | Ga0070704_100002458 | 3300005549 | Bacteria | 10400 |
| 116 | Ga0070704_100036830 | 3300005549 | Bacteria | 3336 |
| 117 | Ga0070704_100042140 | 3300005549 | Bacteria | 3156 |
| 118 | Ga0070704_100176645 | 3300005549 | Bacteria | 1704 |
| 119 | Ga0068855_100274719 | 3300005563 | Bacteria | 1873 |
| 120 | Ga0070664_100003303 | 3300005564 | Bacteria | 13030 |
| 121 | Ga0068854_100000044 | 3300005578 | Bacteria | 91882 |
| 122 | Ga0068854_100001161 | 3300005578 | Bacteria | 15811 |
| 123 | Ga0068854_100035498 | 3300005578 | Bacteria | 3489 |
| 124 | Ga0068856_100000654 | 3300005614 | Bacteria | 37552 |
| 125 | Ga0068856_100031615 | 3300005614 | Bacteria | 5180 |
| 126 | Ga0068856_100130920 | 3300005614 | Bacteria | 2513 |
| 127 | Ga0068856_100205034 | 3300005614 | Bacteria | 1986 |
| 128 | Ga0070702_100002284 | 3300005615 | Bacteria | 8208 |
| 129 | Ga0070702_100006065 | 3300005615 | Bacteria | 5693 |
| 130 | Ga0070702_100031834 | 3300005615 | Bacteria | 2889 |
| 131 | Ga0068852_100169033 | 3300005616 | Bacteria | 2048 |
| 132 | Ga0068859_100004277 | 3300005617 | Bacteria | 14580 |
| 133 | Ga0068859_100015441 | 3300005617 | Bacteria | 7670 |
| 134 | Ga0068864_100039384 | 3300005618 | Bacteria | 4040 |
| 135 | Ga0068864_100307216 | 3300005618 | Bacteria | 1486 |
| 136 | Ga0068866_10003324 | 3300005718 | Bacteria | 6605 |
| 137 | Ga0068861_100001255 | 3300005719 | Bacteria | 15831 |
| 138 | Ga0068861_100011299 | 3300005719 | Bacteria | 6201 |
| 139 | Ga0068851_10000922 | 3300005834 | Bacteria | 12681 |
| 140 | Ga0068863_100082898 | 3300005841 | Bacteria | 3038 |
| 141 | Ga0068863_100302269 | 3300005841 | Bacteria | 1552 |
| 142 | Ga0068858_100003628 | 3300005842 | Bacteria | 15274 |
| 143 | Ga0068858_100079405 | 3300005842 | Bacteria | 3049 |
| 144 | Ga0068860_100003964 | 3300005843 | Bacteria | 15199 |
| 145 | Ga0068860_100005857 | 3300005843 | Bacteria | 12371 |
| 146 | Ga0068862_100006916 | 3300005844 | Bacteria | 9407 |
| 147 | Ga0068862_100030058 | 3300005844 | Bacteria | 4578 |
| 148 | Ga0068862_100069209 | 3300005844 | Bacteria | 3046 |
| 149 | Ga0081455_10007980 | 3300005937 | Bacteria | 11069 |
| 150 | Ga0081455_10053873 | 3300005937 | Bacteria | 3434 |
| 151 | Ga0081538_10000068 | 3300005981 | Bacteria | 97659 |
| 152 | Ga0081540_1000009 | 3300005983 | Bacteria | 193562 |
| 153 | Ga0081540_1000740 | 3300005983 | Bacteria | 30077 |
| 154 | Ga0070717_10002827 | 3300006028 | Bacteria | 12292 |
| 155 | Ga0070717_10009210 | 3300006028 | Bacteria | 7421 |
| 156 | Ga0070717_10049502 | 3300006028 | Bacteria | 3450 |
| 157 | Ga0070717_10378809 | 3300006028 | Bacteria | 1268 |
| 158 | Ga0070715_10001613 | 3300006163 | Bacteria | 6655 |
| 159 | Ga0070715_10041293 | 3300006163 | Bacteria | 1932 |
| 160 | Ga0070716_100002864 | 3300006173 | Bacteria | 8037 |
| 161 | Ga0070716_100021946 | 3300006173 | Bacteria | 3369 |
| 162 | Ga0070716_100074708 | 3300006173 | Bacteria | 2004 |
| 163 | Ga0070712_100004723 | 3300006175 | Bacteria | 8426 |
| 164 | Ga0070712_100016409 | 3300006175 | Bacteria | 4784 |
| 165 | Ga0070712_100018523 | 3300006175 | Bacteria | 4526 |
| 166 | Ga0070712_100074536 | 3300006175 | Bacteria | 2438 |
| 167 | Ga0070712_100294081 | 3300006175 | Bacteria | 1312 |
| 168 | Ga0070712_100315471 | 3300006175 | Bacteria | 1270 |
| 169 | Ga0070712_100330133 | 3300006175 | Bacteria | 1242 |
| 170 | Ga0075369_10008808 | 3300006186 | Bacteria | 3897 |
| 171 | Ga0097621_100111923 | 3300006237 | Bacteria | 2307 |
| 172 | Ga0097621_100253752 | 3300006237 | Bacteria | 1541 |
| 173 | Ga0075370_10150568 | 3300006353 | Bacteria | 1363 |
| 174 | Ga0068871_100023983 | 3300006358 | Bacteria | 4727 |
| 175 | Ga0068871_100052446 | 3300006358 | Bacteria | 3303 |
| 176 | Ga0075433_10046997 | 3300006852 | Bacteria | 3754 |
| 177 | Ga0075433_10130847 | 3300006852 | Bacteria | 2229 |
| 178 | Ga0075433_10142060 | 3300006852 | Bacteria | 2134 |
| 179 | Ga0068865_100000019 | 3300006881 | Bacteria | 105996 |
| 180 | Ga0068865_100005261 | 3300006881 | Bacteria | 7825 |
| 181 | Ga0075436_100057382 | 3300006914 | Bacteria | 2689 |
| 182 | Ga0097620_100004277 | 3300006931 | Bacteria | 14580 |
| 183 | Ga0097620_100015441 | 3300006931 | Bacteria | 7670 |
| 184 | Ga0075435_100085874 | 3300007076 | Bacteria | 2590 |
| 185 | Ga0099794_10037772 | 3300007265 | Bacteria | 2287 |
| 186 | Ga0105251_10017754 | 3300009011 | Bacteria | 3804 |
| 187 | Ga0105240_10034655 | 3300009093 | Bacteria | 6509 |
| 188 | Ga0105240_10086989 | 3300009093 | Bacteria | 3828 |
| 189 | Ga0111539_10070745 | 3300009094 | Bacteria | 4118 |
| 190 | Ga0111539_10090382 | 3300009094 | Bacteria | 3598 |
| 191 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 192 | Ga0105245_10001816 | 3300009098 | Bacteria | 19416 |
| 193 | Ga0105245_10021334 | 3300009098 | Bacteria | 5680 |
| 194 | Ga0105245_10031998 | 3300009098 | Bacteria | 4656 |
| 195 | Ga0105245_10089225 | 3300009098 | Bacteria | 2834 |
| 196 | Ga0105245_10385799 | 3300009098 | Bacteria | 1396 |
| 197 | Ga0105247_10009690 | 3300009101 | Bacteria | 5841 |
| 198 | Ga0105247_10119690 | 3300009101 | Bacteria | 1705 |
| 199 | Ga0114129_10004005 | 3300009147 | Bacteria | 20806 |
| 200 | Ga0105243_10003858 | 3300009148 | Bacteria | 11974 |
| 201 | Ga0105243_10087941 | 3300009148 | Bacteria | 2552 |
| 202 | Ga0105243_10088705 | 3300009148 | Bacteria | 2541 |
| 203 | Ga0105241_10124392 | 3300009174 | Bacteria | 2081 |
| 204 | Ga0105242_10000325 | 3300009176 | Bacteria | 38289 |
| 205 | Ga0105242_10144137 | 3300009176 | Bacteria | 2070 |
| 206 | Ga0105248_10000267 | 3300009177 | Bacteria | 61244 |
| 207 | Ga0105248_10054995 | 3300009177 | Bacteria | 4464 |
| 208 | Ga0105248_10073625 | 3300009177 | Bacteria | 3839 |
| 209 | Ga0105248_10156346 | 3300009177 | Bacteria | 2573 |
| 210 | Ga0105248_10420112 | 3300009177 | Bacteria | 1506 |
| 211 | Ga0105237_10024788 | 3300009545 | Bacteria | 6137 |
| 212 | Ga0105238_10258866 | 3300009551 | Bacteria | 1719 |
| 213 | Ga0105249_10014730 | 3300009553 | Bacteria | 6912 |
| 214 | Ga0105249_10025516 | 3300009553 | Bacteria | 5321 |
| 215 | Ga0105249_10157755 | 3300009553 | Bacteria | 2190 |
| 216 | Ga0105249_10387431 | 3300009553 | Bacteria | 1425 |
| 217 | Ga0105033_101725 | 3300009986 | Bacteria | 1801 |
| 218 | Ga0105239_10016972 | 3300010375 | Bacteria | 8048 |
| 219 | Ga0105239_10318484 | 3300010375 | Bacteria | 1753 |
| 220 | Ga0105239_10482209 | 3300010375 | Bacteria | 1409 |
| 221 | Ga0105239_10764756 | 3300010375 | Bacteria | 1106 |
| 222 | Ga0105246_10012840 | 3300011119 | Bacteria | 5238 |
| 223 | Ga0157342_1000392 | 3300012507 | Bacteria | 2582 |
| 224 | Ga0157373_10145362 | 3300013100 | Bacteria | 1668 |
| 225 | Ga0157370_10208486 | 3300013104 | Bacteria | 1812 |
| 226 | Ga0157370_10334495 | 3300013104 | Bacteria | 1396 |
| 227 | Ga0157369_10001010 | 3300013105 | Bacteria | 35439 |
| 228 | Ga0157369_10222225 | 3300013105 | Bacteria | 1977 |
| 229 | Ga0157374_10077156 | 3300013296 | Bacteria | 3152 |
| 230 | Ga0157374_10435182 | 3300013296 | Bacteria | 1312 |
| 231 | Ga0157378_10009698 | 3300013297 | Bacteria | 8386 |
| 232 | Ga0157378_10128911 | 3300013297 | Bacteria | 2339 |
| 233 | Ga0163162_10007124 | 3300013306 | Bacteria | 10851 |
| 234 | Ga0163162_10019114 | 3300013306 | Bacteria | 6720 |
| 235 | Ga0163162_10233978 | 3300013306 | Bacteria | 1968 |
| 236 | Ga0157372_10000128 | 3300013307 | Bacteria | 82571 |
| 237 | Ga0157372_10002534 | 3300013307 | Bacteria | 19823 |
| 238 | Ga0157372_10070133 | 3300013307 | Bacteria | 3943 |
| 239 | Ga0157375_10001489 | 3300013308 | Bacteria | 20109 |
| 240 | Ga0157375_10018476 | 3300013308 | Bacteria | 6324 |
| 241 | Ga0157375_10264421 | 3300013308 | Bacteria | 1882 |
| 242 | Ga0157375_10420004 | 3300013308 | Bacteria | 1503 |
| 243 | Ga0163163_10065823 | 3300014325 | Bacteria | 3598 |
| 244 | Ga0163163_10108039 | 3300014325 | Bacteria | 2809 |
| 245 | Ga0157380_10000009 | 3300014326 | Bacteria | 142155 |
| 246 | Ga0157380_10002763 | 3300014326 | Bacteria | 11919 |
| 247 | Ga0157377_10009168 | 3300014745 | Bacteria | 4846 |
| 248 | Ga0157377_10062846 | 3300014745 | Bacteria | 2125 |
| 249 | Ga0157379_10006987 | 3300014968 | Bacteria | 9759 |
| 250 | Ga0157379_10009692 | 3300014968 | Bacteria | 8386 |
| 251 | Ga0157379_10015635 | 3300014968 | Bacteria | 6666 |
| 252 | Ga0157376_10034901 | 3300014969 | Bacteria | 4064 |
| 253 | Ga0157376_10321902 | 3300014969 | Bacteria | 1470 |
| 254 | Ga0163161_10002437 | 3300017792 | Bacteria | 13291 |
| 255 | Ga0163161_10025836 | 3300017792 | Bacteria | 4158 |
| 256 | Ga0197907_10255742 | 3300020069 | Bacteria | 2595 |
| 257 | Ga0197907_11021319 | 3300020069 | Bacteria | 2087 |
| 258 | Ga0206356_11118101 | 3300020070 | Bacteria | 2875 |
| 259 | Ga0206350_11332138 | 3300020080 | Bacteria | 1677 |
| 260 | Ga0213873_10000742 | 3300021358 | Bacteria | 5287 |
| 261 | Ga0213876_10006294 | 3300021384 | Bacteria | 6466 |
| 262 | Ga0213875_10007908 | 3300021388 | Bacteria | 5465 |
| 263 | Ga0213875_10093865 | 3300021388 | Bacteria | 1399 |
| 264 | Ga0224712_10004896 | 3300022467 | Bacteria | 3668 |
| 265 | Ga0224712_10068449 | 3300022467 | Bacteria | 1435 |
| 266 | Ga0209563_100088 | 3300025230 | Bacteria | 175375 |
| 267 | Ga0209051_1044455 | 3300025303 | Bacteria | 1546 |
| 268 | Ga0207656_10000153 | 3300025321 | Bacteria | 25555 |
| 269 | Ga0207713_1048880 | 3300025735 | Bacteria | 1700 |
| 270 | Ga0207653_10038162 | 3300025885 | Bacteria | 1569 |
| 271 | Ga0207692_10000297 | 3300025898 | Bacteria | 17196 |
| 272 | Ga0207692_10002263 | 3300025898 | Bacteria | 7378 |
| 273 | Ga0207692_10046926 | 3300025898 | Bacteria | 2167 |
| 274 | Ga0207710_10004469 | 3300025900 | Bacteria | 6101 |
| 275 | Ga0207688_10026396 | 3300025901 | Bacteria | 3193 |
| 276 | Ga0207647_10124002 | 3300025904 | Bacteria | 1522 |
| 277 | Ga0207685_10001088 | 3300025905 | Bacteria | 5367 |
| 278 | Ga0207685_10001777 | 3300025905 | Bacteria | 4691 |
| 279 | Ga0207685_10029613 | 3300025905 | Bacteria | 1940 |
| 280 | Ga0207685_10052613 | 3300025905 | Bacteria | 1578 |
| 281 | Ga0207699_10054483 | 3300025906 | Bacteria | 2376 |
| 282 | Ga0207684_10002157 | 3300025910 | Bacteria | 20173 |
| 283 | Ga0207684_10013578 | 3300025910 | Bacteria | 7040 |
| 284 | Ga0207684_10013721 | 3300025910 | Bacteria | 6998 |
| 285 | Ga0207684_10020758 | 3300025910 | Bacteria | 5613 |
| 286 | Ga0207707_10031073 | 3300025912 | Bacteria | 4672 |
| 287 | Ga0207707_10089707 | 3300025912 | Bacteria | 2687 |
| 288 | Ga0207695_10211133 | 3300025913 | Bacteria | 1852 |
| 289 | Ga0207671_10052185 | 3300025914 | Bacteria | 3030 |
| 290 | Ga0207693_10000882 | 3300025915 | Bacteria | 26867 |
| 291 | Ga0207693_10000976 | 3300025915 | Bacteria | 25733 |
| 292 | Ga0207693_10019671 | 3300025915 | Bacteria | 5369 |
| 293 | Ga0207693_10041129 | 3300025915 | Bacteria | 3640 |
| 294 | Ga0207693_10085318 | 3300025915 | Bacteria | 2474 |
| 295 | Ga0207693_10110512 | 3300025915 | Bacteria | 2155 |
| 296 | Ga0207693_10244588 | 3300025915 | Bacteria | 1408 |
| 297 | Ga0207693_10466257 | 3300025915 | Bacteria | 987 |
| 298 | Ga0207663_10001113 | 3300025916 | Bacteria | 12352 |
| 299 | Ga0207663_10014740 | 3300025916 | Bacteria | 4292 |
| 300 | Ga0207663_10016450 | 3300025916 | Bacteria | 4102 |
| 301 | Ga0207660_10217684 | 3300025917 | Bacteria | 1497 |
| 302 | Ga0207662_10177120 | 3300025918 | Bacteria | 1371 |
| 303 | Ga0207657_10031018 | 3300025919 | Bacteria | 4846 |
| 304 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 305 | Ga0207652_10103749 | 3300025921 | Bacteria | 2514 |
| 306 | Ga0207646_10024119 | 3300025922 | Bacteria | 5576 |
| 307 | Ga0207646_10045626 | 3300025922 | Bacteria | 3934 |
| 308 | Ga0207646_10055718 | 3300025922 | Bacteria | 3534 |
| 309 | Ga0207681_10009903 | 3300025923 | Bacteria | 5832 |
| 310 | Ga0207681_10118247 | 3300025923 | Bacteria | 1940 |
| 311 | Ga0207650_10091591 | 3300025925 | Bacteria | 2324 |
| 312 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 313 | Ga0207659_10235998 | 3300025926 | Bacteria | 1477 |
| 314 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 315 | Ga0207687_10007446 | 3300025927 | Bacteria | 7206 |
| 316 | Ga0207687_10038675 | 3300025927 | Bacteria | 3262 |
| 317 | Ga0207687_10140722 | 3300025927 | Bacteria | 1830 |
| 318 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 319 | Ga0207700_10042632 | 3300025928 | Bacteria | 3328 |
| 320 | Ga0207700_10053164 | 3300025928 | Bacteria | 3033 |
| 321 | Ga0207700_10070458 | 3300025928 | Bacteria | 2688 |
| 322 | Ga0207700_10092321 | 3300025928 | Bacteria | 2393 |
| 323 | Ga0207700_10137796 | 3300025928 | Bacteria | 2001 |
| 324 | Ga0207700_10386735 | 3300025928 | Bacteria | 1224 |
| 325 | Ga0207664_10000495 | 3300025929 | Bacteria | 28038 |
| 326 | Ga0207664_10033143 | 3300025929 | Bacteria | 3966 |
| 327 | Ga0207664_10060418 | 3300025929 | Bacteria | 3020 |
| 328 | Ga0207664_10121767 | 3300025929 | Bacteria | 2184 |
| 329 | Ga0207664_10190867 | 3300025929 | Bacteria | 1763 |
| 330 | Ga0207664_10363640 | 3300025929 | Bacteria | 1282 |
| 331 | Ga0207664_10477170 | 3300025929 | Bacteria | 1115 |
| 332 | Ga0207690_10015803 | 3300025932 | Bacteria | 4581 |
| 333 | Ga0207690_10021359 | 3300025932 | Bacteria | 4014 |
| 334 | Ga0207706_10000974 | 3300025933 | Bacteria | 29198 |
| 335 | Ga0207686_10002796 | 3300025934 | Bacteria | 9449 |
| 336 | Ga0207686_10031498 | 3300025934 | Bacteria | 3150 |
| 337 | Ga0207709_10005737 | 3300025935 | Bacteria | 7012 |
| 338 | Ga0207709_10057841 | 3300025935 | Bacteria | 2406 |
| 339 | Ga0207670_10009403 | 3300025936 | Bacteria | 5579 |
| 340 | Ga0207670_10034219 | 3300025936 | Bacteria | 3281 |
| 341 | Ga0207704_10000009 | 3300025938 | Bacteria | 198266 |
| 342 | Ga0207704_10226513 | 3300025938 | Bacteria | 1387 |
| 343 | Ga0207665_10003803 | 3300025939 | Bacteria | 10083 |
| 344 | Ga0207665_10008645 | 3300025939 | Bacteria | 6701 |
| 345 | Ga0207665_10011749 | 3300025939 | Bacteria | 5755 |
| 346 | Ga0207665_10271713 | 3300025939 | Bacteria | 1259 |
| 347 | Ga0207691_10000121 | 3300025940 | Bacteria | 70558 |
| 348 | Ga0207691_10068747 | 3300025940 | Bacteria | 3200 |
| 349 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 350 | Ga0207711_10071956 | 3300025941 | Bacteria | 3002 |
| 351 | Ga0207711_10270200 | 3300025941 | Bacteria | 1564 |
| 352 | Ga0207689_10030488 | 3300025942 | Bacteria | 4495 |
| 353 | Ga0207689_10033846 | 3300025942 | Bacteria | 4245 |
| 354 | Ga0207661_10000068 | 3300025944 | Bacteria | 70953 |
| 355 | Ga0207661_10016099 | 3300025944 | Bacteria | 5512 |
| 356 | Ga0207661_10205821 | 3300025944 | Bacteria | 1732 |
| 357 | Ga0207679_10327555 | 3300025945 | Bacteria | 1328 |
| 358 | Ga0207667_10234262 | 3300025949 | Bacteria | 1880 |
| 359 | Ga0207667_10266684 | 3300025949 | Bacteria | 1751 |
| 360 | Ga0207651_10262424 | 3300025960 | Bacteria | 1419 |
| 361 | Ga0207712_10011404 | 3300025961 | Bacteria | 5663 |
| 362 | Ga0207712_10043824 | 3300025961 | Bacteria | 3089 |
| 363 | Ga0207668_10004668 | 3300025972 | Bacteria | 8061 |
| 364 | Ga0207668_10013201 | 3300025972 | Bacteria | 5078 |
| 365 | Ga0207668_10047103 | 3300025972 | Bacteria | 2951 |
| 366 | Ga0207640_10000517 | 3300025981 | Bacteria | 23263 |
| 367 | Ga0207640_10007221 | 3300025981 | Bacteria | 6126 |
| 368 | Ga0207658_10000708 | 3300025986 | Bacteria | 28881 |
| 369 | Ga0207658_10025320 | 3300025986 | Bacteria | 4154 |
| 370 | Ga0207677_10000671 | 3300026023 | Bacteria | 20346 |
| 371 | Ga0207677_10007576 | 3300026023 | Bacteria | 6022 |
| 372 | Ga0207677_10154556 | 3300026023 | Bacteria | 1775 |
| 373 | Ga0207703_10055569 | 3300026035 | Bacteria | 3221 |
| 374 | Ga0207703_10094172 | 3300026035 | Bacteria | 2524 |
| 375 | Ga0207703_10164249 | 3300026035 | Bacteria | 1947 |
| 376 | Ga0207639_10017085 | 3300026041 | Bacteria | 5141 |
| 377 | Ga0207678_10013696 | 3300026067 | Bacteria | 7123 |
| 378 | Ga0207678_10027433 | 3300026067 | Bacteria | 4967 |
| 379 | Ga0207708_10011118 | 3300026075 | Bacteria | 6694 |
| 380 | Ga0207708_10022419 | 3300026075 | Bacteria | 4769 |
| 381 | Ga0207708_10146618 | 3300026075 | Bacteria | 1855 |
| 382 | Ga0207702_10000099 | 3300026078 | Bacteria | 100461 |
| 383 | Ga0207702_10014292 | 3300026078 | Bacteria | 6591 |
| 384 | Ga0207702_10122188 | 3300026078 | Bacteria | 2332 |
| 385 | Ga0207702_10210684 | 3300026078 | Bacteria | 1807 |
| 386 | Ga0207641_10068180 | 3300026088 | Bacteria | 3049 |
| 387 | Ga0207641_10124906 | 3300026088 | Bacteria | 2302 |
| 388 | Ga0207648_10002209 | 3300026089 | Bacteria | 21102 |
| 389 | Ga0207676_10079234 | 3300026095 | Bacteria | 2663 |
| 390 | Ga0207674_10059781 | 3300026116 | Bacteria | 3856 |
| 391 | Ga0207674_10181029 | 3300026116 | Bacteria | 2059 |
| 392 | Ga0207674_10492047 | 3300026116 | Bacteria | 1185 |
| 393 | Ga0207675_100002728 | 3300026118 | Bacteria | 17389 |
| 394 | Ga0207675_100003484 | 3300026118 | Bacteria | 15374 |
| 395 | Ga0207675_100009266 | 3300026118 | Bacteria | 9232 |
| 396 | Ga0207675_100129318 | 3300026118 | Bacteria | 2394 |
| 397 | Ga0207683_10000557 | 3300026121 | Bacteria | 34447 |
| 398 | Ga0207683_10000832 | 3300026121 | Bacteria | 28220 |
| 399 | Ga0207683_10076606 | 3300026121 | Bacteria | 2961 |
| 400 | Ga0207698_10035785 | 3300026142 | Bacteria | 3636 |
| 401 | Ga0268266_10011831 | 3300028379 | Bacteria | 7561 |
| 402 | Ga0268266_10128859 | 3300028379 | Bacteria | 2261 |
| 403 | Ga0268266_10240837 | 3300028379 | Bacteria | 1669 |
| 404 | Ga0268265_10002429 | 3300028380 | Bacteria | 14065 |
| 405 | Ga0268265_10014382 | 3300028380 | Bacteria | 5392 |
| 406 | Ga0268265_10036094 | 3300028380 | Bacteria | 3618 |
| 407 | Ga0268264_10020629 | 3300028381 | Bacteria | 5383 |
| 408 | Ga0265336_10017714 | 3300028666 | Bacteria | 2317 |
| 409 | Ga0265338_10000743 | 3300028800 | Bacteria | 55581 |
| 410 | Ga0307513_10014472 | 3300031456 | Bacteria | 9625 |
| 411 | Ga0316575_10004917 | 3300031665 | Bacteria | 4724 |
| 412 | Ga0316576_10009488 | 3300031727 | Bacteria | 6283 |
| 413 | Ga0316576_10257501 | 3300031727 | Bacteria | 1309 |
| 414 | Ga0316577_10011037 | 3300031733 | Bacteria | 4887 |
| 415 | Ga0307416_100265125 | 3300032002 | Bacteria | 1682 |
| 416 | Ga0373950_0001014 | 3300034818 | Bacteria | 3574 |
| 417 | Ga0373926_0001758 | 3300035083 | Bacteria | 6724 |
| 418 | Ga0373926_0004436 | 3300035083 | Bacteria | 4603 |
| 419 | Ga0373926_0017855 | 3300035083 | Bacteria | 2437 |
| 420 | Ga0373926_0020345 | 3300035083 | Bacteria | 2292 |
| 421 | Ga0373926_0071266 | 3300035083 | Bacteria | 1277 |
| 422 | Ga0373928_0004493 | 3300035084 | Bacteria | 2659 |
| 423 | Ga0373929_0004745 | 3300035085 | Bacteria | 2437 |
| 424 | Ga0373934_0000629 | 3300035086 | Bacteria | 12432 |
| 425 | Ga0373934_0008756 | 3300035086 | Bacteria | 3778 |
| 426 | Ga0373934_0018600 | 3300035086 | Bacteria | 2660 |
| 427 | Ga0373934_0019023 | 3300035086 | Bacteria | 2633 |
| 428 | Ga0373934_0033071 | 3300035086 | Bacteria | 2030 |
| 429 | Ga0373944_0004052 | 3300035089 | Bacteria | 3797 |
| 430 | Ga0373951_0005145 | 3300035091 | Bacteria | 3056 |
| 431 | Ga0373923_0000272 | 3300035111 | Bacteria | 11329 |
| 432 | Ga0373923_0035198 | 3300035111 | Bacteria | 2037 |
| 433 | Ga0373923_0040755 | 3300035111 | Bacteria | 1912 |
| 434 | Ga0373923_0212831 | 3300035111 | Bacteria | 896 |
| 435 | Ga0373936_0000716 | 3300035113 | Bacteria | 11592 |
| 436 | Ga0373936_0000918 | 3300035113 | Bacteria | 10522 |
| 437 | Ga0373936_0015301 | 3300035113 | Bacteria | 2939 |
| 438 | Ga0373936_0046082 | 3300035113 | Bacteria | 1757 |
| 439 | Ga0373936_0111202 | 3300035113 | Bacteria | 1163 |
| 440 | Ga0373945_0000124 | 3300035116 | Bacteria | 19016 |
| 441 | Ga0373945_0000169 | 3300035116 | Bacteria | 17244 |
| 442 | Ga0373945_0002456 | 3300035116 | Bacteria | 5817 |
| 443 | Ga0373945_0026685 | 3300035116 | Bacteria | 2013 |
| 444 | Ga0373953_0021007 | 3300035117 | Bacteria | 2445 |
| 445 | Ga0373953_0025487 | 3300035117 | Bacteria | 2259 |
| 446 | Ga0373954_0008891 | 3300035118 | Bacteria | 4420 |
| 447 | Ga0373954_0027038 | 3300035118 | Bacteria | 2631 |
| 448 | Ga0373954_0041769 | 3300035118 | Bacteria | 2139 |
| 449 | Ga0373956_0000191 | 3300035119 | Bacteria | 23567 |
| 450 | Ga0373956_0003979 | 3300035119 | Bacteria | 5938 |
| 451 | Ga0373956_0035650 | 3300035119 | Bacteria | 2194 |
| 452 | Ga0373957_0000550 | 3300035120 | Bacteria | 9517 |
| 453 | Ga0373957_0002209 | 3300035120 | Bacteria | 5505 |
| 454 | Ga0373957_0026216 | 3300035120 | Bacteria | 2106 |
| 455 | Ga0373960_0009139 | 3300035121 | Bacteria | 2394 |
| 456 | Ga0373943_0000064 | 3300035170 | Bacteria | 37284 |
| 457 | Ga0373943_0008483 | 3300035170 | Bacteria | 4609 |
| 458 | Ga0373943_0011403 | 3300035170 | Bacteria | 3999 |
| 459 | Ga0373943_0043669 | 3300035170 | Bacteria | 2178 |
| 460 | Ga0373946_0000149 | 3300035171 | Bacteria | 21381 |
| 461 | Ga0373946_0000326 | 3300035171 | Bacteria | 15418 |
| 462 | Ga0373946_0016738 | 3300035171 | Bacteria | 2796 |
| 463 | Ga0373955_0000050 | 3300035172 | Bacteria | 45664 |
| 464 | Ga0373955_0003540 | 3300035172 | Bacteria | 6873 |
| 465 | Ga0373955_0004609 | 3300035172 | Bacteria | 6111 |
| 466 | Ga0373955_0112163 | 3300035172 | Bacteria | 1577 |
| 467 | Ga0316574_0004911 | 3300035398 | Bacteria | 7082 |
| 468 | Ga0373924_0000037 | 3300035410 | Bacteria | 33504 |
| 469 | Ga0373924_0014248 | 3300035410 | Bacteria | 3002 |
| 470 | Ga0373924_0030687 | 3300035410 | Bacteria | 2156 |
| 471 | Ga0373924_0069347 | 3300035410 | Bacteria | 1485 |
| 472 | Ga0373931_0013437 | 3300035691 | Bacteria | 3986 |
| 473 | Ga0373931_0235595 | 3300035691 | Bacteria | 1107 |
| 474 | Ga0373935_0001258 | 3300035692 | Bacteria | 13997 |
| 475 | Ga0373935_0021464 | 3300035692 | Bacteria | 3954 |
| 476 | Ga0373935_0067950 | 3300035692 | Bacteria | 2292 |
| 477 | Ga0373935_0075236 | 3300035692 | Bacteria | 2184 |
| 478 | Ga0373935_0075656 | 3300035692 | Bacteria | 2178 |
| 479 | Ga0373927_0001700 | 3300035695 | Bacteria | 16442 |
| 480 | Ga0373927_0016572 | 3300035695 | Bacteria | 4860 |
| 481 | Ga0373927_0034117 | 3300035695 | Bacteria | 3311 |
| 482 | Ga0373927_0044293 | 3300035695 | Bacteria | 2879 |
| 483 | Ga0373927_0124920 | 3300035695 | Bacteria | 1680 |
| 484 | Ga0373933_0000149 | 3300035724 | Bacteria | 45676 |
| 485 | Ga0373933_0003274 | 3300035724 | Bacteria | 9057 |
| 486 | Ga0373933_0020277 | 3300035724 | Bacteria | 3767 |
| 487 | Ga0373933_0020491 | 3300035724 | Bacteria | 3748 |
| 488 | Ga0373933_0026835 | 3300035724 | Bacteria | 3311 |
| 489 | Ga0373933_0072162 | 3300035724 | Bacteria | 2102 |
| 490 | Ga0373933_0173855 | 3300035724 | Bacteria | 1371 |
| 491 | Ga0373947_0000906 | 3300035725 | Bacteria | 17951 |
| 492 | Ga0373947_0016202 | 3300035725 | Bacteria | 4285 |
| 493 | Ga0373947_0066354 | 3300035725 | Bacteria | 2202 |
| 494 | Ga0373947_0074142 | 3300035725 | Bacteria | 2093 |
| 495 | Ga0373947_0187856 | 3300035725 | Bacteria | 1347 |
| 496 | Ga0373937_0000319 | 3300036401 | Bacteria | 45685 |
| 497 | Ga0373937_0000686 | 3300036401 | Bacteria | 29455 |
| 498 | Ga0316582_0122288 | 3300036647 | Bacteria | 1742 |
| 499 | Ga0316584_0004267 | 3300036712 | Bacteria | 9442 |
| 500 | Ga0316584_0012190 | 3300036712 | Bacteria | 6059 |
| 501 | Ga0373925_0018370 | 3300037068 | Bacteria | 5082 |
| 502 | Ga0373925_0022837 | 3300037068 | Bacteria | 4564 |
| 503 | Ga0373925_0175520 | 3300037068 | Bacteria | 1693 |
| 504 | Ga0373925_0289620 | 3300037068 | Bacteria | 1320 |
| 505 | Ga0373925_0323317 | 3300037068 | Bacteria | 1248 |
| 506 | Ga0395898_0011622 | 3300037466 | Bacteria | 9138 |
| 507 | Ga0436364_1080858 | 3300037853 | Bacteria | 3051 |
| 508 | Ga0436364_1264688 | 3300037853 | Bacteria | 1592 |
| 509 | Ga0395901_0225559 | 3300038443 | Bacteria | 1957 |
| 510 | Ga0436365_1406444 | 3300039437 | Bacteria | 25793 |
| 511 | Ga0436365_1629153 | 3300039437 | Bacteria | 1390 |
| 512 | Ga0436365_1749326 | 3300039437 | Bacteria | 4296 |
| 513 | Ga0436362_0578357 | 3300039453 | Bacteria | 15297 |
| 514 | Ga0451802_0384859 | 3300041460 | Bacteria | 1747 |
| 515 | Ga0439452_038862 | 3300042010 | Bacteria | 1128 |
| 516 | Ga0466964_0045575 | 3300044706 | Bacteria | 1785 |
| 517 | Ga0466970_0029327 | 3300044765 | Bacteria | 2896 |
| 518 | Ga0466957_0112712 | 3300044842 | Bacteria | 1726 |
| 519 | Ga0466960_0039009 | 3300044901 | Bacteria | 2238 |
| 520 | Ga0466959_0045081 | 3300045049 | Bacteria | 3248 |
| 521 | Ga0466958_0025987 | 3300045836 | Bacteria | 3457 |
| 522 | Ga0466958_0142355 | 3300045836 | Bacteria | 1510 |
| 523 | Ga0466967_0000123 | 3300045976 | Bacteria | 29223 |
| 524 | Ga0466967_0026324 | 3300045976 | Bacteria | 4816 |
| 525 | Ga0466967_0032936 | 3300045976 | Bacteria | 4382 |
| 526 | Ga0466967_0042603 | 3300045976 | Bacteria | 3924 |
| 527 | Ga0466967_0307967 | 3300045976 | Bacteria | 1525 |
| 528 | Ga0495592_0000255 | 3300046454 | Bacteria | 45685 |
| 529 | Ga0495592_0030140 | 3300046454 | Bacteria | 4103 |
| 530 | Ga0495592_0039236 | 3300046454 | Bacteria | 3558 |
| 531 | Ga0495592_0041517 | 3300046454 | Bacteria | 3447 |
| 532 | Ga0495592_0045175 | 3300046454 | Bacteria | 3287 |
| 533 | Ga0495603_0003038 | 3300046455 | Bacteria | 9945 |
| 534 | Ga0495603_0022542 | 3300046455 | Bacteria | 3812 |
| 535 | Ga0495629_0000377 | 3300046459 | Bacteria | 37247 |
| 536 | Ga0495629_0002409 | 3300046459 | Bacteria | 14397 |
| 537 | Ga0495629_0003497 | 3300046459 | Bacteria | 11884 |
| 538 | Ga0495629_0034223 | 3300046459 | Bacteria | 3591 |
| 539 | Ga0495629_0042946 | 3300046459 | Bacteria | 3175 |
| 540 | Ga0495638_0003039 | 3300046460 | Bacteria | 13363 |
| 541 | Ga0495638_0009577 | 3300046460 | Bacteria | 6784 |
| 542 | Ga0495638_0021853 | 3300046460 | Bacteria | 4206 |
| 543 | Ga0495641_0006016 | 3300046461 | Bacteria | 7987 |
| 544 | Ga0495641_0006400 | 3300046461 | Bacteria | 7638 |
| 545 | Ga0495641_0016629 | 3300046461 | Bacteria | 3866 |
| 546 | Ga0495641_0021908 | 3300046461 | Bacteria | 3207 |
| 547 | Ga0495641_0030310 | 3300046461 | Bacteria | 2596 |
| 548 | Ga0495641_0044539 | 3300046461 | Bacteria | 2046 |
| 549 | Ga0495651_0000199 | 3300046462 | Bacteria | 45685 |
| 550 | Ga0495651_0001591 | 3300046462 | Bacteria | 17556 |
| 551 | Ga0495651_0017370 | 3300046462 | Bacteria | 5572 |
| 552 | Ga0495651_0046737 | 3300046462 | Bacteria | 3349 |
| 553 | Ga0495651_0070134 | 3300046462 | Bacteria | 2667 |
| 554 | Ga0495653_0003175 | 3300046463 | Bacteria | 13165 |
| 555 | Ga0495653_0014635 | 3300046463 | Bacteria | 6400 |
| 556 | Ga0495653_0016440 | 3300046463 | Bacteria | 6025 |
| 557 | Ga0495653_0022138 | 3300046463 | Bacteria | 5143 |
| 558 | Ga0495653_0031203 | 3300046463 | Bacteria | 4237 |
| 559 | Ga0495653_0148026 | 3300046463 | Bacteria | 1643 |
| 560 | Ga0495580_0002596 | 3300046472 | Bacteria | 15708 |
| 561 | Ga0495580_0015371 | 3300046472 | Bacteria | 5774 |
| 562 | Ga0495580_0053162 | 3300046472 | Bacteria | 2859 |
| 563 | Ga0495580_0188230 | 3300046472 | Bacteria | 1424 |
| 564 | Ga0495582_0000730 | 3300046473 | Bacteria | 18129 |
| 565 | Ga0495582_0012628 | 3300046473 | Bacteria | 4657 |
| 566 | Ga0495582_0051155 | 3300046473 | Bacteria | 2277 |
| 567 | Ga0495639_0000935 | 3300046475 | Bacteria | 13201 |
| 568 | Ga0495639_0007453 | 3300046475 | Bacteria | 4696 |
| 569 | Ga0495639_0019139 | 3300046475 | Bacteria | 2987 |
| 570 | Ga0495639_0022336 | 3300046475 | Bacteria | 2775 |
| 571 | Ga0495662_0007677 | 3300046476 | Bacteria | 5316 |
| 572 | Ga0495662_0010492 | 3300046476 | Bacteria | 4534 |
| 573 | Ga0495662_0026802 | 3300046476 | Bacteria | 2783 |
| 574 | Ga0495662_0027018 | 3300046476 | Bacteria | 2772 |
| 575 | Ga0495664_0001131 | 3300046477 | Bacteria | 13835 |
| 576 | Ga0495664_0102303 | 3300046477 | Bacteria | 1726 |
| 577 | Ga0495664_0129065 | 3300046477 | Bacteria | 1530 |
| 578 | Ga0495594_0046808 | 3300046499 | Bacteria | 2375 |
| 579 | Ga0495594_0178601 | 3300046499 | Bacteria | 1208 |
| 580 | Ga0495606_0000294 | 3300046507 | Bacteria | 85998 |
| 581 | Ga0495606_0004323 | 3300046507 | Bacteria | 14291 |
| 582 | Ga0495608_0000010 | 3300046511 | Bacteria | 258660 |
| 583 | Ga0495608_0000499 | 3300046511 | Bacteria | 27122 |
| 584 | Ga0495608_0004767 | 3300046511 | Bacteria | 9702 |
| 585 | Ga0495608_0035640 | 3300046511 | Bacteria | 3354 |
| 586 | Ga0495608_0065349 | 3300046511 | Bacteria | 2382 |
| 587 | Ga0495618_0008665 | 3300046514 | Bacteria | 6147 |
| 588 | Ga0495618_0011052 | 3300046514 | Bacteria | 5472 |
| 589 | Ga0495618_0042134 | 3300046514 | Bacteria | 2877 |
| 590 | Ga0495618_0123121 | 3300046514 | Bacteria | 1660 |
| 591 | Ga0495618_0193745 | 3300046514 | Bacteria | 1288 |
| 592 | Ga0495628_0000282 | 3300046516 | Bacteria | 45645 |
| 593 | Ga0495628_0107238 | 3300046516 | Bacteria | 2151 |
| 594 | Ga0495628_0120706 | 3300046516 | Bacteria | 2011 |
| 595 | Ga0495630_0000011 | 3300046517 | Bacteria | 232063 |
| 596 | Ga0495630_0018874 | 3300046517 | Bacteria | 5068 |
| 597 | Ga0495630_0029722 | 3300046517 | Bacteria | 4062 |
| 598 | Ga0495630_0041672 | 3300046517 | Bacteria | 3429 |
| 599 | Ga0495630_0054071 | 3300046517 | Bacteria | 3007 |
| 600 | Ga0495632_0060129 | 3300046519 | Bacteria | 1847 |
| 601 | Ga0495643_0003383 | 3300046522 | Bacteria | 11733 |
| 602 | Ga0495644_0044766 | 3300046523 | Bacteria | 1665 |
| 603 | Ga0495648_0027978 | 3300046524 | Bacteria | 3764 |
| 604 | Ga0495666_0004831 | 3300046526 | Bacteria | 6810 |
| 605 | Ga0495666_0016851 | 3300046526 | Bacteria | 3638 |
| 606 | Ga0495652_0001352 | 3300046529 | Bacteria | 27313 |
| 607 | Ga0495652_0023245 | 3300046529 | Bacteria | 5496 |
| 608 | Ga0495652_0087975 | 3300046529 | Bacteria | 2546 |
| 609 | Ga0495652_0097219 | 3300046529 | Bacteria | 2395 |
| 610 | Ga0495652_0200777 | 3300046529 | Bacteria | 1513 |
| 611 | Ga0495652_0212244 | 3300046529 | Bacteria | 1460 |
| 612 | Ga0495665_0003232 | 3300046531 | Bacteria | 8815 |
| 613 | Ga0495665_0013243 | 3300046531 | Bacteria | 4460 |
| 614 | Ga0495665_0019544 | 3300046531 | Bacteria | 3643 |
| 615 | Ga0495665_0024755 | 3300046531 | Bacteria | 3224 |
| 616 | Ga0495665_0049028 | 3300046531 | Bacteria | 2239 |
| 617 | Ga0495665_0109981 | 3300046531 | Bacteria | 1445 |
| 618 | Ga0495640_0012108 | 3300046533 | Bacteria | 6607 |
| 619 | Ga0495640_0013029 | 3300046533 | Bacteria | 6333 |
| 620 | Ga0495640_0036069 | 3300046533 | Bacteria | 3495 |
| 621 | Ga0495640_0055712 | 3300046533 | Bacteria | 2704 |
| 622 | Ga0495640_0058215 | 3300046533 | Bacteria | 2636 |
| 623 | Ga0495586_0002011 | 3300046535 | Bacteria | 11035 |
| 624 | Ga0495586_0012080 | 3300046535 | Bacteria | 4586 |
| 625 | Ga0495586_0050941 | 3300046535 | Bacteria | 2240 |
| 626 | Ga0495586_0121606 | 3300046535 | Bacteria | 1459 |
| 627 | Ga0495587_0000189 | 3300046536 | Bacteria | 45681 |
| 628 | Ga0495587_0010133 | 3300046536 | Bacteria | 6012 |
| 629 | Ga0495587_0022593 | 3300046536 | Bacteria | 3872 |
| 630 | Ga0495587_0050750 | 3300046536 | Bacteria | 2454 |
| 631 | Ga0495645_0018972 | 3300046543 | Bacteria | 4948 |
| 632 | Ga0495645_0026413 | 3300046543 | Bacteria | 4215 |
| 633 | Ga0495645_0056664 | 3300046543 | Bacteria | 2845 |
| 634 | Ga0495645_0080182 | 3300046543 | Bacteria | 2343 |
| 635 | Ga0495645_0115768 | 3300046543 | Bacteria | 1893 |
| 636 | Ga0495645_0167300 | 3300046543 | Bacteria | 1515 |
| 637 | Ga0495667_0000136 | 3300046559 | Bacteria | 50731 |
| 638 | Ga0495667_0009068 | 3300046559 | Bacteria | 6757 |
| 639 | Ga0495667_0026481 | 3300046559 | Bacteria | 3908 |
| 640 | Ga0495667_0036661 | 3300046559 | Bacteria | 3271 |
| 641 | Ga0495667_0065583 | 3300046559 | Bacteria | 2375 |
| 642 | Ga0495667_0130427 | 3300046559 | Bacteria | 1621 |
| 643 | Ga0495667_0150710 | 3300046559 | Bacteria | 1497 |
| 644 | Ga0495634_0009897 | 3300046642 | Bacteria | 7007 |
| 645 | Ga0495634_0027996 | 3300046642 | Bacteria | 3915 |
| 646 | Ga0495634_0035770 | 3300046642 | Bacteria | 3399 |
| 647 | Ga0495634_0039571 | 3300046642 | Bacteria | 3210 |
| 648 | Ga0495634_0047766 | 3300046642 | Bacteria | 2883 |
| 649 | Ga0495634_0067261 | 3300046642 | Bacteria | 2370 |
| 650 | Ga0495634_0121004 | 3300046642 | Bacteria | 1676 |
| 651 | Ga0495634_0183868 | 3300046642 | Bacteria | 1307 |
| 652 | Ga0495625_0008112 | 3300046660 | Bacteria | 9000 |
| 653 | Ga0495625_0256172 | 3300046660 | Bacteria | 1134 |
| 654 | Ga0495635_0000124 | 3300046663 | Bacteria | 46888 |
| 655 | Ga0495635_0003210 | 3300046663 | Bacteria | 11269 |
| 656 | Ga0495635_0006536 | 3300046663 | Bacteria | 8135 |
| 657 | Ga0495635_0010617 | 3300046663 | Bacteria | 6446 |
| 658 | Ga0495635_0017321 | 3300046663 | Bacteria | 5033 |
| 659 | Ga0495635_0136350 | 3300046663 | Bacteria | 1672 |
| 660 | Ga0495588_0000218 | 3300046674 | Bacteria | 54328 |
| 661 | Ga0495588_0001492 | 3300046674 | Bacteria | 10033 |
| 662 | Ga0495657_0000005 | 3300046675 | Bacteria | 254860 |
| 663 | Ga0495657_0000290 | 3300046675 | Bacteria | 45685 |
| 664 | Ga0495657_0016245 | 3300046675 | Bacteria | 5426 |
| 665 | Ga0495657_0038600 | 3300046675 | Bacteria | 3285 |
| 666 | Ga0495657_0053587 | 3300046675 | Bacteria | 2698 |
| 667 | Ga0495657_0073927 | 3300046675 | Bacteria | 2218 |
| 668 | Ga0495599_0000282 | 3300046678 | Bacteria | 31243 |
| 669 | Ga0495599_0027822 | 3300046678 | Bacteria | 3542 |
| 670 | Ga0495599_0053165 | 3300046678 | Bacteria | 2537 |
| 671 | Ga0495599_0070865 | 3300046678 | Bacteria | 2175 |
| 672 | Ga0495623_0000368 | 3300046679 | Bacteria | 29559 |
| 673 | Ga0495623_0036513 | 3300046679 | Bacteria | 3147 |
| 674 | Ga0495623_0058226 | 3300046679 | Bacteria | 2429 |
| 675 | Ga0495646_0014864 | 3300046680 | Bacteria | 4944 |
| 676 | Ga0495646_0018156 | 3300046680 | Bacteria | 4455 |
| 677 | Ga0495646_0024999 | 3300046680 | Bacteria | 3758 |
| 678 | Ga0495646_0047465 | 3300046680 | Bacteria | 2613 |
| 679 | Ga0495646_0184086 | 3300046680 | Bacteria | 1145 |
| 680 | Ga0495647_0000111 | 3300046681 | Bacteria | 20557 |
| 681 | Ga0495647_0012514 | 3300046681 | Bacteria | 2923 |
| 682 | Ga0495647_0023204 | 3300046681 | Bacteria | 2248 |
| 683 | Ga0495658_0000965 | 3300046683 | Bacteria | 15281 |
| 684 | Ga0495658_0002269 | 3300046683 | Bacteria | 9714 |
| 685 | Ga0495658_0034678 | 3300046683 | Bacteria | 2770 |
| 686 | Ga0495658_0126095 | 3300046683 | Bacteria | 1553 |
| 687 | Ga0495613_0000131 | 3300046689 | Bacteria | 74262 |
| 688 | Ga0495613_0019246 | 3300046689 | Bacteria | 5090 |
| 689 | Ga0495613_0019940 | 3300046689 | Bacteria | 4998 |
| 690 | Ga0495613_0028981 | 3300046689 | Bacteria | 4116 |
| 691 | Ga0495624_0000455 | 3300046690 | Bacteria | 32215 |
| 692 | Ga0495624_0007084 | 3300046690 | Bacteria | 7895 |
| 693 | Ga0495624_0014987 | 3300046690 | Bacteria | 5250 |
| 694 | Ga0495624_0025562 | 3300046690 | Bacteria | 3875 |
| 695 | Ga0495624_0042139 | 3300046690 | Bacteria | 2917 |
| 696 | Ga0495624_0123243 | 3300046690 | Bacteria | 1591 |
| 697 | Ga0495670_0011360 | 3300046691 | Bacteria | 4378 |
| 698 | Ga0495649_0022100 | 3300046694 | Bacteria | 3561 |
| 699 | Ga0495600_0002942 | 3300046809 | Bacteria | 9928 |
| 700 | Ga0495600_0008634 | 3300046809 | Bacteria | 6266 |
| 701 | Ga0495600_0020345 | 3300046809 | Bacteria | 4245 |
| 702 | Ga0495600_0033112 | 3300046809 | Bacteria | 3354 |
| 703 | Ga0495600_0036276 | 3300046809 | Bacteria | 3204 |
| 704 | Ga0495600_0050961 | 3300046809 | Bacteria | 2701 |
| 705 | Ga0495581_0005558 | 3300047315 | Bacteria | 7304 |
| 706 | Ga0495581_0024613 | 3300047315 | Bacteria | 3489 |
| 707 | Ga0495581_0038893 | 3300047315 | Bacteria | 2754 |
| 708 | Ga0495581_0039162 | 3300047315 | Bacteria | 2743 |
| 709 | Ga0495581_0041225 | 3300047315 | Bacteria | 2671 |
| 710 | Ga0495604_0000078 | 3300047317 | Bacteria | 83632 |
| 711 | Ga0495604_0000280 | 3300047317 | Bacteria | 45685 |
| 712 | Ga0495604_0024326 | 3300047317 | Bacteria | 4830 |
| 713 | Ga0495604_0035697 | 3300047317 | Bacteria | 3924 |
| 714 | Ga0495604_0036151 | 3300047317 | Bacteria | 3895 |
| 715 | Ga0495604_0065678 | 3300047317 | Bacteria | 2761 |
| 716 | Ga0495674_0000063 | 3300047319 | Bacteria | 71737 |
| 717 | Ga0495674_0000405 | 3300047319 | Bacteria | 38766 |
| 718 | Ga0495674_0015523 | 3300047319 | Bacteria | 7116 |
| 719 | Ga0495674_0029627 | 3300047319 | Bacteria | 4982 |
| 720 | Ga0495674_0052205 | 3300047319 | Bacteria | 3599 |
| 721 | Ga0495674_0055126 | 3300047319 | Bacteria | 3487 |
| 722 | Ga0495674_0106405 | 3300047319 | Bacteria | 2382 |
| 723 | Ga0495674_0169564 | 3300047319 | Bacteria | 1822 |
| 724 | Ga0495672_0023757 | 3300047320 | Bacteria | 3961 |
| 725 | Ga0495676_0015559 | 3300047321 | Bacteria | 6769 |
| 726 | Ga0495676_0028446 | 3300047321 | Bacteria | 4772 |
| 727 | Ga0495676_0045718 | 3300047321 | Bacteria | 3560 |
| 728 | Ga0495676_0073273 | 3300047321 | Bacteria | 2626 |
| 729 | Ga0495676_0088268 | 3300047321 | Bacteria | 2326 |
| 730 | Ga0495676_0119364 | 3300047321 | Bacteria | 1921 |
| 731 | Ga0495676_0248131 | 3300047321 | Bacteria | 1215 |
| 732 | Ga0495680_0000430 | 3300047322 | Bacteria | 47076 |
| 733 | Ga0495680_0004034 | 3300047322 | Bacteria | 14169 |
| 734 | Ga0495680_0005228 | 3300047322 | Bacteria | 12252 |
| 735 | Ga0495680_0008764 | 3300047322 | Bacteria | 9163 |
| 736 | Ga0495680_0013885 | 3300047322 | Bacteria | 7007 |
| 737 | Ga0495680_0098296 | 3300047322 | Bacteria | 2184 |
| 738 | Ga0495680_0171514 | 3300047322 | Bacteria | 1570 |
| 739 | Ga0495675_0000004 | 3300047444 | Bacteria | 211049 |
| 740 | Ga0495675_0002808 | 3300047444 | Bacteria | 10433 |
| 741 | Ga0495675_0014801 | 3300047444 | Bacteria | 4933 |
| 742 | Ga0495675_0015192 | 3300047444 | Bacteria | 4868 |
| 743 | Ga0495675_0020477 | 3300047444 | Bacteria | 4207 |
| 744 | Ga0495684_0004452 | 3300047471 | Bacteria | 10950 |
| 745 | Ga0495684_0018973 | 3300047471 | Bacteria | 5295 |
| 746 | Ga0495684_0020434 | 3300047471 | Bacteria | 5103 |
| 747 | Ga0495684_0049220 | 3300047471 | Bacteria | 3220 |
| 748 | Ga0495684_0062945 | 3300047471 | Bacteria | 2821 |
| 749 | Ga0495684_0076194 | 3300047471 | Bacteria | 2547 |
| 750 | Ga0495686_0001014 | 3300047472 | Bacteria | 33997 |
| 751 | Ga0495686_0055601 | 3300047472 | Bacteria | 2474 |
| 752 | Ga0495593_0011015 | 3300047673 | Bacteria | 5205 |
| 753 | Ga0495593_0016581 | 3300047673 | Bacteria | 4153 |
| 754 | Ga0495593_0024417 | 3300047673 | Bacteria | 3350 |
| 755 | Ga0495593_0050660 | 3300047673 | Bacteria | 2199 |
| 756 | Ga0495593_0062139 | 3300047673 | Bacteria | 1952 |
| 757 | Ga0495593_0079250 | 3300047673 | Bacteria | 1700 |
| 758 | Ga0495602_0000009 | 3300048088 | Bacteria | 258991 |
| 759 | Ga0495602_0000297 | 3300048088 | Bacteria | 45689 |
| 760 | Ga0495602_0042892 | 3300048088 | Bacteria | 4117 |
| 761 | Ga0495602_0139758 | 3300048088 | Bacteria | 1918 |
| 762 | Ga0495602_0195445 | 3300048088 | Bacteria | 1547 |
| 763 | Ga0495614_0020759 | 3300048089 | Bacteria | 2838 |
| 764 | Ga0495614_0023298 | 3300048089 | Bacteria | 2671 |
| 765 | Ga0495614_0035644 | 3300048089 | Bacteria | 2137 |
| 766 | Ga0496100_0040807 | 3300048903 | Bacteria | 2955 |
| 767 | Ga0496100_0077534 | 3300048903 | Bacteria | 2234 |
| 768 | Ga0496101_0005422 | 3300048904 | Bacteria | 8125 |
| 769 | Ga0496102_0005112 | 3300048905 | Bacteria | 11115 |
| 770 | Ga0496102_0046003 | 3300048905 | Bacteria | 3963 |
| 771 | Ga0496102_0067777 | 3300048905 | Bacteria | 3274 |
| 772 | Ga0496103_0001480 | 3300048906 | Bacteria | 15703 |
| 773 | Ga0496103_0024665 | 3300048906 | Bacteria | 3629 |
| 774 | Ga0496104_0076412 | 3300048907 | Bacteria | 3190 |
| 775 | Ga0496104_0077895 | 3300048907 | Bacteria | 3158 |
| 776 | Ga0496104_0102693 | 3300048907 | Bacteria | 2738 |
| 777 | Ga0496105_0010084 | 3300048908 | Bacteria | 7416 |
| 778 | Ga0496105_0091586 | 3300048908 | Bacteria | 2510 |
| 779 | Ga0496106_0002660 | 3300048909 | Bacteria | 13295 |
| 780 | Ga0496106_0076366 | 3300048909 | Bacteria | 2568 |
| 781 | Ga0496106_0090074 | 3300048909 | Bacteria | 2367 |
| 782 | Ga0496106_0125955 | 3300048909 | Bacteria | 2005 |
| 783 | Ga0496107_0001604 | 3300048910 | Bacteria | 14080 |
| 784 | Ga0496107_0037662 | 3300048910 | Bacteria | 3471 |
| 785 | Ga0496107_0194935 | 3300048910 | Bacteria | 1505 |
| 786 | Ga0496108_0000012 | 3300048911 | Bacteria | 258433 |
| 787 | Ga0496108_0002885 | 3300048911 | Bacteria | 13794 |
| 788 | Ga0496108_0060977 | 3300048911 | Bacteria | 3174 |
| 789 | Ga0496109_0000076 | 3300048912 | Bacteria | 104273 |
| 790 | Ga0496109_0020426 | 3300048912 | Bacteria | 5850 |
| 791 | Ga0496109_0032385 | 3300048912 | Bacteria | 4699 |
| 792 | Ga0496109_0045125 | 3300048912 | Bacteria | 3999 |
| 793 | Ga0496109_0416206 | 3300048912 | Bacteria | 1270 |
| 794 | Ga0496110_0000015 | 3300048913 | Bacteria | 85373 |
| 795 | Ga0496110_0016082 | 3300048913 | Bacteria | 6239 |
| 796 | Ga0496110_0024029 | 3300048913 | Bacteria | 5192 |
| 797 | Ga0496110_0033575 | 3300048913 | Bacteria | 4440 |
| 798 | Ga0496110_0055285 | 3300048913 | Bacteria | 3492 |
| 799 | Ga0496111_0000001 | 3300048914 | Bacteria | 194837 |
| 800 | Ga0496111_0004168 | 3300048914 | Bacteria | 9098 |
| 801 | Ga0496111_0029999 | 3300048914 | Bacteria | 3865 |
| 802 | Ga0496111_0055218 | 3300048914 | Bacteria | 2872 |
| 803 | Ga0496111_0325613 | 3300048914 | Bacteria | 1138 |
| 804 | Ga0496111_0347667 | 3300048914 | Bacteria | 1098 |
| 805 | Ga0496112_0000250 | 3300048915 | Bacteria | 34271 |
| 806 | Ga0496112_0012300 | 3300048915 | Bacteria | 7859 |
| 807 | Ga0496112_0027878 | 3300048915 | Bacteria | 5448 |
| 808 | Ga0496112_0157464 | 3300048915 | Bacteria | 2238 |
| 809 | Ga0496113_0000039 | 3300048916 | Bacteria | 55926 |
| 810 | Ga0496113_0035974 | 3300048916 | Bacteria | 3626 |
| 811 | Ga0496113_0139704 | 3300048916 | Bacteria | 1905 |
| 812 | Ga0496114_0002063 | 3300048917 | Bacteria | 15300 |
| 813 | Ga0496114_0022716 | 3300048917 | Bacteria | 5113 |
| 814 | Ga0496114_0054616 | 3300048917 | Bacteria | 3331 |
| 815 | Ga0496115_0007251 | 3300048918 | Bacteria | 8148 |
| 816 | Ga0496115_0046554 | 3300048918 | Bacteria | 3467 |
| 817 | Ga0496119_0000011 | 3300048922 | Bacteria | 438315 |
| 818 | Ga0496120_0000206 | 3300048923 | Bacteria | 101409 |
| 819 | Ga0496121_0019494 | 3300048924 | Bacteria | 6777 |
| 820 | Ga0496121_0184873 | 3300048924 | Bacteria | 1500 |
| 821 | Ga0496125_0140916 | 3300048928 | Bacteria | 1677 |
| 822 | Ga0496126_0196052 | 3300048929 | Bacteria | 1708 |
| 823 | Ga0495682_0000276 | 3300049460 | Bacteria | 40134 |
| 824 | Ga0501032_0200611 | 3300049569 | Bacteria | 1302 |
| 825 | Ga0501033_0002379 | 3300049570 | Bacteria | 16017 |
| 826 | Ga0501033_0057489 | 3300049570 | Bacteria | 2875 |
| 827 | Ga0501034_0009939 | 3300049571 | Bacteria | 9944 |
| 828 | Ga0501034_0098775 | 3300049571 | Bacteria | 2914 |
| 829 | Ga0501036_0000429 | 3300049572 | Bacteria | 29860 |
| 830 | Ga0501036_0011601 | 3300049572 | Bacteria | 7300 |
| 831 | Ga0501036_0054089 | 3300049572 | Bacteria | 3399 |
| 832 | Ga0501036_0163426 | 3300049572 | Bacteria | 1877 |
| 833 | Ga0501038_0023598 | 3300049574 | Bacteria | 5497 |
| 834 | Ga0501038_0059052 | 3300049574 | Bacteria | 3286 |
| 835 | Ga0501038_0117145 | 3300049574 | Bacteria | 2200 |
| 836 | Ga0501039_0045543 | 3300049575 | Bacteria | 3389 |
| 837 | Ga0501042_0002245 | 3300049578 | Bacteria | 11787 |
| 838 | Ga0501042_0033126 | 3300049578 | Bacteria | 3662 |
| 839 | Ga0501043_0130156 | 3300049579 | Bacteria | 1972 |
| 840 | Ga0501043_0270622 | 3300049579 | Bacteria | 1304 |
| 841 | Ga0501046_0098084 | 3300049580 | Bacteria | 2250 |
| 842 | Ga0501046_0139159 | 3300049580 | Bacteria | 1838 |
| 843 | Ga0501046_0239454 | 3300049580 | Bacteria | 1338 |
| 844 | Ga0501047_0003786 | 3300049581 | Bacteria | 14243 |
| 845 | Ga0501048_0000726 | 3300049582 | Bacteria | 24134 |
| 846 | Ga0501048_0036936 | 3300049582 | Bacteria | 3509 |
| 847 | Ga0501048_0214231 | 3300049582 | Bacteria | 1366 |
| 848 | Ga0501067_0001837 | 3300049583 | Bacteria | 11675 |
| 849 | Ga0501067_0005707 | 3300049583 | Bacteria | 6908 |
| 850 | Ga0501068_0007750 | 3300049584 | Bacteria | 5946 |
| 851 | Ga0501069_0002284 | 3300049585 | Bacteria | 9682 |
| 852 | Ga0501069_0004484 | 3300049585 | Bacteria | 7213 |
| 853 | Ga0501069_0009014 | 3300049585 | Bacteria | 5264 |
| 854 | Ga0501070_0012978 | 3300049586 | Bacteria | 7022 |
| 855 | Ga0501070_0073483 | 3300049586 | Bacteria | 2829 |
| 856 | Ga0501070_0086972 | 3300049586 | Bacteria | 2587 |
| 857 | Ga0501070_0180811 | 3300049586 | Bacteria | 1735 |
| 858 | Ga0501071_0041093 | 3300049587 | Bacteria | 3311 |
| 859 | Ga0501072_0068519 | 3300049588 | Bacteria | 2801 |
| 860 | Ga0501072_0535164 | 3300049588 | Bacteria | 926 |
| 861 | Ga0501073_0007634 | 3300049589 | Bacteria | 8029 |
| 862 | Ga0501073_0055955 | 3300049589 | Bacteria | 2760 |
| 863 | Ga0501074_0050626 | 3300049590 | Bacteria | 2998 |
| 864 | Ga0501074_0095274 | 3300049590 | Bacteria | 2131 |
| 865 | Ga0501083_0031749 | 3300049744 | Bacteria | 3625 |
| 866 | Ga0501035_0008036 | 3300049822 | Bacteria | 9832 |
| 867 | Ga0501035_0009228 | 3300049822 | Bacteria | 9172 |
| 868 | Ga0501035_0092029 | 3300049822 | Bacteria | 2668 |
| 869 | Ga0501044_0013019 | 3300049823 | Bacteria | 9002 |
| 870 | Ga0501044_0057572 | 3300049823 | Bacteria | 3988 |
| 871 | Ga0501044_0155601 | 3300049823 | Bacteria | 2265 |
| 872 | Ga0501045_0005678 | 3300049824 | Bacteria | 8635 |
| 873 | Ga0501045_0127329 | 3300049824 | Bacteria | 1892 |
| 874 | nmdc:mga06z11_126144_c1 | 3300050494 | Bacteria | 1432 |
| 875 | nmdc:mga07m45_16415_c1 | 3300050496 | Bacteria | 3964 |
| 876 | nmdc:mga05p37_5558_c1 | 3300050507 | Bacteria | 14820 |
| 877 | nmdc:mga08y16_51567_c2 | 3300050511 | Bacteria | 3629 |
| 878 | nmdc:mga0n895_111424_c1 | 3300050512 | Bacteria | 2753 |
| 879 | nmdc:mga0n895_43025_c1 | 3300050512 | Bacteria | 4399 |
| 880 | nmdc:mga0rr50_137511_c1 | 3300050513 | Bacteria | 1963 |
| 881 | nmdc:mga08x19_166694_c1 | 3300050514 | Bacteria | 1498 |
| 882 | nmdc:mga0a205_157901_c1 | 3300050515 | Bacteria | 2166 |
| 883 | Ga0495601_0000042 | 3300053077 | Bacteria | 77373 |
| 884 | Ga0495601_0011568 | 3300053077 | Bacteria | 5286 |
| 885 | Ga0495601_0039241 | 3300053077 | Bacteria | 2965 |
| 886 | Ga0495601_0042188 | 3300053077 | Bacteria | 2861 |
| 887 | Ga0495601_0053560 | 3300053077 | Bacteria | 2550 |
| 888 | Ga0495601_0098668 | 3300053077 | Bacteria | 1885 |
| 889 | Ga0495612_0003776 | 3300053078 | Bacteria | 6301 |
| 890 | Ga0495612_0013108 | 3300053078 | Bacteria | 3338 |
| 891 | Ga0495612_0013937 | 3300053078 | Bacteria | 3239 |
| 892 | Ga0495595_0000005 | 3300053084 | Bacteria | 258660 |
| 893 | Ga0495595_0002052 | 3300053084 | Bacteria | 7836 |
| 894 | Ga0495595_0021151 | 3300053084 | Bacteria | 2839 |
| 895 | Ga0495595_0053821 | 3300053084 | Bacteria | 1870 |
| 896 | Ga0495595_0092079 | 3300053084 | Bacteria | 1455 |
| 897 | Ga0495595_0102050 | 3300053084 | Bacteria | 1386 |
| 898 | Ga0495619_0000040 | 3300053085 | Bacteria | 118238 |
| 899 | Ga0495619_0000126 | 3300053085 | Bacteria | 56169 |
| 900 | Ga0495619_0007828 | 3300053085 | Bacteria | 6762 |
| 901 | Ga0495619_0008414 | 3300053085 | Bacteria | 6525 |
| 902 | Ga0495619_0040351 | 3300053085 | Bacteria | 3052 |
| 903 | Ga0495619_0046481 | 3300053085 | Bacteria | 2854 |
| 904 | Ga0500641_0002279 | 3300053096 | Bacteria | 6808 |
| 905 | Ga0500650_0056890 | 3300053098 | Bacteria | 1823 |
| 906 | Ga0500593_000783 | 3300053117 | Bacteria | 11865 |
| 907 | Ga0500608_047987 | 3300053122 | Bacteria | 2052 |
| 908 | Ga0500608_108312 | 3300053122 | Bacteria | 1277 |
| 909 | Ga0500568_0000002 | 3300053139 | Bacteria | 880601 |
| 910 | Ga0500588_0053691 | 3300053146 | Bacteria | 1267 |
| 911 | Ga0500645_000054 | 3300053730 | Bacteria | 93914 |
| 912 | Ga0501084_0030294 | 3300054114 | Bacteria | 4526 |
| 913 | Ga0501084_0049833 | 3300054114 | Bacteria | 3505 |
| 914 | Ga0501082_0028798 | 3300060353 | Bacteria | 4784 |
| 915 | 2616693556 | 2616644814 | Bacteria | 11555299 |
| 916 | 2671837835 | 2671180195 | Bacteria | 9757215 |
| 917 | 2738704002 | 2738541274 | Bacteria | 6909446 |
| 918 | 2739334376 | 2738543028 | Bacteria | 6917070 |
| 919 | 2774855991 | 2773857922 | Bacteria | 9757215 |
| 920 | 2776375977 | 2775506925 | Bacteria | 7237746 |
| 921 | 2863075036 | 2863067949 | Bacteria | 8541735 |
| 922 | 2884699581 | 2884693830 | Bacteria | 11273186 |
| 923 | 2895443216 | 2895442618 | Bacteria | 11027144 |
| 924 | 2919157199 | 2919155634 | Bacteria | 4860545 |
| 925 | 3007875097 | 3007872151 | Bacteria | 5268868 |
| 926 | 8047895127 | 8047893842 | Bacteria | 11723082 |
| 927 | 8048363923 | 8048356638 | Bacteria | 11044339 |
| 928 | 8048372153 | 8048369669 | Bacteria | 11666822 |
| 929 | 8048381087 | 8048379754 | Bacteria | 11877923 |
| 930 | 8056139468 | 8056137416 | Bacteria | 6147080 |
| 931 | Ga0070717_10063501 | |||
| 932 | JGI24742J22300_10012159 | |||
| 933 | JGI25407J50210_10041359 | |||
| 934 | Ga0055536_1024561 | |||
| 935 | Ga0070658_10046996 | |||
| 936 | Ga0070683_100000226 | |||
| 937 | Ga0070683_100029490 | |||
| 938 | Ga0070683_100179933 | |||
| 939 | Ga0070690_100003251 | |||
| 940 | Ga0070690_100074855 | |||
| 941 | Ga0070690_100278915 | |||
| 942 | Ga0070670_100166035 | |||
| 943 | Ga0070666_10028275 | |||
| 944 | Ga0070666_10035693 | |||
| 945 | Ga0070680_100137959 | |||
| 946 | Ga0070682_100000072 | |||
| 947 | Ga0070682_100053977 | |||
| 948 | Ga0068868_100012247 | |||
| 949 | Ga0068868_100015708 | |||
| 950 | Ga0068868_100345383 | |||
| 951 | Ga0070660_100418869 | |||
| 952 | Ga0070689_100001617 | |||
| 953 | Ga0070689_100009128 | |||
| 954 | Ga0070691_10009274 | |||
| 955 | Ga0070692_10156612 | |||
| 956 | Ga0070668_100002229 | |||
| 957 | Ga0070668_100024108 | |||
| 958 | Ga0070675_100000008 | |||
| 959 | Ga0070675_100037489 | |||
| 960 | Ga0070671_100091773 | |||
| 961 | Ga0070674_100008015 | |||
| 962 | Ga0070688_100000018 | |||
| 963 | Ga0070688_100000364 | |||
| 964 | Ga0070688_100038405 | |||
| 965 | Ga0070659_100048610 | |||
| 966 | Ga0070659_100052543 | |||
| 967 | Ga0070667_100001736 | |||
| 968 | Ga0070667_100002459 | |||
| 969 | Ga0070709_10005538 | |||
| 970 | Ga0070709_10096587 | |||
| 971 | Ga0070709_10255817 | |||
| 972 | Ga0070714_100074268 | |||
| 973 | Ga0070713_100000061 | |||
| 974 | Ga0070713_100000246 | |||
| 975 | Ga0070713_100070690 | |||
| 976 | Ga0070713_100098808 | |||
| 977 | Ga0070713_100124655 | |||
| 978 | Ga0070713_100230126 | |||
| 979 | Ga0070710_10003126 | |||
| 980 | Ga0070710_10003839 | |||
| 981 | Ga0070710_10024104 | |||
| 982 | Ga0070710_10114119 | |||
| 983 | Ga0070701_10004227 | |||
| 984 | Ga0070701_10004840 | |||
| 985 | Ga0070701_10057040 | |||
| 986 | Ga0070711_100001099 | |||
| 987 | Ga0070711_100009291 | |||
| 988 | Ga0070711_100052841 | |||
| 989 | Ga0070711_100056556 | |||
| 990 | Ga0070711_100092238 | |||
| 991 | Ga0070705_100017856 | |||
| 992 | Ga0070705_100018185 | |||
| 993 | Ga0070705_100020873 | |||
| 994 | Ga0070705_100040100 | |||
| 995 | Ga0070700_100008540 | |||
| 996 | Ga0070694_100003172 | |||
| 997 | Ga0070694_100196659 | |||
| 998 | Ga0070708_100005178 | |||
| 999 | Ga0070708_100039880 | |||
| 1000 | Ga0070708_100088458 | |||
| 1001 | Ga0070708_100157043 | |||
| 1002 | Ga0070708_100396995 | |||
| 1003 | Ga0070663_100008138 | |||
| 1004 | Ga0070663_100437850 | |||
| 1005 | Ga0070678_100002322 | |||
| 1006 | Ga0070678_100033632 | |||
| 1007 | Ga0070662_100001811 | |||
| 1008 | Ga0070681_10019014 | |||
| 1009 | Ga0070681_10062806 | |||
| 1010 | Ga0070681_10086096 | |||
| 1011 | Ga0068867_100003850 | |||
| 1012 | Ga0070685_10000114 | |||
| 1013 | Ga0070685_10000437 | |||
| 1014 | Ga0070685_10032457 | |||
| 1015 | Ga0070685_10110372 | |||
| 1016 | Ga0070706_100002130 | |||
| 1017 | Ga0070706_100024697 | |||
| 1018 | Ga0070706_100051856 | |||
| 1019 | Ga0070706_100339049 | |||
| 1020 | Ga0070707_100005579 | |||
| 1021 | Ga0070707_100008372 | |||
| 1022 | Ga0070707_100009418 | |||
| 1023 | Ga0070707_100038877 | |||
| 1024 | Ga0070707_100154595 | |||
| 1025 | Ga0070698_100000231 | |||
| 1026 | Ga0070698_100002524 | |||
| 1027 | Ga0070698_100003478 | |||
| 1028 | Ga0070698_100036108 | |||
| 1029 | Ga0070699_100004142 | |||
| 1030 | Ga0070679_100321696 | |||
| 1031 | Ga0070684_100068355 | |||
| 1032 | Ga0070697_100087337 | |||
| 1033 | Ga0068853_100003312 | |||
| 1034 | Ga0068853_100068965 | |||
| 1035 | Ga0070672_100000018 | |||
| 1036 | Ga0070672_100151192 | |||
| 1037 | Ga0070686_100022148 | |||
| 1038 | Ga0070695_100022929 | |||
| 1039 | Ga0070695_100066903 | |||
| 1040 | Ga0070696_100001452 | |||
| 1041 | Ga0070696_100045297 | |||
| 1042 | Ga0070696_100139539 | |||
| 1043 | Ga0070693_100068640 | |||
| 1044 | Ga0070665_100019446 | |||
| 1045 | Ga0070704_100002458 | |||
| 1046 | Ga0070704_100036830 | |||
| 1047 | Ga0070704_100042140 | |||
| 1048 | Ga0070704_100176645 | |||
| 1049 | Ga0068855_100274719 | |||
| 1050 | Ga0070664_100003303 | |||
| 1051 | Ga0068854_100000044 | |||
| 1052 | Ga0068854_100001161 | |||
| 1053 | Ga0068854_100035498 | |||
| 1054 | Ga0068856_100000654 | |||
| 1055 | Ga0068856_100031615 | |||
| 1056 | Ga0068856_100130920 | |||
| 1057 | Ga0068856_100205034 | |||
| 1058 | Ga0070702_100002284 | |||
| 1059 | Ga0070702_100006065 | |||
| 1060 | Ga0070702_100031834 | |||
| 1061 | Ga0068852_100169033 | |||
| 1062 | Ga0068859_100004277 | |||
| 1063 | Ga0068859_100015441 | |||
| 1064 | Ga0068864_100039384 | |||
| 1065 | Ga0068864_100307216 | |||
| 1066 | Ga0068866_10003324 | |||
| 1067 | Ga0068861_100001255 | |||
| 1068 | Ga0068861_100011299 | |||
| 1069 | Ga0068851_10000922 | |||
| 1070 | Ga0068863_100082898 | |||
| 1071 | Ga0068863_100302269 | |||
| 1072 | Ga0068858_100003628 | |||
| 1073 | Ga0068858_100079405 | |||
| 1074 | Ga0068860_100003964 | |||
| 1075 | Ga0068860_100005857 | |||
| 1076 | Ga0068862_100006916 | |||
| 1077 | Ga0068862_100030058 | |||
| 1078 | Ga0068862_100069209 | |||
| 1079 | Ga0081455_10007980 | |||
| 1080 | Ga0081455_10053873 | |||
| 1081 | Ga0081538_10000068 | |||
| 1082 | Ga0081540_1000009 | |||
| 1083 | Ga0081540_1000740 | |||
| 1084 | Ga0070717_10002827 | |||
| 1085 | Ga0070717_10009210 | |||
| 1086 | Ga0070717_10049502 | |||
| 1087 | Ga0070717_10378809 | |||
| 1088 | Ga0070715_10001613 | |||
| 1089 | Ga0070715_10041293 | |||
| 1090 | Ga0070716_100002864 | |||
| 1091 | Ga0070716_100021946 | |||
| 1092 | Ga0070716_100074708 | |||
| 1093 | Ga0070712_100004723 | |||
| 1094 | Ga0070712_100016409 | |||
| 1095 | Ga0070712_100018523 | |||
| 1096 | Ga0070712_100074536 | |||
| 1097 | Ga0070712_100294081 | |||
| 1098 | Ga0070712_100315471 | |||
| 1099 | Ga0070712_100330133 | |||
| 1100 | Ga0075369_10008808 | |||
| 1101 | Ga0097621_100111923 | |||
| 1102 | Ga0097621_100253752 | |||
| 1103 | Ga0075370_10150568 | |||
| 1104 | Ga0068871_100023983 | |||
| 1105 | Ga0068871_100052446 | |||
| 1106 | Ga0075433_10046997 | |||
| 1107 | Ga0075433_10130847 | |||
| 1108 | Ga0075433_10142060 | |||
| 1109 | Ga0068865_100000019 | |||
| 1110 | Ga0068865_100005261 | |||
| 1111 | Ga0075436_100057382 | |||
| 1112 | Ga0097620_100004277 | |||
| 1113 | Ga0097620_100015441 | |||
| 1114 | Ga0075435_100085874 | |||
| 1115 | Ga0099794_10037772 | |||
| 1116 | Ga0105251_10017754 | |||
| 1117 | Ga0105240_10034655 | |||
| 1118 | Ga0105240_10086989 | |||
| 1119 | Ga0111539_10070745 | |||
| 1120 | Ga0111539_10090382 | |||
| 1121 | Ga0105245_10000012 | |||
| 1122 | Ga0105245_10001816 | |||
| 1123 | Ga0105245_10021334 | |||
| 1124 | Ga0105245_10031998 | |||
| 1125 | Ga0105245_10089225 | |||
| 1126 | Ga0105245_10385799 | |||
| 1127 | Ga0105247_10009690 | |||
| 1128 | Ga0105247_10119690 | |||
| 1129 | Ga0114129_10004005 | |||
| 1130 | Ga0105243_10003858 | |||
| 1131 | Ga0105243_10087941 | |||
| 1132 | Ga0105243_10088705 | |||
| 1133 | Ga0105241_10124392 | |||
| 1134 | Ga0105242_10000325 | |||
| 1135 | Ga0105242_10144137 | |||
| 1136 | Ga0105248_10000267 | |||
| 1137 | Ga0105248_10054995 | |||
| 1138 | Ga0105248_10073625 | |||
| 1139 | Ga0105248_10156346 | |||
| 1140 | Ga0105248_10420112 | |||
| 1141 | Ga0105237_10024788 | |||
| 1142 | Ga0105238_10258866 | |||
| 1143 | Ga0105249_10014730 | |||
| 1144 | Ga0105249_10025516 | |||
| 1145 | Ga0105249_10157755 | |||
| 1146 | Ga0105249_10387431 | |||
| 1147 | Ga0105033_101725 | |||
| 1148 | Ga0105239_10016972 | |||
| 1149 | Ga0105239_10318484 | |||
| 1150 | Ga0105239_10482209 | |||
| 1151 | Ga0105239_10764756 | |||
| 1152 | Ga0105246_10012840 | |||
| 1153 | Ga0157342_1000392 | |||
| 1154 | Ga0157373_10145362 | |||
| 1155 | Ga0157370_10208486 | |||
| 1156 | Ga0157370_10334495 | |||
| 1157 | Ga0157369_10001010 | |||
| 1158 | Ga0157369_10222225 | |||
| 1159 | Ga0157374_10077156 | |||
| 1160 | Ga0157374_10435182 | |||
| 1161 | Ga0157378_10009698 | |||
| 1162 | Ga0157378_10128911 | |||
| 1163 | Ga0163162_10007124 | |||
| 1164 | Ga0163162_10019114 | |||
| 1165 | Ga0163162_10233978 | |||
| 1166 | Ga0157372_10000128 | |||
| 1167 | Ga0157372_10002534 | |||
| 1168 | Ga0157372_10070133 | |||
| 1169 | Ga0157375_10001489 | |||
| 1170 | Ga0157375_10018476 | |||
| 1171 | Ga0157375_10264421 | |||
| 1172 | Ga0157375_10420004 | |||
| 1173 | Ga0163163_10065823 | |||
| 1174 | Ga0163163_10108039 | |||
| 1175 | Ga0157380_10000009 | |||
| 1176 | Ga0157380_10002763 | |||
| 1177 | Ga0157377_10009168 | |||
| 1178 | Ga0157377_10062846 | |||
| 1179 | Ga0157379_10006987 | |||
| 1180 | Ga0157379_10009692 | |||
| 1181 | Ga0157379_10015635 | |||
| 1182 | Ga0157376_10034901 | |||
| 1183 | Ga0157376_10321902 | |||
| 1184 | Ga0163161_10002437 | |||
| 1185 | Ga0163161_10025836 | |||
| 1186 | Ga0197907_10255742 | |||
| 1187 | Ga0197907_11021319 | |||
| 1188 | Ga0206356_11118101 | |||
| 1189 | Ga0206350_11332138 | |||
| 1190 | Ga0213873_10000742 | |||
| 1191 | Ga0213876_10006294 | |||
| 1192 | Ga0213875_10007908 | |||
| 1193 | Ga0213875_10093865 | |||
| 1194 | Ga0224712_10004896 | |||
| 1195 | Ga0224712_10068449 | |||
| 1196 | Ga0209563_100088 | |||
| 1197 | Ga0209051_1044455 | |||
| 1198 | Ga0207656_10000153 | |||
| 1199 | Ga0207713_1048880 | |||
| 1200 | Ga0207653_10038162 | |||
| 1201 | Ga0207692_10000297 | |||
| 1202 | Ga0207692_10002263 | |||
| 1203 | Ga0207692_10046926 | |||
| 1204 | Ga0207710_10004469 | |||
| 1205 | Ga0207688_10026396 | |||
| 1206 | Ga0207647_10124002 | |||
| 1207 | Ga0207685_10001088 | |||
| 1208 | Ga0207685_10001777 | |||
| 1209 | Ga0207685_10029613 | |||
| 1210 | Ga0207685_10052613 | |||
| 1211 | Ga0207699_10054483 | |||
| 1212 | Ga0207684_10002157 | |||
| 1213 | Ga0207684_10013578 | |||
| 1214 | Ga0207684_10013721 | |||
| 1215 | Ga0207684_10020758 | |||
| 1216 | Ga0207707_10031073 | |||
| 1217 | Ga0207707_10089707 | |||
| 1218 | Ga0207695_10211133 | |||
| 1219 | Ga0207671_10052185 | |||
| 1220 | Ga0207693_10000882 | |||
| 1221 | Ga0207693_10000976 | |||
| 1222 | Ga0207693_10019671 | |||
| 1223 | Ga0207693_10041129 | |||
| 1224 | Ga0207693_10085318 | |||
| 1225 | Ga0207693_10110512 | |||
| 1226 | Ga0207693_10244588 | |||
| 1227 | Ga0207693_10466257 | |||
| 1228 | Ga0207663_10001113 | |||
| 1229 | Ga0207663_10014740 | |||
| 1230 | Ga0207663_10016450 | |||
| 1231 | Ga0207660_10217684 | |||
| 1232 | Ga0207662_10177120 | |||
| 1233 | Ga0207657_10031018 | |||
| 1234 | Ga0207649_10000005 | |||
| 1235 | Ga0207652_10103749 | |||
| 1236 | Ga0207646_10024119 | |||
| 1237 | Ga0207646_10045626 | |||
| 1238 | Ga0207646_10055718 | |||
| 1239 | Ga0207681_10009903 | |||
| 1240 | Ga0207681_10118247 | |||
| 1241 | Ga0207650_10091591 | |||
| 1242 | Ga0207659_10000014 | |||
| 1243 | Ga0207659_10235998 | |||
| 1244 | Ga0207687_10000011 | |||
| 1245 | Ga0207687_10007446 | |||
| 1246 | Ga0207687_10038675 | |||
| 1247 | Ga0207687_10140722 | |||
| 1248 | Ga0207700_10000016 | |||
| 1249 | Ga0207700_10042632 | |||
| 1250 | Ga0207700_10053164 | |||
| 1251 | Ga0207700_10070458 | |||
| 1252 | Ga0207700_10092321 | |||
| 1253 | Ga0207700_10137796 | |||
| 1254 | Ga0207700_10386735 | |||
| 1255 | Ga0207664_10000495 | |||
| 1256 | Ga0207664_10033143 | |||
| 1257 | Ga0207664_10060418 | |||
| 1258 | Ga0207664_10121767 | |||
| 1259 | Ga0207664_10190867 | |||
| 1260 | Ga0207664_10363640 | |||
| 1261 | Ga0207664_10477170 | |||
| 1262 | Ga0207690_10015803 | |||
| 1263 | Ga0207690_10021359 | |||
| 1264 | Ga0207706_10000974 | |||
| 1265 | Ga0207686_10002796 | |||
| 1266 | Ga0207686_10031498 | |||
| 1267 | Ga0207709_10005737 | |||
| 1268 | Ga0207709_10057841 | |||
| 1269 | Ga0207670_10009403 | |||
| 1270 | Ga0207670_10034219 | |||
| 1271 | Ga0207704_10000009 | |||
| 1272 | Ga0207704_10226513 | |||
| 1273 | Ga0207665_10003803 | |||
| 1274 | Ga0207665_10008645 | |||
| 1275 | Ga0207665_10011749 | |||
| 1276 | Ga0207665_10271713 | |||
| 1277 | Ga0207691_10000121 | |||
| 1278 | Ga0207691_10068747 | |||
| 1279 | Ga0207711_10000024 | |||
| 1280 | Ga0207711_10071956 | |||
| 1281 | Ga0207711_10270200 | |||
| 1282 | Ga0207689_10030488 | |||
| 1283 | Ga0207689_10033846 | |||
| 1284 | Ga0207661_10000068 | |||
| 1285 | Ga0207661_10016099 | |||
| 1286 | Ga0207661_10205821 | |||
| 1287 | Ga0207679_10327555 | |||
| 1288 | Ga0207667_10234262 | |||
| 1289 | Ga0207667_10266684 | |||
| 1290 | Ga0207651_10262424 | |||
| 1291 | Ga0207712_10011404 | |||
| 1292 | Ga0207712_10043824 | |||
| 1293 | Ga0207668_10004668 | |||
| 1294 | Ga0207668_10013201 | |||
| 1295 | Ga0207668_10047103 | |||
| 1296 | Ga0207640_10000517 | |||
| 1297 | Ga0207640_10007221 | |||
| 1298 | Ga0207658_10000708 | |||
| 1299 | Ga0207658_10025320 | |||
| 1300 | Ga0207677_10000671 | |||
| 1301 | Ga0207677_10007576 | |||
| 1302 | Ga0207677_10154556 | |||
| 1303 | Ga0207703_10055569 | |||
| 1304 | Ga0207703_10094172 | |||
| 1305 | Ga0207703_10164249 | |||
| 1306 | Ga0207639_10017085 | |||
| 1307 | Ga0207678_10013696 | |||
| 1308 | Ga0207678_10027433 | |||
| 1309 | Ga0207708_10011118 | |||
| 1310 | Ga0207708_10022419 | |||
| 1311 | Ga0207708_10146618 | |||
| 1312 | Ga0207702_10000099 | |||
| 1313 | Ga0207702_10014292 | |||
| 1314 | Ga0207702_10122188 | |||
| 1315 | Ga0207702_10210684 | |||
| 1316 | Ga0207641_10068180 | |||
| 1317 | Ga0207641_10124906 | |||
| 1318 | Ga0207648_10002209 | |||
| 1319 | Ga0207676_10079234 | |||
| 1320 | Ga0207674_10059781 | |||
| 1321 | Ga0207674_10181029 | |||
| 1322 | Ga0207674_10492047 | |||
| 1323 | Ga0207675_100002728 | |||
| 1324 | Ga0207675_100003484 | |||
| 1325 | Ga0207675_100009266 | |||
| 1326 | Ga0207675_100129318 | |||
| 1327 | Ga0207683_10000557 | |||
| 1328 | Ga0207683_10000832 | |||
| 1329 | Ga0207683_10076606 | |||
| 1330 | Ga0207698_10035785 | |||
| 1331 | Ga0268266_10011831 | |||
| 1332 | Ga0268266_10128859 | |||
| 1333 | Ga0268266_10240837 | |||
| 1334 | Ga0268265_10002429 | |||
| 1335 | Ga0268265_10014382 | |||
| 1336 | Ga0268265_10036094 | |||
| 1337 | Ga0268264_10020629 | |||
| 1338 | Ga0265336_10017714 | |||
| 1339 | Ga0265338_10000743 | |||
| 1340 | Ga0307513_10014472 | |||
| 1341 | Ga0316575_10004917 | |||
| 1342 | Ga0316576_10009488 | |||
| 1343 | Ga0316576_10257501 | |||
| 1344 | Ga0316577_10011037 | |||
| 1345 | Ga0307416_100265125 | |||
| 1346 | Ga0373950_0001014 | |||
| 1347 | Ga0373926_0001758 | |||
| 1348 | Ga0373926_0004436 | |||
| 1349 | Ga0373926_0017855 | |||
| 1350 | Ga0373926_0020345 | |||
| 1351 | Ga0373926_0071266 | |||
| 1352 | Ga0373928_0004493 | |||
| 1353 | Ga0373929_0004745 | |||
| 1354 | Ga0373934_0000629 | |||
| 1355 | Ga0373934_0008756 | |||
| 1356 | Ga0373934_0018600 | |||
| 1357 | Ga0373934_0019023 | |||
| 1358 | Ga0373934_0033071 | |||
| 1359 | Ga0373944_0004052 | |||
| 1360 | Ga0373951_0005145 | |||
| 1361 | Ga0373923_0000272 | |||
| 1362 | Ga0373923_0035198 | |||
| 1363 | Ga0373923_0040755 | |||
| 1364 | Ga0373923_0212831 | |||
| 1365 | Ga0373936_0000716 | |||
| 1366 | Ga0373936_0000918 | |||
| 1367 | Ga0373936_0015301 | |||
| 1368 | Ga0373936_0046082 | |||
| 1369 | Ga0373936_0111202 | |||
| 1370 | Ga0373945_0000124 | |||
| 1371 | Ga0373945_0000169 | |||
| 1372 | Ga0373945_0002456 | |||
| 1373 | Ga0373945_0026685 | |||
| 1374 | Ga0373953_0021007 | |||
| 1375 | Ga0373953_0025487 | |||
| 1376 | Ga0373954_0008891 | |||
| 1377 | Ga0373954_0027038 | |||
| 1378 | Ga0373954_0041769 | |||
| 1379 | Ga0373956_0000191 | |||
| 1380 | Ga0373956_0003979 | |||
| 1381 | Ga0373956_0035650 | |||
| 1382 | Ga0373957_0000550 | |||
| 1383 | Ga0373957_0002209 | |||
| 1384 | Ga0373957_0026216 | |||
| 1385 | Ga0373960_0009139 | |||
| 1386 | Ga0373943_0000064 | |||
| 1387 | Ga0373943_0008483 | |||
| 1388 | Ga0373943_0011403 | |||
| 1389 | Ga0373943_0043669 | |||
| 1390 | Ga0373946_0000149 | |||
| 1391 | Ga0373946_0000326 | |||
| 1392 | Ga0373946_0016738 | |||
| 1393 | Ga0373955_0000050 | |||
| 1394 | Ga0373955_0003540 | |||
| 1395 | Ga0373955_0004609 | |||
| 1396 | Ga0373955_0112163 | |||
| 1397 | Ga0316574_0004911 | |||
| 1398 | Ga0373924_0000037 | |||
| 1399 | Ga0373924_0014248 | |||
| 1400 | Ga0373924_0030687 | |||
| 1401 | Ga0373924_0069347 | |||
| 1402 | Ga0373931_0013437 | |||
| 1403 | Ga0373931_0235595 | |||
| 1404 | Ga0373935_0001258 | |||
| 1405 | Ga0373935_0021464 | |||
| 1406 | Ga0373935_0067950 | |||
| 1407 | Ga0373935_0075236 | |||
| 1408 | Ga0373935_0075656 | |||
| 1409 | Ga0373927_0001700 | |||
| 1410 | Ga0373927_0016572 | |||
| 1411 | Ga0373927_0034117 | |||
| 1412 | Ga0373927_0044293 | |||
| 1413 | Ga0373927_0124920 | |||
| 1414 | Ga0373933_0000149 | |||
| 1415 | Ga0373933_0003274 | |||
| 1416 | Ga0373933_0020277 | |||
| 1417 | Ga0373933_0020491 | |||
| 1418 | Ga0373933_0026835 | |||
| 1419 | Ga0373933_0072162 | |||
| 1420 | Ga0373933_0173855 | |||
| 1421 | Ga0373947_0000906 | |||
| 1422 | Ga0373947_0016202 | |||
| 1423 | Ga0373947_0066354 | |||
| 1424 | Ga0373947_0074142 | |||
| 1425 | Ga0373947_0187856 | |||
| 1426 | Ga0373937_0000319 | |||
| 1427 | Ga0373937_0000686 | |||
| 1428 | Ga0316582_0122288 | |||
| 1429 | Ga0316584_0004267 | |||
| 1430 | Ga0316584_0012190 | |||
| 1431 | Ga0373925_0018370 | |||
| 1432 | Ga0373925_0022837 | |||
| 1433 | Ga0373925_0175520 | |||
| 1434 | Ga0373925_0289620 | |||
| 1435 | Ga0373925_0323317 | |||
| 1436 | Ga0395898_0011622 | |||
| 1437 | Ga0436364_1080858 | |||
| 1438 | Ga0436364_1264688 | |||
| 1439 | Ga0395901_0225559 | |||
| 1440 | Ga0436365_1406444 | |||
| 1441 | Ga0436365_1629153 | |||
| 1442 | Ga0436365_1749326 | |||
| 1443 | Ga0436362_0578357 | |||
| 1444 | Ga0451802_0384859 | |||
| 1445 | Ga0439452_038862 | |||
| 1446 | Ga0466964_0045575 | |||
| 1447 | Ga0466970_0029327 | |||
| 1448 | Ga0466957_0112712 | |||
| 1449 | Ga0466960_0039009 | |||
| 1450 | Ga0466959_0045081 | |||
| 1451 | Ga0466958_0025987 | |||
| 1452 | Ga0466958_0142355 | |||
| 1453 | Ga0466967_0000123 | |||
| 1454 | Ga0466967_0026324 | |||
| 1455 | Ga0466967_0032936 | |||
| 1456 | Ga0466967_0042603 | |||
| 1457 | Ga0466967_0307967 | |||
| 1458 | Ga0495592_0000255 | |||
| 1459 | Ga0495592_0030140 | |||
| 1460 | Ga0495592_0039236 | |||
| 1461 | Ga0495592_0041517 | |||
| 1462 | Ga0495592_0045175 | |||
| 1463 | Ga0495603_0003038 | |||
| 1464 | Ga0495603_0022542 | |||
| 1465 | Ga0495629_0000377 | |||
| 1466 | Ga0495629_0002409 | |||
| 1467 | Ga0495629_0003497 | |||
| 1468 | Ga0495629_0034223 | |||
| 1469 | Ga0495629_0042946 | |||
| 1470 | Ga0495638_0003039 | |||
| 1471 | Ga0495638_0009577 | |||
| 1472 | Ga0495638_0021853 | |||
| 1473 | Ga0495641_0006016 | |||
| 1474 | Ga0495641_0006400 | |||
| 1475 | Ga0495641_0016629 | |||
| 1476 | Ga0495641_0021908 | |||
| 1477 | Ga0495641_0030310 | |||
| 1478 | Ga0495641_0044539 | |||
| 1479 | Ga0495651_0000199 | |||
| 1480 | Ga0495651_0001591 | |||
| 1481 | Ga0495651_0017370 | |||
| 1482 | Ga0495651_0046737 | |||
| 1483 | Ga0495651_0070134 | |||
| 1484 | Ga0495653_0003175 | |||
| 1485 | Ga0495653_0014635 | |||
| 1486 | Ga0495653_0016440 | |||
| 1487 | Ga0495653_0022138 | |||
| 1488 | Ga0495653_0031203 | |||
| 1489 | Ga0495653_0148026 | |||
| 1490 | Ga0495580_0002596 | |||
| 1491 | Ga0495580_0015371 | |||
| 1492 | Ga0495580_0053162 | |||
| 1493 | Ga0495580_0188230 | |||
| 1494 | Ga0495582_0000730 | |||
| 1495 | Ga0495582_0012628 | |||
| 1496 | Ga0495582_0051155 | |||
| 1497 | Ga0495639_0000935 | |||
| 1498 | Ga0495639_0007453 | |||
| 1499 | Ga0495639_0019139 | |||
| 1500 | Ga0495639_0022336 | |||
| 1501 | Ga0495662_0007677 | |||
| 1502 | Ga0495662_0010492 | |||
| 1503 | Ga0495662_0026802 | |||
| 1504 | Ga0495662_0027018 | |||
| 1505 | Ga0495664_0001131 | |||
| 1506 | Ga0495664_0102303 | |||
| 1507 | Ga0495664_0129065 | |||
| 1508 | Ga0495594_0046808 | |||
| 1509 | Ga0495594_0178601 | |||
| 1510 | Ga0495606_0000294 | |||
| 1511 | Ga0495606_0004323 | |||
| 1512 | Ga0495608_0000010 | |||
| 1513 | Ga0495608_0000499 | |||
| 1514 | Ga0495608_0004767 | |||
| 1515 | Ga0495608_0035640 | |||
| 1516 | Ga0495608_0065349 | |||
| 1517 | Ga0495618_0008665 | |||
| 1518 | Ga0495618_0011052 | |||
| 1519 | Ga0495618_0042134 | |||
| 1520 | Ga0495618_0123121 | |||
| 1521 | Ga0495618_0193745 | |||
| 1522 | Ga0495628_0000282 | |||
| 1523 | Ga0495628_0107238 | |||
| 1524 | Ga0495628_0120706 | |||
| 1525 | Ga0495630_0000011 | |||
| 1526 | Ga0495630_0018874 | |||
| 1527 | Ga0495630_0029722 | |||
| 1528 | Ga0495630_0041672 | |||
| 1529 | Ga0495630_0054071 | |||
| 1530 | Ga0495632_0060129 | |||
| 1531 | Ga0495643_0003383 | |||
| 1532 | Ga0495644_0044766 | |||
| 1533 | Ga0495648_0027978 | |||
| 1534 | Ga0495666_0004831 | |||
| 1535 | Ga0495666_0016851 | |||
| 1536 | Ga0495652_0001352 | |||
| 1537 | Ga0495652_0023245 | |||
| 1538 | Ga0495652_0087975 | |||
| 1539 | Ga0495652_0097219 | |||
| 1540 | Ga0495652_0200777 | |||
| 1541 | Ga0495652_0212244 | |||
| 1542 | Ga0495665_0003232 | |||
| 1543 | Ga0495665_0013243 | |||
| 1544 | Ga0495665_0019544 | |||
| 1545 | Ga0495665_0024755 | |||
| 1546 | Ga0495665_0049028 | |||
| 1547 | Ga0495665_0109981 | |||
| 1548 | Ga0495640_0012108 | |||
| 1549 | Ga0495640_0013029 | |||
| 1550 | Ga0495640_0036069 | |||
| 1551 | Ga0495640_0055712 | |||
| 1552 | Ga0495640_0058215 | |||
| 1553 | Ga0495586_0002011 | |||
| 1554 | Ga0495586_0012080 | |||
| 1555 | Ga0495586_0050941 | |||
| 1556 | Ga0495586_0121606 | |||
| 1557 | Ga0495587_0000189 | |||
| 1558 | Ga0495587_0010133 | |||
| 1559 | Ga0495587_0022593 | |||
| 1560 | Ga0495587_0050750 | |||
| 1561 | Ga0495645_0018972 | |||
| 1562 | Ga0495645_0026413 | |||
| 1563 | Ga0495645_0056664 | |||
| 1564 | Ga0495645_0080182 | |||
| 1565 | Ga0495645_0115768 | |||
| 1566 | Ga0495645_0167300 | |||
| 1567 | Ga0495667_0000136 | |||
| 1568 | Ga0495667_0009068 | |||
| 1569 | Ga0495667_0026481 | |||
| 1570 | Ga0495667_0036661 | |||
| 1571 | Ga0495667_0065583 | |||
| 1572 | Ga0495667_0130427 | |||
| 1573 | Ga0495667_0150710 | |||
| 1574 | Ga0495634_0009897 | |||
| 1575 | Ga0495634_0027996 | |||
| 1576 | Ga0495634_0035770 | |||
| 1577 | Ga0495634_0039571 | |||
| 1578 | Ga0495634_0047766 | |||
| 1579 | Ga0495634_0067261 | |||
| 1580 | Ga0495634_0121004 | |||
| 1581 | Ga0495634_0183868 | |||
| 1582 | Ga0495625_0008112 | |||
| 1583 | Ga0495625_0256172 | |||
| 1584 | Ga0495635_0000124 | |||
| 1585 | Ga0495635_0003210 | |||
| 1586 | Ga0495635_0006536 | |||
| 1587 | Ga0495635_0010617 | |||
| 1588 | Ga0495635_0017321 | |||
| 1589 | Ga0495635_0136350 | |||
| 1590 | Ga0495588_0000218 | |||
| 1591 | Ga0495588_0001492 | |||
| 1592 | Ga0495657_0000005 | |||
| 1593 | Ga0495657_0000290 | |||
| 1594 | Ga0495657_0016245 | |||
| 1595 | Ga0495657_0038600 | |||
| 1596 | Ga0495657_0053587 | |||
| 1597 | Ga0495657_0073927 | |||
| 1598 | Ga0495599_0000282 | |||
| 1599 | Ga0495599_0027822 | |||
| 1600 | Ga0495599_0053165 | |||
| 1601 | Ga0495599_0070865 | |||
| 1602 | Ga0495623_0000368 | |||
| 1603 | Ga0495623_0036513 | |||
| 1604 | Ga0495623_0058226 | |||
| 1605 | Ga0495646_0014864 | |||
| 1606 | Ga0495646_0018156 | |||
| 1607 | Ga0495646_0024999 | |||
| 1608 | Ga0495646_0047465 | |||
| 1609 | Ga0495646_0184086 | |||
| 1610 | Ga0495647_0000111 | |||
| 1611 | Ga0495647_0012514 | |||
| 1612 | Ga0495647_0023204 | |||
| 1613 | Ga0495658_0000965 | |||
| 1614 | Ga0495658_0002269 | |||
| 1615 | Ga0495658_0034678 | |||
| 1616 | Ga0495658_0126095 | |||
| 1617 | Ga0495613_0000131 | |||
| 1618 | Ga0495613_0019246 | |||
| 1619 | Ga0495613_0019940 | |||
| 1620 | Ga0495613_0028981 | |||
| 1621 | Ga0495624_0000455 | |||
| 1622 | Ga0495624_0007084 | |||
| 1623 | Ga0495624_0014987 | |||
| 1624 | Ga0495624_0025562 | |||
| 1625 | Ga0495624_0042139 | |||
| 1626 | Ga0495624_0123243 | |||
| 1627 | Ga0495670_0011360 | |||
| 1628 | Ga0495649_0022100 | |||
| 1629 | Ga0495600_0002942 | |||
| 1630 | Ga0495600_0008634 | |||
| 1631 | Ga0495600_0020345 | |||
| 1632 | Ga0495600_0033112 | |||
| 1633 | Ga0495600_0036276 | |||
| 1634 | Ga0495600_0050961 | |||
| 1635 | Ga0495581_0005558 | |||
| 1636 | Ga0495581_0024613 | |||
| 1637 | Ga0495581_0038893 | |||
| 1638 | Ga0495581_0039162 | |||
| 1639 | Ga0495581_0041225 | |||
| 1640 | Ga0495604_0000078 | |||
| 1641 | Ga0495604_0000280 | |||
| 1642 | Ga0495604_0024326 | |||
| 1643 | Ga0495604_0035697 | |||
| 1644 | Ga0495604_0036151 | |||
| 1645 | Ga0495604_0065678 | |||
| 1646 | Ga0495674_0000063 | |||
| 1647 | Ga0495674_0000405 | |||
| 1648 | Ga0495674_0015523 | |||
| 1649 | Ga0495674_0029627 | |||
| 1650 | Ga0495674_0052205 | |||
| 1651 | Ga0495674_0055126 | |||
| 1652 | Ga0495674_0106405 | |||
| 1653 | Ga0495674_0169564 | |||
| 1654 | Ga0495672_0023757 | |||
| 1655 | Ga0495676_0015559 | |||
| 1656 | Ga0495676_0028446 | |||
| 1657 | Ga0495676_0045718 | |||
| 1658 | Ga0495676_0073273 | |||
| 1659 | Ga0495676_0088268 | |||
| 1660 | Ga0495676_0119364 | |||
| 1661 | Ga0495676_0248131 | |||
| 1662 | Ga0495680_0000430 | |||
| 1663 | Ga0495680_0004034 | |||
| 1664 | Ga0495680_0005228 | |||
| 1665 | Ga0495680_0008764 | |||
| 1666 | Ga0495680_0013885 | |||
| 1667 | Ga0495680_0098296 | |||
| 1668 | Ga0495680_0171514 | |||
| 1669 | Ga0495675_0000004 | |||
| 1670 | Ga0495675_0002808 | |||
| 1671 | Ga0495675_0014801 | |||
| 1672 | Ga0495675_0015192 | |||
| 1673 | Ga0495675_0020477 | |||
| 1674 | Ga0495684_0004452 | |||
| 1675 | Ga0495684_0018973 | |||
| 1676 | Ga0495684_0020434 | |||
| 1677 | Ga0495684_0049220 | |||
| 1678 | Ga0495684_0062945 | |||
| 1679 | Ga0495684_0076194 | |||
| 1680 | Ga0495686_0001014 | |||
| 1681 | Ga0495686_0055601 | |||
| 1682 | Ga0495593_0011015 | |||
| 1683 | Ga0495593_0016581 | |||
| 1684 | Ga0495593_0024417 | |||
| 1685 | Ga0495593_0050660 | |||
| 1686 | Ga0495593_0062139 | |||
| 1687 | Ga0495593_0079250 | |||
| 1688 | Ga0495602_0000009 | |||
| 1689 | Ga0495602_0000297 | |||
| 1690 | Ga0495602_0042892 | |||
| 1691 | Ga0495602_0139758 | |||
| 1692 | Ga0495602_0195445 | |||
| 1693 | Ga0495614_0020759 | |||
| 1694 | Ga0495614_0023298 | |||
| 1695 | Ga0495614_0035644 | |||
| 1696 | Ga0496100_0040807 | |||
| 1697 | Ga0496100_0077534 | |||
| 1698 | Ga0496101_0005422 | |||
| 1699 | Ga0496102_0005112 | |||
| 1700 | Ga0496102_0046003 | |||
| 1701 | Ga0496102_0067777 | |||
| 1702 | Ga0496103_0001480 | |||
| 1703 | Ga0496103_0024665 | |||
| 1704 | Ga0496104_0076412 | |||
| 1705 | Ga0496104_0077895 | |||
| 1706 | Ga0496104_0102693 | |||
| 1707 | Ga0496105_0010084 | |||
| 1708 | Ga0496105_0091586 | |||
| 1709 | Ga0496106_0002660 | |||
| 1710 | Ga0496106_0076366 | |||
| 1711 | Ga0496106_0090074 | |||
| 1712 | Ga0496106_0125955 | |||
| 1713 | Ga0496107_0001604 | |||
| 1714 | Ga0496107_0037662 | |||
| 1715 | Ga0496107_0194935 | |||
| 1716 | Ga0496108_0000012 | |||
| 1717 | Ga0496108_0002885 | |||
| 1718 | Ga0496108_0060977 | |||
| 1719 | Ga0496109_0000076 | |||
| 1720 | Ga0496109_0020426 | |||
| 1721 | Ga0496109_0032385 | |||
| 1722 | Ga0496109_0045125 | |||
| 1723 | Ga0496109_0416206 | |||
| 1724 | Ga0496110_0000015 | |||
| 1725 | Ga0496110_0016082 | |||
| 1726 | Ga0496110_0024029 | |||
| 1727 | Ga0496110_0033575 | |||
| 1728 | Ga0496110_0055285 | |||
| 1729 | Ga0496111_0000001 | |||
| 1730 | Ga0496111_0004168 | |||
| 1731 | Ga0496111_0029999 | |||
| 1732 | Ga0496111_0055218 | |||
| 1733 | Ga0496111_0325613 | |||
| 1734 | Ga0496111_0347667 | |||
| 1735 | Ga0496112_0000250 | |||
| 1736 | Ga0496112_0012300 | |||
| 1737 | Ga0496112_0027878 | |||
| 1738 | Ga0496112_0157464 | |||
| 1739 | Ga0496113_0000039 | |||
| 1740 | Ga0496113_0035974 | |||
| 1741 | Ga0496113_0139704 | |||
| 1742 | Ga0496114_0002063 | |||
| 1743 | Ga0496114_0022716 | |||
| 1744 | Ga0496114_0054616 | |||
| 1745 | Ga0496115_0007251 | |||
| 1746 | Ga0496115_0046554 | |||
| 1747 | Ga0496119_0000011 | |||
| 1748 | Ga0496120_0000206 | |||
| 1749 | Ga0496121_0019494 | |||
| 1750 | Ga0496121_0184873 | |||
| 1751 | Ga0496125_0140916 | |||
| 1752 | Ga0496126_0196052 | |||
| 1753 | Ga0495682_0000276 | |||
| 1754 | Ga0501032_0200611 | |||
| 1755 | Ga0501033_0002379 | |||
| 1756 | Ga0501033_0057489 | |||
| 1757 | Ga0501034_0009939 | |||
| 1758 | Ga0501034_0098775 | |||
| 1759 | Ga0501036_0000429 | |||
| 1760 | Ga0501036_0011601 | |||
| 1761 | Ga0501036_0054089 | |||
| 1762 | Ga0501036_0163426 | |||
| 1763 | Ga0501038_0023598 | |||
| 1764 | Ga0501038_0059052 | |||
| 1765 | Ga0501038_0117145 | |||
| 1766 | Ga0501039_0045543 | |||
| 1767 | Ga0501042_0002245 | |||
| 1768 | Ga0501042_0033126 | |||
| 1769 | Ga0501043_0130156 | |||
| 1770 | Ga0501043_0270622 | |||
| 1771 | Ga0501046_0098084 | |||
| 1772 | Ga0501046_0139159 | |||
| 1773 | Ga0501046_0239454 | |||
| 1774 | Ga0501047_0003786 | |||
| 1775 | Ga0501048_0000726 | |||
| 1776 | Ga0501048_0036936 | |||
| 1777 | Ga0501048_0214231 | |||
| 1778 | Ga0501067_0001837 | |||
| 1779 | Ga0501067_0005707 | |||
| 1780 | Ga0501068_0007750 | |||
| 1781 | Ga0501069_0002284 | |||
| 1782 | Ga0501069_0004484 | |||
| 1783 | Ga0501069_0009014 | |||
| 1784 | Ga0501070_0012978 | |||
| 1785 | Ga0501070_0073483 | |||
| 1786 | Ga0501070_0086972 | |||
| 1787 | Ga0501070_0180811 | |||
| 1788 | Ga0501071_0041093 | |||
| 1789 | Ga0501072_0068519 | |||
| 1790 | Ga0501072_0535164 | |||
| 1791 | Ga0501073_0007634 | |||
| 1792 | Ga0501073_0055955 | |||
| 1793 | Ga0501074_0050626 | |||
| 1794 | Ga0501074_0095274 | |||
| 1795 | Ga0501083_0031749 | |||
| 1796 | Ga0501035_0008036 | |||
| 1797 | Ga0501035_0009228 | |||
| 1798 | Ga0501035_0092029 | |||
| 1799 | Ga0501044_0013019 | |||
| 1800 | Ga0501044_0057572 | |||
| 1801 | Ga0501044_0155601 | |||
| 1802 | Ga0501045_0005678 | |||
| 1803 | Ga0501045_0127329 | |||
| 1804 | nmdc:mga06z11_126144_c1 | |||
| 1805 | nmdc:mga07m45_16415_c1 | |||
| 1806 | nmdc:mga05p37_5558_c1 | |||
| 1807 | nmdc:mga08y16_51567_c2 | |||
| 1808 | nmdc:mga0n895_111424_c1 | |||
| 1809 | nmdc:mga0n895_43025_c1 | |||
| 1810 | nmdc:mga0rr50_137511_c1 | |||
| 1811 | nmdc:mga08x19_166694_c1 | |||
| 1812 | nmdc:mga0a205_157901_c1 | |||
| 1813 | Ga0495601_0000042 | |||
| 1814 | Ga0495601_0011568 | |||
| 1815 | Ga0495601_0039241 | |||
| 1816 | Ga0495601_0042188 | |||
| 1817 | Ga0495601_0053560 | |||
| 1818 | Ga0495601_0098668 | |||
| 1819 | Ga0495612_0003776 | |||
| 1820 | Ga0495612_0013108 | |||
| 1821 | Ga0495612_0013937 | |||
| 1822 | Ga0495595_0000005 | |||
| 1823 | Ga0495595_0002052 | |||
| 1824 | Ga0495595_0021151 | |||
| 1825 | Ga0495595_0053821 | |||
| 1826 | Ga0495595_0092079 | |||
| 1827 | Ga0495595_0102050 | |||
| 1828 | Ga0495619_0000040 | |||
| 1829 | Ga0495619_0000126 | |||
| 1830 | Ga0495619_0007828 | |||
| 1831 | Ga0495619_0008414 | |||
| 1832 | Ga0495619_0040351 | |||
| 1833 | Ga0495619_0046481 | |||
| 1834 | Ga0500641_0002279 | |||
| 1835 | Ga0500650_0056890 | |||
| 1836 | Ga0500593_000783 | |||
| 1837 | Ga0500608_047987 | |||
| 1838 | Ga0500608_108312 | |||
| 1839 | Ga0500568_0000002 | |||
| 1840 | Ga0500588_0053691 | |||
| 1841 | Ga0500645_000054 | |||
| 1842 | Ga0501084_0030294 | |||
| 1843 | Ga0501084_0049833 | |||
| 1844 | Ga0501082_0028798 | |||
| 1845 | 2616693556 | |||
| 1846 | 2671837835 | |||
| 1847 | 2738704002 | |||
| 1848 | 2739334376 | |||
| 1849 | 2774855991 | |||
| 1850 | 2776375977 | |||
| 1851 | 2863075036 | |||
| 1852 | 2884699581 | |||
| 1853 | 2895443216 | |||
| 1854 | 2919157199 | |||
| 1855 | 3007875097 | |||
| 1856 | 8047895127 | |||
| 1857 | 8048363923 | |||
| 1858 | 8048372153 | |||
| 1859 | 8048381087 | |||
| 1860 | 8056139468 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4e21-assembly1.cif.gz_B-2 | the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens | 0.968 | 1 | 324 |
| 4e21-assembly1.cif.gz_A-2 | the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens | 0.9615 | 1 | 322 |
| 4e21-assembly1.cif.gz_B-2 | the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens | 0.9472 | 1 | 324 |
| 4e21-assembly1.cif.gz_A-2 | the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens | 0.9436 | 1 | 322 |
| 6vpb-assembly1.cif.gz_A-2 | a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd) | 0.9201 | 2 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4e21A02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9806 | 176 | 320 | 1.10.1040.10 |
| 4e21B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9672 | 2 | 175 | 3.40.50.720 |
| 4e21A02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9656 | 176 | 320 | 1.10.1040.10 |
| 4e21B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9397 | 2 | 175 | 3.40.50.720 |
| af_Q4DU92_1_145_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.938 | 2 | 132 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U3ASQ3-F1-model_v4 | deleted | 0.9983 | 2 | 101 |
|
| AF-A0A535SKF7-F1-model_v4 | 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein | 0.9974 | 1 | 109 |
GO:0004616
GO:0050661 |
| AF-A0A5E8XFU2-F1-model_v4 | deleted | 0.996 | 1 | 101 |
|
| AF-A0A2W5XZ41-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9952 | 1 | 148 |
GO:0004616
GO:0042558 GO:0050661 |
| AF-A0A2M7WZ84-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9951 | 1 | 148 |
GO:0004616
GO:0050661 |