F486038

General Info

Members Datasets Scaffolds Average Seq Length
931 342 1862 413

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10017466|Ga0157370_100174666
Length 450
Sequence LQITDDREIEINEMKKEKIDAGLDTQLRDVQSFSNSHVELIIGLFGFGVVGEGLYKVLKQTPSLKASIKKVCIKNYDKRRDAPASLFTTDKNELLDDRDINVIVEVINDCEAAFEIVSIALKNGKHVVSASKRMIAEHLPDLLLLQQETGRSFLYESAACASIPVIRNLEEYYDNDLLHSIRAIVNGSTNFILTRIFEDGLNFREALLLAQQAGFAETDPRLDVEGYDAVSKWSFLLTHAYGILARPGDILFNGIQHIKKEDAVLAASREQEIRLVACAQKLKDGKVAAFVLPQFVRKDDHLAFVKNEYNGVVIESSFADKQFFYGKGAGSFPTASAVLSDIAALRYNYKYEXKKLYHHQPHEITDDLYLRVFVSFDDLSRVPRDNFEWIEEWHADLDRKWLIGVIHFSELKKYSWWKQENTSLILAADPIVEDIETRKLKRKSLELAGV

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
186 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
216 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
217 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
218 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
219 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
282 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
283 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
288 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
299 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
300 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
301 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
302 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
303 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
307 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
308 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
309 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
310 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
311 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
312 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
313 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
314 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
315 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 2738541278 Niastella sp. CF465 Isolate Unclassified
319 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
320 2818991444 Filimonas endophytica 3197 Isolate Unclassified
321 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
322 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
323 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
324 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
325 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
326 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
327 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
328 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
329 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
330 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
331 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
332 2914759650 Rhizosphaericola mali Isolate Rhizosphere
333 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
334 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
335 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
336 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
337 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
338 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
339 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
340 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
341 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
342 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 0
Rhizoplane 0.32
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10017466 3300013104 Bacteria 7238
2 SwRhRL2b_contig_1239318 2162886007 Bacteria 1524
3 SwRhRL2b_contig_1759593 2162886007 Bacteria 266684
4 JGI24740J21852_10000358 3300001979 Bacteria 19557
5 JGI24740J21852_10037900 3300001979 Bacteria 1484
6 JGI24739J22299_10000433 3300001989 Bacteria 14530
7 JGI24751J29686_10002215 3300002459 Bacteria 3937
8 JGI25154J39366_1000007 3300002738 Bacteria 335932
9 JGI25406J46586_10004160 3300003203 Bacteria 6754
10 JGI25153J46596_10001828 3300003215 Bacteria 12620
11 JGI25153J46596_10018062 3300003215 Bacteria 2753
12 rootH2_10020884 3300003320 Bacteria 5195
13 rootH2_10056261 3300003320 Bacteria 14958
14 rootH2_10100645 3300003320 Bacteria 10994
15 rootL2_10022865 3300003322 Bacteria 7745
16 rootL2_10140272 3300003322 Bacteria 3928
17 rootL2_10163823 3300003322 Bacteria 2021
18 rootH1_10005865 3300003323 Bacteria 31302
19 rootH1_10046794 3300003323 Bacteria 11572
20 rootH1_10135802 3300003323 Bacteria 4034
21 JGI25160J50197_1001383 3300003354 Bacteria 12214
22 JGI25160J50197_1003564 3300003354 Bacteria 6924
23 JGI25160J50197_1011746 3300003354 Bacteria 3080
24 JGI25160J50197_1015956 3300003354 Bacteria 2443
25 Ga0055535_1003112 3300003761 Bacteria 4990
26 Ga0055526_1011071 3300003771 Bacteria 4115
27 Ga0055528_1015931 3300003790 Bacteria 2686
28 Ga0055530_10001252 3300003791 Bacteria 19331
29 Ga0055531_10000020 3300003794 Bacteria 170186
30 Ga0055531_10031189 3300003794 Bacteria 1771
31 Ga0065165_1000010 3300005262 Bacteria 323737
32 Ga0065165_1009228 3300005262 Bacteria 4460
33 Ga0065714_10017635 3300005288 Bacteria 1889
34 Ga0065704_10070133 3300005289 Bacteria 1266035
35 Ga0065704_10073952 3300005289 Bacteria 6644
36 Ga0065704_10075046 3300005289 Bacteria 5824
37 Ga0065712_10007993 3300005290 Bacteria 3304
38 Ga0065715_10093864 3300005293 Bacteria 4520
39 Ga0065715_10098173 3300005293 Bacteria 3586
40 Ga0070658_10058958 3300005327 Bacteria 3126
41 Ga0070658_10075475 3300005327 Bacteria 2765
42 Ga0070658_10179516 3300005327 Bacteria 1781
43 Ga0070658_10214036 3300005327 Bacteria 1628
44 Ga0070676_10004661 3300005328 Bacteria 7243
45 Ga0070683_100001844 3300005329 Bacteria 16533
46 Ga0070683_100003744 3300005329 Bacteria 12409
47 Ga0070683_100018837 3300005329 Bacteria 6123
48 Ga0070683_100020019 3300005329 Bacteria 5950
49 Ga0070690_100016948 3300005330 Bacteria 4373
50 Ga0070690_100032271 3300005330 Bacteria 3270
51 Ga0070690_100112891 3300005330 Bacteria 1816
52 Ga0070670_100026565 3300005331 Bacteria 4980
53 Ga0070670_100027222 3300005331 Bacteria 4918
54 Ga0070670_100038903 3300005331 Bacteria 4090
55 Ga0070670_100059185 3300005331 Bacteria 3288
56 Ga0070670_100080565 3300005331 Bacteria 2798
57 Ga0070670_100297706 3300005331 Bacteria 1411
58 Ga0068869_100002681 3300005334 Bacteria 10764
59 Ga0068869_100009889 3300005334 Bacteria 6196
60 Ga0068869_100016541 3300005334 Bacteria 4973
61 Ga0068869_100034075 3300005334 Bacteria 3600
62 Ga0068869_100084756 3300005334 Unclassified 2372
63 Ga0068869_100186944 3300005334 Unclassified 1627
64 Ga0070666_10026338 3300005335 Bacteria 3798
65 Ga0070666_10030778 3300005335 Bacteria 3538
66 Ga0070666_10095753 3300005335 Bacteria 2043
67 Ga0070680_100011958 3300005336 Bacteria 6734
68 Ga0070680_100130702 3300005336 Bacteria 2101
69 Ga0070680_100163013 3300005336 Bacteria 1874
70 Ga0070680_100217863 3300005336 Unclassified 1611
71 Ga0070682_100000018 3300005337 Bacteria 229427
72 Ga0070682_100013032 3300005337 Bacteria 4774
73 Ga0070682_100072253 3300005337 Bacteria 2211
74 Ga0068868_100008559 3300005338 Bacteria 7326
75 Ga0068868_100063499 3300005338 Bacteria 2929
76 Ga0068868_100107795 3300005338 Bacteria 2261
77 Ga0070660_100001278 3300005339 Bacteria 17159
78 Ga0070660_100005738 3300005339 Bacteria 8598
79 Ga0070660_100041472 3300005339 Bacteria 3509
80 Ga0070660_100067403 3300005339 Bacteria 2788
81 Ga0070660_100072985 3300005339 Bacteria 2682
82 Ga0070660_100092127 3300005339 Bacteria 2392
83 Ga0070689_100035493 3300005340 Bacteria 3810
84 Ga0070689_100039392 3300005340 Bacteria 3618
85 Ga0070689_100088598 3300005340 Bacteria 2436
86 Ga0070691_10001047 3300005341 Bacteria 11397
87 Ga0070661_100018952 3300005344 Bacteria 4900
88 Ga0070668_100008170 3300005347 Bacteria 7771
89 Ga0070669_100017590 3300005353 Bacteria 5099
90 Ga0070669_100021311 3300005353 Bacteria 4632
91 Ga0070669_100074842 3300005353 Bacteria 2510
92 Ga0070669_100166113 3300005353 Bacteria 1718
93 Ga0070675_100007148 3300005354 Bacteria 8599
94 Ga0070675_100016579 3300005354 Bacteria 5849
95 Ga0070675_100323480 3300005354 Bacteria 1363
96 Ga0070671_100017404 3300005355 Bacteria 5821
97 Ga0070671_100100027 3300005355 Bacteria 2433
98 Ga0070674_100053564 3300005356 Bacteria 2787
99 Ga0070674_100145194 3300005356 Bacteria 1785
100 Ga0070673_100013654 3300005364 Bacteria 5629
101 Ga0070673_100034796 3300005364 Bacteria 3816
102 Ga0070673_100049925 3300005364 Bacteria 3269
103 Ga0070673_100062303 3300005364 Bacteria 2963
104 Ga0070673_100089685 3300005364 Bacteria 2510
105 Ga0070673_100177729 3300005364 Bacteria 1820
106 Ga0070688_100005858 3300005365 Bacteria 6504
107 Ga0070688_100007595 3300005365 Bacteria 5852
108 Ga0070688_100132491 3300005365 Bacteria 1684
109 Ga0070659_100002027 3300005366 Bacteria 14487
110 Ga0070659_100005677 3300005366 Bacteria 8974
111 Ga0070659_100010931 3300005366 Bacteria 6699
112 Ga0070659_100081983 3300005366 Bacteria 2577
113 Ga0070659_100167753 3300005366 Bacteria 1797
114 Ga0070667_100012198 3300005367 Bacteria 7110
115 Ga0070667_100012604 3300005367 Bacteria 6992
116 Ga0070667_100053963 3300005367 Bacteria 3393
117 Ga0070667_100103445 3300005367 Unclassified 2462
118 Ga0070667_100108956 3300005367 Bacteria 2400
119 Ga0070667_100112696 3300005367 Bacteria 2360
120 Ga0070667_100136993 3300005367 Bacteria 2141
121 Ga0070667_100156773 3300005367 Bacteria 2003
122 Ga0070701_10006632 3300005438 Bacteria 4884
123 Ga0070663_100089989 3300005455 Bacteria 2272
124 Ga0070678_100021106 3300005456 Bacteria 4288
125 Ga0070678_100061577 3300005456 Bacteria 2767
126 Ga0070678_100088451 3300005456 Bacteria 2368
127 Ga0070678_100208121 3300005456 Bacteria 1619
128 Ga0070662_100002931 3300005457 Bacteria 10611
129 Ga0070662_100004967 3300005457 Bacteria 8451
130 Ga0070662_100007145 3300005457 Bacteria 7230
131 Ga0070662_100009392 3300005457 Bacteria 6392
132 Ga0070662_100016106 3300005457 Bacteria 5015
133 Ga0070662_100111416 3300005457 Bacteria 2085
134 Ga0070681_10032814 3300005458 Bacteria 5213
135 Ga0070681_10065886 3300005458 Unclassified 3591
136 Ga0070681_10074057 3300005458 Bacteria 3367
137 Ga0068867_100059343 3300005459 Bacteria 2836
138 Ga0068867_100074463 3300005459 Bacteria 2545
139 Ga0070685_10024229 3300005466 Bacteria 3331
140 Ga0070685_10069976 3300005466 Bacteria 2077
141 Ga0070698_100003400 3300005471 Bacteria 17500
142 Ga0070679_100001044 3300005530 Bacteria 24138
143 Ga0070679_100004008 3300005530 Bacteria 13562
144 Ga0070679_100073106 3300005530 Bacteria 3421
145 Ga0070679_100157594 3300005530 Bacteria 2245
146 Ga0070684_100001070 3300005535 Bacteria 19608
147 Ga0070684_100012432 3300005535 Bacteria 6823
148 Ga0070684_100014413 3300005535 Bacteria 6405
149 Ga0070684_100055619 3300005535 Bacteria 3450
150 Ga0070684_100061868 3300005535 Bacteria 3278
151 Ga0070684_100120096 3300005535 Unclassified 2364
152 Ga0068853_100001291 3300005539 Bacteria 17981
153 Ga0068853_100006484 3300005539 Bacteria 9307
154 Ga0068853_100022502 3300005539 Bacteria 5265
155 Ga0068853_100044640 3300005539 Bacteria 3794
156 Ga0070672_100001603 3300005543 Bacteria 14052
157 Ga0070672_100214597 3300005543 Bacteria 1613
158 Ga0070693_100050821 3300005547 Bacteria 2371
159 Ga0070665_100000008 3300005548 Bacteria 606341
160 Ga0070665_100003504 3300005548 Bacteria 16699
161 Ga0070665_100109195 3300005548 Bacteria 2769
162 Ga0070665_100114404 3300005548 Bacteria 2701
163 Ga0070704_100025018 3300005549 Bacteria 3926
164 Ga0068855_100000329 3300005563 Bacteria 58994
165 Ga0068855_100000406 3300005563 Bacteria 53320
166 Ga0068855_100013158 3300005563 Bacteria 9980
167 Ga0068855_100013953 3300005563 Bacteria 9688
168 Ga0068855_100017499 3300005563 Bacteria 8619
169 Ga0068855_100056531 3300005563 Bacteria 4604
170 Ga0068855_100064457 3300005563 Bacteria 4273
171 Ga0068855_100108409 3300005563 Bacteria 3190
172 Ga0068855_100111470 3300005563 Bacteria 3141
173 Ga0068855_100143074 3300005563 Bacteria 2724
174 Ga0068855_100183932 3300005563 Bacteria 2362
175 Ga0070664_100008883 3300005564 Bacteria 8141
176 Ga0070664_100026666 3300005564 Bacteria 4796
177 Ga0070664_100031978 3300005564 Bacteria 4401
178 Ga0070664_100061377 3300005564 Unclassified 3204
179 Ga0070664_100067420 3300005564 Bacteria 3058
180 Ga0070664_100346098 3300005564 Bacteria 1351
181 Ga0068857_100004345 3300005577 Bacteria 11963
182 Ga0068857_100004830 3300005577 Bacteria 11421
183 Ga0068857_100015114 3300005577 Bacteria 6737
184 Ga0068857_100022205 3300005577 Bacteria 5582
185 Ga0068857_100080583 3300005577 Bacteria 2907
186 Ga0068857_100130731 3300005577 Bacteria 2264
187 Ga0068857_100132320 3300005577 Bacteria 2250
188 Ga0068854_100006808 3300005578 Bacteria 7287
189 Ga0068854_100022079 3300005578 Bacteria 4328
190 Ga0068854_100031903 3300005578 Bacteria 3663
191 Ga0068854_100073428 3300005578 Bacteria 2507
192 Ga0068854_100144895 3300005578 Bacteria 1826
193 Ga0068854_100208667 3300005578 Bacteria 1540
194 Ga0068856_100034788 3300005614 Bacteria 4935
195 Ga0068856_100035282 3300005614 Bacteria 4900
196 Ga0068856_100131052 3300005614 Bacteria 2512
197 Ga0070702_100046856 3300005615 Bacteria 2452
198 Ga0068852_100006208 3300005616 Bacteria 8614
199 Ga0068852_100008807 3300005616 Bacteria 7466
200 Ga0068852_100015602 3300005616 Bacteria 5900
201 Ga0068852_100020725 3300005616 Bacteria 5231
202 Ga0068852_100138617 3300005616 Bacteria 2249
203 Ga0068852_100175196 3300005616 Bacteria 2013
204 Ga0068852_100184164 3300005616 Bacteria 1966
205 Ga0068859_100000023 3300005617 Bacteria 221914
206 Ga0068859_100000859 3300005617 Bacteria 30939
207 Ga0068859_100020142 3300005617 Bacteria 6697
208 Ga0068859_100058275 3300005617 Bacteria 3890
209 Ga0068859_100134287 3300005617 Bacteria 2546
210 Ga0068859_100176293 3300005617 Unclassified 2219
211 Ga0068859_100187243 3300005617 Bacteria 2154
212 Ga0068864_100009349 3300005618 Bacteria 8085
213 Ga0068864_100056257 3300005618 Bacteria 3399
214 Ga0068864_100153429 3300005618 Unclassified 2088
215 Ga0068866_10017119 3300005718 Bacteria 3254
216 Ga0068866_10040962 3300005718 Bacteria 2296
217 Ga0068861_100047027 3300005719 Bacteria 3256
218 Ga0068861_100059398 3300005719 Bacteria 2928
219 Ga0068861_100256002 3300005719 Unclassified 1496
220 Ga0068851_10002822 3300005834 Bacteria 7654
221 Ga0068851_10053510 3300005834 Bacteria 2055
222 Ga0068870_10030301 3300005840 Bacteria 2733
223 Ga0068870_10041365 3300005840 Bacteria 2394
224 Ga0068863_100000424 3300005841 Bacteria 42794
225 Ga0068863_100065852 3300005841 Bacteria 3428
226 Ga0068863_100193970 3300005841 Bacteria 1952
227 Ga0068863_100306769 3300005841 Bacteria 1540
228 Ga0068860_100000059 3300005843 Bacteria 196400
229 Ga0068860_100001384 3300005843 Bacteria 26311
230 Ga0068860_100009247 3300005843 Bacteria 9797
231 Ga0068860_100011810 3300005843 Bacteria 8607
232 Ga0068860_100013541 3300005843 Bacteria 7996
233 Ga0068860_100015628 3300005843 Bacteria 7411
234 Ga0068860_100024851 3300005843 Bacteria 5783
235 Ga0068860_100029257 3300005843 Bacteria 5298
236 Ga0068860_100034335 3300005843 Unclassified 4864
237 Ga0068860_100063750 3300005843 Bacteria 3500
238 Ga0068860_100153902 3300005843 Bacteria 2215
239 Ga0068862_100004782 3300005844 Bacteria 11396
240 Ga0068862_100061946 3300005844 Bacteria 3216
241 Ga0081539_10001000 3300005985 Bacteria 52492
242 Ga0081539_10012887 3300005985 Bacteria 6367
243 Ga0070716_100103258 3300006173 Bacteria 1752
244 Ga0075366_10017853 3300006195 Bacteria 4091
245 Ga0075366_10091015 3300006195 Bacteria 1827
246 Ga0097621_100000487 3300006237 Bacteria 27766
247 Ga0097621_100028199 3300006237 Bacteria 4424
248 Ga0097621_100071294 3300006237 Bacteria 2871
249 Ga0097621_100078691 3300006237 Bacteria 2739
250 Ga0097621_100089616 3300006237 Bacteria 2572
251 Ga0097621_100114598 3300006237 Bacteria 2281
252 Ga0097621_100119702 3300006237 Bacteria 2232
253 Ga0097621_100259683 3300006237 Bacteria 1523
254 Ga0068871_100024719 3300006358 Unclassified 4662
255 Ga0068871_100097088 3300006358 Bacteria 2462
256 Ga0068871_100189196 3300006358 Bacteria 1772
257 Ga0075428_100006657 3300006844 Bacteria 12851
258 Ga0075428_100079725 3300006844 Bacteria 3573
259 Ga0075428_100102763 3300006844 Bacteria 3117
260 Ga0075430_100029748 3300006846 Bacteria 4636
261 Ga0075431_100032992 3300006847 Bacteria 5336
262 Ga0075431_100165692 3300006847 Bacteria 2272
263 Ga0075429_100006669 3300006880 Bacteria 10009
264 Ga0075429_100027628 3300006880 Bacteria 4926
265 Ga0068865_100008569 3300006881 Bacteria 6321
266 Ga0068865_100098462 3300006881 Bacteria 2137
267 Ga0068865_100211413 3300006881 Bacteria 1512
268 Ga0097620_100000023 3300006931 Bacteria 221914
269 Ga0097620_100000859 3300006931 Bacteria 30939
270 Ga0097620_100020142 3300006931 Bacteria 6697
271 Ga0097620_100058269 3300006931 Bacteria 3890
272 Ga0097620_100134284 3300006931 Bacteria 2546
273 Ga0097620_100176303 3300006931 Unclassified 2219
274 Ga0097620_100187246 3300006931 Bacteria 2154
275 Ga0105240_10000011 3300009093 Bacteria 523646
276 Ga0105240_10000767 3300009093 Bacteria 58332
277 Ga0105240_10002681 3300009093 Bacteria 28340
278 Ga0105240_10008492 3300009093 Bacteria 14688
279 Ga0105240_10009313 3300009093 Bacteria 13924
280 Ga0105240_10009560 3300009093 Bacteria 13726
281 Ga0105240_10016269 3300009093 Bacteria 10076
282 Ga0105240_10064033 3300009093 Bacteria 4570
283 Ga0105240_10182785 3300009093 Bacteria 2473
284 Ga0111539_10006433 3300009094 Bacteria 15147
285 Ga0111539_10022168 3300009094 Bacteria 7807
286 Ga0105245_10317179 3300009098 Bacteria 1534
287 Ga0105247_10024168 3300009101 Bacteria 3661
288 Ga0114129_10003306 3300009147 Bacteria 22637
289 Ga0114129_10182219 3300009147 Bacteria 2857
290 Ga0114129_10206848 3300009147 Bacteria 2655
291 Ga0105241_10000861 3300009174 Bacteria 23026
292 Ga0105241_10010072 3300009174 Bacteria 6941
293 Ga0105241_10018003 3300009174 Bacteria 5193
294 Ga0105241_10024675 3300009174 Bacteria 4466
295 Ga0105241_10133889 3300009174 Bacteria 2010
296 Ga0105242_10005203 3300009176 Bacteria 10041
297 Ga0105242_10027845 3300009176 Bacteria 4493
298 Ga0105242_10035959 3300009176 Bacteria 3971
299 Ga0105242_10066012 3300009176 Bacteria 2987
300 Ga0105242_10094343 3300009176 Bacteria 2524
301 Ga0105242_10257862 3300009176 Bacteria 1574
302 Ga0105248_10040274 3300009177 Bacteria 5237
303 Ga0105237_10000128 3300009545 Bacteria 106338
304 Ga0105237_10001750 3300009545 Bacteria 28065
305 Ga0105237_10006346 3300009545 Bacteria 13145
306 Ga0105237_10007600 3300009545 Bacteria 11844
307 Ga0105237_10007857 3300009545 Bacteria 11628
308 Ga0105237_10040418 3300009545 Bacteria 4703
309 Ga0105237_10112647 3300009545 Bacteria 2713
310 Ga0105237_10139842 3300009545 Unclassified 2415
311 Ga0105237_10143287 3300009545 Bacteria 2384
312 Ga0105238_10013311 3300009551 Bacteria 8299
313 Ga0105238_10023664 3300009551 Bacteria 6259
314 Ga0105238_10082937 3300009551 Unclassified 3195
315 Ga0105249_10002037 3300009553 Bacteria 17526
316 Ga0105249_10002885 3300009553 Bacteria 14839
317 Ga0105249_10008554 3300009553 Bacteria 8924
318 Ga0105249_10010023 3300009553 Bacteria 8315
319 Ga0105249_10019818 3300009553 Bacteria 6005
320 Ga0105249_10025260 3300009553 Bacteria 5346
321 Ga0105249_10119485 3300009553 Bacteria 2503
322 Ga0105239_10000052 3300010375 Bacteria 164624
323 Ga0105239_10000263 3300010375 Bacteria 78014
324 Ga0105239_10000748 3300010375 Bacteria 46087
325 Ga0105239_10002485 3300010375 Bacteria 23480
326 Ga0105239_10003037 3300010375 Bacteria 20874
327 Ga0105239_10016636 3300010375 Bacteria 8130
328 Ga0105239_10025164 3300010375 Bacteria 6556
329 Ga0105239_10103105 3300010375 Bacteria 3157
330 Ga0105239_10121663 3300010375 Bacteria 2899
331 Ga0105239_10129240 3300010375 Bacteria 2808
332 Ga0105239_10180254 3300010375 Bacteria 2363
333 Ga0105246_10000127 3300011119 Bacteria 35078
334 Ga0105246_10007561 3300011119 Bacteria 6667
335 Ga0105246_10099983 3300011119 Bacteria 2109
336 Ga0157373_10001583 3300013100 Bacteria 17384
337 Ga0157373_10004754 3300013100 Bacteria 10220
338 Ga0157373_10089780 3300013100 Unclassified 2164
339 Ga0157373_10135784 3300013100 Bacteria 1729
340 Ga0157373_10161231 3300013100 Bacteria 1578
341 Ga0157371_10000651 3300013102 Bacteria 41136
342 Ga0157371_10000874 3300013102 Bacteria 34176
343 Ga0157371_10002691 3300013102 Bacteria 16786
344 Ga0157371_10003885 3300013102 Bacteria 13319
345 Ga0157371_10012057 3300013102 Bacteria 6625
346 Ga0157371_10014455 3300013102 Bacteria 5956
347 Ga0157371_10015537 3300013102 Bacteria 5710
348 Ga0157371_10026427 3300013102 Bacteria 4220
349 Ga0157371_10031082 3300013102 Bacteria 3847
350 Ga0157371_10044799 3300013102 Bacteria 3149
351 Ga0157371_10053023 3300013102 Unclassified 2880
352 Ga0157371_10116551 3300013102 Bacteria 1898
353 Ga0157371_10153838 3300013102 Bacteria 1641
354 Ga0157370_10010139 3300013104 Bacteria 9950
355 Ga0157370_10019741 3300013104 Bacteria 6747
356 Ga0157370_10027186 3300013104 Bacteria 5641
357 Ga0157370_10032940 3300013104 Bacteria 5055
358 Ga0157370_10060071 3300013104 Bacteria 3610
359 Ga0157370_10067521 3300013104 Bacteria 3380
360 Ga0157370_10101118 3300013104 Bacteria 2700
361 Ga0157370_10103180 3300013104 Bacteria 2670
362 Ga0157370_10175087 3300013104 Bacteria 1994
363 Ga0157369_10016571 3300013105 Bacteria 8283
364 Ga0157369_10066270 3300013105 Bacteria 3885
365 Ga0157369_10124521 3300013105 Bacteria 2733
366 Ga0157369_10288447 3300013105 Bacteria 1709
367 Ga0157374_10000009 3300013296 Bacteria 564330
368 Ga0157374_10002136 3300013296 Bacteria 16661
369 Ga0157374_10017972 3300013296 Bacteria 6234
370 Ga0157374_10050185 3300013296 Bacteria 3878
371 Ga0157374_10050987 3300013296 Bacteria 3850
372 Ga0157374_10071492 3300013296 Unclassified 3271
373 Ga0157374_10152858 3300013296 Bacteria 2245
374 Ga0157374_10311262 3300013296 Bacteria 1559
375 Ga0157378_10003896 3300013297 Bacteria 13218
376 Ga0157378_10004726 3300013297 Bacteria 11942
377 Ga0157378_10005272 3300013297 Bacteria 11353
378 Ga0157378_10025100 3300013297 Bacteria 5251
379 Ga0157378_10025456 3300013297 Bacteria 5210
380 Ga0157378_10044912 3300013297 Bacteria 3924
381 Ga0157378_10175156 3300013297 Bacteria 2014
382 Ga0157378_10284351 3300013297 Bacteria 1595
383 Ga0163162_10000164 3300013306 Bacteria 60866
384 Ga0163162_10000373 3300013306 Bacteria 40682
385 Ga0163162_10000413 3300013306 Bacteria 39230
386 Ga0163162_10000697 3300013306 Bacteria 31013
387 Ga0163162_10000856 3300013306 Bacteria 28341
388 Ga0163162_10002755 3300013306 Bacteria 16693
389 Ga0163162_10007340 3300013306 Bacteria 10714
390 Ga0163162_10060105 3300013306 Bacteria 3834
391 Ga0163162_10141353 3300013306 Bacteria 2521
392 Ga0163162_10151709 3300013306 Bacteria 2436
393 Ga0163162_10222422 3300013306 Bacteria 2018
394 Ga0163162_10237579 3300013306 Bacteria 1953
395 Ga0163162_10253355 3300013306 Bacteria 1892
396 Ga0163162_10287102 3300013306 Bacteria 1777
397 Ga0157372_10000361 3300013307 Bacteria 50140
398 Ga0157372_10000676 3300013307 Bacteria 37536
399 Ga0157372_10004620 3300013307 Bacteria 14640
400 Ga0157372_10007453 3300013307 Bacteria 11638
401 Ga0157372_10016144 3300013307 Bacteria 8012
402 Ga0157372_10032100 3300013307 Bacteria 5755
403 Ga0157372_10041530 3300013307 Bacteria 5086
404 Ga0157372_10046886 3300013307 Bacteria 4799
405 Ga0157372_10050674 3300013307 Bacteria 4617
406 Ga0157372_10061020 3300013307 Bacteria 4220
407 Ga0157372_10143700 3300013307 Unclassified 2751
408 Ga0157372_10147340 3300013307 Bacteria 2715
409 Ga0157372_10155238 3300013307 Bacteria 2643
410 Ga0157372_10172947 3300013307 Bacteria 2499
411 Ga0157372_10256260 3300013307 Bacteria 2031
412 Ga0157372_10434942 3300013307 Bacteria 1529
413 Ga0157372_10465252 3300013307 Bacteria 1474
414 Ga0157375_10019779 3300013308 Bacteria 6135
415 Ga0157375_10129843 3300013308 Bacteria 2638
416 Ga0157375_10155632 3300013308 Bacteria 2424
417 Ga0157375_10169648 3300013308 Bacteria 2329
418 Ga0157375_10281391 3300013308 Bacteria 1826
419 Ga0163163_10000560 3300014325 Bacteria 32679
420 Ga0163163_10002603 3300014325 Bacteria 15288
421 Ga0163163_10012527 3300014325 Bacteria 7732
422 Ga0157380_10020668 3300014326 Bacteria 4923
423 Ga0157380_10035702 3300014326 Bacteria 3841
424 Ga0157380_10068775 3300014326 Bacteria 2855
425 Ga0157380_10098766 3300014326 Bacteria 2426
426 Ga0157380_10126642 3300014326 Bacteria 2172
427 Ga0157380_10190663 3300014326 Bacteria 1809
428 Ga0157377_10004008 3300014745 Bacteria 6716
429 Ga0157377_10030917 3300014745 Bacteria 2905
430 Ga0157377_10034815 3300014745 Bacteria 2757
431 Ga0157377_10035061 3300014745 Bacteria 2750
432 Ga0157377_10073216 3300014745 Bacteria 1985
433 Ga0157377_10147612 3300014745 Bacteria 1451
434 Ga0157379_10016875 3300014968 Bacteria 6426
435 Ga0157379_10034273 3300014968 Bacteria 4525
436 Ga0157379_10048438 3300014968 Bacteria 3793
437 Ga0157379_10149386 3300014968 Bacteria 2107
438 Ga0157376_10002437 3300014969 Bacteria 12579
439 Ga0157376_10003607 3300014969 Bacteria 10680
440 Ga0157376_10007147 3300014969 Bacteria 7933
441 Ga0157376_10065638 3300014969 Bacteria 3066
442 Ga0157376_10113436 3300014969 Bacteria 2390
443 Ga0157376_10179106 3300014969 Bacteria 1936
444 Ga0182005_1000215 3300015265 Bacteria 38214
445 Ga0163161_10001190 3300017792 Bacteria 19553
446 Ga0163161_10006822 3300017792 Bacteria 7896
447 Ga0163161_10030521 3300017792 Bacteria 3837
448 Ga0163161_10042807 3300017792 Bacteria 3258
449 Ga0163161_10108419 3300017792 Unclassified 2074
450 Ga0209436_110381 3300025208 Bacteria 1707
451 Ga0209258_102250 3300025242 Bacteria 5201
452 Ga0209646_1000002 3300025246 Bacteria 1425781
453 Ga0209646_1002397 3300025246 Bacteria 4188
454 Ga0209026_1000545 3300025250 Bacteria 25918
455 Ga0209148_1000283 3300025254 Bacteria 77780
456 Ga0209673_1000082 3300025273 Bacteria 219716
457 Ga0209130_1004066 3300025284 Bacteria 5780
458 Ga0209564_1002231 3300025295 Bacteria 15987
459 Ga0209758_1015206 3300025297 Bacteria 4010
460 Ga0209758_1039797 3300025297 Bacteria 1782
461 Ga0209050_1000389 3300025298 Bacteria 82517
462 Ga0207426_1000040 3300025302 Bacteria 433920
463 Ga0207426_1000341 3300025302 Bacteria 87735
464 Ga0207426_1000951 3300025302 Bacteria 28622
465 Ga0207426_1002430 3300025302 Bacteria 11906
466 Ga0207426_1040618 3300025302 Bacteria 1448
467 Ga0209257_1000001 3300025304 Bacteria 2274655
468 Ga0209257_1003759 3300025304 Bacteria 12538
469 Ga0207697_10081107 3300025315 Unclassified 1367
470 Ga0207656_10039892 3300025321 Bacteria 1989
471 Ga0207682_10013516 3300025893 Bacteria 3181
472 Ga0207642_10012939 3300025899 Bacteria 3028
473 Ga0207710_10002430 3300025900 Bacteria 8659
474 Ga0207710_10034808 3300025900 Bacteria 2214
475 Ga0207680_10107618 3300025903 Bacteria 1802
476 Ga0207647_10000139 3300025904 Bacteria 57477
477 Ga0207647_10000485 3300025904 Bacteria 31915
478 Ga0207647_10016694 3300025904 Bacteria 5004
479 Ga0207647_10038075 3300025904 Bacteria 3043
480 Ga0207647_10077222 3300025904 Bacteria 2002
481 Ga0207647_10083236 3300025904 Unclassified 1916
482 Ga0207645_10000093 3300025907 Bacteria 64854
483 Ga0207645_10008549 3300025907 Bacteria 7135
484 Ga0207645_10045019 3300025907 Bacteria 2821
485 Ga0207643_10003399 3300025908 Bacteria 8581
486 Ga0207705_10007859 3300025909 Bacteria 7832
487 Ga0207705_10014478 3300025909 Bacteria 5676
488 Ga0207705_10097990 3300025909 Bacteria 2154
489 Ga0207705_10100159 3300025909 Bacteria 2131
490 Ga0207654_10009898 3300025911 Bacteria 4848
491 Ga0207654_10014620 3300025911 Bacteria 4057
492 Ga0207654_10020576 3300025911 Bacteria 3500
493 Ga0207707_10003165 3300025912 Bacteria 14612
494 Ga0207707_10084908 3300025912 Unclassified 2766
495 Ga0207707_10173295 3300025912 Bacteria 1885
496 Ga0207707_10219642 3300025912 Bacteria 1654
497 Ga0207695_10000010 3300025913 Bacteria 981919
498 Ga0207695_10000051 3300025913 Bacteria 399641
499 Ga0207695_10000056 3300025913 Bacteria 382433
500 Ga0207695_10000081 3300025913 Bacteria 284797
501 Ga0207695_10000425 3300025913 Bacteria 93523
502 Ga0207695_10000446 3300025913 Bacteria 90493
503 Ga0207695_10000873 3300025913 Bacteria 54922
504 Ga0207695_10011272 3300025913 Bacteria 10839
505 Ga0207695_10013688 3300025913 Bacteria 9656
506 Ga0207695_10025625 3300025913 Bacteria 6597
507 Ga0207695_10147130 3300025913 Bacteria 2299
508 Ga0207671_10000150 3300025914 Bacteria 107685
509 Ga0207671_10001329 3300025914 Bacteria 28904
510 Ga0207671_10001864 3300025914 Bacteria 23482
511 Ga0207671_10007560 3300025914 Bacteria 9410
512 Ga0207671_10007853 3300025914 Bacteria 9167
513 Ga0207671_10033040 3300025914 Bacteria 3851
514 Ga0207671_10068398 3300025914 Unclassified 2646
515 Ga0207671_10085591 3300025914 Bacteria 2369
516 Ga0207660_10023446 3300025917 Bacteria 4168
517 Ga0207660_10034825 3300025917 Bacteria 3492
518 Ga0207660_10097456 3300025917 Unclassified 2191
519 Ga0207660_10141570 3300025917 Bacteria 1839
520 Ga0207662_10004373 3300025918 Bacteria 7423
521 Ga0207657_10002529 3300025919 Bacteria 19785
522 Ga0207657_10008447 3300025919 Bacteria 10445
523 Ga0207657_10021296 3300025919 Bacteria 6105
524 Ga0207657_10025251 3300025919 Bacteria 5482
525 Ga0207657_10106366 3300025919 Bacteria 2321
526 Ga0207657_10125502 3300025919 Bacteria 2108
527 Ga0207657_10233751 3300025919 Bacteria 1469
528 Ga0207649_10037474 3300025920 Bacteria 2929
529 Ga0207649_10090252 3300025920 Bacteria 2005
530 Ga0207652_10000051 3300025921 Bacteria 120327
531 Ga0207652_10000770 3300025921 Bacteria 30686
532 Ga0207652_10014831 3300025921 Bacteria 6319
533 Ga0207652_10031057 3300025921 Bacteria 4482
534 Ga0207652_10170711 3300025921 Unclassified 1951
535 Ga0207652_10253698 3300025921 Bacteria 1586
536 Ga0207681_10046890 3300025923 Bacteria 2908
537 Ga0207681_10150737 3300025923 Bacteria 1742
538 Ga0207681_10204681 3300025923 Bacteria 1517
539 Ga0207650_10011838 3300025925 Bacteria 6011
540 Ga0207650_10132943 3300025925 Bacteria 1949
541 Ga0207650_10150314 3300025925 Bacteria 1837
542 Ga0207650_10168551 3300025925 Bacteria 1739
543 Ga0207659_10027614 3300025926 Bacteria 3846
544 Ga0207659_10033230 3300025926 Bacteria 3548
545 Ga0207659_10035683 3300025926 Unclassified 3439
546 Ga0207659_10058149 3300025926 Bacteria 2775
547 Ga0207644_10039114 3300025931 Bacteria 3346
548 Ga0207690_10043628 3300025932 Bacteria 2952
549 Ga0207706_10002738 3300025933 Bacteria 17152
550 Ga0207706_10006740 3300025933 Bacteria 10620
551 Ga0207706_10131229 3300025933 Unclassified 2204
552 Ga0207686_10002397 3300025934 Bacteria 10219
553 Ga0207686_10077169 3300025934 Bacteria 2162
554 Ga0207686_10106606 3300025934 Bacteria 1881
555 Ga0207670_10061498 3300025936 Bacteria 2563
556 Ga0207670_10099288 3300025936 Bacteria 2076
557 Ga0207670_10170353 3300025936 Bacteria 1632
558 Ga0207669_10029661 3300025937 Bacteria 3029
559 Ga0207691_10000426 3300025940 Bacteria 41840
560 Ga0207691_10003790 3300025940 Bacteria 14676
561 Ga0207691_10007792 3300025940 Bacteria 10312
562 Ga0207691_10024512 3300025940 Bacteria 5673
563 Ga0207691_10060213 3300025940 Bacteria 3451
564 Ga0207689_10005494 3300025942 Bacteria 11337
565 Ga0207689_10006819 3300025942 Bacteria 10044
566 Ga0207689_10008379 3300025942 Bacteria 9004
567 Ga0207689_10009613 3300025942 Bacteria 8338
568 Ga0207689_10012042 3300025942 Bacteria 7413
569 Ga0207689_10012253 3300025942 Bacteria 7334
570 Ga0207689_10031011 3300025942 Bacteria 4454
571 Ga0207689_10033385 3300025942 Bacteria 4276
572 Ga0207689_10132984 3300025942 Unclassified 2048
573 Ga0207661_10000433 3300025944 Bacteria 26991
574 Ga0207661_10002197 3300025944 Bacteria 13471
575 Ga0207661_10009778 3300025944 Bacteria 6888
576 Ga0207661_10020079 3300025944 Bacteria 4990
577 Ga0207661_10023880 3300025944 Unclassified 4625
578 Ga0207661_10055866 3300025944 Bacteria 3168
579 Ga0207679_10013842 3300025945 Bacteria 5291
580 Ga0207679_10077602 3300025945 Bacteria 2528
581 Ga0207667_10000324 3300025949 Bacteria 66282
582 Ga0207667_10001491 3300025949 Bacteria 29391
583 Ga0207667_10004916 3300025949 Bacteria 16320
584 Ga0207667_10020765 3300025949 Bacteria 7296
585 Ga0207667_10026416 3300025949 Bacteria 6344
586 Ga0207667_10040176 3300025949 Bacteria 4982
587 Ga0207667_10064453 3300025949 Unclassified 3826
588 Ga0207667_10117410 3300025949 Bacteria 2742
589 Ga0207667_10142548 3300025949 Bacteria 2467
590 Ga0207667_10177385 3300025949 Bacteria 2189
591 Ga0207651_10019691 3300025960 Bacteria 4052
592 Ga0207651_10160551 3300025960 Bacteria 1762
593 Ga0207651_10223247 3300025960 Bacteria 1524
594 Ga0207712_10001684 3300025961 Bacteria 14843
595 Ga0207712_10016183 3300025961 Bacteria 4823
596 Ga0207712_10026360 3300025961 Unclassified 3871
597 Ga0207712_10115538 3300025961 Bacteria 2020
598 Ga0207668_10001372 3300025972 Bacteria 14346
599 Ga0207668_10090396 3300025972 Bacteria 2247
600 Ga0207640_10069448 3300025981 Bacteria 2366
601 Ga0207640_10146916 3300025981 Bacteria 1726
602 Ga0207658_10080361 3300025986 Bacteria 2497
603 Ga0207658_10082255 3300025986 Unclassified 2472
604 Ga0207677_10017319 3300026023 Bacteria 4292
605 Ga0207677_10143755 3300026023 Bacteria 1830
606 Ga0207677_10197704 3300026023 Bacteria 1595
607 Ga0207677_10256903 3300026023 Bacteria 1422
608 Ga0207703_10008491 3300026035 Bacteria 8116
609 Ga0207639_10009587 3300026041 Bacteria 6685
610 Ga0207639_10015801 3300026041 Bacteria 5329
611 Ga0207639_10021022 3300026041 Bacteria 4681
612 Ga0207639_10041256 3300026041 Bacteria 3451
613 Ga0207639_10049836 3300026041 Bacteria 3178
614 Ga0207639_10068456 3300026041 Bacteria 2766
615 Ga0207639_10075282 3300026041 Bacteria 2654
616 Ga0207639_10129745 3300026041 Bacteria 2085
617 Ga0207639_10214078 3300026041 Bacteria 1660
618 Ga0207639_10236119 3300026041 Bacteria 1587
619 Ga0207678_10040611 3300026067 Bacteria 4034
620 Ga0207702_10038469 3300026078 Bacteria 4006
621 Ga0207702_10043851 3300026078 Bacteria 3757
622 Ga0207702_10086312 3300026078 Unclassified 2736
623 Ga0207641_10000250 3300026088 Bacteria 68774
624 Ga0207641_10003419 3300026088 Bacteria 14064
625 Ga0207641_10003961 3300026088 Bacteria 12936
626 Ga0207641_10111397 3300026088 Bacteria 2427
627 Ga0207648_10004739 3300026089 Bacteria 13898
628 Ga0207648_10010083 3300026089 Bacteria 8982
629 Ga0207648_10022313 3300026089 Bacteria 5687
630 Ga0207648_10025344 3300026089 Bacteria 5285
631 Ga0207648_10037061 3300026089 Bacteria 4295
632 Ga0207648_10044331 3300026089 Bacteria 3902
633 Ga0207648_10066688 3300026089 Bacteria 3139
634 Ga0207648_10107713 3300026089 Bacteria 2446
635 Ga0207676_10013866 3300026095 Bacteria 5787
636 Ga0207676_10024842 3300026095 Bacteria 4439
637 Ga0207676_10028937 3300026095 Bacteria 4144
638 Ga0207676_10030918 3300026095 Bacteria 4023
639 Ga0207676_10050380 3300026095 Bacteria 3246
640 Ga0207676_10099684 3300026095 Unclassified 2405
641 Ga0207674_10004594 3300026116 Bacteria 16575
642 Ga0207674_10008341 3300026116 Bacteria 11989
643 Ga0207674_10030768 3300026116 Bacteria 5642
644 Ga0207674_10033858 3300026116 Bacteria 5345
645 Ga0207674_10123089 3300026116 Bacteria 2559
646 Ga0207674_10250770 3300026116 Bacteria 1717
647 Ga0207675_100000599 3300026118 Bacteria 35195
648 Ga0207675_100008087 3300026118 Bacteria 9907
649 Ga0207675_100040059 3300026118 Bacteria 4372
650 Ga0207675_100040594 3300026118 Bacteria 4346
651 Ga0207675_100429898 3300026118 Bacteria 1305
652 Ga0207683_10011150 3300026121 Bacteria 7662
653 Ga0207683_10037056 3300026121 Bacteria 4247
654 Ga0207683_10081531 3300026121 Bacteria 2872
655 Ga0207683_10112392 3300026121 Bacteria 2439
656 Ga0207683_10133738 3300026121 Bacteria 2232
657 Ga0207683_10305745 3300026121 Bacteria 1455
658 Ga0207683_10313671 3300026121 Unclassified 1436
659 Ga0207698_10002595 3300026142 Bacteria 10744
660 Ga0207698_10084196 3300026142 Unclassified 2577
661 Ga0207698_10127667 3300026142 Unclassified 2166
662 Ga0207698_10175597 3300026142 Bacteria 1891
663 Ga0207428_10101572 3300027907 Bacteria 2222
664 Ga0268266_10000016 3300028379 Bacteria 629101
665 Ga0268266_10007816 3300028379 Bacteria 9585
666 Ga0268266_10214932 3300028379 Bacteria 1765
667 Ga0268265_10042632 3300028380 Bacteria 3368
668 Ga0268265_10260802 3300028380 Bacteria 1541
669 Ga0268264_10000015 3300028381 Bacteria 508501
670 Ga0268264_10001580 3300028381 Bacteria 21079
671 Ga0268264_10003253 3300028381 Bacteria 14053
672 Ga0268264_10003762 3300028381 Bacteria 13023
673 Ga0268264_10023117 3300028381 Bacteria 5072
674 Ga0268264_10027215 3300028381 Bacteria 4669
675 Ga0268264_10027753 3300028381 Unclassified 4628
676 Ga0268264_10049065 3300028381 Bacteria 3511
677 Ga0268264_10139530 3300028381 Bacteria 2160
678 Ga0307517_10015597 3300028786 Bacteria 10079
679 Ga0307515_10000010 3300028794 Bacteria 651586
680 Ga0307515_10000057 3300028794 Bacteria 261695
681 Ga0265338_10079195 3300028800 Bacteria 2766
682 Ga0265324_10023935 3300029957 Bacteria 2172
683 Ga0307511_10000024 3300030521 Bacteria 112616
684 Ga0265330_10000013 3300031235 Bacteria 177129
685 Ga0265332_10000019 3300031238 Bacteria 222130
686 Ga0265328_10004579 3300031239 Bacteria 5995
687 Ga0265320_10008899 3300031240 Bacteria 6102
688 Ga0265325_10008789 3300031241 Bacteria 5937
689 Ga0265329_10004580 3300031242 Bacteria 5718
690 Ga0265339_10023126 3300031249 Bacteria 3595
691 Ga0265327_10000006 3300031251 Bacteria 693716
692 Ga0265327_10000046 3300031251 Bacteria 280722
693 Ga0265327_10000239 3300031251 Bacteria 109804
694 Ga0265327_10000618 3300031251 Bacteria 58585
695 Ga0265327_10000726 3300031251 Bacteria 51653
696 Ga0265327_10031497 3300031251 Bacteria 2978
697 Ga0265316_10000111 3300031344 Bacteria 87754
698 Ga0307509_10102308 3300031507 Bacteria 2897
699 Ga0307509_10290150 3300031507 Unclassified 1391
700 Ga0307508_10001247 3300031616 Bacteria 29056
701 Ga0265314_10000004 3300031711 Bacteria 939480
702 Ga0265342_10000017 3300031712 Bacteria 180644
703 Ga0307516_10002738 3300031730 Bacteria 23246
704 Ga0307516_10052934 3300031730 Bacteria 3972
705 Ga0307516_10221684 3300031730 Bacteria 1600
706 Ga0307405_10000001 3300031731 Bacteria 1731270
707 Ga0307406_10017842 3300031901 Bacteria 4139
708 Ga0307414_10072314 3300032004 Bacteria 2491
709 Ga0307510_10000042 3300033180 Bacteria 100951
710 Ga0373923_0036518 3300035111 Bacteria 2006
711 Ga0373935_0178506 3300035692 Bacteria 1457
712 Ga0373927_0019498 3300035695 Bacteria 4447
713 Ga0373937_0002128 3300036401 Bacteria 16559
714 Ga0395899_0011662 3300037312 Bacteria 6727
715 Ga0395899_0035366 3300037312 Bacteria 3750
716 Ga0395899_0039531 3300037312 Bacteria 3531
717 Ga0395899_0047757 3300037312 Bacteria 3186
718 Ga0395899_0110395 3300037312 Bacteria 1978
719 Ga0395900_0010950 3300037418 Bacteria 9275
720 Ga0395900_0011050 3300037418 Bacteria 9226
721 Ga0395900_0165276 3300037418 Bacteria 2255
722 Ga0395900_0391710 3300037418 Bacteria 1355
723 Ga0395898_0001697 3300037466 Bacteria 29404
724 Ga0395898_0045358 3300037466 Bacteria 4321
725 Ga0395898_0053988 3300037466 Bacteria 3922
726 Ga0395898_0132518 3300037466 Bacteria 2386
727 Ga0395905_0019301 3300037471 Bacteria 6463
728 Ga0395905_0065228 3300037471 Bacteria 3409
729 Ga0395905_0116178 3300037471 Bacteria 2515
730 Ga0395905_0242968 3300037471 Bacteria 1682
731 Ga0395905_0277475 3300037471 Bacteria 1562
732 Ga0395901_0079052 3300038443 Unclassified 3434
733 Ga0395901_0086677 3300038443 Bacteria 3274
734 Ga0395901_0088589 3300038443 Bacteria 3237
735 Ga0436365_1889064 3300039437 Bacteria 17551
736 Ga0436365_1892627 3300039437 Bacteria 12715
737 Ga0439436_0001903 3300041404 Bacteria 6174
738 Ga0439439_0013021 3300041406 Bacteria 2014
739 Ga0439441_005992 3300042001 Bacteria 1910
740 Ga0439442_005454 3300042002 Unclassified 2544
741 Ga0450923_009304 3300042125 Bacteria 1715
742 Ga0451577_0015486 3300042876 Bacteria 7094
743 Ga0451577_0273802 3300042876 Bacteria 1529
744 Ga0466969_0000132 3300044656 Bacteria 40569
745 Ga0466969_0035045 3300044656 Bacteria 2541
746 Ga0466972_0000095 3300044658 Bacteria 77981
747 Ga0466972_0000205 3300044658 Bacteria 43008
748 Ga0466972_0000946 3300044658 Bacteria 13963
749 Ga0466966_0000239 3300044684 Bacteria 36312
750 Ga0466961_0016781 3300044693 Bacteria 4708
751 Ga0466964_0019963 3300044706 Bacteria 2578
752 Ga0453684_0021683 3300044712 Bacteria 9579
753 Ga0453684_0023757 3300044712 Bacteria 9004
754 Ga0453684_0024881 3300044712 Bacteria 8719
755 Ga0453684_0027420 3300044712 Bacteria 8171
756 Ga0453684_0030202 3300044712 Bacteria 7663
757 Ga0453684_0041437 3300044712 Bacteria 6228
758 Ga0453684_0136521 3300044712 Bacteria 2936
759 Ga0466968_0009777 3300044735 Bacteria 3701
760 Ga0466968_0035392 3300044735 Bacteria 2089
761 Ga0466970_0000529 3300044765 Bacteria 18707
762 Ga0466970_0108824 3300044765 Bacteria 1513
763 Ga0466957_0007324 3300044842 Bacteria 6235
764 Ga0466957_0010280 3300044842 Bacteria 5364
765 Ga0466957_0043397 3300044842 Bacteria 2723
766 Ga0466959_0000031 3300045049 Bacteria 111271
767 Ga0466959_0000501 3300045049 Bacteria 22709
768 Ga0466959_0057953 3300045049 Bacteria 2823
769 Ga0451576_0082567 3300045051 Bacteria 3342
770 Ga0495638_0044936 3300046460 Bacteria 2781
771 Ga0495638_0071636 3300046460 Unclassified 2120
772 Ga0495653_0064989 3300046463 Bacteria 2747
773 Ga0495650_0022359 3300046471 Bacteria 3034
774 Ga0495582_0126018 3300046473 Bacteria 1445
775 Ga0495607_0143172 3300046501 Bacteria 1231
776 Ga0495606_0040930 3300046507 Bacteria 3110
777 Ga0495606_0069818 3300046507 Bacteria 2218
778 Ga0495608_0085406 3300046511 Bacteria 2046
779 Ga0495618_0094930 3300046514 Bacteria 1907
780 Ga0495643_0000392 3300046522 Bacteria 57744
781 Ga0495648_0002775 3300046524 Bacteria 15798
782 Ga0495587_0082808 3300046536 Bacteria 1859
783 Ga0495598_0035309 3300046537 Bacteria 1431
784 Ga0495633_0000090 3300046558 Bacteria 122693
785 Ga0495668_0000138 3300046616 Bacteria 109654
786 Ga0495668_0000268 3300046616 Bacteria 73486
787 Ga0495668_0002233 3300046616 Bacteria 16405
788 Ga0495611_0000086 3300046648 Bacteria 66762
789 Ga0495625_0044931 3300046660 Bacteria 3196
790 Ga0495635_0071624 3300046663 Bacteria 2376
791 Ga0495623_0076293 3300046679 Unclassified 2080
792 Ga0495658_0048030 3300046683 Unclassified 2405
793 Ga0495613_0099140 3300046689 Bacteria 2105
794 Ga0495649_0063746 3300046694 Bacteria 1980
795 Ga0495636_0000082 3300047318 Bacteria 40011
796 Ga0495674_0014078 3300047319 Bacteria 7498
797 Ga0495672_0022692 3300047320 Bacteria 4075
798 Ga0495672_0035473 3300047320 Bacteria 3072
799 Ga0495687_000004 3300047443 Bacteria 779298
800 Ga0495684_0104665 3300047471 Bacteria 2139
801 Ga0495686_0000128 3300047472 Bacteria 156223
802 Ga0495686_0002851 3300047472 Bacteria 15578
803 Ga0495686_0051739 3300047472 Bacteria 2577
804 Ga0495686_0143147 3300047472 Bacteria 1409
805 Ga0495602_0240779 3300048088 Bacteria 1354
806 Ga0496114_0002926 3300048917 Bacteria 13088
807 Ga0496114_0045155 3300048917 Bacteria 3659
808 Ga0496115_0037645 3300048918 Bacteria 3835
809 Ga0496121_0000020 3300048924 Bacteria 498732
810 Ga0496125_0000443 3300048928 Bacteria 75675
811 Ga0496126_0024161 3300048929 Bacteria 5871
812 Ga0496126_0031463 3300048929 Bacteria 5013
813 Ga0501031_0039040 3300049568 Bacteria 3097
814 Ga0501032_0000789 3300049569 Bacteria 25632
815 Ga0501032_0070324 3300049569 Bacteria 2334
816 Ga0501032_0091219 3300049569 Unclassified 2021
817 Ga0501033_0127944 3300049570 Unclassified 1841
818 Ga0501034_0003172 3300049571 Bacteria 18908
819 Ga0501034_0006168 3300049571 Bacteria 12923
820 Ga0501034_0008905 3300049571 Bacteria 10548
821 Ga0501034_0050586 3300049571 Bacteria 4190
822 Ga0501034_0243265 3300049571 Bacteria 1745
823 Ga0501036_0001149 3300049572 Bacteria 20161
824 Ga0501037_0004723 3300049573 Bacteria 9900
825 Ga0501038_0011400 3300049574 Bacteria 8113
826 Ga0501038_0044610 3300049574 Bacteria 3850
827 Ga0501039_0005691 3300049575 Bacteria 9441
828 Ga0501043_0011111 3300049579 Bacteria 7054
829 Ga0501043_0013354 3300049579 Bacteria 6422
830 Ga0501043_0026299 3300049579 Bacteria 4566
831 Ga0501043_0026464 3300049579 Bacteria 4550
832 Ga0501043_0087724 3300049579 Bacteria 2445
833 Ga0501046_0012945 3300049580 Bacteria 7088
834 Ga0501047_0003691 3300049581 Bacteria 14416
835 Ga0501047_0007639 3300049581 Bacteria 10181
836 Ga0501047_0010562 3300049581 Bacteria 8732
837 Ga0501047_0064339 3300049581 Bacteria 3537
838 Ga0501047_0088305 3300049581 Bacteria 2977
839 Ga0501048_0003076 3300049582 Bacteria 12717
840 Ga0501070_0090044 3300049586 Bacteria 2539
841 Ga0501070_0097839 3300049586 Bacteria 2427
842 Ga0501072_0153911 3300049588 Bacteria 1834
843 Ga0501073_0002127 3300049589 Bacteria 14843
844 Ga0501073_0010834 3300049589 Bacteria 6677
845 Ga0501074_0000268 3300049590 Bacteria 29703
846 Ga0501074_0054393 3300049590 Bacteria 2887
847 Ga0501235_006460 3300049669 Bacteria 2554
848 Ga0501257_012348 3300049686 Bacteria 1954
849 Ga0501225_0000589 3300049705 Bacteria 11341
850 Ga0501079_0028531 3300049741 Bacteria 4283
851 Ga0501080_0009651 3300049742 Bacteria 8812
852 Ga0501080_0130042 3300049742 Bacteria 2331
853 Ga0501083_0002364 3300049744 Bacteria 12916
854 Ga0501241_000384 3300049758 Bacteria 9683
855 Ga0501266_003293 3300049763 Bacteria 2009
856 Ga0501035_0006540 3300049822 Bacteria 10934
857 Ga0501035_0037819 3300049822 Bacteria 4368
858 Ga0501035_0095205 3300049822 Bacteria 2618
859 Ga0501035_0121557 3300049822 Unclassified 2282
860 Ga0501044_0006312 3300049823 Bacteria 13108
861 Ga0501044_0008384 3300049823 Bacteria 11335
862 Ga0501044_0009325 3300049823 Bacteria 10708
863 Ga0501044_0020523 3300049823 Bacteria 7056
864 Ga0501044_0037083 3300049823 Bacteria 5097
865 Ga0501044_0171853 3300049823 Bacteria 2138
866 Ga0501284_00008 3300050005 Bacteria 143517
867 nmdc:mga0k408_28094_c1 3300050493 Bacteria 3197
868 nmdc:mga0k408_67998_c1 3300050493 Bacteria 2077
869 nmdc:mga05p37_2260_c1 3300050507 Bacteria 22440
870 nmdc:mga05p37_239788_c1 3300050507 Bacteria 2181
871 nmdc:mga09592_29361_c1 3300050508 Bacteria 4574
872 nmdc:mga09592_33001_c1 3300050508 Bacteria 4319
873 nmdc:mga0qj67_49668_c1 3300050509 Bacteria 3315
874 nmdc:mga0qj67_8348_c1 3300050509 Bacteria 7679
875 nmdc:mga06r32_137630_c1 3300050510 Bacteria 2417
876 nmdc:mga06r32_25308_c1 3300050510 Bacteria 5521
877 nmdc:mga08y16_5732_c1 3300050511 Bacteria 13017
878 nmdc:mga08y16_66728_c1 3300050511 Bacteria 3755
879 Ga0500578_0000119 3300053086 Bacteria 95584
880 Ga0500644_0000279 3300053088 Bacteria 28337
881 Ga0500583_0000010 3300053092 Bacteria 160546
882 Ga0500583_0003806 3300053092 Bacteria 4821
883 Ga0500641_0000073 3300053096 Bacteria 40903
884 Ga0500641_0036900 3300053096 Bacteria 1957
885 Ga0500569_000815 3300053109 Bacteria 5503
886 Ga0500642_0005679 3300053130 Bacteria 4048
887 Ga0500658_0001824 3300053134 Bacteria 8394
888 Ga0500568_0000641 3300053139 Bacteria 25249
889 Ga0500568_0005236 3300053139 Bacteria 6742
890 Ga0500577_0000916 3300053142 Bacteria 7637
891 Ga0500588_0001353 3300053146 Bacteria 4631
892 Ga0500589_011051 3300053147 Bacteria 3890
893 Ga0500604_0023314 3300053151 Bacteria 1765
894 Ga0500616_0002914 3300053153 Bacteria 13661
895 Ga0500616_0022029 3300053153 Bacteria 3563
896 Ga0500616_0061009 3300053153 Bacteria 1954
897 Ga0500622_0000176 3300053156 Bacteria 69125
898 Ga0500622_0000488 3300053156 Bacteria 37136
899 Ga0500622_0003314 3300053156 Bacteria 10885
900 Ga0500622_0047892 3300053156 Bacteria 2206
901 Ga0500627_0003198 3300053158 Bacteria 5026
902 Ga0500633_0006823 3300053160 Bacteria 2830
903 Ga0500636_0032081 3300053177 Bacteria 3109
904 Ga0500611_000020 3300053727 Bacteria 105250
905 Ga0501082_0040431 3300060353 Bacteria 4022
906 Ga0466962_0055837 3300061719 Bacteria 1887
907 2738729013 2738541278 Bacteria 9755573
908 2819573758 2818991442 Bacteria 8318214
909 2819587877 2818991444 Bacteria 6968812
910 2819680515 2818991460 Bacteria 7595395
911 2821137092 2821136567 Bacteria 8080116
912 2840677608 2840677318 Bacteria 2664183
913 2881249428 2881247448 Bacteria 3717788
914 2881957182 2881955468 Bacteria 3545609
915 2883072988 2883068021 Bacteria 6192739
916 2884798073 2884791551 Bacteria 8511252
917 2890807106 2890804823 Bacteria 3717572
918 2896085426 2896085136 Bacteria 6129793
919 2896113612 2896109856 Bacteria 7140722
920 2904468166 2904467357 Bacteria 8057758
921 2914762852 2914759650 Bacteria 4701441
922 2919511006 2919509842 Bacteria 4104664
923 2929158096 2929154850 Bacteria 6753285
924 2929182809 2929177148 Bacteria 7883697
925 2929241373 2929239360 Bacteria 7745570
926 2929923394 2929921140 Bacteria 8649150
927 2945978763 2945977869 Bacteria 7777518
928 2946015370 2946013367 Bacteria 7766675
929 2958512782 2958512119 Bacteria 4528530
930 2965323596 2965320100 Bacteria 3975600
931 8003152795 8003151029 Bacteria 8187759
932 Ga0157370_10017466
933 SwRhRL2b_contig_1239318
934 SwRhRL2b_contig_1759593
935 JGI24740J21852_10000358
936 JGI24740J21852_10037900
937 JGI24739J22299_10000433
938 JGI24751J29686_10002215
939 JGI25154J39366_1000007
940 JGI25406J46586_10004160
941 JGI25153J46596_10001828
942 JGI25153J46596_10018062
943 rootH2_10020884
944 rootH2_10056261
945 rootH2_10100645
946 rootL2_10022865
947 rootL2_10140272
948 rootL2_10163823
949 rootH1_10005865
950 rootH1_10046794
951 rootH1_10135802
952 JGI25160J50197_1001383
953 JGI25160J50197_1003564
954 JGI25160J50197_1011746
955 JGI25160J50197_1015956
956 Ga0055535_1003112
957 Ga0055526_1011071
958 Ga0055528_1015931
959 Ga0055530_10001252
960 Ga0055531_10000020
961 Ga0055531_10031189
962 Ga0065165_1000010
963 Ga0065165_1009228
964 Ga0065714_10017635
965 Ga0065704_10070133
966 Ga0065704_10073952
967 Ga0065704_10075046
968 Ga0065712_10007993
969 Ga0065715_10093864
970 Ga0065715_10098173
971 Ga0070658_10058958
972 Ga0070658_10075475
973 Ga0070658_10179516
974 Ga0070658_10214036
975 Ga0070676_10004661
976 Ga0070683_100001844
977 Ga0070683_100003744
978 Ga0070683_100018837
979 Ga0070683_100020019
980 Ga0070690_100016948
981 Ga0070690_100032271
982 Ga0070690_100112891
983 Ga0070670_100026565
984 Ga0070670_100027222
985 Ga0070670_100038903
986 Ga0070670_100059185
987 Ga0070670_100080565
988 Ga0070670_100297706
989 Ga0068869_100002681
990 Ga0068869_100009889
991 Ga0068869_100016541
992 Ga0068869_100034075
993 Ga0068869_100084756
994 Ga0068869_100186944
995 Ga0070666_10026338
996 Ga0070666_10030778
997 Ga0070666_10095753
998 Ga0070680_100011958
999 Ga0070680_100130702
1000 Ga0070680_100163013
1001 Ga0070680_100217863
1002 Ga0070682_100000018
1003 Ga0070682_100013032
1004 Ga0070682_100072253
1005 Ga0068868_100008559
1006 Ga0068868_100063499
1007 Ga0068868_100107795
1008 Ga0070660_100001278
1009 Ga0070660_100005738
1010 Ga0070660_100041472
1011 Ga0070660_100067403
1012 Ga0070660_100072985
1013 Ga0070660_100092127
1014 Ga0070689_100035493
1015 Ga0070689_100039392
1016 Ga0070689_100088598
1017 Ga0070691_10001047
1018 Ga0070661_100018952
1019 Ga0070668_100008170
1020 Ga0070669_100017590
1021 Ga0070669_100021311
1022 Ga0070669_100074842
1023 Ga0070669_100166113
1024 Ga0070675_100007148
1025 Ga0070675_100016579
1026 Ga0070675_100323480
1027 Ga0070671_100017404
1028 Ga0070671_100100027
1029 Ga0070674_100053564
1030 Ga0070674_100145194
1031 Ga0070673_100013654
1032 Ga0070673_100034796
1033 Ga0070673_100049925
1034 Ga0070673_100062303
1035 Ga0070673_100089685
1036 Ga0070673_100177729
1037 Ga0070688_100005858
1038 Ga0070688_100007595
1039 Ga0070688_100132491
1040 Ga0070659_100002027
1041 Ga0070659_100005677
1042 Ga0070659_100010931
1043 Ga0070659_100081983
1044 Ga0070659_100167753
1045 Ga0070667_100012198
1046 Ga0070667_100012604
1047 Ga0070667_100053963
1048 Ga0070667_100103445
1049 Ga0070667_100108956
1050 Ga0070667_100112696
1051 Ga0070667_100136993
1052 Ga0070667_100156773
1053 Ga0070701_10006632
1054 Ga0070663_100089989
1055 Ga0070678_100021106
1056 Ga0070678_100061577
1057 Ga0070678_100088451
1058 Ga0070678_100208121
1059 Ga0070662_100002931
1060 Ga0070662_100004967
1061 Ga0070662_100007145
1062 Ga0070662_100009392
1063 Ga0070662_100016106
1064 Ga0070662_100111416
1065 Ga0070681_10032814
1066 Ga0070681_10065886
1067 Ga0070681_10074057
1068 Ga0068867_100059343
1069 Ga0068867_100074463
1070 Ga0070685_10024229
1071 Ga0070685_10069976
1072 Ga0070698_100003400
1073 Ga0070679_100001044
1074 Ga0070679_100004008
1075 Ga0070679_100073106
1076 Ga0070679_100157594
1077 Ga0070684_100001070
1078 Ga0070684_100012432
1079 Ga0070684_100014413
1080 Ga0070684_100055619
1081 Ga0070684_100061868
1082 Ga0070684_100120096
1083 Ga0068853_100001291
1084 Ga0068853_100006484
1085 Ga0068853_100022502
1086 Ga0068853_100044640
1087 Ga0070672_100001603
1088 Ga0070672_100214597
1089 Ga0070693_100050821
1090 Ga0070665_100000008
1091 Ga0070665_100003504
1092 Ga0070665_100109195
1093 Ga0070665_100114404
1094 Ga0070704_100025018
1095 Ga0068855_100000329
1096 Ga0068855_100000406
1097 Ga0068855_100013158
1098 Ga0068855_100013953
1099 Ga0068855_100017499
1100 Ga0068855_100056531
1101 Ga0068855_100064457
1102 Ga0068855_100108409
1103 Ga0068855_100111470
1104 Ga0068855_100143074
1105 Ga0068855_100183932
1106 Ga0070664_100008883
1107 Ga0070664_100026666
1108 Ga0070664_100031978
1109 Ga0070664_100061377
1110 Ga0070664_100067420
1111 Ga0070664_100346098
1112 Ga0068857_100004345
1113 Ga0068857_100004830
1114 Ga0068857_100015114
1115 Ga0068857_100022205
1116 Ga0068857_100080583
1117 Ga0068857_100130731
1118 Ga0068857_100132320
1119 Ga0068854_100006808
1120 Ga0068854_100022079
1121 Ga0068854_100031903
1122 Ga0068854_100073428
1123 Ga0068854_100144895
1124 Ga0068854_100208667
1125 Ga0068856_100034788
1126 Ga0068856_100035282
1127 Ga0068856_100131052
1128 Ga0070702_100046856
1129 Ga0068852_100006208
1130 Ga0068852_100008807
1131 Ga0068852_100015602
1132 Ga0068852_100020725
1133 Ga0068852_100138617
1134 Ga0068852_100175196
1135 Ga0068852_100184164
1136 Ga0068859_100000023
1137 Ga0068859_100000859
1138 Ga0068859_100020142
1139 Ga0068859_100058275
1140 Ga0068859_100134287
1141 Ga0068859_100176293
1142 Ga0068859_100187243
1143 Ga0068864_100009349
1144 Ga0068864_100056257
1145 Ga0068864_100153429
1146 Ga0068866_10017119
1147 Ga0068866_10040962
1148 Ga0068861_100047027
1149 Ga0068861_100059398
1150 Ga0068861_100256002
1151 Ga0068851_10002822
1152 Ga0068851_10053510
1153 Ga0068870_10030301
1154 Ga0068870_10041365
1155 Ga0068863_100000424
1156 Ga0068863_100065852
1157 Ga0068863_100193970
1158 Ga0068863_100306769
1159 Ga0068860_100000059
1160 Ga0068860_100001384
1161 Ga0068860_100009247
1162 Ga0068860_100011810
1163 Ga0068860_100013541
1164 Ga0068860_100015628
1165 Ga0068860_100024851
1166 Ga0068860_100029257
1167 Ga0068860_100034335
1168 Ga0068860_100063750
1169 Ga0068860_100153902
1170 Ga0068862_100004782
1171 Ga0068862_100061946
1172 Ga0081539_10001000
1173 Ga0081539_10012887
1174 Ga0070716_100103258
1175 Ga0075366_10017853
1176 Ga0075366_10091015
1177 Ga0097621_100000487
1178 Ga0097621_100028199
1179 Ga0097621_100071294
1180 Ga0097621_100078691
1181 Ga0097621_100089616
1182 Ga0097621_100114598
1183 Ga0097621_100119702
1184 Ga0097621_100259683
1185 Ga0068871_100024719
1186 Ga0068871_100097088
1187 Ga0068871_100189196
1188 Ga0075428_100006657
1189 Ga0075428_100079725
1190 Ga0075428_100102763
1191 Ga0075430_100029748
1192 Ga0075431_100032992
1193 Ga0075431_100165692
1194 Ga0075429_100006669
1195 Ga0075429_100027628
1196 Ga0068865_100008569
1197 Ga0068865_100098462
1198 Ga0068865_100211413
1199 Ga0097620_100000023
1200 Ga0097620_100000859
1201 Ga0097620_100020142
1202 Ga0097620_100058269
1203 Ga0097620_100134284
1204 Ga0097620_100176303
1205 Ga0097620_100187246
1206 Ga0105240_10000011
1207 Ga0105240_10000767
1208 Ga0105240_10002681
1209 Ga0105240_10008492
1210 Ga0105240_10009313
1211 Ga0105240_10009560
1212 Ga0105240_10016269
1213 Ga0105240_10064033
1214 Ga0105240_10182785
1215 Ga0111539_10006433
1216 Ga0111539_10022168
1217 Ga0105245_10317179
1218 Ga0105247_10024168
1219 Ga0114129_10003306
1220 Ga0114129_10182219
1221 Ga0114129_10206848
1222 Ga0105241_10000861
1223 Ga0105241_10010072
1224 Ga0105241_10018003
1225 Ga0105241_10024675
1226 Ga0105241_10133889
1227 Ga0105242_10005203
1228 Ga0105242_10027845
1229 Ga0105242_10035959
1230 Ga0105242_10066012
1231 Ga0105242_10094343
1232 Ga0105242_10257862
1233 Ga0105248_10040274
1234 Ga0105237_10000128
1235 Ga0105237_10001750
1236 Ga0105237_10006346
1237 Ga0105237_10007600
1238 Ga0105237_10007857
1239 Ga0105237_10040418
1240 Ga0105237_10112647
1241 Ga0105237_10139842
1242 Ga0105237_10143287
1243 Ga0105238_10013311
1244 Ga0105238_10023664
1245 Ga0105238_10082937
1246 Ga0105249_10002037
1247 Ga0105249_10002885
1248 Ga0105249_10008554
1249 Ga0105249_10010023
1250 Ga0105249_10019818
1251 Ga0105249_10025260
1252 Ga0105249_10119485
1253 Ga0105239_10000052
1254 Ga0105239_10000263
1255 Ga0105239_10000748
1256 Ga0105239_10002485
1257 Ga0105239_10003037
1258 Ga0105239_10016636
1259 Ga0105239_10025164
1260 Ga0105239_10103105
1261 Ga0105239_10121663
1262 Ga0105239_10129240
1263 Ga0105239_10180254
1264 Ga0105246_10000127
1265 Ga0105246_10007561
1266 Ga0105246_10099983
1267 Ga0157373_10001583
1268 Ga0157373_10004754
1269 Ga0157373_10089780
1270 Ga0157373_10135784
1271 Ga0157373_10161231
1272 Ga0157371_10000651
1273 Ga0157371_10000874
1274 Ga0157371_10002691
1275 Ga0157371_10003885
1276 Ga0157371_10012057
1277 Ga0157371_10014455
1278 Ga0157371_10015537
1279 Ga0157371_10026427
1280 Ga0157371_10031082
1281 Ga0157371_10044799
1282 Ga0157371_10053023
1283 Ga0157371_10116551
1284 Ga0157371_10153838
1285 Ga0157370_10010139
1286 Ga0157370_10019741
1287 Ga0157370_10027186
1288 Ga0157370_10032940
1289 Ga0157370_10060071
1290 Ga0157370_10067521
1291 Ga0157370_10101118
1292 Ga0157370_10103180
1293 Ga0157370_10175087
1294 Ga0157369_10016571
1295 Ga0157369_10066270
1296 Ga0157369_10124521
1297 Ga0157369_10288447
1298 Ga0157374_10000009
1299 Ga0157374_10002136
1300 Ga0157374_10017972
1301 Ga0157374_10050185
1302 Ga0157374_10050987
1303 Ga0157374_10071492
1304 Ga0157374_10152858
1305 Ga0157374_10311262
1306 Ga0157378_10003896
1307 Ga0157378_10004726
1308 Ga0157378_10005272
1309 Ga0157378_10025100
1310 Ga0157378_10025456
1311 Ga0157378_10044912
1312 Ga0157378_10175156
1313 Ga0157378_10284351
1314 Ga0163162_10000164
1315 Ga0163162_10000373
1316 Ga0163162_10000413
1317 Ga0163162_10000697
1318 Ga0163162_10000856
1319 Ga0163162_10002755
1320 Ga0163162_10007340
1321 Ga0163162_10060105
1322 Ga0163162_10141353
1323 Ga0163162_10151709
1324 Ga0163162_10222422
1325 Ga0163162_10237579
1326 Ga0163162_10253355
1327 Ga0163162_10287102
1328 Ga0157372_10000361
1329 Ga0157372_10000676
1330 Ga0157372_10004620
1331 Ga0157372_10007453
1332 Ga0157372_10016144
1333 Ga0157372_10032100
1334 Ga0157372_10041530
1335 Ga0157372_10046886
1336 Ga0157372_10050674
1337 Ga0157372_10061020
1338 Ga0157372_10143700
1339 Ga0157372_10147340
1340 Ga0157372_10155238
1341 Ga0157372_10172947
1342 Ga0157372_10256260
1343 Ga0157372_10434942
1344 Ga0157372_10465252
1345 Ga0157375_10019779
1346 Ga0157375_10129843
1347 Ga0157375_10155632
1348 Ga0157375_10169648
1349 Ga0157375_10281391
1350 Ga0163163_10000560
1351 Ga0163163_10002603
1352 Ga0163163_10012527
1353 Ga0157380_10020668
1354 Ga0157380_10035702
1355 Ga0157380_10068775
1356 Ga0157380_10098766
1357 Ga0157380_10126642
1358 Ga0157380_10190663
1359 Ga0157377_10004008
1360 Ga0157377_10030917
1361 Ga0157377_10034815
1362 Ga0157377_10035061
1363 Ga0157377_10073216
1364 Ga0157377_10147612
1365 Ga0157379_10016875
1366 Ga0157379_10034273
1367 Ga0157379_10048438
1368 Ga0157379_10149386
1369 Ga0157376_10002437
1370 Ga0157376_10003607
1371 Ga0157376_10007147
1372 Ga0157376_10065638
1373 Ga0157376_10113436
1374 Ga0157376_10179106
1375 Ga0182005_1000215
1376 Ga0163161_10001190
1377 Ga0163161_10006822
1378 Ga0163161_10030521
1379 Ga0163161_10042807
1380 Ga0163161_10108419
1381 Ga0209436_110381
1382 Ga0209258_102250
1383 Ga0209646_1000002
1384 Ga0209646_1002397
1385 Ga0209026_1000545
1386 Ga0209148_1000283
1387 Ga0209673_1000082
1388 Ga0209130_1004066
1389 Ga0209564_1002231
1390 Ga0209758_1015206
1391 Ga0209758_1039797
1392 Ga0209050_1000389
1393 Ga0207426_1000040
1394 Ga0207426_1000341
1395 Ga0207426_1000951
1396 Ga0207426_1002430
1397 Ga0207426_1040618
1398 Ga0209257_1000001
1399 Ga0209257_1003759
1400 Ga0207697_10081107
1401 Ga0207656_10039892
1402 Ga0207682_10013516
1403 Ga0207642_10012939
1404 Ga0207710_10002430
1405 Ga0207710_10034808
1406 Ga0207680_10107618
1407 Ga0207647_10000139
1408 Ga0207647_10000485
1409 Ga0207647_10016694
1410 Ga0207647_10038075
1411 Ga0207647_10077222
1412 Ga0207647_10083236
1413 Ga0207645_10000093
1414 Ga0207645_10008549
1415 Ga0207645_10045019
1416 Ga0207643_10003399
1417 Ga0207705_10007859
1418 Ga0207705_10014478
1419 Ga0207705_10097990
1420 Ga0207705_10100159
1421 Ga0207654_10009898
1422 Ga0207654_10014620
1423 Ga0207654_10020576
1424 Ga0207707_10003165
1425 Ga0207707_10084908
1426 Ga0207707_10173295
1427 Ga0207707_10219642
1428 Ga0207695_10000010
1429 Ga0207695_10000051
1430 Ga0207695_10000056
1431 Ga0207695_10000081
1432 Ga0207695_10000425
1433 Ga0207695_10000446
1434 Ga0207695_10000873
1435 Ga0207695_10011272
1436 Ga0207695_10013688
1437 Ga0207695_10025625
1438 Ga0207695_10147130
1439 Ga0207671_10000150
1440 Ga0207671_10001329
1441 Ga0207671_10001864
1442 Ga0207671_10007560
1443 Ga0207671_10007853
1444 Ga0207671_10033040
1445 Ga0207671_10068398
1446 Ga0207671_10085591
1447 Ga0207660_10023446
1448 Ga0207660_10034825
1449 Ga0207660_10097456
1450 Ga0207660_10141570
1451 Ga0207662_10004373
1452 Ga0207657_10002529
1453 Ga0207657_10008447
1454 Ga0207657_10021296
1455 Ga0207657_10025251
1456 Ga0207657_10106366
1457 Ga0207657_10125502
1458 Ga0207657_10233751
1459 Ga0207649_10037474
1460 Ga0207649_10090252
1461 Ga0207652_10000051
1462 Ga0207652_10000770
1463 Ga0207652_10014831
1464 Ga0207652_10031057
1465 Ga0207652_10170711
1466 Ga0207652_10253698
1467 Ga0207681_10046890
1468 Ga0207681_10150737
1469 Ga0207681_10204681
1470 Ga0207650_10011838
1471 Ga0207650_10132943
1472 Ga0207650_10150314
1473 Ga0207650_10168551
1474 Ga0207659_10027614
1475 Ga0207659_10033230
1476 Ga0207659_10035683
1477 Ga0207659_10058149
1478 Ga0207644_10039114
1479 Ga0207690_10043628
1480 Ga0207706_10002738
1481 Ga0207706_10006740
1482 Ga0207706_10131229
1483 Ga0207686_10002397
1484 Ga0207686_10077169
1485 Ga0207686_10106606
1486 Ga0207670_10061498
1487 Ga0207670_10099288
1488 Ga0207670_10170353
1489 Ga0207669_10029661
1490 Ga0207691_10000426
1491 Ga0207691_10003790
1492 Ga0207691_10007792
1493 Ga0207691_10024512
1494 Ga0207691_10060213
1495 Ga0207689_10005494
1496 Ga0207689_10006819
1497 Ga0207689_10008379
1498 Ga0207689_10009613
1499 Ga0207689_10012042
1500 Ga0207689_10012253
1501 Ga0207689_10031011
1502 Ga0207689_10033385
1503 Ga0207689_10132984
1504 Ga0207661_10000433
1505 Ga0207661_10002197
1506 Ga0207661_10009778
1507 Ga0207661_10020079
1508 Ga0207661_10023880
1509 Ga0207661_10055866
1510 Ga0207679_10013842
1511 Ga0207679_10077602
1512 Ga0207667_10000324
1513 Ga0207667_10001491
1514 Ga0207667_10004916
1515 Ga0207667_10020765
1516 Ga0207667_10026416
1517 Ga0207667_10040176
1518 Ga0207667_10064453
1519 Ga0207667_10117410
1520 Ga0207667_10142548
1521 Ga0207667_10177385
1522 Ga0207651_10019691
1523 Ga0207651_10160551
1524 Ga0207651_10223247
1525 Ga0207712_10001684
1526 Ga0207712_10016183
1527 Ga0207712_10026360
1528 Ga0207712_10115538
1529 Ga0207668_10001372
1530 Ga0207668_10090396
1531 Ga0207640_10069448
1532 Ga0207640_10146916
1533 Ga0207658_10080361
1534 Ga0207658_10082255
1535 Ga0207677_10017319
1536 Ga0207677_10143755
1537 Ga0207677_10197704
1538 Ga0207677_10256903
1539 Ga0207703_10008491
1540 Ga0207639_10009587
1541 Ga0207639_10015801
1542 Ga0207639_10021022
1543 Ga0207639_10041256
1544 Ga0207639_10049836
1545 Ga0207639_10068456
1546 Ga0207639_10075282
1547 Ga0207639_10129745
1548 Ga0207639_10214078
1549 Ga0207639_10236119
1550 Ga0207678_10040611
1551 Ga0207702_10038469
1552 Ga0207702_10043851
1553 Ga0207702_10086312
1554 Ga0207641_10000250
1555 Ga0207641_10003419
1556 Ga0207641_10003961
1557 Ga0207641_10111397
1558 Ga0207648_10004739
1559 Ga0207648_10010083
1560 Ga0207648_10022313
1561 Ga0207648_10025344
1562 Ga0207648_10037061
1563 Ga0207648_10044331
1564 Ga0207648_10066688
1565 Ga0207648_10107713
1566 Ga0207676_10013866
1567 Ga0207676_10024842
1568 Ga0207676_10028937
1569 Ga0207676_10030918
1570 Ga0207676_10050380
1571 Ga0207676_10099684
1572 Ga0207674_10004594
1573 Ga0207674_10008341
1574 Ga0207674_10030768
1575 Ga0207674_10033858
1576 Ga0207674_10123089
1577 Ga0207674_10250770
1578 Ga0207675_100000599
1579 Ga0207675_100008087
1580 Ga0207675_100040059
1581 Ga0207675_100040594
1582 Ga0207675_100429898
1583 Ga0207683_10011150
1584 Ga0207683_10037056
1585 Ga0207683_10081531
1586 Ga0207683_10112392
1587 Ga0207683_10133738
1588 Ga0207683_10305745
1589 Ga0207683_10313671
1590 Ga0207698_10002595
1591 Ga0207698_10084196
1592 Ga0207698_10127667
1593 Ga0207698_10175597
1594 Ga0207428_10101572
1595 Ga0268266_10000016
1596 Ga0268266_10007816
1597 Ga0268266_10214932
1598 Ga0268265_10042632
1599 Ga0268265_10260802
1600 Ga0268264_10000015
1601 Ga0268264_10001580
1602 Ga0268264_10003253
1603 Ga0268264_10003762
1604 Ga0268264_10023117
1605 Ga0268264_10027215
1606 Ga0268264_10027753
1607 Ga0268264_10049065
1608 Ga0268264_10139530
1609 Ga0307517_10015597
1610 Ga0307515_10000010
1611 Ga0307515_10000057
1612 Ga0265338_10079195
1613 Ga0265324_10023935
1614 Ga0307511_10000024
1615 Ga0265330_10000013
1616 Ga0265332_10000019
1617 Ga0265328_10004579
1618 Ga0265320_10008899
1619 Ga0265325_10008789
1620 Ga0265329_10004580
1621 Ga0265339_10023126
1622 Ga0265327_10000006
1623 Ga0265327_10000046
1624 Ga0265327_10000239
1625 Ga0265327_10000618
1626 Ga0265327_10000726
1627 Ga0265327_10031497
1628 Ga0265316_10000111
1629 Ga0307509_10102308
1630 Ga0307509_10290150
1631 Ga0307508_10001247
1632 Ga0265314_10000004
1633 Ga0265342_10000017
1634 Ga0307516_10002738
1635 Ga0307516_10052934
1636 Ga0307516_10221684
1637 Ga0307405_10000001
1638 Ga0307406_10017842
1639 Ga0307414_10072314
1640 Ga0307510_10000042
1641 Ga0373923_0036518
1642 Ga0373935_0178506
1643 Ga0373927_0019498
1644 Ga0373937_0002128
1645 Ga0395899_0011662
1646 Ga0395899_0035366
1647 Ga0395899_0039531
1648 Ga0395899_0047757
1649 Ga0395899_0110395
1650 Ga0395900_0010950
1651 Ga0395900_0011050
1652 Ga0395900_0165276
1653 Ga0395900_0391710
1654 Ga0395898_0001697
1655 Ga0395898_0045358
1656 Ga0395898_0053988
1657 Ga0395898_0132518
1658 Ga0395905_0019301
1659 Ga0395905_0065228
1660 Ga0395905_0116178
1661 Ga0395905_0242968
1662 Ga0395905_0277475
1663 Ga0395901_0079052
1664 Ga0395901_0086677
1665 Ga0395901_0088589
1666 Ga0436365_1889064
1667 Ga0436365_1892627
1668 Ga0439436_0001903
1669 Ga0439439_0013021
1670 Ga0439441_005992
1671 Ga0439442_005454
1672 Ga0450923_009304
1673 Ga0451577_0015486
1674 Ga0451577_0273802
1675 Ga0466969_0000132
1676 Ga0466969_0035045
1677 Ga0466972_0000095
1678 Ga0466972_0000205
1679 Ga0466972_0000946
1680 Ga0466966_0000239
1681 Ga0466961_0016781
1682 Ga0466964_0019963
1683 Ga0453684_0021683
1684 Ga0453684_0023757
1685 Ga0453684_0024881
1686 Ga0453684_0027420
1687 Ga0453684_0030202
1688 Ga0453684_0041437
1689 Ga0453684_0136521
1690 Ga0466968_0009777
1691 Ga0466968_0035392
1692 Ga0466970_0000529
1693 Ga0466970_0108824
1694 Ga0466957_0007324
1695 Ga0466957_0010280
1696 Ga0466957_0043397
1697 Ga0466959_0000031
1698 Ga0466959_0000501
1699 Ga0466959_0057953
1700 Ga0451576_0082567
1701 Ga0495638_0044936
1702 Ga0495638_0071636
1703 Ga0495653_0064989
1704 Ga0495650_0022359
1705 Ga0495582_0126018
1706 Ga0495607_0143172
1707 Ga0495606_0040930
1708 Ga0495606_0069818
1709 Ga0495608_0085406
1710 Ga0495618_0094930
1711 Ga0495643_0000392
1712 Ga0495648_0002775
1713 Ga0495587_0082808
1714 Ga0495598_0035309
1715 Ga0495633_0000090
1716 Ga0495668_0000138
1717 Ga0495668_0000268
1718 Ga0495668_0002233
1719 Ga0495611_0000086
1720 Ga0495625_0044931
1721 Ga0495635_0071624
1722 Ga0495623_0076293
1723 Ga0495658_0048030
1724 Ga0495613_0099140
1725 Ga0495649_0063746
1726 Ga0495636_0000082
1727 Ga0495674_0014078
1728 Ga0495672_0022692
1729 Ga0495672_0035473
1730 Ga0495687_000004
1731 Ga0495684_0104665
1732 Ga0495686_0000128
1733 Ga0495686_0002851
1734 Ga0495686_0051739
1735 Ga0495686_0143147
1736 Ga0495602_0240779
1737 Ga0496114_0002926
1738 Ga0496114_0045155
1739 Ga0496115_0037645
1740 Ga0496121_0000020
1741 Ga0496125_0000443
1742 Ga0496126_0024161
1743 Ga0496126_0031463
1744 Ga0501031_0039040
1745 Ga0501032_0000789
1746 Ga0501032_0070324
1747 Ga0501032_0091219
1748 Ga0501033_0127944
1749 Ga0501034_0003172
1750 Ga0501034_0006168
1751 Ga0501034_0008905
1752 Ga0501034_0050586
1753 Ga0501034_0243265
1754 Ga0501036_0001149
1755 Ga0501037_0004723
1756 Ga0501038_0011400
1757 Ga0501038_0044610
1758 Ga0501039_0005691
1759 Ga0501043_0011111
1760 Ga0501043_0013354
1761 Ga0501043_0026299
1762 Ga0501043_0026464
1763 Ga0501043_0087724
1764 Ga0501046_0012945
1765 Ga0501047_0003691
1766 Ga0501047_0007639
1767 Ga0501047_0010562
1768 Ga0501047_0064339
1769 Ga0501047_0088305
1770 Ga0501048_0003076
1771 Ga0501070_0090044
1772 Ga0501070_0097839
1773 Ga0501072_0153911
1774 Ga0501073_0002127
1775 Ga0501073_0010834
1776 Ga0501074_0000268
1777 Ga0501074_0054393
1778 Ga0501235_006460
1779 Ga0501257_012348
1780 Ga0501225_0000589
1781 Ga0501079_0028531
1782 Ga0501080_0009651
1783 Ga0501080_0130042
1784 Ga0501083_0002364
1785 Ga0501241_000384
1786 Ga0501266_003293
1787 Ga0501035_0006540
1788 Ga0501035_0037819
1789 Ga0501035_0095205
1790 Ga0501035_0121557
1791 Ga0501044_0006312
1792 Ga0501044_0008384
1793 Ga0501044_0009325
1794 Ga0501044_0020523
1795 Ga0501044_0037083
1796 Ga0501044_0171853
1797 Ga0501284_00008
1798 nmdc:mga0k408_28094_c1
1799 nmdc:mga0k408_67998_c1
1800 nmdc:mga05p37_2260_c1
1801 nmdc:mga05p37_239788_c1
1802 nmdc:mga09592_29361_c1
1803 nmdc:mga09592_33001_c1
1804 nmdc:mga0qj67_49668_c1
1805 nmdc:mga0qj67_8348_c1
1806 nmdc:mga06r32_137630_c1
1807 nmdc:mga06r32_25308_c1
1808 nmdc:mga08y16_5732_c1
1809 nmdc:mga08y16_66728_c1
1810 Ga0500578_0000119
1811 Ga0500644_0000279
1812 Ga0500583_0000010
1813 Ga0500583_0003806
1814 Ga0500641_0000073
1815 Ga0500641_0036900
1816 Ga0500569_000815
1817 Ga0500642_0005679
1818 Ga0500658_0001824
1819 Ga0500568_0000641
1820 Ga0500568_0005236
1821 Ga0500577_0000916
1822 Ga0500588_0001353
1823 Ga0500589_011051
1824 Ga0500604_0023314
1825 Ga0500616_0002914
1826 Ga0500616_0022029
1827 Ga0500616_0061009
1828 Ga0500622_0000176
1829 Ga0500622_0000488
1830 Ga0500622_0003314
1831 Ga0500622_0047892
1832 Ga0500627_0003198
1833 Ga0500633_0006823
1834 Ga0500636_0032081
1835 Ga0500611_000020
1836 Ga0501082_0040431
1837 Ga0466962_0055837
1838 2738729013
1839 2819573758
1840 2819587877
1841 2819680515
1842 2821137092
1843 2840677608
1844 2881249428
1845 2881957182
1846 2883072988
1847 2884798073
1848 2890807106
1849 2896085426
1850 2896113612
1851 2904468166
1852 2914762852
1853 2919511006
1854 2929158096
1855 2929182809
1856 2929241373
1857 2929923394
1858 2945978763
1859 2946015370
1860 2958512782
1861 2965323596
1862 8003152795

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00742

Homoserine_dh

Homoserine dehydrogenase

164

343

0.99

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

46

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a0r-assembly1.cif.gz_A-2 homoserine dehydrogenase from thermus thermophilus hb8 unliganded form 0.9168 6 316
5xdf-assembly1.cif.gz_A homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse 0.9088 6 316
6dzs-assembly1.cif.gz_B mycobacterial homoserine dehydrogenase thra in complex with nadp 0.8735 4 395
6dzs-assembly2.cif.gz_C mycobacterial homoserine dehydrogenase thra in complex with nadp 0.8705 4 395
6dzs-assembly2.cif.gz_D mycobacterial homoserine dehydrogenase thra in complex with nadp 0.867 4 395
ID Description Score Start End Superfamily
af_Q2FYV4_151_297_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9609 145 290 3.30.360.10
af_P9WPX1_139_304_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9456 130 290 3.30.360.10
af_Q2FYV4_151_297_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.942 145 290 3.30.360.10
3mtjA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9387 129 290 3.30.360.10
6dzsB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9332 4 128 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A136P9J0-F1-model_v4 Homoserine dehydrogenase 0.98 4 112 GO:0004412
GO:0009088
GO:0050661
AF-A0A4Q3RPB9-F1-model_v4 Homoserine dehydrogenase (EC 1.1.1.3) 0.9754 2 310 GO:0004412
GO:0009086
GO:0009088
GO:0050661
AF-A0A2B7ZTL4-F1-model_v4 Homoserine dehydrogenase (EC 1.1.1.3) 0.9733 3 331 GO:0004412
GO:0009086
GO:0009088
GO:0050661
AF-A0A519W233-F1-model_v4 Homoserine dehydrogenase 0.9732 1 139 GO:0004412
GO:0009088
GO:0050661
AF-A0A1W1VSI3-F1-model_v4 Homoserine dehydrogenase (EC 1.1.1.3) 0.9693 4 323 GO:0004412
GO:0009086
GO:0009088
GO:0050661

Map