F486016

General Info

Members Datasets Scaffolds Average Seq Length
930 375 1860 337

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10063501|Ga0070717_100635013
Length 359
Sequence MTTDKPMQLGMIGLGRMGANLSRRLMRDGHRVVVYDHTPDHVKQLAGEGATGALTLEEFVAKLEKPRAAWLMLPAAVTGPVLERLAVLLEPGDIVIDGGNTYYRDDIDRAKELMPRQLHYVDVGTSGGIFGLERGFCLMIGGEDGPVEHLDPIFKSIAPGAGTAEPTPGRSRSDTGTAQDGYLHCGPSGSGHFVKMVHNGIEYGMMAAIAEGLSIIKHANVGQDEVQSDDAETTPLRDPQYYQYDIDVAEVAEVWRRGSVISSWLIDLTADALARSPQLDNFGGHVSDSGEGRWTVIAAVDEGVPAPVITAALIERFESRGLGEFGDKVLSALRSEFGGHAEKESDNSGRILPADPTGT

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
353 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
354 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
357 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
361 2671180195 Frankia sp. CcI49 Isolate Nodule
362 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
363 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
364 2773857922 Frankia sp. CcI49 Isolate Nodule
365 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
366 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
367 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
368 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
369 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
370 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
371 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
372 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
373 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
374 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
375 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0.65
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0.22
Rhizoplane 5.7
Rhizosphere 90.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10063501 3300006028 Bacteria 3065
2 JGI24742J22300_10012159 3300002244 Bacteria 1432
3 JGI25407J50210_10041359 3300003373 Bacteria 1180
4 Ga0055536_1024561 3300003781 Bacteria 1742
5 Ga0070658_10046996 3300005327 Bacteria 3493
6 Ga0070683_100000226 3300005329 Bacteria 38469
7 Ga0070683_100029490 3300005329 Bacteria 4968
8 Ga0070683_100179933 3300005329 Bacteria 2007
9 Ga0070690_100003251 3300005330 Bacteria 8869
10 Ga0070690_100074855 3300005330 Bacteria 2206
11 Ga0070690_100278915 3300005330 Bacteria 1191
12 Ga0070670_100166035 3300005331 Bacteria 1914
13 Ga0070666_10028275 3300005335 Bacteria 3678
14 Ga0070666_10035693 3300005335 Bacteria 3298
15 Ga0070680_100137959 3300005336 Bacteria 2044
16 Ga0070682_100000072 3300005337 Bacteria 93808
17 Ga0070682_100053977 3300005337 Bacteria 2520
18 Ga0068868_100012247 3300005338 Bacteria 6265
19 Ga0068868_100015708 3300005338 Bacteria 5608
20 Ga0068868_100345383 3300005338 Bacteria 1273
21 Ga0070660_100418869 3300005339 Bacteria 1109
22 Ga0070689_100001617 3300005340 Bacteria 14384
23 Ga0070689_100009128 3300005340 Bacteria 7021
24 Ga0070691_10009274 3300005341 Bacteria 4497
25 Ga0070692_10156612 3300005345 Bacteria 1302
26 Ga0070668_100002229 3300005347 Bacteria 14246
27 Ga0070668_100024108 3300005347 Bacteria 4608
28 Ga0070675_100000008 3300005354 Bacteria 250004
29 Ga0070675_100037489 3300005354 Bacteria 3949
30 Ga0070671_100091773 3300005355 Bacteria 2544
31 Ga0070674_100008015 3300005356 Bacteria 6261
32 Ga0070688_100000018 3300005365 Bacteria 72357
33 Ga0070688_100000364 3300005365 Bacteria 22986
34 Ga0070688_100038405 3300005365 Bacteria 2924
35 Ga0070659_100048610 3300005366 Bacteria 3333
36 Ga0070659_100052543 3300005366 Bacteria 3206
37 Ga0070667_100001736 3300005367 Bacteria 19468
38 Ga0070667_100002459 3300005367 Bacteria 16172
39 Ga0070709_10005538 3300005434 Bacteria 6836
40 Ga0070709_10096587 3300005434 Bacteria 1960
41 Ga0070709_10255817 3300005434 Bacteria 1263
42 Ga0070714_100074268 3300005435 Bacteria 2947
43 Ga0070713_100000061 3300005436 Bacteria 68662
44 Ga0070713_100000246 3300005436 Bacteria 35790
45 Ga0070713_100070690 3300005436 Bacteria 2947
46 Ga0070713_100098808 3300005436 Bacteria 2525
47 Ga0070713_100124655 3300005436 Bacteria 2264
48 Ga0070713_100230126 3300005436 Bacteria 1685
49 Ga0070710_10003126 3300005437 Bacteria 7843
50 Ga0070710_10003839 3300005437 Bacteria 7109
51 Ga0070710_10024104 3300005437 Bacteria 3206
52 Ga0070710_10114119 3300005437 Bacteria 1627
53 Ga0070701_10004227 3300005438 Bacteria 5785
54 Ga0070701_10004840 3300005438 Bacteria 5505
55 Ga0070701_10057040 3300005438 Bacteria 2046
56 Ga0070711_100001099 3300005439 Bacteria 14425
57 Ga0070711_100009291 3300005439 Bacteria 6048
58 Ga0070711_100052841 3300005439 Bacteria 2797
59 Ga0070711_100056556 3300005439 Bacteria 2713
60 Ga0070711_100092238 3300005439 Bacteria 2185
61 Ga0070705_100017856 3300005440 Bacteria 3710
62 Ga0070705_100018185 3300005440 Bacteria 3680
63 Ga0070705_100020873 3300005440 Bacteria 3476
64 Ga0070705_100040100 3300005440 Bacteria 2661
65 Ga0070700_100008540 3300005441 Bacteria 5576
66 Ga0070694_100003172 3300005444 Bacteria 9807
67 Ga0070694_100196659 3300005444 Bacteria 1500
68 Ga0070708_100005178 3300005445 Bacteria 10323
69 Ga0070708_100039880 3300005445 Bacteria 4111
70 Ga0070708_100088458 3300005445 Bacteria 2816
71 Ga0070708_100157043 3300005445 Bacteria 2118
72 Ga0070708_100396995 3300005445 Bacteria 1300
73 Ga0070663_100008138 3300005455 Bacteria 6431
74 Ga0070663_100437850 3300005455 Bacteria 1075
75 Ga0070678_100002322 3300005456 Bacteria 10386
76 Ga0070678_100033632 3300005456 Bacteria 3562
77 Ga0070662_100001811 3300005457 Bacteria 13140
78 Ga0070681_10019014 3300005458 Bacteria 6875
79 Ga0070681_10062806 3300005458 Bacteria 3687
80 Ga0070681_10086096 3300005458 Bacteria 3095
81 Ga0068867_100003850 3300005459 Bacteria 10550
82 Ga0070685_10000114 3300005466 Bacteria 51524
83 Ga0070685_10000437 3300005466 Bacteria 24303
84 Ga0070685_10032457 3300005466 Bacteria 2924
85 Ga0070685_10110372 3300005466 Bacteria 1693
86 Ga0070706_100002130 3300005467 Bacteria 20170
87 Ga0070706_100024697 3300005467 Bacteria 5533
88 Ga0070706_100051856 3300005467 Bacteria 3787
89 Ga0070706_100339049 3300005467 Bacteria 1401
90 Ga0070707_100005579 3300005468 Bacteria 11755
91 Ga0070707_100008372 3300005468 Bacteria 9603
92 Ga0070707_100009418 3300005468 Bacteria 9066
93 Ga0070707_100038877 3300005468 Bacteria 4546
94 Ga0070707_100154595 3300005468 Bacteria 2234
95 Ga0070698_100000231 3300005471 Bacteria 55183
96 Ga0070698_100002524 3300005471 Bacteria 20162
97 Ga0070698_100003478 3300005471 Bacteria 17336
98 Ga0070698_100036108 3300005471 Bacteria 5108
99 Ga0070699_100004142 3300005518 Bacteria 12813
100 Ga0070679_100321696 3300005530 Bacteria 1496
101 Ga0070684_100068355 3300005535 Bacteria 3122
102 Ga0070697_100087337 3300005536 Bacteria 2575
103 Ga0068853_100003312 3300005539 Bacteria 12323
104 Ga0068853_100068965 3300005539 Bacteria 3075
105 Ga0070672_100000018 3300005543 Bacteria 70205
106 Ga0070672_100151192 3300005543 Bacteria 1920
107 Ga0070686_100022148 3300005544 Bacteria 3782
108 Ga0070695_100022929 3300005545 Bacteria 3832
109 Ga0070695_100066903 3300005545 Bacteria 2342
110 Ga0070696_100001452 3300005546 Bacteria 15503
111 Ga0070696_100045297 3300005546 Bacteria 3048
112 Ga0070696_100139539 3300005546 Bacteria 1770
113 Ga0070693_100068640 3300005547 Bacteria 2081
114 Ga0070665_100019446 3300005548 Bacteria 6816
115 Ga0070704_100002458 3300005549 Bacteria 10400
116 Ga0070704_100036830 3300005549 Bacteria 3336
117 Ga0070704_100042140 3300005549 Bacteria 3156
118 Ga0070704_100176645 3300005549 Bacteria 1704
119 Ga0068855_100274719 3300005563 Bacteria 1873
120 Ga0070664_100003303 3300005564 Bacteria 13030
121 Ga0068854_100000044 3300005578 Bacteria 91882
122 Ga0068854_100001161 3300005578 Bacteria 15811
123 Ga0068854_100035498 3300005578 Bacteria 3489
124 Ga0068856_100000654 3300005614 Bacteria 37552
125 Ga0068856_100031615 3300005614 Bacteria 5180
126 Ga0068856_100130920 3300005614 Bacteria 2513
127 Ga0068856_100205034 3300005614 Bacteria 1986
128 Ga0070702_100002284 3300005615 Bacteria 8208
129 Ga0070702_100006065 3300005615 Bacteria 5693
130 Ga0070702_100031834 3300005615 Bacteria 2889
131 Ga0068852_100169033 3300005616 Bacteria 2048
132 Ga0068859_100004277 3300005617 Bacteria 14580
133 Ga0068859_100015441 3300005617 Bacteria 7670
134 Ga0068864_100039384 3300005618 Bacteria 4040
135 Ga0068864_100307216 3300005618 Bacteria 1486
136 Ga0068866_10003324 3300005718 Bacteria 6605
137 Ga0068861_100001255 3300005719 Bacteria 15831
138 Ga0068861_100011299 3300005719 Bacteria 6201
139 Ga0068851_10000922 3300005834 Bacteria 12681
140 Ga0068863_100082898 3300005841 Bacteria 3038
141 Ga0068863_100302269 3300005841 Bacteria 1552
142 Ga0068858_100003628 3300005842 Bacteria 15274
143 Ga0068858_100079405 3300005842 Bacteria 3049
144 Ga0068860_100003964 3300005843 Bacteria 15199
145 Ga0068860_100005857 3300005843 Bacteria 12371
146 Ga0068862_100006916 3300005844 Bacteria 9407
147 Ga0068862_100030058 3300005844 Bacteria 4578
148 Ga0068862_100069209 3300005844 Bacteria 3046
149 Ga0081455_10007980 3300005937 Bacteria 11069
150 Ga0081455_10053873 3300005937 Bacteria 3434
151 Ga0081538_10000068 3300005981 Bacteria 97659
152 Ga0081540_1000009 3300005983 Bacteria 193562
153 Ga0081540_1000740 3300005983 Bacteria 30077
154 Ga0070717_10002827 3300006028 Bacteria 12292
155 Ga0070717_10009210 3300006028 Bacteria 7421
156 Ga0070717_10049502 3300006028 Bacteria 3450
157 Ga0070717_10378809 3300006028 Bacteria 1268
158 Ga0070715_10001613 3300006163 Bacteria 6655
159 Ga0070715_10041293 3300006163 Bacteria 1932
160 Ga0070716_100002864 3300006173 Bacteria 8037
161 Ga0070716_100021946 3300006173 Bacteria 3369
162 Ga0070716_100074708 3300006173 Bacteria 2004
163 Ga0070712_100004723 3300006175 Bacteria 8426
164 Ga0070712_100016409 3300006175 Bacteria 4784
165 Ga0070712_100018523 3300006175 Bacteria 4526
166 Ga0070712_100074536 3300006175 Bacteria 2438
167 Ga0070712_100294081 3300006175 Bacteria 1312
168 Ga0070712_100315471 3300006175 Bacteria 1270
169 Ga0070712_100330133 3300006175 Bacteria 1242
170 Ga0075369_10008808 3300006186 Bacteria 3897
171 Ga0097621_100111923 3300006237 Bacteria 2307
172 Ga0097621_100253752 3300006237 Bacteria 1541
173 Ga0075370_10150568 3300006353 Bacteria 1363
174 Ga0068871_100023983 3300006358 Bacteria 4727
175 Ga0068871_100052446 3300006358 Bacteria 3303
176 Ga0075433_10046997 3300006852 Bacteria 3754
177 Ga0075433_10130847 3300006852 Bacteria 2229
178 Ga0075433_10142060 3300006852 Bacteria 2134
179 Ga0068865_100000019 3300006881 Bacteria 105996
180 Ga0068865_100005261 3300006881 Bacteria 7825
181 Ga0075436_100057382 3300006914 Bacteria 2689
182 Ga0097620_100004277 3300006931 Bacteria 14580
183 Ga0097620_100015441 3300006931 Bacteria 7670
184 Ga0075435_100085874 3300007076 Bacteria 2590
185 Ga0099794_10037772 3300007265 Bacteria 2287
186 Ga0105251_10017754 3300009011 Bacteria 3804
187 Ga0105240_10034655 3300009093 Bacteria 6509
188 Ga0105240_10086989 3300009093 Bacteria 3828
189 Ga0111539_10070745 3300009094 Bacteria 4118
190 Ga0111539_10090382 3300009094 Bacteria 3598
191 Ga0105245_10000012 3300009098 Bacteria 267151
192 Ga0105245_10001816 3300009098 Bacteria 19416
193 Ga0105245_10021334 3300009098 Bacteria 5680
194 Ga0105245_10031998 3300009098 Bacteria 4656
195 Ga0105245_10089225 3300009098 Bacteria 2834
196 Ga0105245_10385799 3300009098 Bacteria 1396
197 Ga0105247_10009690 3300009101 Bacteria 5841
198 Ga0105247_10119690 3300009101 Bacteria 1705
199 Ga0114129_10004005 3300009147 Bacteria 20806
200 Ga0105243_10003858 3300009148 Bacteria 11974
201 Ga0105243_10087941 3300009148 Bacteria 2552
202 Ga0105243_10088705 3300009148 Bacteria 2541
203 Ga0105241_10124392 3300009174 Bacteria 2081
204 Ga0105242_10000325 3300009176 Bacteria 38289
205 Ga0105242_10144137 3300009176 Bacteria 2070
206 Ga0105248_10000267 3300009177 Bacteria 61244
207 Ga0105248_10054995 3300009177 Bacteria 4464
208 Ga0105248_10073625 3300009177 Bacteria 3839
209 Ga0105248_10156346 3300009177 Bacteria 2573
210 Ga0105248_10420112 3300009177 Bacteria 1506
211 Ga0105237_10024788 3300009545 Bacteria 6137
212 Ga0105238_10258866 3300009551 Bacteria 1719
213 Ga0105249_10014730 3300009553 Bacteria 6912
214 Ga0105249_10025516 3300009553 Bacteria 5321
215 Ga0105249_10157755 3300009553 Bacteria 2190
216 Ga0105249_10387431 3300009553 Bacteria 1425
217 Ga0105033_101725 3300009986 Bacteria 1801
218 Ga0105239_10016972 3300010375 Bacteria 8048
219 Ga0105239_10318484 3300010375 Bacteria 1753
220 Ga0105239_10482209 3300010375 Bacteria 1409
221 Ga0105239_10764756 3300010375 Bacteria 1106
222 Ga0105246_10012840 3300011119 Bacteria 5238
223 Ga0157342_1000392 3300012507 Bacteria 2582
224 Ga0157373_10145362 3300013100 Bacteria 1668
225 Ga0157370_10208486 3300013104 Bacteria 1812
226 Ga0157370_10334495 3300013104 Bacteria 1396
227 Ga0157369_10001010 3300013105 Bacteria 35439
228 Ga0157369_10222225 3300013105 Bacteria 1977
229 Ga0157374_10077156 3300013296 Bacteria 3152
230 Ga0157374_10435182 3300013296 Bacteria 1312
231 Ga0157378_10009698 3300013297 Bacteria 8386
232 Ga0157378_10128911 3300013297 Bacteria 2339
233 Ga0163162_10007124 3300013306 Bacteria 10851
234 Ga0163162_10019114 3300013306 Bacteria 6720
235 Ga0163162_10233978 3300013306 Bacteria 1968
236 Ga0157372_10000128 3300013307 Bacteria 82571
237 Ga0157372_10002534 3300013307 Bacteria 19823
238 Ga0157372_10070133 3300013307 Bacteria 3943
239 Ga0157375_10001489 3300013308 Bacteria 20109
240 Ga0157375_10018476 3300013308 Bacteria 6324
241 Ga0157375_10264421 3300013308 Bacteria 1882
242 Ga0157375_10420004 3300013308 Bacteria 1503
243 Ga0163163_10065823 3300014325 Bacteria 3598
244 Ga0163163_10108039 3300014325 Bacteria 2809
245 Ga0157380_10000009 3300014326 Bacteria 142155
246 Ga0157380_10002763 3300014326 Bacteria 11919
247 Ga0157377_10009168 3300014745 Bacteria 4846
248 Ga0157377_10062846 3300014745 Bacteria 2125
249 Ga0157379_10006987 3300014968 Bacteria 9759
250 Ga0157379_10009692 3300014968 Bacteria 8386
251 Ga0157379_10015635 3300014968 Bacteria 6666
252 Ga0157376_10034901 3300014969 Bacteria 4064
253 Ga0157376_10321902 3300014969 Bacteria 1470
254 Ga0163161_10002437 3300017792 Bacteria 13291
255 Ga0163161_10025836 3300017792 Bacteria 4158
256 Ga0197907_10255742 3300020069 Bacteria 2595
257 Ga0197907_11021319 3300020069 Bacteria 2087
258 Ga0206356_11118101 3300020070 Bacteria 2875
259 Ga0206350_11332138 3300020080 Bacteria 1677
260 Ga0213873_10000742 3300021358 Bacteria 5287
261 Ga0213876_10006294 3300021384 Bacteria 6466
262 Ga0213875_10007908 3300021388 Bacteria 5465
263 Ga0213875_10093865 3300021388 Bacteria 1399
264 Ga0224712_10004896 3300022467 Bacteria 3668
265 Ga0224712_10068449 3300022467 Bacteria 1435
266 Ga0209563_100088 3300025230 Bacteria 175375
267 Ga0209051_1044455 3300025303 Bacteria 1546
268 Ga0207656_10000153 3300025321 Bacteria 25555
269 Ga0207713_1048880 3300025735 Bacteria 1700
270 Ga0207653_10038162 3300025885 Bacteria 1569
271 Ga0207692_10000297 3300025898 Bacteria 17196
272 Ga0207692_10002263 3300025898 Bacteria 7378
273 Ga0207692_10046926 3300025898 Bacteria 2167
274 Ga0207710_10004469 3300025900 Bacteria 6101
275 Ga0207688_10026396 3300025901 Bacteria 3193
276 Ga0207647_10124002 3300025904 Bacteria 1522
277 Ga0207685_10001088 3300025905 Bacteria 5367
278 Ga0207685_10001777 3300025905 Bacteria 4691
279 Ga0207685_10029613 3300025905 Bacteria 1940
280 Ga0207685_10052613 3300025905 Bacteria 1578
281 Ga0207699_10054483 3300025906 Bacteria 2376
282 Ga0207684_10002157 3300025910 Bacteria 20173
283 Ga0207684_10013578 3300025910 Bacteria 7040
284 Ga0207684_10013721 3300025910 Bacteria 6998
285 Ga0207684_10020758 3300025910 Bacteria 5613
286 Ga0207707_10031073 3300025912 Bacteria 4672
287 Ga0207707_10089707 3300025912 Bacteria 2687
288 Ga0207695_10211133 3300025913 Bacteria 1852
289 Ga0207671_10052185 3300025914 Bacteria 3030
290 Ga0207693_10000882 3300025915 Bacteria 26867
291 Ga0207693_10000976 3300025915 Bacteria 25733
292 Ga0207693_10019671 3300025915 Bacteria 5369
293 Ga0207693_10041129 3300025915 Bacteria 3640
294 Ga0207693_10085318 3300025915 Bacteria 2474
295 Ga0207693_10110512 3300025915 Bacteria 2155
296 Ga0207693_10244588 3300025915 Bacteria 1408
297 Ga0207693_10466257 3300025915 Bacteria 987
298 Ga0207663_10001113 3300025916 Bacteria 12352
299 Ga0207663_10014740 3300025916 Bacteria 4292
300 Ga0207663_10016450 3300025916 Bacteria 4102
301 Ga0207660_10217684 3300025917 Bacteria 1497
302 Ga0207662_10177120 3300025918 Bacteria 1371
303 Ga0207657_10031018 3300025919 Bacteria 4846
304 Ga0207649_10000005 3300025920 Bacteria 356179
305 Ga0207652_10103749 3300025921 Bacteria 2514
306 Ga0207646_10024119 3300025922 Bacteria 5576
307 Ga0207646_10045626 3300025922 Bacteria 3934
308 Ga0207646_10055718 3300025922 Bacteria 3534
309 Ga0207681_10009903 3300025923 Bacteria 5832
310 Ga0207681_10118247 3300025923 Bacteria 1940
311 Ga0207650_10091591 3300025925 Bacteria 2324
312 Ga0207659_10000014 3300025926 Bacteria 168481
313 Ga0207659_10235998 3300025926 Bacteria 1477
314 Ga0207687_10000011 3300025927 Bacteria 388349
315 Ga0207687_10007446 3300025927 Bacteria 7206
316 Ga0207687_10038675 3300025927 Bacteria 3262
317 Ga0207687_10140722 3300025927 Bacteria 1830
318 Ga0207700_10000016 3300025928 Bacteria 202434
319 Ga0207700_10042632 3300025928 Bacteria 3328
320 Ga0207700_10053164 3300025928 Bacteria 3033
321 Ga0207700_10070458 3300025928 Bacteria 2688
322 Ga0207700_10092321 3300025928 Bacteria 2393
323 Ga0207700_10137796 3300025928 Bacteria 2001
324 Ga0207700_10386735 3300025928 Bacteria 1224
325 Ga0207664_10000495 3300025929 Bacteria 28038
326 Ga0207664_10033143 3300025929 Bacteria 3966
327 Ga0207664_10060418 3300025929 Bacteria 3020
328 Ga0207664_10121767 3300025929 Bacteria 2184
329 Ga0207664_10190867 3300025929 Bacteria 1763
330 Ga0207664_10363640 3300025929 Bacteria 1282
331 Ga0207664_10477170 3300025929 Bacteria 1115
332 Ga0207690_10015803 3300025932 Bacteria 4581
333 Ga0207690_10021359 3300025932 Bacteria 4014
334 Ga0207706_10000974 3300025933 Bacteria 29198
335 Ga0207686_10002796 3300025934 Bacteria 9449
336 Ga0207686_10031498 3300025934 Bacteria 3150
337 Ga0207709_10005737 3300025935 Bacteria 7012
338 Ga0207709_10057841 3300025935 Bacteria 2406
339 Ga0207670_10009403 3300025936 Bacteria 5579
340 Ga0207670_10034219 3300025936 Bacteria 3281
341 Ga0207704_10000009 3300025938 Bacteria 198266
342 Ga0207704_10226513 3300025938 Bacteria 1387
343 Ga0207665_10003803 3300025939 Bacteria 10083
344 Ga0207665_10008645 3300025939 Bacteria 6701
345 Ga0207665_10011749 3300025939 Bacteria 5755
346 Ga0207665_10271713 3300025939 Bacteria 1259
347 Ga0207691_10000121 3300025940 Bacteria 70558
348 Ga0207691_10068747 3300025940 Bacteria 3200
349 Ga0207711_10000024 3300025941 Bacteria 293596
350 Ga0207711_10071956 3300025941 Bacteria 3002
351 Ga0207711_10270200 3300025941 Bacteria 1564
352 Ga0207689_10030488 3300025942 Bacteria 4495
353 Ga0207689_10033846 3300025942 Bacteria 4245
354 Ga0207661_10000068 3300025944 Bacteria 70953
355 Ga0207661_10016099 3300025944 Bacteria 5512
356 Ga0207661_10205821 3300025944 Bacteria 1732
357 Ga0207679_10327555 3300025945 Bacteria 1328
358 Ga0207667_10234262 3300025949 Bacteria 1880
359 Ga0207667_10266684 3300025949 Bacteria 1751
360 Ga0207651_10262424 3300025960 Bacteria 1419
361 Ga0207712_10011404 3300025961 Bacteria 5663
362 Ga0207712_10043824 3300025961 Bacteria 3089
363 Ga0207668_10004668 3300025972 Bacteria 8061
364 Ga0207668_10013201 3300025972 Bacteria 5078
365 Ga0207668_10047103 3300025972 Bacteria 2951
366 Ga0207640_10000517 3300025981 Bacteria 23263
367 Ga0207640_10007221 3300025981 Bacteria 6126
368 Ga0207658_10000708 3300025986 Bacteria 28881
369 Ga0207658_10025320 3300025986 Bacteria 4154
370 Ga0207677_10000671 3300026023 Bacteria 20346
371 Ga0207677_10007576 3300026023 Bacteria 6022
372 Ga0207677_10154556 3300026023 Bacteria 1775
373 Ga0207703_10055569 3300026035 Bacteria 3221
374 Ga0207703_10094172 3300026035 Bacteria 2524
375 Ga0207703_10164249 3300026035 Bacteria 1947
376 Ga0207639_10017085 3300026041 Bacteria 5141
377 Ga0207678_10013696 3300026067 Bacteria 7123
378 Ga0207678_10027433 3300026067 Bacteria 4967
379 Ga0207708_10011118 3300026075 Bacteria 6694
380 Ga0207708_10022419 3300026075 Bacteria 4769
381 Ga0207708_10146618 3300026075 Bacteria 1855
382 Ga0207702_10000099 3300026078 Bacteria 100461
383 Ga0207702_10014292 3300026078 Bacteria 6591
384 Ga0207702_10122188 3300026078 Bacteria 2332
385 Ga0207702_10210684 3300026078 Bacteria 1807
386 Ga0207641_10068180 3300026088 Bacteria 3049
387 Ga0207641_10124906 3300026088 Bacteria 2302
388 Ga0207648_10002209 3300026089 Bacteria 21102
389 Ga0207676_10079234 3300026095 Bacteria 2663
390 Ga0207674_10059781 3300026116 Bacteria 3856
391 Ga0207674_10181029 3300026116 Bacteria 2059
392 Ga0207674_10492047 3300026116 Bacteria 1185
393 Ga0207675_100002728 3300026118 Bacteria 17389
394 Ga0207675_100003484 3300026118 Bacteria 15374
395 Ga0207675_100009266 3300026118 Bacteria 9232
396 Ga0207675_100129318 3300026118 Bacteria 2394
397 Ga0207683_10000557 3300026121 Bacteria 34447
398 Ga0207683_10000832 3300026121 Bacteria 28220
399 Ga0207683_10076606 3300026121 Bacteria 2961
400 Ga0207698_10035785 3300026142 Bacteria 3636
401 Ga0268266_10011831 3300028379 Bacteria 7561
402 Ga0268266_10128859 3300028379 Bacteria 2261
403 Ga0268266_10240837 3300028379 Bacteria 1669
404 Ga0268265_10002429 3300028380 Bacteria 14065
405 Ga0268265_10014382 3300028380 Bacteria 5392
406 Ga0268265_10036094 3300028380 Bacteria 3618
407 Ga0268264_10020629 3300028381 Bacteria 5383
408 Ga0265336_10017714 3300028666 Bacteria 2317
409 Ga0265338_10000743 3300028800 Bacteria 55581
410 Ga0307513_10014472 3300031456 Bacteria 9625
411 Ga0316575_10004917 3300031665 Bacteria 4724
412 Ga0316576_10009488 3300031727 Bacteria 6283
413 Ga0316576_10257501 3300031727 Bacteria 1309
414 Ga0316577_10011037 3300031733 Bacteria 4887
415 Ga0307416_100265125 3300032002 Bacteria 1682
416 Ga0373950_0001014 3300034818 Bacteria 3574
417 Ga0373926_0001758 3300035083 Bacteria 6724
418 Ga0373926_0004436 3300035083 Bacteria 4603
419 Ga0373926_0017855 3300035083 Bacteria 2437
420 Ga0373926_0020345 3300035083 Bacteria 2292
421 Ga0373926_0071266 3300035083 Bacteria 1277
422 Ga0373928_0004493 3300035084 Bacteria 2659
423 Ga0373929_0004745 3300035085 Bacteria 2437
424 Ga0373934_0000629 3300035086 Bacteria 12432
425 Ga0373934_0008756 3300035086 Bacteria 3778
426 Ga0373934_0018600 3300035086 Bacteria 2660
427 Ga0373934_0019023 3300035086 Bacteria 2633
428 Ga0373934_0033071 3300035086 Bacteria 2030
429 Ga0373944_0004052 3300035089 Bacteria 3797
430 Ga0373951_0005145 3300035091 Bacteria 3056
431 Ga0373923_0000272 3300035111 Bacteria 11329
432 Ga0373923_0035198 3300035111 Bacteria 2037
433 Ga0373923_0040755 3300035111 Bacteria 1912
434 Ga0373923_0212831 3300035111 Bacteria 896
435 Ga0373936_0000716 3300035113 Bacteria 11592
436 Ga0373936_0000918 3300035113 Bacteria 10522
437 Ga0373936_0015301 3300035113 Bacteria 2939
438 Ga0373936_0046082 3300035113 Bacteria 1757
439 Ga0373936_0111202 3300035113 Bacteria 1163
440 Ga0373945_0000124 3300035116 Bacteria 19016
441 Ga0373945_0000169 3300035116 Bacteria 17244
442 Ga0373945_0002456 3300035116 Bacteria 5817
443 Ga0373945_0026685 3300035116 Bacteria 2013
444 Ga0373953_0021007 3300035117 Bacteria 2445
445 Ga0373953_0025487 3300035117 Bacteria 2259
446 Ga0373954_0008891 3300035118 Bacteria 4420
447 Ga0373954_0027038 3300035118 Bacteria 2631
448 Ga0373954_0041769 3300035118 Bacteria 2139
449 Ga0373956_0000191 3300035119 Bacteria 23567
450 Ga0373956_0003979 3300035119 Bacteria 5938
451 Ga0373956_0035650 3300035119 Bacteria 2194
452 Ga0373957_0000550 3300035120 Bacteria 9517
453 Ga0373957_0002209 3300035120 Bacteria 5505
454 Ga0373957_0026216 3300035120 Bacteria 2106
455 Ga0373960_0009139 3300035121 Bacteria 2394
456 Ga0373943_0000064 3300035170 Bacteria 37284
457 Ga0373943_0008483 3300035170 Bacteria 4609
458 Ga0373943_0011403 3300035170 Bacteria 3999
459 Ga0373943_0043669 3300035170 Bacteria 2178
460 Ga0373946_0000149 3300035171 Bacteria 21381
461 Ga0373946_0000326 3300035171 Bacteria 15418
462 Ga0373946_0016738 3300035171 Bacteria 2796
463 Ga0373955_0000050 3300035172 Bacteria 45664
464 Ga0373955_0003540 3300035172 Bacteria 6873
465 Ga0373955_0004609 3300035172 Bacteria 6111
466 Ga0373955_0112163 3300035172 Bacteria 1577
467 Ga0316574_0004911 3300035398 Bacteria 7082
468 Ga0373924_0000037 3300035410 Bacteria 33504
469 Ga0373924_0014248 3300035410 Bacteria 3002
470 Ga0373924_0030687 3300035410 Bacteria 2156
471 Ga0373924_0069347 3300035410 Bacteria 1485
472 Ga0373931_0013437 3300035691 Bacteria 3986
473 Ga0373931_0235595 3300035691 Bacteria 1107
474 Ga0373935_0001258 3300035692 Bacteria 13997
475 Ga0373935_0021464 3300035692 Bacteria 3954
476 Ga0373935_0067950 3300035692 Bacteria 2292
477 Ga0373935_0075236 3300035692 Bacteria 2184
478 Ga0373935_0075656 3300035692 Bacteria 2178
479 Ga0373927_0001700 3300035695 Bacteria 16442
480 Ga0373927_0016572 3300035695 Bacteria 4860
481 Ga0373927_0034117 3300035695 Bacteria 3311
482 Ga0373927_0044293 3300035695 Bacteria 2879
483 Ga0373927_0124920 3300035695 Bacteria 1680
484 Ga0373933_0000149 3300035724 Bacteria 45676
485 Ga0373933_0003274 3300035724 Bacteria 9057
486 Ga0373933_0020277 3300035724 Bacteria 3767
487 Ga0373933_0020491 3300035724 Bacteria 3748
488 Ga0373933_0026835 3300035724 Bacteria 3311
489 Ga0373933_0072162 3300035724 Bacteria 2102
490 Ga0373933_0173855 3300035724 Bacteria 1371
491 Ga0373947_0000906 3300035725 Bacteria 17951
492 Ga0373947_0016202 3300035725 Bacteria 4285
493 Ga0373947_0066354 3300035725 Bacteria 2202
494 Ga0373947_0074142 3300035725 Bacteria 2093
495 Ga0373947_0187856 3300035725 Bacteria 1347
496 Ga0373937_0000319 3300036401 Bacteria 45685
497 Ga0373937_0000686 3300036401 Bacteria 29455
498 Ga0316582_0122288 3300036647 Bacteria 1742
499 Ga0316584_0004267 3300036712 Bacteria 9442
500 Ga0316584_0012190 3300036712 Bacteria 6059
501 Ga0373925_0018370 3300037068 Bacteria 5082
502 Ga0373925_0022837 3300037068 Bacteria 4564
503 Ga0373925_0175520 3300037068 Bacteria 1693
504 Ga0373925_0289620 3300037068 Bacteria 1320
505 Ga0373925_0323317 3300037068 Bacteria 1248
506 Ga0395898_0011622 3300037466 Bacteria 9138
507 Ga0436364_1080858 3300037853 Bacteria 3051
508 Ga0436364_1264688 3300037853 Bacteria 1592
509 Ga0395901_0225559 3300038443 Bacteria 1957
510 Ga0436365_1406444 3300039437 Bacteria 25793
511 Ga0436365_1629153 3300039437 Bacteria 1390
512 Ga0436365_1749326 3300039437 Bacteria 4296
513 Ga0436362_0578357 3300039453 Bacteria 15297
514 Ga0451802_0384859 3300041460 Bacteria 1747
515 Ga0439452_038862 3300042010 Bacteria 1128
516 Ga0466964_0045575 3300044706 Bacteria 1785
517 Ga0466970_0029327 3300044765 Bacteria 2896
518 Ga0466957_0112712 3300044842 Bacteria 1726
519 Ga0466960_0039009 3300044901 Bacteria 2238
520 Ga0466959_0045081 3300045049 Bacteria 3248
521 Ga0466958_0025987 3300045836 Bacteria 3457
522 Ga0466958_0142355 3300045836 Bacteria 1510
523 Ga0466967_0000123 3300045976 Bacteria 29223
524 Ga0466967_0026324 3300045976 Bacteria 4816
525 Ga0466967_0032936 3300045976 Bacteria 4382
526 Ga0466967_0042603 3300045976 Bacteria 3924
527 Ga0466967_0307967 3300045976 Bacteria 1525
528 Ga0495592_0000255 3300046454 Bacteria 45685
529 Ga0495592_0030140 3300046454 Bacteria 4103
530 Ga0495592_0039236 3300046454 Bacteria 3558
531 Ga0495592_0041517 3300046454 Bacteria 3447
532 Ga0495592_0045175 3300046454 Bacteria 3287
533 Ga0495603_0003038 3300046455 Bacteria 9945
534 Ga0495603_0022542 3300046455 Bacteria 3812
535 Ga0495629_0000377 3300046459 Bacteria 37247
536 Ga0495629_0002409 3300046459 Bacteria 14397
537 Ga0495629_0003497 3300046459 Bacteria 11884
538 Ga0495629_0034223 3300046459 Bacteria 3591
539 Ga0495629_0042946 3300046459 Bacteria 3175
540 Ga0495638_0003039 3300046460 Bacteria 13363
541 Ga0495638_0009577 3300046460 Bacteria 6784
542 Ga0495638_0021853 3300046460 Bacteria 4206
543 Ga0495641_0006016 3300046461 Bacteria 7987
544 Ga0495641_0006400 3300046461 Bacteria 7638
545 Ga0495641_0016629 3300046461 Bacteria 3866
546 Ga0495641_0021908 3300046461 Bacteria 3207
547 Ga0495641_0030310 3300046461 Bacteria 2596
548 Ga0495641_0044539 3300046461 Bacteria 2046
549 Ga0495651_0000199 3300046462 Bacteria 45685
550 Ga0495651_0001591 3300046462 Bacteria 17556
551 Ga0495651_0017370 3300046462 Bacteria 5572
552 Ga0495651_0046737 3300046462 Bacteria 3349
553 Ga0495651_0070134 3300046462 Bacteria 2667
554 Ga0495653_0003175 3300046463 Bacteria 13165
555 Ga0495653_0014635 3300046463 Bacteria 6400
556 Ga0495653_0016440 3300046463 Bacteria 6025
557 Ga0495653_0022138 3300046463 Bacteria 5143
558 Ga0495653_0031203 3300046463 Bacteria 4237
559 Ga0495653_0148026 3300046463 Bacteria 1643
560 Ga0495580_0002596 3300046472 Bacteria 15708
561 Ga0495580_0015371 3300046472 Bacteria 5774
562 Ga0495580_0053162 3300046472 Bacteria 2859
563 Ga0495580_0188230 3300046472 Bacteria 1424
564 Ga0495582_0000730 3300046473 Bacteria 18129
565 Ga0495582_0012628 3300046473 Bacteria 4657
566 Ga0495582_0051155 3300046473 Bacteria 2277
567 Ga0495639_0000935 3300046475 Bacteria 13201
568 Ga0495639_0007453 3300046475 Bacteria 4696
569 Ga0495639_0019139 3300046475 Bacteria 2987
570 Ga0495639_0022336 3300046475 Bacteria 2775
571 Ga0495662_0007677 3300046476 Bacteria 5316
572 Ga0495662_0010492 3300046476 Bacteria 4534
573 Ga0495662_0026802 3300046476 Bacteria 2783
574 Ga0495662_0027018 3300046476 Bacteria 2772
575 Ga0495664_0001131 3300046477 Bacteria 13835
576 Ga0495664_0102303 3300046477 Bacteria 1726
577 Ga0495664_0129065 3300046477 Bacteria 1530
578 Ga0495594_0046808 3300046499 Bacteria 2375
579 Ga0495594_0178601 3300046499 Bacteria 1208
580 Ga0495606_0000294 3300046507 Bacteria 85998
581 Ga0495606_0004323 3300046507 Bacteria 14291
582 Ga0495608_0000010 3300046511 Bacteria 258660
583 Ga0495608_0000499 3300046511 Bacteria 27122
584 Ga0495608_0004767 3300046511 Bacteria 9702
585 Ga0495608_0035640 3300046511 Bacteria 3354
586 Ga0495608_0065349 3300046511 Bacteria 2382
587 Ga0495618_0008665 3300046514 Bacteria 6147
588 Ga0495618_0011052 3300046514 Bacteria 5472
589 Ga0495618_0042134 3300046514 Bacteria 2877
590 Ga0495618_0123121 3300046514 Bacteria 1660
591 Ga0495618_0193745 3300046514 Bacteria 1288
592 Ga0495628_0000282 3300046516 Bacteria 45645
593 Ga0495628_0107238 3300046516 Bacteria 2151
594 Ga0495628_0120706 3300046516 Bacteria 2011
595 Ga0495630_0000011 3300046517 Bacteria 232063
596 Ga0495630_0018874 3300046517 Bacteria 5068
597 Ga0495630_0029722 3300046517 Bacteria 4062
598 Ga0495630_0041672 3300046517 Bacteria 3429
599 Ga0495630_0054071 3300046517 Bacteria 3007
600 Ga0495632_0060129 3300046519 Bacteria 1847
601 Ga0495643_0003383 3300046522 Bacteria 11733
602 Ga0495644_0044766 3300046523 Bacteria 1665
603 Ga0495648_0027978 3300046524 Bacteria 3764
604 Ga0495666_0004831 3300046526 Bacteria 6810
605 Ga0495666_0016851 3300046526 Bacteria 3638
606 Ga0495652_0001352 3300046529 Bacteria 27313
607 Ga0495652_0023245 3300046529 Bacteria 5496
608 Ga0495652_0087975 3300046529 Bacteria 2546
609 Ga0495652_0097219 3300046529 Bacteria 2395
610 Ga0495652_0200777 3300046529 Bacteria 1513
611 Ga0495652_0212244 3300046529 Bacteria 1460
612 Ga0495665_0003232 3300046531 Bacteria 8815
613 Ga0495665_0013243 3300046531 Bacteria 4460
614 Ga0495665_0019544 3300046531 Bacteria 3643
615 Ga0495665_0024755 3300046531 Bacteria 3224
616 Ga0495665_0049028 3300046531 Bacteria 2239
617 Ga0495665_0109981 3300046531 Bacteria 1445
618 Ga0495640_0012108 3300046533 Bacteria 6607
619 Ga0495640_0013029 3300046533 Bacteria 6333
620 Ga0495640_0036069 3300046533 Bacteria 3495
621 Ga0495640_0055712 3300046533 Bacteria 2704
622 Ga0495640_0058215 3300046533 Bacteria 2636
623 Ga0495586_0002011 3300046535 Bacteria 11035
624 Ga0495586_0012080 3300046535 Bacteria 4586
625 Ga0495586_0050941 3300046535 Bacteria 2240
626 Ga0495586_0121606 3300046535 Bacteria 1459
627 Ga0495587_0000189 3300046536 Bacteria 45681
628 Ga0495587_0010133 3300046536 Bacteria 6012
629 Ga0495587_0022593 3300046536 Bacteria 3872
630 Ga0495587_0050750 3300046536 Bacteria 2454
631 Ga0495645_0018972 3300046543 Bacteria 4948
632 Ga0495645_0026413 3300046543 Bacteria 4215
633 Ga0495645_0056664 3300046543 Bacteria 2845
634 Ga0495645_0080182 3300046543 Bacteria 2343
635 Ga0495645_0115768 3300046543 Bacteria 1893
636 Ga0495645_0167300 3300046543 Bacteria 1515
637 Ga0495667_0000136 3300046559 Bacteria 50731
638 Ga0495667_0009068 3300046559 Bacteria 6757
639 Ga0495667_0026481 3300046559 Bacteria 3908
640 Ga0495667_0036661 3300046559 Bacteria 3271
641 Ga0495667_0065583 3300046559 Bacteria 2375
642 Ga0495667_0130427 3300046559 Bacteria 1621
643 Ga0495667_0150710 3300046559 Bacteria 1497
644 Ga0495634_0009897 3300046642 Bacteria 7007
645 Ga0495634_0027996 3300046642 Bacteria 3915
646 Ga0495634_0035770 3300046642 Bacteria 3399
647 Ga0495634_0039571 3300046642 Bacteria 3210
648 Ga0495634_0047766 3300046642 Bacteria 2883
649 Ga0495634_0067261 3300046642 Bacteria 2370
650 Ga0495634_0121004 3300046642 Bacteria 1676
651 Ga0495634_0183868 3300046642 Bacteria 1307
652 Ga0495625_0008112 3300046660 Bacteria 9000
653 Ga0495625_0256172 3300046660 Bacteria 1134
654 Ga0495635_0000124 3300046663 Bacteria 46888
655 Ga0495635_0003210 3300046663 Bacteria 11269
656 Ga0495635_0006536 3300046663 Bacteria 8135
657 Ga0495635_0010617 3300046663 Bacteria 6446
658 Ga0495635_0017321 3300046663 Bacteria 5033
659 Ga0495635_0136350 3300046663 Bacteria 1672
660 Ga0495588_0000218 3300046674 Bacteria 54328
661 Ga0495588_0001492 3300046674 Bacteria 10033
662 Ga0495657_0000005 3300046675 Bacteria 254860
663 Ga0495657_0000290 3300046675 Bacteria 45685
664 Ga0495657_0016245 3300046675 Bacteria 5426
665 Ga0495657_0038600 3300046675 Bacteria 3285
666 Ga0495657_0053587 3300046675 Bacteria 2698
667 Ga0495657_0073927 3300046675 Bacteria 2218
668 Ga0495599_0000282 3300046678 Bacteria 31243
669 Ga0495599_0027822 3300046678 Bacteria 3542
670 Ga0495599_0053165 3300046678 Bacteria 2537
671 Ga0495599_0070865 3300046678 Bacteria 2175
672 Ga0495623_0000368 3300046679 Bacteria 29559
673 Ga0495623_0036513 3300046679 Bacteria 3147
674 Ga0495623_0058226 3300046679 Bacteria 2429
675 Ga0495646_0014864 3300046680 Bacteria 4944
676 Ga0495646_0018156 3300046680 Bacteria 4455
677 Ga0495646_0024999 3300046680 Bacteria 3758
678 Ga0495646_0047465 3300046680 Bacteria 2613
679 Ga0495646_0184086 3300046680 Bacteria 1145
680 Ga0495647_0000111 3300046681 Bacteria 20557
681 Ga0495647_0012514 3300046681 Bacteria 2923
682 Ga0495647_0023204 3300046681 Bacteria 2248
683 Ga0495658_0000965 3300046683 Bacteria 15281
684 Ga0495658_0002269 3300046683 Bacteria 9714
685 Ga0495658_0034678 3300046683 Bacteria 2770
686 Ga0495658_0126095 3300046683 Bacteria 1553
687 Ga0495613_0000131 3300046689 Bacteria 74262
688 Ga0495613_0019246 3300046689 Bacteria 5090
689 Ga0495613_0019940 3300046689 Bacteria 4998
690 Ga0495613_0028981 3300046689 Bacteria 4116
691 Ga0495624_0000455 3300046690 Bacteria 32215
692 Ga0495624_0007084 3300046690 Bacteria 7895
693 Ga0495624_0014987 3300046690 Bacteria 5250
694 Ga0495624_0025562 3300046690 Bacteria 3875
695 Ga0495624_0042139 3300046690 Bacteria 2917
696 Ga0495624_0123243 3300046690 Bacteria 1591
697 Ga0495670_0011360 3300046691 Bacteria 4378
698 Ga0495649_0022100 3300046694 Bacteria 3561
699 Ga0495600_0002942 3300046809 Bacteria 9928
700 Ga0495600_0008634 3300046809 Bacteria 6266
701 Ga0495600_0020345 3300046809 Bacteria 4245
702 Ga0495600_0033112 3300046809 Bacteria 3354
703 Ga0495600_0036276 3300046809 Bacteria 3204
704 Ga0495600_0050961 3300046809 Bacteria 2701
705 Ga0495581_0005558 3300047315 Bacteria 7304
706 Ga0495581_0024613 3300047315 Bacteria 3489
707 Ga0495581_0038893 3300047315 Bacteria 2754
708 Ga0495581_0039162 3300047315 Bacteria 2743
709 Ga0495581_0041225 3300047315 Bacteria 2671
710 Ga0495604_0000078 3300047317 Bacteria 83632
711 Ga0495604_0000280 3300047317 Bacteria 45685
712 Ga0495604_0024326 3300047317 Bacteria 4830
713 Ga0495604_0035697 3300047317 Bacteria 3924
714 Ga0495604_0036151 3300047317 Bacteria 3895
715 Ga0495604_0065678 3300047317 Bacteria 2761
716 Ga0495674_0000063 3300047319 Bacteria 71737
717 Ga0495674_0000405 3300047319 Bacteria 38766
718 Ga0495674_0015523 3300047319 Bacteria 7116
719 Ga0495674_0029627 3300047319 Bacteria 4982
720 Ga0495674_0052205 3300047319 Bacteria 3599
721 Ga0495674_0055126 3300047319 Bacteria 3487
722 Ga0495674_0106405 3300047319 Bacteria 2382
723 Ga0495674_0169564 3300047319 Bacteria 1822
724 Ga0495672_0023757 3300047320 Bacteria 3961
725 Ga0495676_0015559 3300047321 Bacteria 6769
726 Ga0495676_0028446 3300047321 Bacteria 4772
727 Ga0495676_0045718 3300047321 Bacteria 3560
728 Ga0495676_0073273 3300047321 Bacteria 2626
729 Ga0495676_0088268 3300047321 Bacteria 2326
730 Ga0495676_0119364 3300047321 Bacteria 1921
731 Ga0495676_0248131 3300047321 Bacteria 1215
732 Ga0495680_0000430 3300047322 Bacteria 47076
733 Ga0495680_0004034 3300047322 Bacteria 14169
734 Ga0495680_0005228 3300047322 Bacteria 12252
735 Ga0495680_0008764 3300047322 Bacteria 9163
736 Ga0495680_0013885 3300047322 Bacteria 7007
737 Ga0495680_0098296 3300047322 Bacteria 2184
738 Ga0495680_0171514 3300047322 Bacteria 1570
739 Ga0495675_0000004 3300047444 Bacteria 211049
740 Ga0495675_0002808 3300047444 Bacteria 10433
741 Ga0495675_0014801 3300047444 Bacteria 4933
742 Ga0495675_0015192 3300047444 Bacteria 4868
743 Ga0495675_0020477 3300047444 Bacteria 4207
744 Ga0495684_0004452 3300047471 Bacteria 10950
745 Ga0495684_0018973 3300047471 Bacteria 5295
746 Ga0495684_0020434 3300047471 Bacteria 5103
747 Ga0495684_0049220 3300047471 Bacteria 3220
748 Ga0495684_0062945 3300047471 Bacteria 2821
749 Ga0495684_0076194 3300047471 Bacteria 2547
750 Ga0495686_0001014 3300047472 Bacteria 33997
751 Ga0495686_0055601 3300047472 Bacteria 2474
752 Ga0495593_0011015 3300047673 Bacteria 5205
753 Ga0495593_0016581 3300047673 Bacteria 4153
754 Ga0495593_0024417 3300047673 Bacteria 3350
755 Ga0495593_0050660 3300047673 Bacteria 2199
756 Ga0495593_0062139 3300047673 Bacteria 1952
757 Ga0495593_0079250 3300047673 Bacteria 1700
758 Ga0495602_0000009 3300048088 Bacteria 258991
759 Ga0495602_0000297 3300048088 Bacteria 45689
760 Ga0495602_0042892 3300048088 Bacteria 4117
761 Ga0495602_0139758 3300048088 Bacteria 1918
762 Ga0495602_0195445 3300048088 Bacteria 1547
763 Ga0495614_0020759 3300048089 Bacteria 2838
764 Ga0495614_0023298 3300048089 Bacteria 2671
765 Ga0495614_0035644 3300048089 Bacteria 2137
766 Ga0496100_0040807 3300048903 Bacteria 2955
767 Ga0496100_0077534 3300048903 Bacteria 2234
768 Ga0496101_0005422 3300048904 Bacteria 8125
769 Ga0496102_0005112 3300048905 Bacteria 11115
770 Ga0496102_0046003 3300048905 Bacteria 3963
771 Ga0496102_0067777 3300048905 Bacteria 3274
772 Ga0496103_0001480 3300048906 Bacteria 15703
773 Ga0496103_0024665 3300048906 Bacteria 3629
774 Ga0496104_0076412 3300048907 Bacteria 3190
775 Ga0496104_0077895 3300048907 Bacteria 3158
776 Ga0496104_0102693 3300048907 Bacteria 2738
777 Ga0496105_0010084 3300048908 Bacteria 7416
778 Ga0496105_0091586 3300048908 Bacteria 2510
779 Ga0496106_0002660 3300048909 Bacteria 13295
780 Ga0496106_0076366 3300048909 Bacteria 2568
781 Ga0496106_0090074 3300048909 Bacteria 2367
782 Ga0496106_0125955 3300048909 Bacteria 2005
783 Ga0496107_0001604 3300048910 Bacteria 14080
784 Ga0496107_0037662 3300048910 Bacteria 3471
785 Ga0496107_0194935 3300048910 Bacteria 1505
786 Ga0496108_0000012 3300048911 Bacteria 258433
787 Ga0496108_0002885 3300048911 Bacteria 13794
788 Ga0496108_0060977 3300048911 Bacteria 3174
789 Ga0496109_0000076 3300048912 Bacteria 104273
790 Ga0496109_0020426 3300048912 Bacteria 5850
791 Ga0496109_0032385 3300048912 Bacteria 4699
792 Ga0496109_0045125 3300048912 Bacteria 3999
793 Ga0496109_0416206 3300048912 Bacteria 1270
794 Ga0496110_0000015 3300048913 Bacteria 85373
795 Ga0496110_0016082 3300048913 Bacteria 6239
796 Ga0496110_0024029 3300048913 Bacteria 5192
797 Ga0496110_0033575 3300048913 Bacteria 4440
798 Ga0496110_0055285 3300048913 Bacteria 3492
799 Ga0496111_0000001 3300048914 Bacteria 194837
800 Ga0496111_0004168 3300048914 Bacteria 9098
801 Ga0496111_0029999 3300048914 Bacteria 3865
802 Ga0496111_0055218 3300048914 Bacteria 2872
803 Ga0496111_0325613 3300048914 Bacteria 1138
804 Ga0496111_0347667 3300048914 Bacteria 1098
805 Ga0496112_0000250 3300048915 Bacteria 34271
806 Ga0496112_0012300 3300048915 Bacteria 7859
807 Ga0496112_0027878 3300048915 Bacteria 5448
808 Ga0496112_0157464 3300048915 Bacteria 2238
809 Ga0496113_0000039 3300048916 Bacteria 55926
810 Ga0496113_0035974 3300048916 Bacteria 3626
811 Ga0496113_0139704 3300048916 Bacteria 1905
812 Ga0496114_0002063 3300048917 Bacteria 15300
813 Ga0496114_0022716 3300048917 Bacteria 5113
814 Ga0496114_0054616 3300048917 Bacteria 3331
815 Ga0496115_0007251 3300048918 Bacteria 8148
816 Ga0496115_0046554 3300048918 Bacteria 3467
817 Ga0496119_0000011 3300048922 Bacteria 438315
818 Ga0496120_0000206 3300048923 Bacteria 101409
819 Ga0496121_0019494 3300048924 Bacteria 6777
820 Ga0496121_0184873 3300048924 Bacteria 1500
821 Ga0496125_0140916 3300048928 Bacteria 1677
822 Ga0496126_0196052 3300048929 Bacteria 1708
823 Ga0495682_0000276 3300049460 Bacteria 40134
824 Ga0501032_0200611 3300049569 Bacteria 1302
825 Ga0501033_0002379 3300049570 Bacteria 16017
826 Ga0501033_0057489 3300049570 Bacteria 2875
827 Ga0501034_0009939 3300049571 Bacteria 9944
828 Ga0501034_0098775 3300049571 Bacteria 2914
829 Ga0501036_0000429 3300049572 Bacteria 29860
830 Ga0501036_0011601 3300049572 Bacteria 7300
831 Ga0501036_0054089 3300049572 Bacteria 3399
832 Ga0501036_0163426 3300049572 Bacteria 1877
833 Ga0501038_0023598 3300049574 Bacteria 5497
834 Ga0501038_0059052 3300049574 Bacteria 3286
835 Ga0501038_0117145 3300049574 Bacteria 2200
836 Ga0501039_0045543 3300049575 Bacteria 3389
837 Ga0501042_0002245 3300049578 Bacteria 11787
838 Ga0501042_0033126 3300049578 Bacteria 3662
839 Ga0501043_0130156 3300049579 Bacteria 1972
840 Ga0501043_0270622 3300049579 Bacteria 1304
841 Ga0501046_0098084 3300049580 Bacteria 2250
842 Ga0501046_0139159 3300049580 Bacteria 1838
843 Ga0501046_0239454 3300049580 Bacteria 1338
844 Ga0501047_0003786 3300049581 Bacteria 14243
845 Ga0501048_0000726 3300049582 Bacteria 24134
846 Ga0501048_0036936 3300049582 Bacteria 3509
847 Ga0501048_0214231 3300049582 Bacteria 1366
848 Ga0501067_0001837 3300049583 Bacteria 11675
849 Ga0501067_0005707 3300049583 Bacteria 6908
850 Ga0501068_0007750 3300049584 Bacteria 5946
851 Ga0501069_0002284 3300049585 Bacteria 9682
852 Ga0501069_0004484 3300049585 Bacteria 7213
853 Ga0501069_0009014 3300049585 Bacteria 5264
854 Ga0501070_0012978 3300049586 Bacteria 7022
855 Ga0501070_0073483 3300049586 Bacteria 2829
856 Ga0501070_0086972 3300049586 Bacteria 2587
857 Ga0501070_0180811 3300049586 Bacteria 1735
858 Ga0501071_0041093 3300049587 Bacteria 3311
859 Ga0501072_0068519 3300049588 Bacteria 2801
860 Ga0501072_0535164 3300049588 Bacteria 926
861 Ga0501073_0007634 3300049589 Bacteria 8029
862 Ga0501073_0055955 3300049589 Bacteria 2760
863 Ga0501074_0050626 3300049590 Bacteria 2998
864 Ga0501074_0095274 3300049590 Bacteria 2131
865 Ga0501083_0031749 3300049744 Bacteria 3625
866 Ga0501035_0008036 3300049822 Bacteria 9832
867 Ga0501035_0009228 3300049822 Bacteria 9172
868 Ga0501035_0092029 3300049822 Bacteria 2668
869 Ga0501044_0013019 3300049823 Bacteria 9002
870 Ga0501044_0057572 3300049823 Bacteria 3988
871 Ga0501044_0155601 3300049823 Bacteria 2265
872 Ga0501045_0005678 3300049824 Bacteria 8635
873 Ga0501045_0127329 3300049824 Bacteria 1892
874 nmdc:mga06z11_126144_c1 3300050494 Bacteria 1432
875 nmdc:mga07m45_16415_c1 3300050496 Bacteria 3964
876 nmdc:mga05p37_5558_c1 3300050507 Bacteria 14820
877 nmdc:mga08y16_51567_c2 3300050511 Bacteria 3629
878 nmdc:mga0n895_111424_c1 3300050512 Bacteria 2753
879 nmdc:mga0n895_43025_c1 3300050512 Bacteria 4399
880 nmdc:mga0rr50_137511_c1 3300050513 Bacteria 1963
881 nmdc:mga08x19_166694_c1 3300050514 Bacteria 1498
882 nmdc:mga0a205_157901_c1 3300050515 Bacteria 2166
883 Ga0495601_0000042 3300053077 Bacteria 77373
884 Ga0495601_0011568 3300053077 Bacteria 5286
885 Ga0495601_0039241 3300053077 Bacteria 2965
886 Ga0495601_0042188 3300053077 Bacteria 2861
887 Ga0495601_0053560 3300053077 Bacteria 2550
888 Ga0495601_0098668 3300053077 Bacteria 1885
889 Ga0495612_0003776 3300053078 Bacteria 6301
890 Ga0495612_0013108 3300053078 Bacteria 3338
891 Ga0495612_0013937 3300053078 Bacteria 3239
892 Ga0495595_0000005 3300053084 Bacteria 258660
893 Ga0495595_0002052 3300053084 Bacteria 7836
894 Ga0495595_0021151 3300053084 Bacteria 2839
895 Ga0495595_0053821 3300053084 Bacteria 1870
896 Ga0495595_0092079 3300053084 Bacteria 1455
897 Ga0495595_0102050 3300053084 Bacteria 1386
898 Ga0495619_0000040 3300053085 Bacteria 118238
899 Ga0495619_0000126 3300053085 Bacteria 56169
900 Ga0495619_0007828 3300053085 Bacteria 6762
901 Ga0495619_0008414 3300053085 Bacteria 6525
902 Ga0495619_0040351 3300053085 Bacteria 3052
903 Ga0495619_0046481 3300053085 Bacteria 2854
904 Ga0500641_0002279 3300053096 Bacteria 6808
905 Ga0500650_0056890 3300053098 Bacteria 1823
906 Ga0500593_000783 3300053117 Bacteria 11865
907 Ga0500608_047987 3300053122 Bacteria 2052
908 Ga0500608_108312 3300053122 Bacteria 1277
909 Ga0500568_0000002 3300053139 Bacteria 880601
910 Ga0500588_0053691 3300053146 Bacteria 1267
911 Ga0500645_000054 3300053730 Bacteria 93914
912 Ga0501084_0030294 3300054114 Bacteria 4526
913 Ga0501084_0049833 3300054114 Bacteria 3505
914 Ga0501082_0028798 3300060353 Bacteria 4784
915 2616693556 2616644814 Bacteria 11555299
916 2671837835 2671180195 Bacteria 9757215
917 2738704002 2738541274 Bacteria 6909446
918 2739334376 2738543028 Bacteria 6917070
919 2774855991 2773857922 Bacteria 9757215
920 2776375977 2775506925 Bacteria 7237746
921 2863075036 2863067949 Bacteria 8541735
922 2884699581 2884693830 Bacteria 11273186
923 2895443216 2895442618 Bacteria 11027144
924 2919157199 2919155634 Bacteria 4860545
925 3007875097 3007872151 Bacteria 5268868
926 8047895127 8047893842 Bacteria 11723082
927 8048363923 8048356638 Bacteria 11044339
928 8048372153 8048369669 Bacteria 11666822
929 8048381087 8048379754 Bacteria 11877923
930 8056139468 8056137416 Bacteria 6147080
931 Ga0070717_10063501
932 JGI24742J22300_10012159
933 JGI25407J50210_10041359
934 Ga0055536_1024561
935 Ga0070658_10046996
936 Ga0070683_100000226
937 Ga0070683_100029490
938 Ga0070683_100179933
939 Ga0070690_100003251
940 Ga0070690_100074855
941 Ga0070690_100278915
942 Ga0070670_100166035
943 Ga0070666_10028275
944 Ga0070666_10035693
945 Ga0070680_100137959
946 Ga0070682_100000072
947 Ga0070682_100053977
948 Ga0068868_100012247
949 Ga0068868_100015708
950 Ga0068868_100345383
951 Ga0070660_100418869
952 Ga0070689_100001617
953 Ga0070689_100009128
954 Ga0070691_10009274
955 Ga0070692_10156612
956 Ga0070668_100002229
957 Ga0070668_100024108
958 Ga0070675_100000008
959 Ga0070675_100037489
960 Ga0070671_100091773
961 Ga0070674_100008015
962 Ga0070688_100000018
963 Ga0070688_100000364
964 Ga0070688_100038405
965 Ga0070659_100048610
966 Ga0070659_100052543
967 Ga0070667_100001736
968 Ga0070667_100002459
969 Ga0070709_10005538
970 Ga0070709_10096587
971 Ga0070709_10255817
972 Ga0070714_100074268
973 Ga0070713_100000061
974 Ga0070713_100000246
975 Ga0070713_100070690
976 Ga0070713_100098808
977 Ga0070713_100124655
978 Ga0070713_100230126
979 Ga0070710_10003126
980 Ga0070710_10003839
981 Ga0070710_10024104
982 Ga0070710_10114119
983 Ga0070701_10004227
984 Ga0070701_10004840
985 Ga0070701_10057040
986 Ga0070711_100001099
987 Ga0070711_100009291
988 Ga0070711_100052841
989 Ga0070711_100056556
990 Ga0070711_100092238
991 Ga0070705_100017856
992 Ga0070705_100018185
993 Ga0070705_100020873
994 Ga0070705_100040100
995 Ga0070700_100008540
996 Ga0070694_100003172
997 Ga0070694_100196659
998 Ga0070708_100005178
999 Ga0070708_100039880
1000 Ga0070708_100088458
1001 Ga0070708_100157043
1002 Ga0070708_100396995
1003 Ga0070663_100008138
1004 Ga0070663_100437850
1005 Ga0070678_100002322
1006 Ga0070678_100033632
1007 Ga0070662_100001811
1008 Ga0070681_10019014
1009 Ga0070681_10062806
1010 Ga0070681_10086096
1011 Ga0068867_100003850
1012 Ga0070685_10000114
1013 Ga0070685_10000437
1014 Ga0070685_10032457
1015 Ga0070685_10110372
1016 Ga0070706_100002130
1017 Ga0070706_100024697
1018 Ga0070706_100051856
1019 Ga0070706_100339049
1020 Ga0070707_100005579
1021 Ga0070707_100008372
1022 Ga0070707_100009418
1023 Ga0070707_100038877
1024 Ga0070707_100154595
1025 Ga0070698_100000231
1026 Ga0070698_100002524
1027 Ga0070698_100003478
1028 Ga0070698_100036108
1029 Ga0070699_100004142
1030 Ga0070679_100321696
1031 Ga0070684_100068355
1032 Ga0070697_100087337
1033 Ga0068853_100003312
1034 Ga0068853_100068965
1035 Ga0070672_100000018
1036 Ga0070672_100151192
1037 Ga0070686_100022148
1038 Ga0070695_100022929
1039 Ga0070695_100066903
1040 Ga0070696_100001452
1041 Ga0070696_100045297
1042 Ga0070696_100139539
1043 Ga0070693_100068640
1044 Ga0070665_100019446
1045 Ga0070704_100002458
1046 Ga0070704_100036830
1047 Ga0070704_100042140
1048 Ga0070704_100176645
1049 Ga0068855_100274719
1050 Ga0070664_100003303
1051 Ga0068854_100000044
1052 Ga0068854_100001161
1053 Ga0068854_100035498
1054 Ga0068856_100000654
1055 Ga0068856_100031615
1056 Ga0068856_100130920
1057 Ga0068856_100205034
1058 Ga0070702_100002284
1059 Ga0070702_100006065
1060 Ga0070702_100031834
1061 Ga0068852_100169033
1062 Ga0068859_100004277
1063 Ga0068859_100015441
1064 Ga0068864_100039384
1065 Ga0068864_100307216
1066 Ga0068866_10003324
1067 Ga0068861_100001255
1068 Ga0068861_100011299
1069 Ga0068851_10000922
1070 Ga0068863_100082898
1071 Ga0068863_100302269
1072 Ga0068858_100003628
1073 Ga0068858_100079405
1074 Ga0068860_100003964
1075 Ga0068860_100005857
1076 Ga0068862_100006916
1077 Ga0068862_100030058
1078 Ga0068862_100069209
1079 Ga0081455_10007980
1080 Ga0081455_10053873
1081 Ga0081538_10000068
1082 Ga0081540_1000009
1083 Ga0081540_1000740
1084 Ga0070717_10002827
1085 Ga0070717_10009210
1086 Ga0070717_10049502
1087 Ga0070717_10378809
1088 Ga0070715_10001613
1089 Ga0070715_10041293
1090 Ga0070716_100002864
1091 Ga0070716_100021946
1092 Ga0070716_100074708
1093 Ga0070712_100004723
1094 Ga0070712_100016409
1095 Ga0070712_100018523
1096 Ga0070712_100074536
1097 Ga0070712_100294081
1098 Ga0070712_100315471
1099 Ga0070712_100330133
1100 Ga0075369_10008808
1101 Ga0097621_100111923
1102 Ga0097621_100253752
1103 Ga0075370_10150568
1104 Ga0068871_100023983
1105 Ga0068871_100052446
1106 Ga0075433_10046997
1107 Ga0075433_10130847
1108 Ga0075433_10142060
1109 Ga0068865_100000019
1110 Ga0068865_100005261
1111 Ga0075436_100057382
1112 Ga0097620_100004277
1113 Ga0097620_100015441
1114 Ga0075435_100085874
1115 Ga0099794_10037772
1116 Ga0105251_10017754
1117 Ga0105240_10034655
1118 Ga0105240_10086989
1119 Ga0111539_10070745
1120 Ga0111539_10090382
1121 Ga0105245_10000012
1122 Ga0105245_10001816
1123 Ga0105245_10021334
1124 Ga0105245_10031998
1125 Ga0105245_10089225
1126 Ga0105245_10385799
1127 Ga0105247_10009690
1128 Ga0105247_10119690
1129 Ga0114129_10004005
1130 Ga0105243_10003858
1131 Ga0105243_10087941
1132 Ga0105243_10088705
1133 Ga0105241_10124392
1134 Ga0105242_10000325
1135 Ga0105242_10144137
1136 Ga0105248_10000267
1137 Ga0105248_10054995
1138 Ga0105248_10073625
1139 Ga0105248_10156346
1140 Ga0105248_10420112
1141 Ga0105237_10024788
1142 Ga0105238_10258866
1143 Ga0105249_10014730
1144 Ga0105249_10025516
1145 Ga0105249_10157755
1146 Ga0105249_10387431
1147 Ga0105033_101725
1148 Ga0105239_10016972
1149 Ga0105239_10318484
1150 Ga0105239_10482209
1151 Ga0105239_10764756
1152 Ga0105246_10012840
1153 Ga0157342_1000392
1154 Ga0157373_10145362
1155 Ga0157370_10208486
1156 Ga0157370_10334495
1157 Ga0157369_10001010
1158 Ga0157369_10222225
1159 Ga0157374_10077156
1160 Ga0157374_10435182
1161 Ga0157378_10009698
1162 Ga0157378_10128911
1163 Ga0163162_10007124
1164 Ga0163162_10019114
1165 Ga0163162_10233978
1166 Ga0157372_10000128
1167 Ga0157372_10002534
1168 Ga0157372_10070133
1169 Ga0157375_10001489
1170 Ga0157375_10018476
1171 Ga0157375_10264421
1172 Ga0157375_10420004
1173 Ga0163163_10065823
1174 Ga0163163_10108039
1175 Ga0157380_10000009
1176 Ga0157380_10002763
1177 Ga0157377_10009168
1178 Ga0157377_10062846
1179 Ga0157379_10006987
1180 Ga0157379_10009692
1181 Ga0157379_10015635
1182 Ga0157376_10034901
1183 Ga0157376_10321902
1184 Ga0163161_10002437
1185 Ga0163161_10025836
1186 Ga0197907_10255742
1187 Ga0197907_11021319
1188 Ga0206356_11118101
1189 Ga0206350_11332138
1190 Ga0213873_10000742
1191 Ga0213876_10006294
1192 Ga0213875_10007908
1193 Ga0213875_10093865
1194 Ga0224712_10004896
1195 Ga0224712_10068449
1196 Ga0209563_100088
1197 Ga0209051_1044455
1198 Ga0207656_10000153
1199 Ga0207713_1048880
1200 Ga0207653_10038162
1201 Ga0207692_10000297
1202 Ga0207692_10002263
1203 Ga0207692_10046926
1204 Ga0207710_10004469
1205 Ga0207688_10026396
1206 Ga0207647_10124002
1207 Ga0207685_10001088
1208 Ga0207685_10001777
1209 Ga0207685_10029613
1210 Ga0207685_10052613
1211 Ga0207699_10054483
1212 Ga0207684_10002157
1213 Ga0207684_10013578
1214 Ga0207684_10013721
1215 Ga0207684_10020758
1216 Ga0207707_10031073
1217 Ga0207707_10089707
1218 Ga0207695_10211133
1219 Ga0207671_10052185
1220 Ga0207693_10000882
1221 Ga0207693_10000976
1222 Ga0207693_10019671
1223 Ga0207693_10041129
1224 Ga0207693_10085318
1225 Ga0207693_10110512
1226 Ga0207693_10244588
1227 Ga0207693_10466257
1228 Ga0207663_10001113
1229 Ga0207663_10014740
1230 Ga0207663_10016450
1231 Ga0207660_10217684
1232 Ga0207662_10177120
1233 Ga0207657_10031018
1234 Ga0207649_10000005
1235 Ga0207652_10103749
1236 Ga0207646_10024119
1237 Ga0207646_10045626
1238 Ga0207646_10055718
1239 Ga0207681_10009903
1240 Ga0207681_10118247
1241 Ga0207650_10091591
1242 Ga0207659_10000014
1243 Ga0207659_10235998
1244 Ga0207687_10000011
1245 Ga0207687_10007446
1246 Ga0207687_10038675
1247 Ga0207687_10140722
1248 Ga0207700_10000016
1249 Ga0207700_10042632
1250 Ga0207700_10053164
1251 Ga0207700_10070458
1252 Ga0207700_10092321
1253 Ga0207700_10137796
1254 Ga0207700_10386735
1255 Ga0207664_10000495
1256 Ga0207664_10033143
1257 Ga0207664_10060418
1258 Ga0207664_10121767
1259 Ga0207664_10190867
1260 Ga0207664_10363640
1261 Ga0207664_10477170
1262 Ga0207690_10015803
1263 Ga0207690_10021359
1264 Ga0207706_10000974
1265 Ga0207686_10002796
1266 Ga0207686_10031498
1267 Ga0207709_10005737
1268 Ga0207709_10057841
1269 Ga0207670_10009403
1270 Ga0207670_10034219
1271 Ga0207704_10000009
1272 Ga0207704_10226513
1273 Ga0207665_10003803
1274 Ga0207665_10008645
1275 Ga0207665_10011749
1276 Ga0207665_10271713
1277 Ga0207691_10000121
1278 Ga0207691_10068747
1279 Ga0207711_10000024
1280 Ga0207711_10071956
1281 Ga0207711_10270200
1282 Ga0207689_10030488
1283 Ga0207689_10033846
1284 Ga0207661_10000068
1285 Ga0207661_10016099
1286 Ga0207661_10205821
1287 Ga0207679_10327555
1288 Ga0207667_10234262
1289 Ga0207667_10266684
1290 Ga0207651_10262424
1291 Ga0207712_10011404
1292 Ga0207712_10043824
1293 Ga0207668_10004668
1294 Ga0207668_10013201
1295 Ga0207668_10047103
1296 Ga0207640_10000517
1297 Ga0207640_10007221
1298 Ga0207658_10000708
1299 Ga0207658_10025320
1300 Ga0207677_10000671
1301 Ga0207677_10007576
1302 Ga0207677_10154556
1303 Ga0207703_10055569
1304 Ga0207703_10094172
1305 Ga0207703_10164249
1306 Ga0207639_10017085
1307 Ga0207678_10013696
1308 Ga0207678_10027433
1309 Ga0207708_10011118
1310 Ga0207708_10022419
1311 Ga0207708_10146618
1312 Ga0207702_10000099
1313 Ga0207702_10014292
1314 Ga0207702_10122188
1315 Ga0207702_10210684
1316 Ga0207641_10068180
1317 Ga0207641_10124906
1318 Ga0207648_10002209
1319 Ga0207676_10079234
1320 Ga0207674_10059781
1321 Ga0207674_10181029
1322 Ga0207674_10492047
1323 Ga0207675_100002728
1324 Ga0207675_100003484
1325 Ga0207675_100009266
1326 Ga0207675_100129318
1327 Ga0207683_10000557
1328 Ga0207683_10000832
1329 Ga0207683_10076606
1330 Ga0207698_10035785
1331 Ga0268266_10011831
1332 Ga0268266_10128859
1333 Ga0268266_10240837
1334 Ga0268265_10002429
1335 Ga0268265_10014382
1336 Ga0268265_10036094
1337 Ga0268264_10020629
1338 Ga0265336_10017714
1339 Ga0265338_10000743
1340 Ga0307513_10014472
1341 Ga0316575_10004917
1342 Ga0316576_10009488
1343 Ga0316576_10257501
1344 Ga0316577_10011037
1345 Ga0307416_100265125
1346 Ga0373950_0001014
1347 Ga0373926_0001758
1348 Ga0373926_0004436
1349 Ga0373926_0017855
1350 Ga0373926_0020345
1351 Ga0373926_0071266
1352 Ga0373928_0004493
1353 Ga0373929_0004745
1354 Ga0373934_0000629
1355 Ga0373934_0008756
1356 Ga0373934_0018600
1357 Ga0373934_0019023
1358 Ga0373934_0033071
1359 Ga0373944_0004052
1360 Ga0373951_0005145
1361 Ga0373923_0000272
1362 Ga0373923_0035198
1363 Ga0373923_0040755
1364 Ga0373923_0212831
1365 Ga0373936_0000716
1366 Ga0373936_0000918
1367 Ga0373936_0015301
1368 Ga0373936_0046082
1369 Ga0373936_0111202
1370 Ga0373945_0000124
1371 Ga0373945_0000169
1372 Ga0373945_0002456
1373 Ga0373945_0026685
1374 Ga0373953_0021007
1375 Ga0373953_0025487
1376 Ga0373954_0008891
1377 Ga0373954_0027038
1378 Ga0373954_0041769
1379 Ga0373956_0000191
1380 Ga0373956_0003979
1381 Ga0373956_0035650
1382 Ga0373957_0000550
1383 Ga0373957_0002209
1384 Ga0373957_0026216
1385 Ga0373960_0009139
1386 Ga0373943_0000064
1387 Ga0373943_0008483
1388 Ga0373943_0011403
1389 Ga0373943_0043669
1390 Ga0373946_0000149
1391 Ga0373946_0000326
1392 Ga0373946_0016738
1393 Ga0373955_0000050
1394 Ga0373955_0003540
1395 Ga0373955_0004609
1396 Ga0373955_0112163
1397 Ga0316574_0004911
1398 Ga0373924_0000037
1399 Ga0373924_0014248
1400 Ga0373924_0030687
1401 Ga0373924_0069347
1402 Ga0373931_0013437
1403 Ga0373931_0235595
1404 Ga0373935_0001258
1405 Ga0373935_0021464
1406 Ga0373935_0067950
1407 Ga0373935_0075236
1408 Ga0373935_0075656
1409 Ga0373927_0001700
1410 Ga0373927_0016572
1411 Ga0373927_0034117
1412 Ga0373927_0044293
1413 Ga0373927_0124920
1414 Ga0373933_0000149
1415 Ga0373933_0003274
1416 Ga0373933_0020277
1417 Ga0373933_0020491
1418 Ga0373933_0026835
1419 Ga0373933_0072162
1420 Ga0373933_0173855
1421 Ga0373947_0000906
1422 Ga0373947_0016202
1423 Ga0373947_0066354
1424 Ga0373947_0074142
1425 Ga0373947_0187856
1426 Ga0373937_0000319
1427 Ga0373937_0000686
1428 Ga0316582_0122288
1429 Ga0316584_0004267
1430 Ga0316584_0012190
1431 Ga0373925_0018370
1432 Ga0373925_0022837
1433 Ga0373925_0175520
1434 Ga0373925_0289620
1435 Ga0373925_0323317
1436 Ga0395898_0011622
1437 Ga0436364_1080858
1438 Ga0436364_1264688
1439 Ga0395901_0225559
1440 Ga0436365_1406444
1441 Ga0436365_1629153
1442 Ga0436365_1749326
1443 Ga0436362_0578357
1444 Ga0451802_0384859
1445 Ga0439452_038862
1446 Ga0466964_0045575
1447 Ga0466970_0029327
1448 Ga0466957_0112712
1449 Ga0466960_0039009
1450 Ga0466959_0045081
1451 Ga0466958_0025987
1452 Ga0466958_0142355
1453 Ga0466967_0000123
1454 Ga0466967_0026324
1455 Ga0466967_0032936
1456 Ga0466967_0042603
1457 Ga0466967_0307967
1458 Ga0495592_0000255
1459 Ga0495592_0030140
1460 Ga0495592_0039236
1461 Ga0495592_0041517
1462 Ga0495592_0045175
1463 Ga0495603_0003038
1464 Ga0495603_0022542
1465 Ga0495629_0000377
1466 Ga0495629_0002409
1467 Ga0495629_0003497
1468 Ga0495629_0034223
1469 Ga0495629_0042946
1470 Ga0495638_0003039
1471 Ga0495638_0009577
1472 Ga0495638_0021853
1473 Ga0495641_0006016
1474 Ga0495641_0006400
1475 Ga0495641_0016629
1476 Ga0495641_0021908
1477 Ga0495641_0030310
1478 Ga0495641_0044539
1479 Ga0495651_0000199
1480 Ga0495651_0001591
1481 Ga0495651_0017370
1482 Ga0495651_0046737
1483 Ga0495651_0070134
1484 Ga0495653_0003175
1485 Ga0495653_0014635
1486 Ga0495653_0016440
1487 Ga0495653_0022138
1488 Ga0495653_0031203
1489 Ga0495653_0148026
1490 Ga0495580_0002596
1491 Ga0495580_0015371
1492 Ga0495580_0053162
1493 Ga0495580_0188230
1494 Ga0495582_0000730
1495 Ga0495582_0012628
1496 Ga0495582_0051155
1497 Ga0495639_0000935
1498 Ga0495639_0007453
1499 Ga0495639_0019139
1500 Ga0495639_0022336
1501 Ga0495662_0007677
1502 Ga0495662_0010492
1503 Ga0495662_0026802
1504 Ga0495662_0027018
1505 Ga0495664_0001131
1506 Ga0495664_0102303
1507 Ga0495664_0129065
1508 Ga0495594_0046808
1509 Ga0495594_0178601
1510 Ga0495606_0000294
1511 Ga0495606_0004323
1512 Ga0495608_0000010
1513 Ga0495608_0000499
1514 Ga0495608_0004767
1515 Ga0495608_0035640
1516 Ga0495608_0065349
1517 Ga0495618_0008665
1518 Ga0495618_0011052
1519 Ga0495618_0042134
1520 Ga0495618_0123121
1521 Ga0495618_0193745
1522 Ga0495628_0000282
1523 Ga0495628_0107238
1524 Ga0495628_0120706
1525 Ga0495630_0000011
1526 Ga0495630_0018874
1527 Ga0495630_0029722
1528 Ga0495630_0041672
1529 Ga0495630_0054071
1530 Ga0495632_0060129
1531 Ga0495643_0003383
1532 Ga0495644_0044766
1533 Ga0495648_0027978
1534 Ga0495666_0004831
1535 Ga0495666_0016851
1536 Ga0495652_0001352
1537 Ga0495652_0023245
1538 Ga0495652_0087975
1539 Ga0495652_0097219
1540 Ga0495652_0200777
1541 Ga0495652_0212244
1542 Ga0495665_0003232
1543 Ga0495665_0013243
1544 Ga0495665_0019544
1545 Ga0495665_0024755
1546 Ga0495665_0049028
1547 Ga0495665_0109981
1548 Ga0495640_0012108
1549 Ga0495640_0013029
1550 Ga0495640_0036069
1551 Ga0495640_0055712
1552 Ga0495640_0058215
1553 Ga0495586_0002011
1554 Ga0495586_0012080
1555 Ga0495586_0050941
1556 Ga0495586_0121606
1557 Ga0495587_0000189
1558 Ga0495587_0010133
1559 Ga0495587_0022593
1560 Ga0495587_0050750
1561 Ga0495645_0018972
1562 Ga0495645_0026413
1563 Ga0495645_0056664
1564 Ga0495645_0080182
1565 Ga0495645_0115768
1566 Ga0495645_0167300
1567 Ga0495667_0000136
1568 Ga0495667_0009068
1569 Ga0495667_0026481
1570 Ga0495667_0036661
1571 Ga0495667_0065583
1572 Ga0495667_0130427
1573 Ga0495667_0150710
1574 Ga0495634_0009897
1575 Ga0495634_0027996
1576 Ga0495634_0035770
1577 Ga0495634_0039571
1578 Ga0495634_0047766
1579 Ga0495634_0067261
1580 Ga0495634_0121004
1581 Ga0495634_0183868
1582 Ga0495625_0008112
1583 Ga0495625_0256172
1584 Ga0495635_0000124
1585 Ga0495635_0003210
1586 Ga0495635_0006536
1587 Ga0495635_0010617
1588 Ga0495635_0017321
1589 Ga0495635_0136350
1590 Ga0495588_0000218
1591 Ga0495588_0001492
1592 Ga0495657_0000005
1593 Ga0495657_0000290
1594 Ga0495657_0016245
1595 Ga0495657_0038600
1596 Ga0495657_0053587
1597 Ga0495657_0073927
1598 Ga0495599_0000282
1599 Ga0495599_0027822
1600 Ga0495599_0053165
1601 Ga0495599_0070865
1602 Ga0495623_0000368
1603 Ga0495623_0036513
1604 Ga0495623_0058226
1605 Ga0495646_0014864
1606 Ga0495646_0018156
1607 Ga0495646_0024999
1608 Ga0495646_0047465
1609 Ga0495646_0184086
1610 Ga0495647_0000111
1611 Ga0495647_0012514
1612 Ga0495647_0023204
1613 Ga0495658_0000965
1614 Ga0495658_0002269
1615 Ga0495658_0034678
1616 Ga0495658_0126095
1617 Ga0495613_0000131
1618 Ga0495613_0019246
1619 Ga0495613_0019940
1620 Ga0495613_0028981
1621 Ga0495624_0000455
1622 Ga0495624_0007084
1623 Ga0495624_0014987
1624 Ga0495624_0025562
1625 Ga0495624_0042139
1626 Ga0495624_0123243
1627 Ga0495670_0011360
1628 Ga0495649_0022100
1629 Ga0495600_0002942
1630 Ga0495600_0008634
1631 Ga0495600_0020345
1632 Ga0495600_0033112
1633 Ga0495600_0036276
1634 Ga0495600_0050961
1635 Ga0495581_0005558
1636 Ga0495581_0024613
1637 Ga0495581_0038893
1638 Ga0495581_0039162
1639 Ga0495581_0041225
1640 Ga0495604_0000078
1641 Ga0495604_0000280
1642 Ga0495604_0024326
1643 Ga0495604_0035697
1644 Ga0495604_0036151
1645 Ga0495604_0065678
1646 Ga0495674_0000063
1647 Ga0495674_0000405
1648 Ga0495674_0015523
1649 Ga0495674_0029627
1650 Ga0495674_0052205
1651 Ga0495674_0055126
1652 Ga0495674_0106405
1653 Ga0495674_0169564
1654 Ga0495672_0023757
1655 Ga0495676_0015559
1656 Ga0495676_0028446
1657 Ga0495676_0045718
1658 Ga0495676_0073273
1659 Ga0495676_0088268
1660 Ga0495676_0119364
1661 Ga0495676_0248131
1662 Ga0495680_0000430
1663 Ga0495680_0004034
1664 Ga0495680_0005228
1665 Ga0495680_0008764
1666 Ga0495680_0013885
1667 Ga0495680_0098296
1668 Ga0495680_0171514
1669 Ga0495675_0000004
1670 Ga0495675_0002808
1671 Ga0495675_0014801
1672 Ga0495675_0015192
1673 Ga0495675_0020477
1674 Ga0495684_0004452
1675 Ga0495684_0018973
1676 Ga0495684_0020434
1677 Ga0495684_0049220
1678 Ga0495684_0062945
1679 Ga0495684_0076194
1680 Ga0495686_0001014
1681 Ga0495686_0055601
1682 Ga0495593_0011015
1683 Ga0495593_0016581
1684 Ga0495593_0024417
1685 Ga0495593_0050660
1686 Ga0495593_0062139
1687 Ga0495593_0079250
1688 Ga0495602_0000009
1689 Ga0495602_0000297
1690 Ga0495602_0042892
1691 Ga0495602_0139758
1692 Ga0495602_0195445
1693 Ga0495614_0020759
1694 Ga0495614_0023298
1695 Ga0495614_0035644
1696 Ga0496100_0040807
1697 Ga0496100_0077534
1698 Ga0496101_0005422
1699 Ga0496102_0005112
1700 Ga0496102_0046003
1701 Ga0496102_0067777
1702 Ga0496103_0001480
1703 Ga0496103_0024665
1704 Ga0496104_0076412
1705 Ga0496104_0077895
1706 Ga0496104_0102693
1707 Ga0496105_0010084
1708 Ga0496105_0091586
1709 Ga0496106_0002660
1710 Ga0496106_0076366
1711 Ga0496106_0090074
1712 Ga0496106_0125955
1713 Ga0496107_0001604
1714 Ga0496107_0037662
1715 Ga0496107_0194935
1716 Ga0496108_0000012
1717 Ga0496108_0002885
1718 Ga0496108_0060977
1719 Ga0496109_0000076
1720 Ga0496109_0020426
1721 Ga0496109_0032385
1722 Ga0496109_0045125
1723 Ga0496109_0416206
1724 Ga0496110_0000015
1725 Ga0496110_0016082
1726 Ga0496110_0024029
1727 Ga0496110_0033575
1728 Ga0496110_0055285
1729 Ga0496111_0000001
1730 Ga0496111_0004168
1731 Ga0496111_0029999
1732 Ga0496111_0055218
1733 Ga0496111_0325613
1734 Ga0496111_0347667
1735 Ga0496112_0000250
1736 Ga0496112_0012300
1737 Ga0496112_0027878
1738 Ga0496112_0157464
1739 Ga0496113_0000039
1740 Ga0496113_0035974
1741 Ga0496113_0139704
1742 Ga0496114_0002063
1743 Ga0496114_0022716
1744 Ga0496114_0054616
1745 Ga0496115_0007251
1746 Ga0496115_0046554
1747 Ga0496119_0000011
1748 Ga0496120_0000206
1749 Ga0496121_0019494
1750 Ga0496121_0184873
1751 Ga0496125_0140916
1752 Ga0496126_0196052
1753 Ga0495682_0000276
1754 Ga0501032_0200611
1755 Ga0501033_0002379
1756 Ga0501033_0057489
1757 Ga0501034_0009939
1758 Ga0501034_0098775
1759 Ga0501036_0000429
1760 Ga0501036_0011601
1761 Ga0501036_0054089
1762 Ga0501036_0163426
1763 Ga0501038_0023598
1764 Ga0501038_0059052
1765 Ga0501038_0117145
1766 Ga0501039_0045543
1767 Ga0501042_0002245
1768 Ga0501042_0033126
1769 Ga0501043_0130156
1770 Ga0501043_0270622
1771 Ga0501046_0098084
1772 Ga0501046_0139159
1773 Ga0501046_0239454
1774 Ga0501047_0003786
1775 Ga0501048_0000726
1776 Ga0501048_0036936
1777 Ga0501048_0214231
1778 Ga0501067_0001837
1779 Ga0501067_0005707
1780 Ga0501068_0007750
1781 Ga0501069_0002284
1782 Ga0501069_0004484
1783 Ga0501069_0009014
1784 Ga0501070_0012978
1785 Ga0501070_0073483
1786 Ga0501070_0086972
1787 Ga0501070_0180811
1788 Ga0501071_0041093
1789 Ga0501072_0068519
1790 Ga0501072_0535164
1791 Ga0501073_0007634
1792 Ga0501073_0055955
1793 Ga0501074_0050626
1794 Ga0501074_0095274
1795 Ga0501083_0031749
1796 Ga0501035_0008036
1797 Ga0501035_0009228
1798 Ga0501035_0092029
1799 Ga0501044_0013019
1800 Ga0501044_0057572
1801 Ga0501044_0155601
1802 Ga0501045_0005678
1803 Ga0501045_0127329
1804 nmdc:mga06z11_126144_c1
1805 nmdc:mga07m45_16415_c1
1806 nmdc:mga05p37_5558_c1
1807 nmdc:mga08y16_51567_c2
1808 nmdc:mga0n895_111424_c1
1809 nmdc:mga0n895_43025_c1
1810 nmdc:mga0rr50_137511_c1
1811 nmdc:mga08x19_166694_c1
1812 nmdc:mga0a205_157901_c1
1813 Ga0495601_0000042
1814 Ga0495601_0011568
1815 Ga0495601_0039241
1816 Ga0495601_0042188
1817 Ga0495601_0053560
1818 Ga0495601_0098668
1819 Ga0495612_0003776
1820 Ga0495612_0013108
1821 Ga0495612_0013937
1822 Ga0495595_0000005
1823 Ga0495595_0002052
1824 Ga0495595_0021151
1825 Ga0495595_0053821
1826 Ga0495595_0092079
1827 Ga0495595_0102050
1828 Ga0495619_0000040
1829 Ga0495619_0000126
1830 Ga0495619_0007828
1831 Ga0495619_0008414
1832 Ga0495619_0040351
1833 Ga0495619_0046481
1834 Ga0500641_0002279
1835 Ga0500650_0056890
1836 Ga0500593_000783
1837 Ga0500608_047987
1838 Ga0500608_108312
1839 Ga0500568_0000002
1840 Ga0500588_0053691
1841 Ga0500645_000054
1842 Ga0501084_0030294
1843 Ga0501084_0049833
1844 Ga0501082_0028798
1845 2616693556
1846 2671837835
1847 2738704002
1848 2739334376
1849 2774855991
1850 2776375977
1851 2863075036
1852 2884699581
1853 2895443216
1854 2919157199
1855 3007875097
1856 8047895127
1857 8048363923
1858 8048372153
1859 8048381087
1860 8056139468

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

8

164

0.97

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

191

229

0.87

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

8

101

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e21-assembly1.cif.gz_B-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.968 1 324
4e21-assembly1.cif.gz_A-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9615 1 322
4e21-assembly1.cif.gz_B-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9472 1 324
4e21-assembly1.cif.gz_A-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9436 1 322
6vpb-assembly1.cif.gz_A-2 a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd) 0.9201 2 327
ID Description Score Start End Superfamily
4e21A02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9806 176 320 1.10.1040.10
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9672 2 175 3.40.50.720
4e21A02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9656 176 320 1.10.1040.10
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9397 2 175 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.938 2 132 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4U3ASQ3-F1-model_v4 deleted 0.9983 2 101
AF-A0A535SKF7-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.9974 1 109 GO:0004616
GO:0050661
AF-A0A5E8XFU2-F1-model_v4 deleted 0.996 1 101
AF-A0A2W5XZ41-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9952 1 148 GO:0004616
GO:0042558
GO:0050661
AF-A0A2M7WZ84-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9951 1 148 GO:0004616
GO:0050661

Map