F486050

General Info

Members Datasets Scaffolds Average Seq Length
931 275 931 235

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0142022|Ga0496115_0142022_497_1321
Length 274
Sequence MRTAKTTAILREFMGCSFAQNGIAVDDRPSIFYDTIKGGIMNLTTAVALVTGGTAGIGRSIAKTLVESGARVAITGRDKARLEETAQTLGVFPIHADVSNEVDVIRSYREVLAKFGDLDILVNNAGVGVFKSLVDMDRASFDNVFATNVTGAMLMGREAARHFIKRNRGAIINIASTAGLRGAANGTAYYASKFALRGMTECWRAELRKYNIRVMLVNPSEVITNFAASAGITQKANETKLRGEEIAYAVKAILEMDDRGFTPELTIFATNPID

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
173 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
198 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
201 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 1.18
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10150567 3300005295 Bacteria 1663
2 Ga0070658_10187959 3300005327 Bacteria 1740
3 Ga0070676_10217763 3300005328 Bacteria 1260
4 Ga0070683_100098299 3300005329 Bacteria 2754
5 Ga0070690_100032320 3300005330 Bacteria 3267
6 Ga0070670_100007834 3300005331 Bacteria 9089
7 Ga0070670_100010330 3300005331 Bacteria 7968
8 Ga0070670_100308850 3300005331 Bacteria 1384
9 Ga0070677_10059985 3300005333 Bacteria 1566
10 Ga0068869_100002089 3300005334 Bacteria 12012
11 Ga0068869_100058052 3300005334 Bacteria 2828
12 Ga0068869_100096635 3300005334 Bacteria 2230
13 Ga0068869_100408070 3300005334 Unclassified 1119
14 Ga0068869_100706225 3300005334 Unclassified 860
15 Ga0070666_10001137 3300005335 Bacteria 16197
16 Ga0070666_10039637 3300005335 Bacteria 3141
17 Ga0070666_10046062 3300005335 Bacteria 2924
18 Ga0070666_10167662 3300005335 Bacteria 1537
19 Ga0070666_10257688 3300005335 Bacteria 1236
20 Ga0070680_100013946 3300005336 Bacteria 6272
21 Ga0068868_100005508 3300005338 Bacteria 8903
22 Ga0068868_100006505 3300005338 Bacteria 8272
23 Ga0068868_100047539 3300005338 Bacteria 3364
24 Ga0068868_100145886 3300005338 Bacteria 1946
25 Ga0068868_100158663 3300005338 Bacteria 1867
26 Ga0068868_100206923 3300005338 Bacteria 1638
27 Ga0068868_100309782 3300005338 Unclassified 1343
28 Ga0068868_100443529 3300005338 Bacteria 1128
29 Ga0070660_100024608 3300005339 Bacteria 4466
30 Ga0070660_100120887 3300005339 Bacteria 2090
31 Ga0070660_100151657 3300005339 Unclassified 1864
32 Ga0070689_100043304 3300005340 Bacteria 3459
33 Ga0070689_100046856 3300005340 Bacteria 3332
34 Ga0070689_100223763 3300005340 Bacteria 1544
35 Ga0070691_10013126 3300005341 Bacteria 3795
36 Ga0070661_100110285 3300005344 Bacteria 2054
37 Ga0070661_100269976 3300005344 Bacteria 1317
38 Ga0070692_10062155 3300005345 Bacteria 1970
39 Ga0070669_100033005 3300005353 Bacteria 3742
40 Ga0070669_100162159 3300005353 Bacteria 1738
41 Ga0070675_100000819 3300005354 Bacteria 21941
42 Ga0070675_100004909 3300005354 Bacteria 10201
43 Ga0070675_100005091 3300005354 Bacteria 10027
44 Ga0070675_100129004 3300005354 Bacteria 2153
45 Ga0070675_100211505 3300005354 Unclassified 1686
46 Ga0070671_100016426 3300005355 Bacteria 5985
47 Ga0070671_100044390 3300005355 Bacteria 3694
48 Ga0070671_100046964 3300005355 Bacteria 3591
49 Ga0070671_100071980 3300005355 Bacteria 2886
50 Ga0070671_100072762 3300005355 Unclassified 2871
51 Ga0070671_100332130 3300005355 Bacteria 1296
52 Ga0070671_100351943 3300005355 Bacteria 1257
53 Ga0070674_100081645 3300005356 Bacteria 2311
54 Ga0070674_100145780 3300005356 Bacteria 1782
55 Ga0070674_100187972 3300005356 Bacteria 1587
56 Ga0070674_100763458 3300005356 Bacteria 832
57 Ga0070673_100023649 3300005364 Bacteria 4492
58 Ga0070673_100066805 3300005364 Bacteria 2874
59 Ga0070673_100201593 3300005364 Bacteria 1714
60 Ga0070673_100246687 3300005364 Bacteria 1555
61 Ga0070673_100323817 3300005364 Bacteria 1362
62 Ga0070688_100229994 3300005365 Archaea 1311
63 Ga0070688_100443521 3300005365 Bacteria 969
64 Ga0070688_100466105 3300005365 Bacteria 947
65 Ga0070659_100043757 3300005366 Unclassified 3503
66 Ga0070659_100184786 3300005366 Bacteria 1711
67 Ga0070667_100072696 3300005367 Bacteria 2931
68 Ga0070667_100082239 3300005367 Bacteria 2757
69 Ga0070667_100082948 3300005367 Bacteria 2745
70 Ga0070667_100163950 3300005367 Bacteria 1959
71 Ga0070667_100560439 3300005367 Bacteria 1051
72 Ga0070713_100011378 3300005436 Bacteria 6479
73 Ga0070713_100025278 3300005436 Bacteria 4640
74 Ga0070713_100181065 3300005436 Bacteria 1894
75 Ga0070713_100724831 3300005436 Bacteria 950
76 Ga0070713_100808371 3300005436 Bacteria 899
77 Ga0070710_10339695 3300005437 Bacteria 991
78 Ga0070701_10049956 3300005438 Bacteria 2164
79 Ga0070711_100069704 3300005439 Bacteria 2474
80 Ga0070711_100514942 3300005439 Bacteria 988
81 Ga0070705_100305830 3300005440 Bacteria 1141
82 Ga0070700_100001632 3300005441 Bacteria 11208
83 Ga0070694_100065444 3300005444 Bacteria 2490
84 Ga0070694_100083783 3300005444 Bacteria 2223
85 Ga0070694_100387784 3300005444 Bacteria 1091
86 Ga0070663_100087079 3300005455 Bacteria 2308
87 Ga0070678_100273146 3300005456 Bacteria 1426
88 Ga0070662_100022723 3300005457 Bacteria 4297
89 Ga0070662_100101600 3300005457 Bacteria 2177
90 Ga0070662_100231891 3300005457 Bacteria 1477
91 Ga0070681_10072278 3300005458 Bacteria 3412
92 Ga0070681_10093516 3300005458 Bacteria 2955
93 Ga0070681_10379789 3300005458 Bacteria 1324
94 Ga0068867_100021545 3300005459 Bacteria 4599
95 Ga0068867_100033466 3300005459 Bacteria 3722
96 Ga0068867_100085376 3300005459 Bacteria 2386
97 Ga0068867_100325983 3300005459 Bacteria 1274
98 Ga0070685_10536405 3300005466 Bacteria 833
99 Ga0070706_100004393 3300005467 Bacteria 13616
100 Ga0070706_100077523 3300005467 Bacteria 3076
101 Ga0070707_100003828 3300005468 Bacteria 14183
102 Ga0070707_100203689 3300005468 Bacteria 1929
103 Ga0070698_100014652 3300005471 Bacteria 8285
104 Ga0070698_100108751 3300005471 Bacteria 2739
105 Ga0070698_100357158 3300005471 Bacteria 1393
106 Ga0070699_100000875 3300005518 Bacteria 28029
107 Ga0070684_100007408 3300005535 Bacteria 8527
108 Ga0070684_100007644 3300005535 Bacteria 8427
109 Ga0070684_100042326 3300005535 Unclassified 3931
110 Ga0070684_100838806 3300005535 Bacteria 860
111 Ga0068853_100101024 3300005539 Unclassified 2550
112 Ga0068853_100150560 3300005539 Bacteria 2094
113 Ga0068853_100363828 3300005539 Bacteria 1348
114 Ga0068853_100738297 3300005539 Unclassified 940
115 Ga0070672_100001694 3300005543 Bacteria 13762
116 Ga0070672_100082506 3300005543 Bacteria 2579
117 Ga0070672_100126706 3300005543 Bacteria 2095
118 Ga0070686_100044340 3300005544 Bacteria 2795
119 Ga0070686_100098881 3300005544 Unclassified 1967
120 Ga0070686_100110702 3300005544 Bacteria 1870
121 Ga0070695_100081632 3300005545 Bacteria 2140
122 Ga0070696_100088620 3300005546 Bacteria 2200
123 Ga0070665_100004087 3300005548 Bacteria 15342
124 Ga0070665_100153131 3300005548 Bacteria 2308
125 Ga0070665_100499736 3300005548 Unclassified 1227
126 Ga0070665_100583453 3300005548 Bacteria 1131
127 Ga0070704_100003332 3300005549 Bacteria 9195
128 Ga0070704_100105274 3300005549 Bacteria 2135
129 Ga0070704_100511939 3300005549 Bacteria 1043
130 Ga0070704_100825013 3300005549 Bacteria 830
131 Ga0068855_100001557 3300005563 Bacteria 28824
132 Ga0068855_100009822 3300005563 Bacteria 11545
133 Ga0068855_100014867 3300005563 Bacteria 9374
134 Ga0068855_100047694 3300005563 Bacteria 5060
135 Ga0068855_100152601 3300005563 Bacteria 2626
136 Ga0068855_100213834 3300005563 Bacteria 2165
137 Ga0068855_100776972 3300005563 Bacteria 1019
138 Ga0068855_101000435 3300005563 Unclassified 878
139 Ga0070664_100007205 3300005564 Bacteria 8971
140 Ga0070664_100007317 3300005564 Bacteria 8903
141 Ga0070664_100148442 3300005564 Bacteria 2069
142 Ga0070664_100315645 3300005564 Bacteria 1415
143 Ga0070664_100644939 3300005564 Bacteria 984
144 Ga0068857_100011025 3300005577 Bacteria 7869
145 Ga0068857_100095755 3300005577 Bacteria 2660
146 Ga0068857_100140302 3300005577 Bacteria 2184
147 Ga0068857_100143645 3300005577 Bacteria 2158
148 Ga0068854_100021040 3300005578 Unclassified 4423
149 Ga0068856_100003142 3300005614 Bacteria 16839
150 Ga0068856_100006380 3300005614 Bacteria 11569
151 Ga0068856_100066042 3300005614 Unclassified 3575
152 Ga0068856_100129805 3300005614 Unclassified 2525
153 Ga0068856_100163931 3300005614 Bacteria 2234
154 Ga0068856_100405723 3300005614 Bacteria 1382
155 Ga0068856_100466278 3300005614 Eukaryota 1284
156 Ga0068852_100032351 3300005616 Unclassified 4330
157 Ga0068852_100180611 3300005616 Bacteria 1984
158 Ga0068852_100210805 3300005616 Bacteria 1843
159 Ga0068852_100903455 3300005616 Bacteria 900
160 Ga0068859_100001734 3300005617 Bacteria 22220
161 Ga0068859_100004423 3300005617 Bacteria 14339
162 Ga0068859_100431213 3300005617 Bacteria 1415
163 Ga0068859_100768319 3300005617 Bacteria 1052
164 Ga0068864_100003613 3300005618 Bacteria 12788
165 Ga0068864_100263442 3300005618 Bacteria 1604
166 Ga0068866_10010753 3300005718 Bacteria 3934
167 Ga0068866_10232944 3300005718 Bacteria 1118
168 Ga0068866_10456362 3300005718 Bacteria 837
169 Ga0068861_100025559 3300005719 Bacteria 4284
170 Ga0068861_100051526 3300005719 Bacteria 3125
171 Ga0068861_100110659 3300005719 Bacteria 2200
172 Ga0068861_100153647 3300005719 Bacteria 1891
173 Ga0068861_100204700 3300005719 Bacteria 1659
174 Ga0068861_100453585 3300005719 Bacteria 1149
175 Ga0068861_100725587 3300005719 Bacteria 926
176 Ga0068851_10332069 3300005834 Unclassified 881
177 Ga0068870_10201428 3300005840 Bacteria 1207
178 Ga0068863_100053375 3300005841 Archaea 3831
179 Ga0068863_100066682 3300005841 Unclassified 3405
180 Ga0068863_100114859 3300005841 Bacteria 2565
181 Ga0068863_100171821 3300005841 Unclassified 2079
182 Ga0068863_100198611 3300005841 Bacteria 1928
183 Ga0068863_100342225 3300005841 Bacteria 1455
184 Ga0068863_100475219 3300005841 Bacteria 1228
185 Ga0068858_100007279 3300005842 Bacteria 10723
186 Ga0068858_100012093 3300005842 Bacteria 8136
187 Ga0068858_100015353 3300005842 Bacteria 7202
188 Ga0068858_100023284 3300005842 Bacteria 5771
189 Ga0068858_100032999 3300005842 Bacteria 4808
190 Ga0068858_100170495 3300005842 Bacteria 2052
191 Ga0068860_100017221 3300005843 Bacteria 7043
192 Ga0068860_100031737 3300005843 Bacteria 5079
193 Ga0068860_100273388 3300005843 Bacteria 1649
194 Ga0068860_100282331 3300005843 Bacteria 1623
195 Ga0068860_100297603 3300005843 Bacteria 1580
196 Ga0068860_100376983 3300005843 Bacteria 1400
197 Ga0068860_100476081 3300005843 Bacteria 1244
198 Ga0068862_100154944 3300005844 Bacteria 2042
199 Ga0068862_100259555 3300005844 Bacteria 1586
200 Ga0068862_100327219 3300005844 Bacteria 1416
201 Ga0070717_10015510 3300006028 Bacteria 5888
202 Ga0070717_10321859 3300006028 Unclassified 1378
203 Ga0070712_100032433 3300006175 Bacteria 3528
204 Ga0097621_100005568 3300006237 Bacteria 8881
205 Ga0097621_100006771 3300006237 Bacteria 8138
206 Ga0097621_100007326 3300006237 Bacteria 7886
207 Ga0097621_100011511 3300006237 Bacteria 6518
208 Ga0097621_100047814 3300006237 Bacteria 3467
209 Ga0097621_100062808 3300006237 Bacteria 3050
210 Ga0097621_100118314 3300006237 Bacteria 2245
211 Ga0097621_100409269 3300006237 Bacteria 1215
212 Ga0068871_100005892 3300006358 Bacteria 8617
213 Ga0068871_100013531 3300006358 Bacteria 6056
214 Ga0068871_100016427 3300006358 Bacteria 5574
215 Ga0068871_100018946 3300006358 Bacteria 5246
216 Ga0068871_100023980 3300006358 Unclassified 4727
217 Ga0068871_100043261 3300006358 Bacteria 3618
218 Ga0068871_100054353 3300006358 Bacteria 3249
219 Ga0068871_100099886 3300006358 Unclassified 2430
220 Ga0068871_100152043 3300006358 Unclassified 1974
221 Ga0068871_100194424 3300006358 Bacteria 1749
222 Ga0068871_100231568 3300006358 Bacteria 1603
223 Ga0068871_100247047 3300006358 Bacteria 1553
224 Ga0068871_100575110 3300006358 Bacteria 1022
225 Ga0068871_100681286 3300006358 Bacteria 941
226 Ga0075428_100000019 3300006844 Bacteria 137803
227 Ga0075428_100006790 3300006844 Bacteria 12736
228 Ga0075428_100009289 3300006844 Bacteria 10901
229 Ga0075428_100023052 3300006844 Bacteria 6889
230 Ga0075428_100799367 3300006844 Bacteria 1003
231 Ga0075430_100034914 3300006846 Bacteria 4269
232 Ga0075430_100113743 3300006846 Bacteria 2256
233 Ga0075430_100173636 3300006846 Bacteria 1793
234 Ga0075431_100000914 3300006847 Bacteria 26009
235 Ga0075431_100023001 3300006847 Bacteria 6370
236 Ga0075431_100040152 3300006847 Bacteria 4822
237 Ga0075431_100088438 3300006847 Unclassified 3197
238 Ga0075431_100169520 3300006847 Bacteria 2243
239 Ga0075433_10021120 3300006852 Bacteria 5456
240 Ga0075433_10080599 3300006852 Bacteria 2870
241 Ga0075433_10311480 3300006852 Unclassified 1393
242 Ga0075434_100031003 3300006871 Bacteria 5270
243 Ga0075434_100086245 3300006871 Unclassified 3139
244 Ga0075429_100012100 3300006880 Bacteria 7478
245 Ga0075429_100076018 3300006880 Bacteria 2925
246 Ga0075429_100482109 3300006880 Bacteria 1087
247 Ga0068865_100008234 3300006881 Bacteria 6436
248 Ga0068865_100011766 3300006881 Bacteria 5482
249 Ga0068865_100060820 3300006881 Bacteria 2645
250 Ga0068865_100460680 3300006881 Bacteria 1053
251 Ga0097620_100001734 3300006931 Bacteria 22220
252 Ga0097620_100004423 3300006931 Bacteria 14339
253 Ga0097620_100431247 3300006931 Bacteria 1415
254 Ga0097620_100768304 3300006931 Bacteria 1052
255 Ga0075435_100554134 3300007076 Bacteria 996
256 Ga0099794_10030342 3300007265 Bacteria 2524
257 Ga0099795_10154082 3300007788 Bacteria 943
258 Ga0105240_10001330 3300009093 Bacteria 42531
259 Ga0105240_10005789 3300009093 Bacteria 18334
260 Ga0105240_10008052 3300009093 Bacteria 15167
261 Ga0105240_10025249 3300009093 Bacteria 7812
262 Ga0105240_10254118 3300009093 Bacteria 2031
263 Ga0105240_10454277 3300009093 Bacteria 1433
264 Ga0105240_10511859 3300009093 Bacteria 1333
265 Ga0105240_10700341 3300009093 Unclassified 1106
266 Ga0105240_10730359 3300009093 Bacteria 1078
267 Ga0111539_10000002 3300009094 Bacteria 983359
268 Ga0111539_10058550 3300009094 Bacteria 4571
269 Ga0111539_10359843 3300009094 Unclassified 1694
270 Ga0111539_10983809 3300009094 Bacteria 981
271 Ga0111539_11241595 3300009094 Bacteria 865
272 Ga0105245_10003921 3300009098 Bacteria 13224
273 Ga0105245_10004784 3300009098 Bacteria 11948
274 Ga0105245_10015086 3300009098 Bacteria 6731
275 Ga0105245_10015179 3300009098 Bacteria 6710
276 Ga0105245_10018883 3300009098 Bacteria 6033
277 Ga0105245_10019679 3300009098 Bacteria 5915
278 Ga0105245_10045083 3300009098 Bacteria 3937
279 Ga0105245_10047016 3300009098 Bacteria 3857
280 Ga0105245_10104026 3300009098 Bacteria 2632
281 Ga0105245_10119235 3300009098 Bacteria 2463
282 Ga0105245_10254073 3300009098 Bacteria 1709
283 Ga0105245_10651823 3300009098 Bacteria 1083
284 Ga0114129_10000155 3300009147 Bacteria 72923
285 Ga0114129_10011725 3300009147 Bacteria 12473
286 Ga0114129_10017965 3300009147 Bacteria 10071
287 Ga0114129_10029504 3300009147 Bacteria 7770
288 Ga0114129_10094556 3300009147 Bacteria 4139
289 Ga0114129_10173617 3300009147 Bacteria 2937
290 Ga0114129_10195313 3300009147 Unclassified 2745
291 Ga0114129_10259513 3300009147 Bacteria 2330
292 Ga0114129_10491830 3300009147 Bacteria 1603
293 Ga0114129_11074232 3300009147 Bacteria 1009
294 Ga0105243_10019430 3300009148 Bacteria 5152
295 Ga0105243_10066698 3300009148 Bacteria 2895
296 Ga0105243_10168216 3300009148 Bacteria 1896
297 Ga0105243_10199346 3300009148 Bacteria 1754
298 Ga0105243_10291081 3300009148 Bacteria 1475
299 Ga0105241_10010069 3300009174 Bacteria 6942
300 Ga0105241_10010616 3300009174 Bacteria 6754
301 Ga0105241_10168439 3300009174 Bacteria 1807
302 Ga0105241_10169075 3300009174 Bacteria 1804
303 Ga0105241_10227616 3300009174 Bacteria 1570
304 Ga0105241_10338474 3300009174 Bacteria 1303
305 Ga0105242_10003209 3300009176 Bacteria 12731
306 Ga0105242_10004802 3300009176 Bacteria 10459
307 Ga0105242_10013007 3300009176 Bacteria 6419
308 Ga0105242_10014276 3300009176 Bacteria 6153
309 Ga0105242_10049223 3300009176 Bacteria 3429
310 Ga0105242_10086644 3300009176 Bacteria 2628
311 Ga0105242_10129960 3300009176 Bacteria 2173
312 Ga0105242_10287860 3300009176 Bacteria 1495
313 Ga0105242_10335522 3300009176 Bacteria 1392
314 Ga0105248_10001841 3300009177 Bacteria 23501
315 Ga0105248_10009082 3300009177 Bacteria 10932
316 Ga0105248_10013147 3300009177 Bacteria 9113
317 Ga0105248_10019625 3300009177 Bacteria 7482
318 Ga0105248_10027712 3300009177 Bacteria 6309
319 Ga0105248_10047477 3300009177 Bacteria 4815
320 Ga0105248_10068707 3300009177 Bacteria 3978
321 Ga0105248_10116151 3300009177 Bacteria 3018
322 Ga0105248_10142009 3300009177 Bacteria 2709
323 Ga0105248_10168306 3300009177 Bacteria 2470
324 Ga0105248_10217253 3300009177 Unclassified 2153
325 Ga0105248_10450458 3300009177 Bacteria 1450
326 Ga0105248_10767645 3300009177 Bacteria 1088
327 Ga0105248_10771186 3300009177 Bacteria 1085
328 Ga0105237_10009655 3300009545 Bacteria 10326
329 Ga0105237_10025571 3300009545 Bacteria 6034
330 Ga0105237_10075686 3300009545 Bacteria 3357
331 Ga0105237_10247602 3300009545 Bacteria 1784
332 Ga0105237_10389168 3300009545 Bacteria 1399
333 Ga0105237_10408572 3300009545 Bacteria 1362
334 Ga0105238_10001988 3300009551 Bacteria 20594
335 Ga0105238_10014783 3300009551 Bacteria 7894
336 Ga0105238_10017173 3300009551 Bacteria 7349
337 Ga0105238_10032711 3300009551 Bacteria 5293
338 Ga0105238_10049845 3300009551 Bacteria 4216
339 Ga0105238_10060696 3300009551 Bacteria 3785
340 Ga0105238_10153791 3300009551 Bacteria 2275
341 Ga0105238_10348091 3300009551 Bacteria 1471
342 Ga0105238_10370196 3300009551 Bacteria 1423
343 Ga0105238_10642085 3300009551 Unclassified 1071
344 Ga0105249_10009517 3300009553 Bacteria 8514
345 Ga0105239_10010683 3300010375 Bacteria 10266
346 Ga0105239_10011071 3300010375 Bacteria 10068
347 Ga0105239_10028364 3300010375 Bacteria 6158
348 Ga0105239_10029627 3300010375 Bacteria 6017
349 Ga0105239_10529675 3300010375 Bacteria 1341
350 Ga0105246_10013333 3300011119 Bacteria 5151
351 Ga0105246_10027766 3300011119 Bacteria 3713
352 Ga0105246_10225611 3300011119 Unclassified 1472
353 Ga0105246_10285079 3300011119 Bacteria 1327
354 Ga0105246_10303823 3300011119 Bacteria 1290
355 Ga0105246_10584421 3300011119 Unclassified 962
356 Ga0157370_10001733 3300013104 Bacteria 26851
357 Ga0157370_10003270 3300013104 Bacteria 19098
358 Ga0157370_10032457 3300013104 Bacteria 5099
359 Ga0157370_10132190 3300013104 Bacteria 2327
360 Ga0157370_10239498 3300013104 Bacteria 1679
361 Ga0157369_10004743 3300013105 Bacteria 15975
362 Ga0157369_10010200 3300013105 Bacteria 10718
363 Ga0157369_10040053 3300013105 Bacteria 5118
364 Ga0157369_10085323 3300013105 Bacteria 3374
365 Ga0157374_10063327 3300013296 Bacteria 3468
366 Ga0157374_10067952 3300013296 Bacteria 3352
367 Ga0157374_10069124 3300013296 Bacteria 3325
368 Ga0157374_10072565 3300013296 Bacteria 3248
369 Ga0157374_10222409 3300013296 Bacteria 1853
370 Ga0157374_10310016 3300013296 Bacteria 1562
371 Ga0157374_10421479 3300013296 Bacteria 1334
372 Ga0157378_10001898 3300013297 Bacteria 18768
373 Ga0157378_10003929 3300013297 Bacteria 13155
374 Ga0157378_10012987 3300013297 Bacteria 7285
375 Ga0157378_10115656 3300013297 Unclassified 2465
376 Ga0157378_10179491 3300013297 Bacteria 1991
377 Ga0157378_10180595 3300013297 Bacteria 1985
378 Ga0157378_10218029 3300013297 Bacteria 1813
379 Ga0157378_10297574 3300013297 Bacteria 1561
380 Ga0157378_10578752 3300013297 Bacteria 1132
381 Ga0157378_10625605 3300013297 Bacteria 1090
382 Ga0157378_10784376 3300013297 Unclassified 978
383 Ga0163162_10003543 3300013306 Bacteria 14933
384 Ga0163162_10016295 3300013306 Bacteria 7266
385 Ga0163162_10104866 3300013306 Bacteria 2921
386 Ga0163162_10209912 3300013306 Bacteria 2077
387 Ga0163162_10243951 3300013306 Bacteria 1928
388 Ga0163162_10253751 3300013306 Bacteria 1891
389 Ga0163162_10513070 3300013306 Bacteria 1329
390 Ga0163162_10779527 3300013306 Bacteria 1074
391 Ga0163162_11351926 3300013306 Bacteria 810
392 Ga0157372_10088667 3300013307 Bacteria 3513
393 Ga0157372_10094141 3300013307 Bacteria 3410
394 Ga0157372_10144222 3300013307 Bacteria 2746
395 Ga0157372_10266572 3300013307 Unclassified 1989
396 Ga0157375_10005323 3300013308 Bacteria 11181
397 Ga0157375_10064400 3300013308 Bacteria 3650
398 Ga0157375_10081184 3300013308 Bacteria 3282
399 Ga0157375_10365727 3300013308 Unclassified 1609
400 Ga0157375_10533105 3300013308 Bacteria 1337
401 Ga0157375_10536502 3300013308 Bacteria 1332
402 Ga0157375_10623852 3300013308 Bacteria 1236
403 Ga0157375_10661389 3300013308 Unclassified 1200
404 Ga0157375_10681028 3300013308 Unclassified 1183
405 Ga0157375_10722039 3300013308 Bacteria 1149
406 Ga0157375_11344250 3300013308 Bacteria 841
407 Ga0163163_10005414 3300014325 Bacteria 11036
408 Ga0163163_10006715 3300014325 Bacteria 10085
409 Ga0163163_10015575 3300014325 Bacteria 7031
410 Ga0163163_10027228 3300014325 Bacteria 5474
411 Ga0163163_10033698 3300014325 Bacteria 4957
412 Ga0163163_10078549 3300014325 Bacteria 3297
413 Ga0163163_10102741 3300014325 Unclassified 2882
414 Ga0163163_10171701 3300014325 Bacteria 2215
415 Ga0163163_10220085 3300014325 Bacteria 1947
416 Ga0163163_10278708 3300014325 Bacteria 1723
417 Ga0163163_10413896 3300014325 Bacteria 1407
418 Ga0163163_10570566 3300014325 Bacteria 1194
419 Ga0163163_10623996 3300014325 Bacteria 1141
420 Ga0163163_10897605 3300014325 Bacteria 950
421 Ga0163163_10899258 3300014325 Bacteria 949
422 Ga0157380_10039169 3300014326 Bacteria 3685
423 Ga0157380_10089306 3300014326 Unclassified 2538
424 Ga0157380_10120262 3300014326 Bacteria 2224
425 Ga0157380_10150459 3300014326 Bacteria 2011
426 Ga0157380_10242050 3300014326 Bacteria 1627
427 Ga0157380_10268174 3300014326 Bacteria 1555
428 Ga0157380_10469449 3300014326 Bacteria 1214
429 Ga0157380_10572221 3300014326 Bacteria 1112
430 Ga0157379_10018470 3300014968 Bacteria 6149
431 Ga0157379_10063826 3300014968 Bacteria 3292
432 Ga0157379_10508449 3300014968 Bacteria 1117
433 Ga0157379_10527357 3300014968 Bacteria 1097
434 Ga0157379_10596119 3300014968 Bacteria 1031
435 Ga0157376_10010212 3300014969 Bacteria 6856
436 Ga0157376_10108109 3300014969 Bacteria 2443
437 Ga0157376_10120322 3300014969 Unclassified 2326
438 Ga0157376_10143468 3300014969 Bacteria 2145
439 Ga0157376_10201002 3300014969 Bacteria 1834
440 Ga0157376_10322746 3300014969 Bacteria 1468
441 Ga0157376_10398599 3300014969 Bacteria 1330
442 Ga0163161_10292902 3300017792 Bacteria 1280
443 Ga0207656_10230793 3300025321 Unclassified 902
444 Ga0207642_10124897 3300025899 Bacteria 1333
445 Ga0207688_10149985 3300025901 Bacteria 1377
446 Ga0207680_10034792 3300025903 Bacteria 2885
447 Ga0207680_10034916 3300025903 Unclassified 2881
448 Ga0207680_10511611 3300025903 Unclassified 856
449 Ga0207645_10001872 3300025907 Bacteria 16990
450 Ga0207645_10064264 3300025907 Bacteria 2345
451 Ga0207645_10075966 3300025907 Bacteria 2151
452 Ga0207684_10027292 3300025910 Bacteria 4867
453 Ga0207684_10071202 3300025910 Bacteria 2955
454 Ga0207654_10007504 3300025911 Bacteria 5496
455 Ga0207654_10008176 3300025911 Bacteria 5278
456 Ga0207654_10055078 3300025911 Unclassified 2301
457 Ga0207654_10231162 3300025911 Bacteria 1231
458 Ga0207707_10000684 3300025912 Bacteria 33633
459 Ga0207707_10112457 3300025912 Bacteria 2380
460 Ga0207707_10148104 3300025912 Bacteria 2052
461 Ga0207707_10293890 3300025912 Bacteria 1405
462 Ga0207695_10002411 3300025913 Bacteria 27678
463 Ga0207695_10013324 3300025913 Bacteria 9811
464 Ga0207695_10017685 3300025913 Bacteria 8282
465 Ga0207695_10019139 3300025913 Bacteria 7891
466 Ga0207695_10125494 3300025913 Bacteria 2530
467 Ga0207695_10375259 3300025913 Bacteria 1308
468 Ga0207695_10458774 3300025913 Bacteria 1157
469 Ga0207695_10501779 3300025913 Bacteria 1095
470 Ga0207671_10109280 3300025914 Unclassified 2102
471 Ga0207671_10145663 3300025914 Bacteria 1827
472 Ga0207671_10162510 3300025914 Unclassified 1730
473 Ga0207671_10228348 3300025914 Bacteria 1460
474 Ga0207671_10312852 3300025914 Bacteria 1242
475 Ga0207663_10024777 3300025916 Bacteria 3460
476 Ga0207663_10130826 3300025916 Bacteria 1734
477 Ga0207660_10009072 3300025917 Bacteria 6441
478 Ga0207660_10038258 3300025917 Bacteria 3348
479 Ga0207662_10137907 3300025918 Bacteria 1543
480 Ga0207662_10212784 3300025918 Unclassified 1255
481 Ga0207657_10012255 3300025919 Bacteria 8470
482 Ga0207657_10034860 3300025919 Bacteria 4519
483 Ga0207657_10079881 3300025919 Unclassified 2751
484 Ga0207649_10146318 3300025920 Bacteria 1622
485 Ga0207652_10031216 3300025921 Bacteria 4473
486 Ga0207652_10152293 3300025921 Bacteria 2071
487 Ga0207646_10062415 3300025922 Bacteria 3327
488 Ga0207646_10088273 3300025922 Bacteria 2774
489 Ga0207681_10027372 3300025923 Bacteria 3685
490 Ga0207681_10037039 3300025923 Bacteria 3222
491 Ga0207681_10104848 3300025923 Bacteria 2046
492 Ga0207681_10168940 3300025923 Bacteria 1656
493 Ga0207694_10003273 3300025924 Bacteria 12910
494 Ga0207694_10003730 3300025924 Bacteria 12070
495 Ga0207694_10015269 3300025924 Bacteria 5794
496 Ga0207694_10029198 3300025924 Bacteria 4206
497 Ga0207694_10087637 3300025924 Unclassified 2452
498 Ga0207694_10105887 3300025924 Bacteria 2233
499 Ga0207694_10232241 3300025924 Bacteria 1506
500 Ga0207694_10365277 3300025924 Bacteria 1196
501 Ga0207650_10022870 3300025925 Bacteria 4429
502 Ga0207650_10052007 3300025925 Bacteria 3033
503 Ga0207659_10031579 3300025926 Bacteria 3627
504 Ga0207659_10033418 3300025926 Bacteria 3540
505 Ga0207659_10085404 3300025926 Bacteria 2345
506 Ga0207659_10619435 3300025926 Bacteria 923
507 Ga0207687_10000615 3300025927 Bacteria 24045
508 Ga0207687_10002388 3300025927 Bacteria 12730
509 Ga0207687_10015132 3300025927 Bacteria 5055
510 Ga0207687_10022888 3300025927 Bacteria 4161
511 Ga0207687_10031178 3300025927 Bacteria 3601
512 Ga0207687_10032699 3300025927 Unclassified 3524
513 Ga0207687_10042953 3300025927 Unclassified 3113
514 Ga0207687_10071858 3300025927 Bacteria 2473
515 Ga0207687_10361564 3300025927 Bacteria 1185
516 Ga0207700_10007797 3300025928 Bacteria 6579
517 Ga0207700_10016437 3300025928 Bacteria 4916
518 Ga0207700_10162335 3300025928 Unclassified 1857
519 Ga0207700_10403327 3300025928 Bacteria 1198
520 Ga0207700_10788148 3300025928 Bacteria 850
521 Ga0207664_10148545 3300025929 Bacteria 1989
522 Ga0207644_10014418 3300025931 Bacteria 5288
523 Ga0207644_10096761 3300025931 Bacteria 2210
524 Ga0207644_10292988 3300025931 Unclassified 1309
525 Ga0207690_10121896 3300025932 Bacteria 1895
526 Ga0207706_10010848 3300025933 Bacteria 8313
527 Ga0207706_10265246 3300025933 Bacteria 1499
528 Ga0207686_10001799 3300025934 Bacteria 11917
529 Ga0207686_10007390 3300025934 Bacteria 5915
530 Ga0207686_10007614 3300025934 Bacteria 5835
531 Ga0207686_10058827 3300025934 Bacteria 2425
532 Ga0207686_10074536 3300025934 Bacteria 2193
533 Ga0207686_10078201 3300025934 Bacteria 2150
534 Ga0207686_10080439 3300025934 Bacteria 2124
535 Ga0207686_10112162 3300025934 Bacteria 1841
536 Ga0207686_10146652 3300025934 Bacteria 1638
537 Ga0207709_10006604 3300025935 Bacteria 6512
538 Ga0207709_10071855 3300025935 Bacteria 2199
539 Ga0207709_10258662 3300025935 Bacteria 1275
540 Ga0207670_10024442 3300025936 Bacteria 3775
541 Ga0207670_10177664 3300025936 Bacteria 1601
542 Ga0207670_10210646 3300025936 Bacteria 1482
543 Ga0207670_10457480 3300025936 Bacteria 1030
544 Ga0207669_10004816 3300025937 Bacteria 5991
545 Ga0207704_10016459 3300025938 Bacteria 3801
546 Ga0207704_10020800 3300025938 Bacteria 3480
547 Ga0207704_10047949 3300025938 Bacteria 2558
548 Ga0207691_10077819 3300025940 Bacteria 2987
549 Ga0207691_10101394 3300025940 Bacteria 2569
550 Ga0207691_10107778 3300025940 Bacteria 2480
551 Ga0207691_10110974 3300025940 Archaea 2439
552 Ga0207691_10407610 3300025940 Bacteria 1159
553 Ga0207711_10000207 3300025941 Bacteria 62922
554 Ga0207711_10001638 3300025941 Bacteria 20646
555 Ga0207711_10006493 3300025941 Bacteria 9845
556 Ga0207711_10007210 3300025941 Bacteria 9317
557 Ga0207711_10022429 3300025941 Bacteria 5279
558 Ga0207711_10041712 3300025941 Bacteria 3909
559 Ga0207711_10093431 3300025941 Bacteria 2649
560 Ga0207711_10169272 3300025941 Bacteria 1982
561 Ga0207711_10199657 3300025941 Bacteria 1825
562 Ga0207711_10285077 3300025941 Bacteria 1521
563 Ga0207711_10345190 3300025941 Bacteria 1378
564 Ga0207711_10534334 3300025941 Bacteria 1094
565 Ga0207689_10002878 3300025942 Bacteria 15867
566 Ga0207689_10017739 3300025942 Bacteria 6014
567 Ga0207689_10061818 3300025942 Bacteria 3080
568 Ga0207689_10116681 3300025942 Unclassified 2194
569 Ga0207689_10666243 3300025942 Unclassified 877
570 Ga0207661_10005447 3300025944 Bacteria 8971
571 Ga0207661_10009405 3300025944 Bacteria 7008
572 Ga0207661_10015726 3300025944 Bacteria 5574
573 Ga0207661_10062858 3300025944 Bacteria 3005
574 Ga0207661_10429628 3300025944 Bacteria 1201
575 Ga0207679_10017573 3300025945 Bacteria 4774
576 Ga0207679_10125327 3300025945 Bacteria 2051
577 Ga0207679_10146409 3300025945 Bacteria 1916
578 Ga0207679_10309879 3300025945 Bacteria 1363
579 Ga0207679_10390565 3300025945 Bacteria 1222
580 Ga0207679_10599340 3300025945 Bacteria 993
581 Ga0207667_10001255 3300025949 Bacteria 31815
582 Ga0207667_10015370 3300025949 Bacteria 8700
583 Ga0207667_10015668 3300025949 Bacteria 8599
584 Ga0207667_10019763 3300025949 Bacteria 7509
585 Ga0207667_10043664 3300025949 Bacteria 4756
586 Ga0207667_10126843 3300025949 Bacteria 2629
587 Ga0207667_10234170 3300025949 Bacteria 1880
588 Ga0207651_10001469 3300025960 Bacteria 10719
589 Ga0207651_10034021 3300025960 Bacteria 3295
590 Ga0207651_10041524 3300025960 Bacteria 3054
591 Ga0207651_10045725 3300025960 Bacteria 2938
592 Ga0207651_10094790 3300025960 Unclassified 2196
593 Ga0207651_10135196 3300025960 Bacteria 1895
594 Ga0207712_10010889 3300025961 Bacteria 5789
595 Ga0207712_10074850 3300025961 Bacteria 2446
596 Ga0207712_10473253 3300025961 Bacteria 1066
597 Ga0207668_10036119 3300025972 Bacteria 3296
598 Ga0207640_10088904 3300025981 Bacteria 2134
599 Ga0207640_10435884 3300025981 Bacteria 1076
600 Ga0207658_10039244 3300025986 Bacteria 3416
601 Ga0207658_10161180 3300025986 Bacteria 1838
602 Ga0207658_10341024 3300025986 Bacteria 1302
603 Ga0207677_10010460 3300026023 Bacteria 5249
604 Ga0207677_10050312 3300026023 Bacteria 2818
605 Ga0207677_10342878 3300026023 Bacteria 1249
606 Ga0207677_10354736 3300026023 Bacteria 1230
607 Ga0207677_10448855 3300026023 Bacteria 1105
608 Ga0207703_10042849 3300026035 Bacteria 3631
609 Ga0207703_10068429 3300026035 Bacteria 2925
610 Ga0207703_10080218 3300026035 Bacteria 2717
611 Ga0207703_10331621 3300026035 Bacteria 1396
612 Ga0207703_10522471 3300026035 Unclassified 1117
613 Ga0207639_10122814 3300026041 Bacteria 2136
614 Ga0207639_10234835 3300026041 Unclassified 1591
615 Ga0207639_10244257 3300026041 Bacteria 1563
616 Ga0207678_10085842 3300026067 Bacteria 2690
617 Ga0207678_10565836 3300026067 Bacteria 995
618 Ga0207708_10003022 3300026075 Bacteria 12403
619 Ga0207708_10144762 3300026075 Bacteria 1867
620 Ga0207708_10374943 3300026075 Bacteria 1172
621 Ga0207702_10033941 3300026078 Unclassified 4264
622 Ga0207702_10120988 3300026078 Bacteria 2343
623 Ga0207702_10347159 3300026078 Bacteria 1419
624 Ga0207641_10079572 3300026088 Bacteria 2841
625 Ga0207641_10238156 3300026088 Bacteria 1694
626 Ga0207641_10350538 3300026088 Bacteria 1407
627 Ga0207641_10564372 3300026088 Bacteria 1111
628 Ga0207641_10748789 3300026088 Bacteria 964
629 Ga0207648_10002253 3300026089 Bacteria 20851
630 Ga0207648_10082092 3300026089 Bacteria 2811
631 Ga0207648_10110615 3300026089 Bacteria 2412
632 Ga0207648_10263112 3300026089 Bacteria 1539
633 Ga0207648_10415245 3300026089 Bacteria 1221
634 Ga0207676_10004508 3300026095 Bacteria 9848
635 Ga0207676_10015043 3300026095 Bacteria 5578
636 Ga0207676_10117918 3300026095 Bacteria 2233
637 Ga0207674_10000252 3300026116 Bacteria 66798
638 Ga0207674_10002778 3300026116 Bacteria 21814
639 Ga0207674_10020948 3300026116 Bacteria 7052
640 Ga0207674_10038242 3300026116 Bacteria 4985
641 Ga0207674_10393383 3300026116 Bacteria 1340
642 Ga0207674_10768156 3300026116 Bacteria 930
643 Ga0207675_100004828 3300026118 Bacteria 12980
644 Ga0207675_100043589 3300026118 Bacteria 4190
645 Ga0207675_100069545 3300026118 Bacteria 3290
646 Ga0207675_100079920 3300026118 Bacteria 3065
647 Ga0207675_100140132 3300026118 Bacteria 2297
648 Ga0207675_100189308 3300026118 Bacteria 1973
649 Ga0207675_100733535 3300026118 Bacteria 998
650 Ga0207683_10277629 3300026121 Bacteria 1531
651 Ga0207683_10562854 3300026121 Bacteria 1054
652 Ga0207698_10087334 3300026142 Bacteria 2540
653 Ga0207698_10165103 3300026142 Bacteria 1942
654 Ga0209588_1089657 3300027671 Bacteria 991
655 Ga0207428_10000004 3300027907 Bacteria 727800
656 Ga0268266_10019226 3300028379 Bacteria 5817
657 Ga0268266_10070530 3300028379 Bacteria 3028
658 Ga0268266_10087524 3300028379 Bacteria 2725
659 Ga0268266_10398170 3300028379 Bacteria 1301
660 Ga0268265_10073994 3300028380 Bacteria 2663
661 Ga0268265_10173647 3300028380 Bacteria 1845
662 Ga0268265_10196908 3300028380 Bacteria 1744
663 Ga0268265_10272682 3300028380 Bacteria 1510
664 Ga0268264_10030492 3300028381 Bacteria 4420
665 Ga0268264_10036700 3300028381 Bacteria 4038
666 Ga0265760_10007034 3300031090 Unclassified 3223
667 Ga0265329_10028572 3300031242 Bacteria 1828
668 Ga0265331_10215362 3300031250 Bacteria 864
669 Ga0265313_10006675 3300031595 Bacteria 8090
670 Ga0265313_10009655 3300031595 Bacteria 6231
671 Ga0265314_10001386 3300031711 Bacteria 27202
672 Ga0265314_10005349 3300031711 Bacteria 11602
673 Ga0316576_10025794 3300031727 Bacteria 4118
674 Ga0316576_10077146 3300031727 Bacteria 2467
675 Ga0316578_10261088 3300031728 Bacteria 1038
676 Ga0307405_10030145 3300031731 Bacteria 3178
677 Ga0307412_10064463 3300031911 Bacteria 2476
678 Ga0307412_10355170 3300031911 Bacteria 1178
679 Ga0307409_100148400 3300031995 Bacteria 2032
680 Ga0307416_100007255 3300032002 Bacteria 7026
681 Ga0307411_10533578 3300032005 Bacteria 998
682 Ga0316583_10046053 3300032133 Bacteria 1539
683 Ga0373926_0000614 3300035083 Bacteria 9676
684 Ga0373934_0004206 3300035086 Bacteria 5309
685 Ga0373952_0031857 3300035092 Bacteria 1174
686 Ga0373923_0011426 3300035111 Bacteria 3255
687 Ga0373939_0192345 3300035114 Bacteria 767
688 Ga0373953_0035336 3300035117 Bacteria 1963
689 Ga0373954_0002133 3300035118 Bacteria 8214
690 Ga0373954_0257828 3300035118 Unclassified 859
691 Ga0373956_0042534 3300035119 Bacteria 2020
692 Ga0373956_0219625 3300035119 Bacteria 902
693 Ga0373956_0274475 3300035119 Unclassified 802
694 Ga0373957_0117090 3300035120 Bacteria 1076
695 Ga0373943_0138686 3300035170 Unclassified 1308
696 Ga0373946_0178564 3300035171 Unclassified 1006
697 Ga0373955_0006974 3300035172 Bacteria 5171
698 Ga0373955_0081164 3300035172 Bacteria 1833
699 Ga0373955_0081681 3300035172 Bacteria 1828
700 Ga0373955_0088444 3300035172 Bacteria 1762
701 Ga0373955_0295581 3300035172 Unclassified 976
702 Ga0373935_0000902 3300035692 Bacteria 16048
703 Ga0373935_0028083 3300035692 Bacteria 3477
704 Ga0373935_0037190 3300035692 Bacteria 3046
705 Ga0373935_0522022 3300035692 Bacteria 864
706 Ga0373927_0004041 3300035695 Bacteria 10373
707 Ga0373927_0005586 3300035695 Bacteria 8645
708 Ga0373927_0080942 3300035695 Bacteria 2105
709 Ga0373927_0188568 3300035695 Bacteria 1353
710 Ga0373933_0016981 3300035724 Unclassified 4080
711 Ga0373933_0044230 3300035724 Bacteria 2637
712 Ga0373933_0266037 3300035724 Bacteria 1106
713 Ga0373947_0015220 3300035725 Bacteria 4416
714 Ga0373947_0069973 3300035725 Bacteria 2149
715 Ga0373947_0070709 3300035725 Bacteria 2139
716 Ga0373947_0596161 3300035725 Bacteria 753
717 Ga0373937_0001951 3300036401 Bacteria 17278
718 Ga0373937_0004398 3300036401 Bacteria 11975
719 Ga0373937_0012599 3300036401 Bacteria 7442
720 Ga0373937_0023943 3300036401 Bacteria 5505
721 Ga0373937_0127113 3300036401 Bacteria 2379
722 Ga0373937_0210578 3300036401 Bacteria 1829
723 Ga0373937_0272259 3300036401 Unclassified 1598
724 Ga0373937_0299426 3300036401 Unclassified 1520
725 Ga0373937_0356081 3300036401 Bacteria 1387
726 Ga0373937_0359925 3300036401 Bacteria 1379
727 Ga0373937_0535302 3300036401 Unclassified 1113
728 Ga0373937_0665295 3300036401 Bacteria 987
729 Ga0373937_0715231 3300036401 Bacteria 948
730 Ga0316582_0032046 3300036647 Bacteria 3217
731 Ga0316584_0022871 3300036712 Bacteria 4562
732 Ga0316584_0371458 3300036712 Bacteria 1024
733 Ga0373925_0009351 3300037068 Bacteria 7138
734 Ga0373925_0018646 3300037068 Bacteria 5045
735 Ga0439453_0034636 3300041408 Bacteria 970
736 Ga0450896_033444 3300042133 Bacteria 784
737 Ga0451577_0131290 3300042876 Bacteria 2247
738 Ga0453684_0299781 3300044712 Bacteria 1827
739 Ga0451576_0276693 3300045051 Bacteria 1755
740 Ga0451576_0300579 3300045051 Bacteria 1679
741 Ga0451576_0397770 3300045051 Bacteria 1444
742 Ga0495592_0011052 3300046454 Bacteria 6813
743 Ga0495592_0022690 3300046454 Bacteria 4774
744 Ga0495592_0033271 3300046454 Unclassified 3889
745 Ga0495592_0063728 3300046454 Bacteria 2703
746 Ga0495592_0071647 3300046454 Bacteria 2522
747 Ga0495603_0409420 3300046455 Bacteria 777
748 Ga0495629_0063335 3300046459 Bacteria 2583
749 Ga0495651_0000126 3300046462 Bacteria 56547
750 Ga0495651_0005148 3300046462 Bacteria 9968
751 Ga0495651_0009981 3300046462 Bacteria 7300
752 Ga0495651_0417465 3300046462 Unclassified 873
753 Ga0495651_0486437 3300046462 Bacteria 792
754 Ga0495653_0010223 3300046463 Bacteria 7682
755 Ga0495653_0088967 3300046463 Unclassified 2264
756 Ga0495653_0127564 3300046463 Unclassified 1805
757 Ga0495653_0145011 3300046463 Unclassified 1665
758 Ga0495653_0460601 3300046463 Bacteria 798
759 Ga0495580_0005481 3300046472 Bacteria 10486
760 Ga0495580_0015510 3300046472 Bacteria 5745
761 Ga0495580_0018716 3300046472 Bacteria 5154
762 Ga0495580_0053551 3300046472 Unclassified 2847
763 Ga0495580_0164608 3300046472 Bacteria 1534
764 Ga0495580_0264332 3300046472 Bacteria 1176
765 Ga0495580_0283151 3300046472 Bacteria 1131
766 Ga0495582_0049359 3300046473 Bacteria 2317
767 Ga0495582_0126266 3300046473 Bacteria 1444
768 Ga0495639_0069564 3300046475 Bacteria 1624
769 Ga0495639_0117335 3300046475 Bacteria 1267
770 Ga0495639_0207836 3300046475 Bacteria 960
771 Ga0495664_0019425 3300046477 Bacteria 3907
772 Ga0495594_0106000 3300046499 Bacteria 1583
773 Ga0495594_0113942 3300046499 Unclassified 1526
774 Ga0495608_0002023 3300046511 Bacteria 14549
775 Ga0495608_0006811 3300046511 Bacteria 8103
776 Ga0495608_0010563 3300046511 Bacteria 6442
777 Ga0495608_0029614 3300046511 Unclassified 3712
778 Ga0495608_0043759 3300046511 Bacteria 2991
779 Ga0495618_0007195 3300046514 Bacteria 6738
780 Ga0495628_0001880 3300046516 Bacteria 19059
781 Ga0495628_0012049 3300046516 Bacteria 7293
782 Ga0495628_0018608 3300046516 Bacteria 5751
783 Ga0495628_0066816 3300046516 Unclassified 2810
784 Ga0495628_0232312 3300046516 Bacteria 1382
785 Ga0495628_0301316 3300046516 Bacteria 1186
786 Ga0495630_0001011 3300046517 Bacteria 19496
787 Ga0495630_0001268 3300046517 Bacteria 17403
788 Ga0495630_0003853 3300046517 Bacteria 10471
789 Ga0495630_0017821 3300046517 Bacteria 5208
790 Ga0495666_0020095 3300046526 Bacteria 3313
791 Ga0495652_0013561 3300046529 Bacteria 7335
792 Ga0495652_0016762 3300046529 Bacteria 6549
793 Ga0495652_0064347 3300046529 Unclassified 3084
794 Ga0495665_0013131 3300046531 Bacteria 4482
795 Ga0495665_0085639 3300046531 Bacteria 1656
796 Ga0495586_0000405 3300046535 Bacteria 26188
797 Ga0495586_0069027 3300046535 Bacteria 1929
798 Ga0495586_0181340 3300046535 Bacteria 1191
799 Ga0495586_0193084 3300046535 Bacteria 1153
800 Ga0495586_0205454 3300046535 Bacteria 1117
801 Ga0495586_0247271 3300046535 Bacteria 1017
802 Ga0495587_0001076 3300046536 Bacteria 17951
803 Ga0495587_0004806 3300046536 Bacteria 8868
804 Ga0495587_0128957 3300046536 Bacteria 1446
805 Ga0495621_0015319 3300046539 Bacteria 2443
806 Ga0495621_0054027 3300046539 Bacteria 1443
807 Ga0495645_0002936 3300046543 Bacteria 11555
808 Ga0495645_0024700 3300046543 Bacteria 4361
809 Ga0495645_0038923 3300046543 Unclassified 3468
810 Ga0495645_0132836 3300046543 Bacteria 1743
811 Ga0495645_0222984 3300046543 Bacteria 1267
812 Ga0495667_0001136 3300046559 Bacteria 17338
813 Ga0495667_0013664 3300046559 Bacteria 5488
814 Ga0495667_0042162 3300046559 Bacteria 3026
815 Ga0495667_0219038 3300046559 Unclassified 1215
816 Ga0495667_0274600 3300046559 Bacteria 1070
817 Ga0495634_0040074 3300046642 Bacteria 3188
818 Ga0495634_0141460 3300046642 Unclassified 1527
819 Ga0495635_0054682 3300046663 Unclassified 2749
820 Ga0495635_0130570 3300046663 Bacteria 1712
821 Ga0495635_0190783 3300046663 Bacteria 1391
822 Ga0495657_0004041 3300046675 Bacteria 11765
823 Ga0495657_0145507 3300046675 Unclassified 1474
824 Ga0495599_0003977 3300046678 Bacteria 8705
825 Ga0495599_0018901 3300046678 Unclassified 4296
826 Ga0495623_0003934 3300046679 Bacteria 9790
827 Ga0495623_0081568 3300046679 Bacteria 2000
828 Ga0495623_0260433 3300046679 Bacteria 972
829 Ga0495646_0000785 3300046680 Bacteria 17756
830 Ga0495646_0058133 3300046680 Unclassified 2312
831 Ga0495658_0045096 3300046683 Bacteria 2473
832 Ga0495658_0171042 3300046683 Bacteria 1345
833 Ga0495613_0001706 3300046689 Bacteria 16725
834 Ga0495613_0056494 3300046689 Bacteria 2882
835 Ga0495613_0168362 3300046689 Bacteria 1556
836 Ga0495613_0545359 3300046689 Unclassified 776
837 Ga0495624_0016528 3300046690 Bacteria 4965
838 Ga0495624_0393308 3300046690 Bacteria 832
839 Ga0495600_0003140 3300046809 Bacteria 9666
840 Ga0495600_0082885 3300046809 Bacteria 2093
841 Ga0495604_0005091 3300047317 Bacteria 10407
842 Ga0495604_0010297 3300047317 Bacteria 7406
843 Ga0495604_0044978 3300047317 Bacteria 3447
844 Ga0495604_0400656 3300047317 Unclassified 904
845 Ga0495674_0001401 3300047319 Bacteria 23572
846 Ga0495674_0013223 3300047319 Bacteria 7758
847 Ga0495674_0020559 3300047319 Bacteria 6110
848 Ga0495674_0024847 3300047319 Bacteria 5500
849 Ga0495674_0055836 3300047319 Unclassified 3462
850 Ga0495674_0236338 3300047319 Unclassified 1507
851 Ga0495676_0046014 3300047321 Bacteria 3547
852 Ga0495680_0000253 3300047322 Bacteria 59346
853 Ga0495680_0001258 3300047322 Bacteria 27663
854 Ga0495680_0089003 3300047322 Bacteria 2319
855 Ga0495680_0096719 3300047322 Unclassified 2205
856 Ga0495680_0186848 3300047322 Bacteria 1493
857 Ga0495675_0000165 3300047444 Bacteria 47340
858 Ga0495675_0005957 3300047444 Bacteria 7451
859 Ga0495675_0148243 3300047444 Bacteria 1451
860 Ga0495675_0178269 3300047444 Bacteria 1302
861 Ga0495684_0000125 3300047471 Bacteria 56588
862 Ga0495684_0009716 3300047471 Bacteria 7422
863 Ga0495684_0012342 3300047471 Bacteria 6590
864 Ga0495684_0013320 3300047471 Bacteria 6336
865 Ga0495684_0025018 3300047471 Bacteria 4592
866 Ga0495684_0076222 3300047471 Bacteria 2547
867 Ga0495684_0203701 3300047471 Bacteria 1458
868 Ga0495684_0311031 3300047471 Bacteria 1129
869 Ga0495602_0003164 3300048088 Bacteria 16964
870 Ga0495602_0012198 3300048088 Bacteria 8849
871 Ga0495602_0021669 3300048088 Bacteria 6316
872 Ga0495602_0081110 3300048088 Bacteria 2729
873 Ga0495602_0228155 3300048088 Unclassified 1401
874 Ga0496100_0005245 3300048903 Bacteria 6963
875 Ga0496101_0018969 3300048904 Bacteria 4687
876 Ga0496104_0170139 3300048907 Unclassified 2089
877 Ga0496104_0195870 3300048907 Bacteria 1933
878 Ga0496104_0298439 3300048907 Bacteria 1523
879 Ga0496104_0358451 3300048907 Bacteria 1371
880 Ga0496107_0062033 3300048910 Unclassified 2708
881 Ga0496112_0440891 3300048915 Bacteria 1240
882 Ga0496112_0570133 3300048915 Bacteria 1065
883 Ga0496114_0002302 3300048917 Bacteria 14547
884 Ga0496115_0142022 3300048918 Bacteria 1981
885 Ga0501042_0443823 3300049578 Bacteria 941
886 Ga0501046_0234035 3300049580 Unclassified 1356
887 Ga0501047_0104620 3300049581 Bacteria 2711
888 Ga0501048_0135796 3300049582 Bacteria 1738
889 Ga0501074_0088039 3300049590 Unclassified 2224
890 Ga0501075_0021304 3300049591 Bacteria 4724
891 Ga0501076_0046871 3300049592 Bacteria 3416
892 Ga0501079_0042736 3300049741 Unclassified 3499
893 Ga0501080_0098430 3300049742 Unclassified 2715
894 nmdc:mga05p37_105860_c1 3300050507 Bacteria 3460
895 nmdc:mga05p37_215848_c1 3300050507 Bacteria 2317
896 nmdc:mga05p37_33_c1 3300050507 Bacteria 112965
897 nmdc:mga05p37_48567_c1 3300050507 Bacteria 5218
898 nmdc:mga05p37_7649_c1 3300050507 Bacteria 12752
899 nmdc:mga05p37_827925_c1 3300050507 Bacteria 1008
900 nmdc:mga09592_296325_c1 3300050508 Bacteria 1402
901 nmdc:mga09592_3004_c1 3300050508 Bacteria 13675
902 nmdc:mga09592_3103_c1 3300050508 Bacteria 13488
903 nmdc:mga06r32_149771_c1 3300050510 Bacteria 2311
904 nmdc:mga06r32_208333_c1 3300050510 Bacteria 1943
905 nmdc:mga06r32_29148_c1 3300050510 Bacteria 5170
906 nmdc:mga06r32_46080_c1 3300050510 Bacteria 4160
907 nmdc:mga06r32_5990_c1 3300050510 Bacteria 10937
908 nmdc:mga06r32_84513_c1 3300050510 Unclassified 3093
909 nmdc:mga08y16_249954_c1 3300050511 Bacteria 1832
910 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
911 nmdc:mga0n895_208421_c1 3300050512 Bacteria 1985
912 nmdc:mga0n895_28312_c1 3300050512 Bacteria 5329
913 nmdc:mga0n895_879410_c1 3300050512 Bacteria 882
914 nmdc:mga0rr50_280591_c1 3300050513 Bacteria 1390
915 nmdc:mga08x19_304343_c1 3300050514 Bacteria 1107
916 nmdc:mga0a205_218116_c1 3300050515 Unclassified 1794
917 nmdc:mga0a205_242635_c1 3300050515 Bacteria 1682
918 nmdc:mga0a205_30462_c1 3300050515 Bacteria 5166
919 nmdc:mga0a205_398057_c1 3300050515 Bacteria 1241
920 Ga0495601_0022203 3300053077 Unclassified 3894
921 Ga0495601_0195274 3300053077 Unclassified 1323
922 Ga0495612_0003944 3300053078 Bacteria 6161
923 Ga0495595_0103462 3300053084 Bacteria 1376
924 Ga0495619_0021501 3300053085 Unclassified 4119
925 Ga0495619_0081684 3300053085 Bacteria 2177
926 Ga0495619_0300394 3300053085 Bacteria 1112
927 Ga0495619_0551672 3300053085 Unclassified 790
928 Ga0500568_0008529 3300053139 Unclassified 4932
929 Ga0501084_0042671 3300054114 Bacteria 3794
930 Ga0501082_0129189 3300060353 Unclassified 2192
931 Ga0530510_0018388 3300061734 Bacteria 4955

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0570133 Ga0496112_0570133_258_923 221
2 3300005340 Ga0070689_100046856 Ga0070689_1000468563 224
3 3300005365 Ga0070688_100466105 Ga0070688_1004661051 224
4 3300025936 Ga0207670_10210646 Ga0207670_102106462 224
5 3300005841 Ga0068863_100066682 Ga0068863_1000666822 225
6 3300028381 Ga0268264_10030492 Ga0268264_100304923 225
7 3300009098 Ga0105245_10019679 Ga0105245_100196793 226
8 3300009177 Ga0105248_10217253 Ga0105248_102172531 226
9 3300013306 Ga0163162_10243951 Ga0163162_102439512 226
10 3300049578 Ga0501042_0443823 Ga0501042_0443823_232_924 228
11 3300005444 Ga0070694_100083783 Ga0070694_1000837832 232
12 3300005467 Ga0070706_100004393 Ga0070706_1000043937 232
13 3300005471 Ga0070698_100014652 Ga0070698_1000146526 232
14 3300005549 Ga0070704_100003332 Ga0070704_1000033323 232
15 3300005549 Ga0070704_100511939 Ga0070704_1005119391 232
16 3300005719 Ga0068861_100110659 Ga0068861_1001106592 232
17 3300006844 Ga0075428_100023052 Ga0075428_1000230523 232
18 3300006846 Ga0075430_100113743 Ga0075430_1001137432 232
19 3300006847 Ga0075431_100000914 Ga0075431_1000009144 232
20 3300006852 Ga0075433_10080599 Ga0075433_100805992 232
21 3300009094 Ga0111539_10983809 Ga0111539_109838092 232
22 3300009147 Ga0114129_10000155 Ga0114129_1000015515 232
23 3300011119 Ga0105246_10225611 Ga0105246_102256111 232
24 3300025910 Ga0207684_10027292 Ga0207684_100272922 232
25 3300026035 Ga0207703_10042849 Ga0207703_100428493 232
26 3300026118 Ga0207675_100004828 Ga0207675_1000048289 232
27 3300045051 Ga0451576_0276693 Ga0451576_0276693_471_1169 232
28 3300045051 Ga0451576_0300579 Ga0451576_0300579_392_1090 232
29 3300050507 nmdc:mga05p37_33_c1 nmdc:mga05p37_33_c1_53511_54209 232
30 3300050508 nmdc:mga09592_3103_c1 nmdc:mga09592_3103_c1_12510_13208 232
31 3300050510 nmdc:mga06r32_46080_c1 nmdc:mga06r32_46080_c1_3301_4002 232
32 3300050512 nmdc:mga0n895_879410_c1 nmdc:mga0n895_879410_c1_103_801 232
33 3300050515 nmdc:mga0a205_242635_c1 nmdc:mga0a205_242635_c1_28_726 232
34 3300009147 Ga0114129_10173617 Ga0114129_101736173 233
35 3300009147 Ga0114129_10491830 Ga0114129_104918302 233
36 3300025960 Ga0207651_10135196 Ga0207651_101351962 233
37 3300031727 Ga0316576_10025794 Ga0316576_100257941 233
38 3300031727 Ga0316576_10077146 Ga0316576_100771462 233
39 3300031728 Ga0316578_10261088 Ga0316578_102610882 233
40 3300032133 Ga0316583_10046053 Ga0316583_100460532 233
41 3300036647 Ga0316582_0032046 Ga0316582_0032046_2149_2853 233
42 3300036712 Ga0316584_0022871 Ga0316584_0022871_1293_1997 233
43 3300036712 Ga0316584_0371458 Ga0316584_0371458_153_908 233
44 3300042133 Ga0450896_033444 Ga0450896_033444_59_760 233
45 3300042876 Ga0451577_0131290 Ga0451577_0131290_1480_2181 233
46 3300044712 Ga0453684_0299781 Ga0453684_0299781_925_1626 233
47 3300050507 nmdc:mga05p37_215848_c1 nmdc:mga05p37_215848_c1_41_742 233
48 3300005327 Ga0070658_10187959 Ga0070658_101879593 234
49 3300005329 Ga0070683_100098299 Ga0070683_1000982992 234
50 3300005331 Ga0070670_100007834 Ga0070670_1000078344 234
51 3300005331 Ga0070670_100308850 Ga0070670_1003088502 234
52 3300005334 Ga0068869_100096635 Ga0068869_1000966352 234
53 3300005334 Ga0068869_100408070 Ga0068869_1004080701 234
54 3300005334 Ga0068869_100706225 Ga0068869_1007062251 234
55 3300005335 Ga0070666_10001137 Ga0070666_100011376 234
56 3300005335 Ga0070666_10039637 Ga0070666_100396371 234
57 3300005335 Ga0070666_10046062 Ga0070666_100460622 234
58 3300005335 Ga0070666_10257688 Ga0070666_102576881 234
59 3300005336 Ga0070680_100013946 Ga0070680_1000139462 234
60 3300005338 Ga0068868_100005508 Ga0068868_1000055086 234
61 3300005338 Ga0068868_100006505 Ga0068868_1000065054 234
62 3300005338 Ga0068868_100145886 Ga0068868_1001458862 234
63 3300005338 Ga0068868_100158663 Ga0068868_1001586632 234
64 3300005338 Ga0068868_100309782 Ga0068868_1003097821 234
65 3300005338 Ga0068868_100443529 Ga0068868_1004435291 234
66 3300005339 Ga0070660_100024608 Ga0070660_1000246082 234
67 3300005339 Ga0070660_100120887 Ga0070660_1001208873 234
68 3300005339 Ga0070660_100151657 Ga0070660_1001516572 234
69 3300005340 Ga0070689_100043304 Ga0070689_1000433043 234
70 3300005341 Ga0070691_10013126 Ga0070691_100131262 234
71 3300005344 Ga0070661_100110285 Ga0070661_1001102852 234
72 3300005344 Ga0070661_100269976 Ga0070661_1002699762 234
73 3300005353 Ga0070669_100162159 Ga0070669_1001621592 234
74 3300005354 Ga0070675_100211505 Ga0070675_1002115052 234
75 3300005355 Ga0070671_100016426 Ga0070671_1000164264 234
76 3300005355 Ga0070671_100044390 Ga0070671_1000443902 234
77 3300005355 Ga0070671_100071980 Ga0070671_1000719802 234
78 3300005355 Ga0070671_100072762 Ga0070671_1000727624 234
79 3300005355 Ga0070671_100332130 Ga0070671_1003321302 234
80 3300005356 Ga0070674_100763458 Ga0070674_1007634581 234
81 3300005364 Ga0070673_100066805 Ga0070673_1000668054 234
82 3300005364 Ga0070673_100323817 Ga0070673_1003238172 234
83 3300005365 Ga0070688_100229994 Ga0070688_1002299941 234
84 3300005366 Ga0070659_100043757 Ga0070659_1000437572 234
85 3300005366 Ga0070659_100184786 Ga0070659_1001847862 234
86 3300005367 Ga0070667_100072696 Ga0070667_1000726962 234
87 3300005367 Ga0070667_100082239 Ga0070667_1000822392 234
88 3300005367 Ga0070667_100163950 Ga0070667_1001639502 234
89 3300005367 Ga0070667_100560439 Ga0070667_1005604392 234
90 3300005436 Ga0070713_100011378 Ga0070713_1000113783 234
91 3300005436 Ga0070713_100025278 Ga0070713_1000252782 234
92 3300005436 Ga0070713_100181065 Ga0070713_1001810652 234
93 3300005436 Ga0070713_100724831 Ga0070713_1007248311 234
94 3300005436 Ga0070713_100808371 Ga0070713_1008083711 234
95 3300005437 Ga0070710_10339695 Ga0070710_103396951 234
96 3300005439 Ga0070711_100069704 Ga0070711_1000697043 234
97 3300005439 Ga0070711_100514942 Ga0070711_1005149422 234
98 3300005457 Ga0070662_100022723 Ga0070662_1000227231 234
99 3300005457 Ga0070662_100231891 Ga0070662_1002318912 234
100 3300005458 Ga0070681_10072278 Ga0070681_100722783 234
101 3300005458 Ga0070681_10093516 Ga0070681_100935163 234
102 3300005458 Ga0070681_10379789 Ga0070681_103797892 234
103 3300005459 Ga0068867_100033466 Ga0068867_1000334664 234
104 3300005459 Ga0068867_100085376 Ga0068867_1000853762 234
105 3300005459 Ga0068867_100325983 Ga0068867_1003259832 234
106 3300005466 Ga0070685_10536405 Ga0070685_105364051 234
107 3300005468 Ga0070707_100003828 Ga0070707_1000038287 234
108 3300005471 Ga0070698_100357158 Ga0070698_1003571582 234
109 3300005535 Ga0070684_100007408 Ga0070684_1000074084 234
110 3300005535 Ga0070684_100007644 Ga0070684_1000076447 234
111 3300005535 Ga0070684_100042326 Ga0070684_1000423265 234
112 3300005535 Ga0070684_100838806 Ga0070684_1008388061 234
113 3300005539 Ga0068853_100101024 Ga0068853_1001010242 234
114 3300005539 Ga0068853_100150560 Ga0068853_1001505602 234
115 3300005539 Ga0068853_100363828 Ga0068853_1003638282 234
116 3300005539 Ga0068853_100738297 Ga0068853_1007382972 234
117 3300005543 Ga0070672_100001694 Ga0070672_1000016946 234
118 3300005544 Ga0070686_100098881 Ga0070686_1000988812 234
119 3300005544 Ga0070686_100110702 Ga0070686_1001107022 234
120 3300005548 Ga0070665_100004087 Ga0070665_10000408712 234
121 3300005548 Ga0070665_100153131 Ga0070665_1001531313 234
122 3300005548 Ga0070665_100499736 Ga0070665_1004997362 234
123 3300005563 Ga0068855_100001557 Ga0068855_1000015575 234
124 3300005563 Ga0068855_100009822 Ga0068855_1000098227 234
125 3300005563 Ga0068855_100014867 Ga0068855_1000148677 234
126 3300005563 Ga0068855_100047694 Ga0068855_1000476943 234
127 3300005563 Ga0068855_100152601 Ga0068855_1001526011 234
128 3300005563 Ga0068855_100213834 Ga0068855_1002138342 234
129 3300005563 Ga0068855_100776972 Ga0068855_1007769722 234
130 3300005563 Ga0068855_101000435 Ga0068855_1010004351 234
131 3300005564 Ga0070664_100007205 Ga0070664_1000072059 234
132 3300005564 Ga0070664_100148442 Ga0070664_1001484422 234
133 3300005564 Ga0070664_100315645 Ga0070664_1003156452 234
134 3300005564 Ga0070664_100644939 Ga0070664_1006449392 234
135 3300005577 Ga0068857_100011025 Ga0068857_1000110255 234
136 3300005577 Ga0068857_100095755 Ga0068857_1000957553 234
137 3300005577 Ga0068857_100140302 Ga0068857_1001403022 234
138 3300005577 Ga0068857_100143645 Ga0068857_1001436452 234
139 3300005578 Ga0068854_100021040 Ga0068854_1000210402 234
140 3300005614 Ga0068856_100003142 Ga0068856_10000314214 234
141 3300005614 Ga0068856_100006380 Ga0068856_1000063807 234
142 3300005614 Ga0068856_100066042 Ga0068856_1000660424 234
143 3300005614 Ga0068856_100129805 Ga0068856_1001298053 234
144 3300005614 Ga0068856_100163931 Ga0068856_1001639312 234
145 3300005614 Ga0068856_100405723 Ga0068856_1004057232 234
146 3300005614 Ga0068856_100466278 Ga0068856_1004662781 234
147 3300005616 Ga0068852_100032351 Ga0068852_1000323512 234
148 3300005616 Ga0068852_100180611 Ga0068852_1001806112 234
149 3300005616 Ga0068852_100210805 Ga0068852_1002108052 234
150 3300005616 Ga0068852_100903455 Ga0068852_1009034552 234
151 3300005617 Ga0068859_100431213 Ga0068859_1004312131 234
152 3300005617 Ga0068859_100768319 Ga0068859_1007683191 234
153 3300005618 Ga0068864_100003613 Ga0068864_1000036136 234
154 3300005718 Ga0068866_10232944 Ga0068866_102329442 234
155 3300005718 Ga0068866_10456362 Ga0068866_104563621 234
156 3300005719 Ga0068861_100025559 Ga0068861_1000255595 234
157 3300005834 Ga0068851_10332069 Ga0068851_103320691 234
158 3300005841 Ga0068863_100053375 Ga0068863_1000533754 234
159 3300005841 Ga0068863_100114859 Ga0068863_1001148593 234
160 3300005841 Ga0068863_100171821 Ga0068863_1001718212 234
161 3300005841 Ga0068863_100198611 Ga0068863_1001986112 234
162 3300005841 Ga0068863_100342225 Ga0068863_1003422252 234
163 3300005842 Ga0068858_100007279 Ga0068858_1000072792 234
164 3300005842 Ga0068858_100012093 Ga0068858_1000120936 234
165 3300005842 Ga0068858_100023284 Ga0068858_1000232844 234
166 3300005842 Ga0068858_100032999 Ga0068858_1000329993 234
167 3300005842 Ga0068858_100170495 Ga0068858_1001704953 234
168 3300005843 Ga0068860_100017221 Ga0068860_1000172214 234
169 3300005843 Ga0068860_100273388 Ga0068860_1002733882 234
170 3300005843 Ga0068860_100282331 Ga0068860_1002823313 234
171 3300005843 Ga0068860_100376983 Ga0068860_1003769832 234
172 3300005843 Ga0068860_100476081 Ga0068860_1004760812 234
173 3300006028 Ga0070717_10015510 Ga0070717_100155102 234
174 3300006028 Ga0070717_10321859 Ga0070717_103218592 234
175 3300006175 Ga0070712_100032433 Ga0070712_1000324335 234
176 3300006237 Ga0097621_100005568 Ga0097621_1000055686 234
177 3300006237 Ga0097621_100006771 Ga0097621_1000067714 234
178 3300006237 Ga0097621_100011511 Ga0097621_1000115117 234
179 3300006237 Ga0097621_100047814 Ga0097621_1000478142 234
180 3300006237 Ga0097621_100062808 Ga0097621_1000628082 234
181 3300006237 Ga0097621_100118314 Ga0097621_1001183142 234
182 3300006237 Ga0097621_100409269 Ga0097621_1004092691 234
183 3300006358 Ga0068871_100013531 Ga0068871_1000135315 234
184 3300006358 Ga0068871_100016427 Ga0068871_1000164272 234
185 3300006358 Ga0068871_100018946 Ga0068871_1000189465 234
186 3300006358 Ga0068871_100043261 Ga0068871_1000432612 234
187 3300006358 Ga0068871_100054353 Ga0068871_1000543531 234
188 3300006358 Ga0068871_100099886 Ga0068871_1000998862 234
189 3300006358 Ga0068871_100152043 Ga0068871_1001520433 234
190 3300006358 Ga0068871_100194424 Ga0068871_1001944242 234
191 3300006358 Ga0068871_100231568 Ga0068871_1002315682 234
192 3300006358 Ga0068871_100247047 Ga0068871_1002470472 234
193 3300006844 Ga0075428_100799367 Ga0075428_1007993671 234
194 3300006846 Ga0075430_100173636 Ga0075430_1001736362 234
195 3300006847 Ga0075431_100088438 Ga0075431_1000884382 234
196 3300006847 Ga0075431_100169520 Ga0075431_1001695202 234
197 3300006852 Ga0075433_10021120 Ga0075433_100211206 234
198 3300006852 Ga0075433_10311480 Ga0075433_103114802 234
199 3300006871 Ga0075434_100031003 Ga0075434_1000310035 234
200 3300006871 Ga0075434_100086245 Ga0075434_1000862452 234
201 3300006880 Ga0075429_100076018 Ga0075429_1000760183 234
202 3300006880 Ga0075429_100482109 Ga0075429_1004821092 234
203 3300006881 Ga0068865_100060820 Ga0068865_1000608204 234
204 3300006881 Ga0068865_100460680 Ga0068865_1004606801 234
205 3300006931 Ga0097620_100431247 Ga0097620_1004312471 234
206 3300006931 Ga0097620_100768304 Ga0097620_1007683042 234
207 3300007076 Ga0075435_100554134 Ga0075435_1005541342 234
208 3300007265 Ga0099794_10030342 Ga0099794_100303422 234
209 3300007788 Ga0099795_10154082 Ga0099795_101540822 234
210 3300009093 Ga0105240_10001330 Ga0105240_1000133011 234
211 3300009093 Ga0105240_10005789 Ga0105240_1000578910 234
212 3300009093 Ga0105240_10008052 Ga0105240_100080527 234
213 3300009093 Ga0105240_10025249 Ga0105240_100252492 234
214 3300009093 Ga0105240_10254118 Ga0105240_102541182 234
215 3300009093 Ga0105240_10454277 Ga0105240_104542772 234
216 3300009093 Ga0105240_10511859 Ga0105240_105118591 234
217 3300009093 Ga0105240_10700341 Ga0105240_107003412 234
218 3300009093 Ga0105240_10730359 Ga0105240_107303592 234
219 3300009094 Ga0111539_10359843 Ga0111539_103598432 234
220 3300009098 Ga0105245_10003921 Ga0105245_1000392114 234
221 3300009098 Ga0105245_10004784 Ga0105245_100047849 234
222 3300009098 Ga0105245_10015179 Ga0105245_100151794 234
223 3300009098 Ga0105245_10018883 Ga0105245_100188835 234
224 3300009098 Ga0105245_10045083 Ga0105245_100450834 234
225 3300009098 Ga0105245_10047016 Ga0105245_100470162 234
226 3300009098 Ga0105245_10104026 Ga0105245_101040262 234
227 3300009098 Ga0105245_10119235 Ga0105245_101192352 234
228 3300009098 Ga0105245_10254073 Ga0105245_102540732 234
229 3300009098 Ga0105245_10651823 Ga0105245_106518232 234
230 3300009147 Ga0114129_10011725 Ga0114129_100117255 234
231 3300009147 Ga0114129_10029504 Ga0114129_100295044 234
232 3300009147 Ga0114129_10094556 Ga0114129_100945563 234
233 3300009147 Ga0114129_10195313 Ga0114129_101953133 234
234 3300009147 Ga0114129_11074232 Ga0114129_110742322 234
235 3300009148 Ga0105243_10066698 Ga0105243_100666982 234
236 3300009148 Ga0105243_10168216 Ga0105243_101682162 234
237 3300009174 Ga0105241_10010069 Ga0105241_100100695 234
238 3300009174 Ga0105241_10010616 Ga0105241_100106165 234
239 3300009174 Ga0105241_10168439 Ga0105241_101684393 234
240 3300009174 Ga0105241_10169075 Ga0105241_101690752 234
241 3300009174 Ga0105241_10227616 Ga0105241_102276162 234
242 3300009174 Ga0105241_10338474 Ga0105241_103384742 234
243 3300009176 Ga0105242_10003209 Ga0105242_1000320911 234
244 3300009176 Ga0105242_10014276 Ga0105242_100142762 234
245 3300009176 Ga0105242_10049223 Ga0105242_100492233 234
246 3300009176 Ga0105242_10129960 Ga0105242_101299602 234
247 3300009176 Ga0105242_10287860 Ga0105242_102878602 234
248 3300009176 Ga0105242_10335522 Ga0105242_103355222 234
249 3300009177 Ga0105248_10001841 Ga0105248_1000184115 234
250 3300009177 Ga0105248_10009082 Ga0105248_100090826 234
251 3300009177 Ga0105248_10013147 Ga0105248_100131475 234
252 3300009177 Ga0105248_10019625 Ga0105248_100196255 234
253 3300009177 Ga0105248_10027712 Ga0105248_100277123 234
254 3300009177 Ga0105248_10047477 Ga0105248_100474773 234
255 3300009177 Ga0105248_10068707 Ga0105248_100687072 234
256 3300009177 Ga0105248_10142009 Ga0105248_101420094 234
257 3300009177 Ga0105248_10168306 Ga0105248_101683063 234
258 3300009177 Ga0105248_10450458 Ga0105248_104504582 234
259 3300009545 Ga0105237_10009655 Ga0105237_100096552 234
260 3300009545 Ga0105237_10025571 Ga0105237_100255717 234
261 3300009545 Ga0105237_10075686 Ga0105237_100756863 234
262 3300009545 Ga0105237_10247602 Ga0105237_102476021 234
263 3300009545 Ga0105237_10389168 Ga0105237_103891682 234
264 3300009545 Ga0105237_10408572 Ga0105237_104085722 234
265 3300009551 Ga0105238_10001988 Ga0105238_1000198812 234
266 3300009551 Ga0105238_10014783 Ga0105238_100147832 234
267 3300009551 Ga0105238_10017173 Ga0105238_100171732 234
268 3300009551 Ga0105238_10032711 Ga0105238_100327112 234
269 3300009551 Ga0105238_10049845 Ga0105238_100498452 234
270 3300009551 Ga0105238_10060696 Ga0105238_100606965 234
271 3300009551 Ga0105238_10153791 Ga0105238_101537912 234
272 3300009551 Ga0105238_10348091 Ga0105238_103480911 234
273 3300009551 Ga0105238_10370196 Ga0105238_103701963 234
274 3300009551 Ga0105238_10642085 Ga0105238_106420851 234
275 3300009553 Ga0105249_10009517 Ga0105249_100095174 234
276 3300010375 Ga0105239_10010683 Ga0105239_100106834 234
277 3300010375 Ga0105239_10011071 Ga0105239_100110714 234
278 3300010375 Ga0105239_10028364 Ga0105239_100283644 234
279 3300010375 Ga0105239_10029627 Ga0105239_100296276 234
280 3300010375 Ga0105239_10529675 Ga0105239_105296752 234
281 3300011119 Ga0105246_10013333 Ga0105246_100133336 234
282 3300011119 Ga0105246_10027766 Ga0105246_100277666 234
283 3300011119 Ga0105246_10303823 Ga0105246_103038232 234
284 3300011119 Ga0105246_10584421 Ga0105246_105844211 234
285 3300013104 Ga0157370_10001733 Ga0157370_1000173311 234
286 3300013104 Ga0157370_10003270 Ga0157370_1000327011 234
287 3300013104 Ga0157370_10032457 Ga0157370_100324575 234
288 3300013104 Ga0157370_10132190 Ga0157370_101321902 234
289 3300013104 Ga0157370_10239498 Ga0157370_102394982 234
290 3300013105 Ga0157369_10004743 Ga0157369_1000474310 234
291 3300013105 Ga0157369_10010200 Ga0157369_100102006 234
292 3300013105 Ga0157369_10040053 Ga0157369_100400535 234
293 3300013105 Ga0157369_10085323 Ga0157369_100853232 234
294 3300013296 Ga0157374_10063327 Ga0157374_100633274 234
295 3300013296 Ga0157374_10067952 Ga0157374_100679523 234
296 3300013296 Ga0157374_10069124 Ga0157374_100691242 234
297 3300013296 Ga0157374_10072565 Ga0157374_100725655 234
298 3300013296 Ga0157374_10222409 Ga0157374_102224092 234
299 3300013296 Ga0157374_10310016 Ga0157374_103100162 234
300 3300013296 Ga0157374_10421479 Ga0157374_104214791 234
301 3300013297 Ga0157378_10001898 Ga0157378_100018987 234
302 3300013297 Ga0157378_10003929 Ga0157378_100039295 234
303 3300013297 Ga0157378_10012987 Ga0157378_100129874 234
304 3300013297 Ga0157378_10115656 Ga0157378_101156561 234
305 3300013297 Ga0157378_10179491 Ga0157378_101794912 234
306 3300013297 Ga0157378_10218029 Ga0157378_102180292 234
307 3300013297 Ga0157378_10297574 Ga0157378_102975742 234
308 3300013297 Ga0157378_10578752 Ga0157378_105787521 234
309 3300013297 Ga0157378_10625605 Ga0157378_106256051 234
310 3300013297 Ga0157378_10784376 Ga0157378_107843761 234
311 3300013306 Ga0163162_10003543 Ga0163162_100035434 234
312 3300013306 Ga0163162_10016295 Ga0163162_100162956 234
313 3300013306 Ga0163162_10104866 Ga0163162_101048661 234
314 3300013306 Ga0163162_10209912 Ga0163162_102099122 234
315 3300013306 Ga0163162_10513070 Ga0163162_105130702 234
316 3300013306 Ga0163162_10779527 Ga0163162_107795272 234
317 3300013306 Ga0163162_11351926 Ga0163162_113519261 234
318 3300013307 Ga0157372_10088667 Ga0157372_100886672 234
319 3300013307 Ga0157372_10094141 Ga0157372_100941412 234
320 3300013307 Ga0157372_10144222 Ga0157372_101442225 234
321 3300013307 Ga0157372_10266572 Ga0157372_102665722 234
322 3300013308 Ga0157375_10005323 Ga0157375_100053235 234
323 3300013308 Ga0157375_10064400 Ga0157375_100644003 234
324 3300013308 Ga0157375_10081184 Ga0157375_100811842 234
325 3300013308 Ga0157375_10365727 Ga0157375_103657272 234
326 3300013308 Ga0157375_10533105 Ga0157375_105331052 234
327 3300013308 Ga0157375_10536502 Ga0157375_105365021 234
328 3300013308 Ga0157375_10661389 Ga0157375_106613892 234
329 3300013308 Ga0157375_10681028 Ga0157375_106810282 234
330 3300013308 Ga0157375_10722039 Ga0157375_107220392 234
331 3300014325 Ga0163163_10005414 Ga0163163_100054147 234
332 3300014325 Ga0163163_10006715 Ga0163163_100067152 234
333 3300014325 Ga0163163_10015575 Ga0163163_100155752 234
334 3300014325 Ga0163163_10027228 Ga0163163_100272282 234
335 3300014325 Ga0163163_10033698 Ga0163163_100336984 234
336 3300014325 Ga0163163_10078549 Ga0163163_100785493 234
337 3300014325 Ga0163163_10102741 Ga0163163_101027414 234
338 3300014325 Ga0163163_10171701 Ga0163163_101717012 234
339 3300014325 Ga0163163_10220085 Ga0163163_102200852 234
340 3300014325 Ga0163163_10278708 Ga0163163_102787081 234
341 3300014325 Ga0163163_10413896 Ga0163163_104138961 234
342 3300014325 Ga0163163_10570566 Ga0163163_105705661 234
343 3300014325 Ga0163163_10623996 Ga0163163_106239961 234
344 3300014326 Ga0157380_10039169 Ga0157380_100391692 234
345 3300014326 Ga0157380_10242050 Ga0157380_102420502 234
346 3300014326 Ga0157380_10572221 Ga0157380_105722211 234
347 3300014968 Ga0157379_10018470 Ga0157379_100184703 234
348 3300014968 Ga0157379_10063826 Ga0157379_100638264 234
349 3300014968 Ga0157379_10508449 Ga0157379_105084492 234
350 3300014968 Ga0157379_10527357 Ga0157379_105273572 234
351 3300014968 Ga0157379_10596119 Ga0157379_105961192 234
352 3300014969 Ga0157376_10108109 Ga0157376_101081092 234
353 3300014969 Ga0157376_10120322 Ga0157376_101203223 234
354 3300014969 Ga0157376_10201002 Ga0157376_102010022 234
355 3300014969 Ga0157376_10322746 Ga0157376_103227462 234
356 3300014969 Ga0157376_10398599 Ga0157376_103985992 234
357 3300025321 Ga0207656_10230793 Ga0207656_102307931 234
358 3300025899 Ga0207642_10124897 Ga0207642_101248971 234
359 3300025903 Ga0207680_10034916 Ga0207680_100349164 234
360 3300025903 Ga0207680_10511611 Ga0207680_105116111 234
361 3300025911 Ga0207654_10007504 Ga0207654_100075044 234
362 3300025911 Ga0207654_10008176 Ga0207654_100081763 234
363 3300025911 Ga0207654_10055078 Ga0207654_100550782 234
364 3300025911 Ga0207654_10231162 Ga0207654_102311622 234
365 3300025912 Ga0207707_10000684 Ga0207707_1000068410 234
366 3300025912 Ga0207707_10112457 Ga0207707_101124572 234
367 3300025912 Ga0207707_10148104 Ga0207707_101481042 234
368 3300025912 Ga0207707_10293890 Ga0207707_102938902 234
369 3300025913 Ga0207695_10002411 Ga0207695_100024112 234
370 3300025913 Ga0207695_10013324 Ga0207695_1001332410 234
371 3300025913 Ga0207695_10017685 Ga0207695_100176859 234
372 3300025913 Ga0207695_10019139 Ga0207695_100191396 234
373 3300025913 Ga0207695_10125494 Ga0207695_101254942 234
374 3300025913 Ga0207695_10375259 Ga0207695_103752592 234
375 3300025913 Ga0207695_10458774 Ga0207695_104587742 234
376 3300025913 Ga0207695_10501779 Ga0207695_105017792 234
377 3300025914 Ga0207671_10109280 Ga0207671_101092802 234
378 3300025914 Ga0207671_10145663 Ga0207671_101456631 234
379 3300025914 Ga0207671_10162510 Ga0207671_101625102 234
380 3300025914 Ga0207671_10228348 Ga0207671_102283482 234
381 3300025914 Ga0207671_10312852 Ga0207671_103128522 234
382 3300025916 Ga0207663_10024777 Ga0207663_100247774 234
383 3300025916 Ga0207663_10130826 Ga0207663_101308262 234
384 3300025917 Ga0207660_10009072 Ga0207660_100090722 234
385 3300025917 Ga0207660_10038258 Ga0207660_100382582 234
386 3300025918 Ga0207662_10212784 Ga0207662_102127841 234
387 3300025919 Ga0207657_10012255 Ga0207657_100122555 234
388 3300025919 Ga0207657_10034860 Ga0207657_100348603 234
389 3300025919 Ga0207657_10079881 Ga0207657_100798814 234
390 3300025920 Ga0207649_10146318 Ga0207649_101463183 234
391 3300025921 Ga0207652_10031216 Ga0207652_100312162 234
392 3300025921 Ga0207652_10152293 Ga0207652_101522933 234
393 3300025922 Ga0207646_10088273 Ga0207646_100882732 234
394 3300025924 Ga0207694_10003273 Ga0207694_100032737 234
395 3300025924 Ga0207694_10003730 Ga0207694_100037306 234
396 3300025924 Ga0207694_10015269 Ga0207694_100152695 234
397 3300025924 Ga0207694_10029198 Ga0207694_100291984 234
398 3300025924 Ga0207694_10087637 Ga0207694_100876373 234
399 3300025924 Ga0207694_10105887 Ga0207694_101058871 234
400 3300025924 Ga0207694_10232241 Ga0207694_102322411 234
401 3300025924 Ga0207694_10365277 Ga0207694_103652772 234
402 3300025925 Ga0207650_10022870 Ga0207650_100228704 234
403 3300025927 Ga0207687_10000615 Ga0207687_100006158 234
404 3300025927 Ga0207687_10002388 Ga0207687_1000238814 234
405 3300025927 Ga0207687_10015132 Ga0207687_100151325 234
406 3300025927 Ga0207687_10022888 Ga0207687_100228882 234
407 3300025927 Ga0207687_10031178 Ga0207687_100311783 234
408 3300025927 Ga0207687_10032699 Ga0207687_100326995 234
409 3300025927 Ga0207687_10042953 Ga0207687_100429531 234
410 3300025927 Ga0207687_10071858 Ga0207687_100718582 234
411 3300025927 Ga0207687_10361564 Ga0207687_103615642 234
412 3300025928 Ga0207700_10007797 Ga0207700_100077973 234
413 3300025928 Ga0207700_10016437 Ga0207700_100164372 234
414 3300025928 Ga0207700_10162335 Ga0207700_101623352 234
415 3300025928 Ga0207700_10403327 Ga0207700_104033272 234
416 3300025928 Ga0207700_10788148 Ga0207700_107881482 234
417 3300025929 Ga0207664_10148545 Ga0207664_101485452 234
418 3300025931 Ga0207644_10096761 Ga0207644_100967611 234
419 3300025931 Ga0207644_10292988 Ga0207644_102929881 234
420 3300025932 Ga0207690_10121896 Ga0207690_101218962 234
421 3300025933 Ga0207706_10010848 Ga0207706_100108485 234
422 3300025933 Ga0207706_10265246 Ga0207706_102652462 234
423 3300025934 Ga0207686_10007390 Ga0207686_100073901 234
424 3300025934 Ga0207686_10007614 Ga0207686_100076145 234
425 3300025934 Ga0207686_10058827 Ga0207686_100588273 234
426 3300025934 Ga0207686_10074536 Ga0207686_100745362 234
427 3300025934 Ga0207686_10078201 Ga0207686_100782012 234
428 3300025934 Ga0207686_10080439 Ga0207686_100804393 234
429 3300025934 Ga0207686_10146652 Ga0207686_101466522 234
430 3300025935 Ga0207709_10071855 Ga0207709_100718552 234
431 3300025936 Ga0207670_10024442 Ga0207670_100244423 234
432 3300025938 Ga0207704_10020800 Ga0207704_100208002 234
433 3300025938 Ga0207704_10047949 Ga0207704_100479493 234
434 3300025940 Ga0207691_10110974 Ga0207691_101109741 234
435 3300025940 Ga0207691_10407610 Ga0207691_104076102 234
436 3300025941 Ga0207711_10000207 Ga0207711_1000020755 234
437 3300025941 Ga0207711_10001638 Ga0207711_100016385 234
438 3300025941 Ga0207711_10007210 Ga0207711_100072108 234
439 3300025941 Ga0207711_10022429 Ga0207711_100224295 234
440 3300025941 Ga0207711_10041712 Ga0207711_100417122 234
441 3300025941 Ga0207711_10093431 Ga0207711_100934312 234
442 3300025941 Ga0207711_10169272 Ga0207711_101692723 234
443 3300025941 Ga0207711_10199657 Ga0207711_101996573 234
444 3300025941 Ga0207711_10285077 Ga0207711_102850772 234
445 3300025941 Ga0207711_10345190 Ga0207711_103451902 234
446 3300025942 Ga0207689_10061818 Ga0207689_100618182 234
447 3300025942 Ga0207689_10116681 Ga0207689_101166813 234
448 3300025942 Ga0207689_10666243 Ga0207689_106662431 234
449 3300025944 Ga0207661_10005447 Ga0207661_100054473 234
450 3300025944 Ga0207661_10009405 Ga0207661_100094057 234
451 3300025944 Ga0207661_10015726 Ga0207661_100157265 234
452 3300025944 Ga0207661_10062858 Ga0207661_100628583 234
453 3300025944 Ga0207661_10429628 Ga0207661_104296282 234
454 3300025945 Ga0207679_10017573 Ga0207679_100175733 234
455 3300025945 Ga0207679_10125327 Ga0207679_101253272 234
456 3300025945 Ga0207679_10309879 Ga0207679_103098792 234
457 3300025945 Ga0207679_10390565 Ga0207679_103905652 234
458 3300025945 Ga0207679_10599340 Ga0207679_105993402 234
459 3300025949 Ga0207667_10001255 Ga0207667_1000125519 234
460 3300025949 Ga0207667_10015370 Ga0207667_100153704 234
461 3300025949 Ga0207667_10015668 Ga0207667_100156683 234
462 3300025949 Ga0207667_10019763 Ga0207667_100197634 234
463 3300025949 Ga0207667_10043664 Ga0207667_100436644 234
464 3300025949 Ga0207667_10126843 Ga0207667_101268433 234
465 3300025949 Ga0207667_10234170 Ga0207667_102341702 234
466 3300025960 Ga0207651_10045725 Ga0207651_100457254 234
467 3300025960 Ga0207651_10094790 Ga0207651_100947902 234
468 3300025961 Ga0207712_10010889 Ga0207712_100108895 234
469 3300025981 Ga0207640_10435884 Ga0207640_104358841 234
470 3300025986 Ga0207658_10039244 Ga0207658_100392442 234
471 3300025986 Ga0207658_10161180 Ga0207658_101611802 234
472 3300025986 Ga0207658_10341024 Ga0207658_103410242 234
473 3300026023 Ga0207677_10010460 Ga0207677_100104602 234
474 3300026023 Ga0207677_10354736 Ga0207677_103547362 234
475 3300026023 Ga0207677_10448855 Ga0207677_104488552 234
476 3300026035 Ga0207703_10068429 Ga0207703_100684292 234
477 3300026035 Ga0207703_10080218 Ga0207703_100802182 234
478 3300026041 Ga0207639_10122814 Ga0207639_101228142 234
479 3300026041 Ga0207639_10234835 Ga0207639_102348352 234
480 3300026041 Ga0207639_10244257 Ga0207639_102442573 234
481 3300026078 Ga0207702_10033941 Ga0207702_100339413 234
482 3300026078 Ga0207702_10120988 Ga0207702_101209883 234
483 3300026078 Ga0207702_10347159 Ga0207702_103471591 234
484 3300026088 Ga0207641_10079572 Ga0207641_100795722 234
485 3300026088 Ga0207641_10350538 Ga0207641_103505382 234
486 3300026088 Ga0207641_10564372 Ga0207641_105643722 234
487 3300026088 Ga0207641_10748789 Ga0207641_107487892 234
488 3300026089 Ga0207648_10082092 Ga0207648_100820923 234
489 3300026089 Ga0207648_10110615 Ga0207648_101106153 234
490 3300026089 Ga0207648_10263112 Ga0207648_102631122 234
491 3300026095 Ga0207676_10004508 Ga0207676_100045084 234
492 3300026095 Ga0207676_10015043 Ga0207676_100150432 234
493 3300026116 Ga0207674_10000252 Ga0207674_1000025217 234
494 3300026116 Ga0207674_10002778 Ga0207674_100027787 234
495 3300026116 Ga0207674_10020948 Ga0207674_100209486 234
496 3300026116 Ga0207674_10038242 Ga0207674_100382422 234
497 3300026116 Ga0207674_10393383 Ga0207674_103933832 234
498 3300026118 Ga0207675_100079920 Ga0207675_1000799204 234
499 3300026121 Ga0207683_10562854 Ga0207683_105628541 234
500 3300026142 Ga0207698_10087334 Ga0207698_100873342 234
501 3300026142 Ga0207698_10165103 Ga0207698_101651032 234
502 3300027671 Ga0209588_1089657 Ga0209588_10896571 234
503 3300028379 Ga0268266_10019226 Ga0268266_100192262 234
504 3300028379 Ga0268266_10087524 Ga0268266_100875243 234
505 3300028379 Ga0268266_10398170 Ga0268266_103981701 234
506 3300028380 Ga0268265_10173647 Ga0268265_101736472 234
507 3300028380 Ga0268265_10272682 Ga0268265_102726822 234
508 3300028381 Ga0268264_10036700 Ga0268264_100367004 234
509 3300031090 Ga0265760_10007034 Ga0265760_100070343 234
510 3300031242 Ga0265329_10028572 Ga0265329_100285722 234
511 3300031250 Ga0265331_10215362 Ga0265331_102153621 234
512 3300031595 Ga0265313_10006675 Ga0265313_100066754 234
513 3300031595 Ga0265313_10009655 Ga0265313_100096552 234
514 3300031711 Ga0265314_10001386 Ga0265314_1000138626 234
515 3300031711 Ga0265314_10005349 Ga0265314_1000534912 234
516 3300031911 Ga0307412_10355170 Ga0307412_103551701 234
517 3300035083 Ga0373926_0000614 Ga0373926_0000614_1394_2098 234
518 3300035086 Ga0373934_0004206 Ga0373934_0004206_911_1615 234
519 3300035092 Ga0373952_0031857 Ga0373952_0031857_405_1109 234
520 3300035111 Ga0373923_0011426 Ga0373923_0011426_1696_2400 234
521 3300035114 Ga0373939_0192345 Ga0373939_0192345_21_725 234
522 3300035117 Ga0373953_0035336 Ga0373953_0035336_71_775 234
523 3300035118 Ga0373954_0002133 Ga0373954_0002133_4722_5426 234
524 3300035118 Ga0373954_0257828 Ga0373954_0257828_106_810 234
525 3300035119 Ga0373956_0042534 Ga0373956_0042534_706_1410 234
526 3300035119 Ga0373956_0219625 Ga0373956_0219625_79_783 234
527 3300035119 Ga0373956_0274475 Ga0373956_0274475_62_766 234
528 3300035120 Ga0373957_0117090 Ga0373957_0117090_206_988 234
529 3300035170 Ga0373943_0138686 Ga0373943_0138686_64_768 234
530 3300035171 Ga0373946_0178564 Ga0373946_0178564_94_798 234
531 3300035172 Ga0373955_0006974 Ga0373955_0006974_4145_4849 234
532 3300035172 Ga0373955_0081164 Ga0373955_0081164_276_980 234
533 3300035172 Ga0373955_0081681 Ga0373955_0081681_360_1064 234
534 3300035172 Ga0373955_0088444 Ga0373955_0088444_314_1018 234
535 3300035692 Ga0373935_0000902 Ga0373935_0000902_13326_14030 234
536 3300035692 Ga0373935_0028083 Ga0373935_0028083_264_968 234
537 3300035692 Ga0373935_0522022 Ga0373935_0522022_23_727 234
538 3300035695 Ga0373927_0004041 Ga0373927_0004041_2978_3682 234
539 3300035695 Ga0373927_0005586 Ga0373927_0005586_3891_4595 234
540 3300035695 Ga0373927_0080942 Ga0373927_0080942_311_1015 234
541 3300035695 Ga0373927_0188568 Ga0373927_0188568_554_1258 234
542 3300035724 Ga0373933_0016981 Ga0373933_0016981_1275_1979 234
543 3300035724 Ga0373933_0044230 Ga0373933_0044230_1372_2076 234
544 3300035724 Ga0373933_0266037 Ga0373933_0266037_193_897 234
545 3300035725 Ga0373947_0015220 Ga0373947_0015220_3055_3759 234
546 3300035725 Ga0373947_0069973 Ga0373947_0069973_691_1395 234
547 3300035725 Ga0373947_0070709 Ga0373947_0070709_307_1011 234
548 3300036401 Ga0373937_0001951 Ga0373937_0001951_10506_11210 234
549 3300036401 Ga0373937_0004398 Ga0373937_0004398_3155_3859 234
550 3300036401 Ga0373937_0012599 Ga0373937_0012599_4938_5723 234
551 3300036401 Ga0373937_0023943 Ga0373937_0023943_829_1533 234
552 3300036401 Ga0373937_0127113 Ga0373937_0127113_1066_1770 234
553 3300036401 Ga0373937_0210578 Ga0373937_0210578_334_1038 234
554 3300036401 Ga0373937_0272259 Ga0373937_0272259_834_1538 234
555 3300036401 Ga0373937_0299426 Ga0373937_0299426_493_1197 234
556 3300036401 Ga0373937_0356081 Ga0373937_0356081_649_1353 234
557 3300036401 Ga0373937_0359925 Ga0373937_0359925_493_1227 234
558 3300036401 Ga0373937_0535302 Ga0373937_0535302_180_884 234
559 3300036401 Ga0373937_0665295 Ga0373937_0665295_251_955 234
560 3300036401 Ga0373937_0715231 Ga0373937_0715231_212_916 234
561 3300037068 Ga0373925_0009351 Ga0373925_0009351_4378_5082 234
562 3300041408 Ga0439453_0034636 Ga0439453_0034636_62_766 234
563 3300045051 Ga0451576_0397770 Ga0451576_0397770_542_1246 234
564 3300046454 Ga0495592_0011052 Ga0495592_0011052_1000_1704 234
565 3300046454 Ga0495592_0022690 Ga0495592_0022690_3816_4520 234
566 3300046454 Ga0495592_0033271 Ga0495592_0033271_3048_3752 234
567 3300046454 Ga0495592_0063728 Ga0495592_0063728_32_736 234
568 3300046454 Ga0495592_0071647 Ga0495592_0071647_572_1276 234
569 3300046459 Ga0495629_0063335 Ga0495629_0063335_1582_2286 234
570 3300046462 Ga0495651_0000126 Ga0495651_0000126_21629_22333 234
571 3300046462 Ga0495651_0005148 Ga0495651_0005148_9157_9861 234
572 3300046462 Ga0495651_0009981 Ga0495651_0009981_1511_2215 234
573 3300046462 Ga0495651_0417465 Ga0495651_0417465_81_785 234
574 3300046463 Ga0495653_0010223 Ga0495653_0010223_3175_3879 234
575 3300046463 Ga0495653_0088967 Ga0495653_0088967_198_902 234
576 3300046463 Ga0495653_0127564 Ga0495653_0127564_1004_1708 234
577 3300046463 Ga0495653_0145011 Ga0495653_0145011_501_1205 234
578 3300046463 Ga0495653_0460601 Ga0495653_0460601_31_735 234
579 3300046472 Ga0495580_0005481 Ga0495580_0005481_1150_1854 234
580 3300046472 Ga0495580_0015510 Ga0495580_0015510_4876_5580 234
581 3300046472 Ga0495580_0018716 Ga0495580_0018716_2134_2838 234
582 3300046472 Ga0495580_0164608 Ga0495580_0164608_142_846 234
583 3300046472 Ga0495580_0264332 Ga0495580_0264332_398_1102 234
584 3300046472 Ga0495580_0283151 Ga0495580_0283151_176_880 234
585 3300046473 Ga0495582_0049359 Ga0495582_0049359_50_754 234
586 3300046473 Ga0495582_0126266 Ga0495582_0126266_509_1258 234
587 3300046475 Ga0495639_0069564 Ga0495639_0069564_582_1325 234
588 3300046475 Ga0495639_0117335 Ga0495639_0117335_485_1189 234
589 3300046475 Ga0495639_0207836 Ga0495639_0207836_151_900 234
590 3300046477 Ga0495664_0019425 Ga0495664_0019425_742_1446 234
591 3300046499 Ga0495594_0113942 Ga0495594_0113942_129_833 234
592 3300046511 Ga0495608_0006811 Ga0495608_0006811_2830_3534 234
593 3300046511 Ga0495608_0010563 Ga0495608_0010563_2561_3265 234
594 3300046511 Ga0495608_0029614 Ga0495608_0029614_1522_2226 234
595 3300046511 Ga0495608_0043759 Ga0495608_0043759_87_872 234
596 3300046514 Ga0495618_0007195 Ga0495618_0007195_2681_3385 234
597 3300046516 Ga0495628_0001880 Ga0495628_0001880_6026_6730 234
598 3300046516 Ga0495628_0012049 Ga0495628_0012049_616_1320 234
599 3300046516 Ga0495628_0018608 Ga0495628_0018608_3595_4299 234
600 3300046516 Ga0495628_0301316 Ga0495628_0301316_358_1062 234
601 3300046517 Ga0495630_0001011 Ga0495630_0001011_18236_18940 234
602 3300046517 Ga0495630_0003853 Ga0495630_0003853_7756_8460 234
603 3300046517 Ga0495630_0017821 Ga0495630_0017821_2612_3316 234
604 3300046526 Ga0495666_0020095 Ga0495666_0020095_2293_2997 234
605 3300046529 Ga0495652_0013561 Ga0495652_0013561_686_1390 234
606 3300046529 Ga0495652_0016762 Ga0495652_0016762_2191_2895 234
607 3300046529 Ga0495652_0064347 Ga0495652_0064347_1269_1973 234
608 3300046531 Ga0495665_0013131 Ga0495665_0013131_3328_4032 234
609 3300046531 Ga0495665_0085639 Ga0495665_0085639_874_1578 234
610 3300046535 Ga0495586_0000405 Ga0495586_0000405_3088_3792 234
611 3300046535 Ga0495586_0069027 Ga0495586_0069027_1117_1821 234
612 3300046535 Ga0495586_0181340 Ga0495586_0181340_80_784 234
613 3300046535 Ga0495586_0193084 Ga0495586_0193084_422_1129 234
614 3300046535 Ga0495586_0205454 Ga0495586_0205454_219_923 234
615 3300046535 Ga0495586_0247271 Ga0495586_0247271_263_967 234
616 3300046536 Ga0495587_0001076 Ga0495587_0001076_7322_8026 234
617 3300046536 Ga0495587_0004806 Ga0495587_0004806_7976_8680 234
618 3300046536 Ga0495587_0128957 Ga0495587_0128957_477_1181 234
619 3300046539 Ga0495621_0015319 Ga0495621_0015319_413_1117 234
620 3300046543 Ga0495645_0002936 Ga0495645_0002936_5963_6667 234
621 3300046543 Ga0495645_0024700 Ga0495645_0024700_358_1062 234
622 3300046543 Ga0495645_0132836 Ga0495645_0132836_505_1209 234
623 3300046543 Ga0495645_0222984 Ga0495645_0222984_300_1004 234
624 3300046559 Ga0495667_0001136 Ga0495667_0001136_8167_8952 234
625 3300046559 Ga0495667_0013664 Ga0495667_0013664_4727_5431 234
626 3300046559 Ga0495667_0219038 Ga0495667_0219038_348_1052 234
627 3300046559 Ga0495667_0274600 Ga0495667_0274600_337_1041 234
628 3300046642 Ga0495634_0040074 Ga0495634_0040074_1623_2327 234
629 3300046663 Ga0495635_0054682 Ga0495635_0054682_32_736 234
630 3300046663 Ga0495635_0130570 Ga0495635_0130570_977_1681 234
631 3300046663 Ga0495635_0190783 Ga0495635_0190783_497_1201 234
632 3300046675 Ga0495657_0004041 Ga0495657_0004041_7699_8484 234
633 3300046675 Ga0495657_0145507 Ga0495657_0145507_86_790 234
634 3300046678 Ga0495599_0003977 Ga0495599_0003977_4129_4833 234
635 3300046678 Ga0495599_0018901 Ga0495599_0018901_3389_4093 234
636 3300046679 Ga0495623_0003934 Ga0495623_0003934_3050_3754 234
637 3300046679 Ga0495623_0260433 Ga0495623_0260433_230_934 234
638 3300046680 Ga0495646_0000785 Ga0495646_0000785_5676_6380 234
639 3300046680 Ga0495646_0058133 Ga0495646_0058133_1273_1977 234
640 3300046683 Ga0495658_0045096 Ga0495658_0045096_567_1274 234
641 3300046683 Ga0495658_0171042 Ga0495658_0171042_107_856 234
642 3300046689 Ga0495613_0056494 Ga0495613_0056494_279_983 234
643 3300046689 Ga0495613_0168362 Ga0495613_0168362_648_1352 234
644 3300046689 Ga0495613_0545359 Ga0495613_0545359_10_714 234
645 3300046690 Ga0495624_0016528 Ga0495624_0016528_3220_3924 234
646 3300046690 Ga0495624_0393308 Ga0495624_0393308_19_723 234
647 3300046809 Ga0495600_0003140 Ga0495600_0003140_2082_2786 234
648 3300046809 Ga0495600_0082885 Ga0495600_0082885_76_780 234
649 3300047317 Ga0495604_0005091 Ga0495604_0005091_5977_6681 234
650 3300047317 Ga0495604_0010297 Ga0495604_0010297_4524_5228 234
651 3300047317 Ga0495604_0044978 Ga0495604_0044978_2286_2990 234
652 3300047317 Ga0495604_0400656 Ga0495604_0400656_88_792 234
653 3300047319 Ga0495674_0001401 Ga0495674_0001401_9283_9987 234
654 3300047319 Ga0495674_0013223 Ga0495674_0013223_3645_4349 234
655 3300047319 Ga0495674_0020559 Ga0495674_0020559_4754_5458 234
656 3300047319 Ga0495674_0024847 Ga0495674_0024847_1435_2139 234
657 3300047319 Ga0495674_0055836 Ga0495674_0055836_1701_2405 234
658 3300047319 Ga0495674_0236338 Ga0495674_0236338_191_895 234
659 3300047321 Ga0495676_0046014 Ga0495676_0046014_1845_2549 234
660 3300047322 Ga0495680_0000253 Ga0495680_0000253_18294_18998 234
661 3300047322 Ga0495680_0001258 Ga0495680_0001258_17899_18603 234
662 3300047322 Ga0495680_0089003 Ga0495680_0089003_744_1448 234
663 3300047322 Ga0495680_0096719 Ga0495680_0096719_61_765 234
664 3300047444 Ga0495675_0000165 Ga0495675_0000165_15844_16548 234
665 3300047444 Ga0495675_0005957 Ga0495675_0005957_1943_2647 234
666 3300047444 Ga0495675_0178269 Ga0495675_0178269_510_1214 234
667 3300047471 Ga0495684_0009716 Ga0495684_0009716_3517_4221 234
668 3300047471 Ga0495684_0012342 Ga0495684_0012342_1127_1831 234
669 3300047471 Ga0495684_0013320 Ga0495684_0013320_1199_1903 234
670 3300047471 Ga0495684_0025018 Ga0495684_0025018_2968_3672 234
671 3300047471 Ga0495684_0076222 Ga0495684_0076222_177_881 234
672 3300047471 Ga0495684_0203701 Ga0495684_0203701_374_1078 234
673 3300047471 Ga0495684_0311031 Ga0495684_0311031_152_934 234
674 3300048088 Ga0495602_0003164 Ga0495602_0003164_9133_9837 234
675 3300048088 Ga0495602_0012198 Ga0495602_0012198_6757_7461 234
676 3300048088 Ga0495602_0021669 Ga0495602_0021669_5162_5866 234
677 3300048088 Ga0495602_0081110 Ga0495602_0081110_1030_1734 234
678 3300048088 Ga0495602_0228155 Ga0495602_0228155_246_950 234
679 3300048907 Ga0496104_0358451 Ga0496104_0358451_490_1194 234
680 3300048915 Ga0496112_0440891 Ga0496112_0440891_335_1039 234
681 3300048918 Ga0496115_0142022 Ga0496115_0142022_497_1321 234
682 3300049581 Ga0501047_0104620 Ga0501047_0104620_1509_2213 234
683 3300050507 nmdc:mga05p37_105860_c1 nmdc:mga05p37_105860_c1_2648_3352 234
684 3300050507 nmdc:mga05p37_48567_c1 nmdc:mga05p37_48567_c1_913_1617 234
685 3300050507 nmdc:mga05p37_7649_c1 nmdc:mga05p37_7649_c1_3773_4477 234
686 3300050507 nmdc:mga05p37_827925_c1 nmdc:mga05p37_827925_c1_58_762 234
687 3300050508 nmdc:mga09592_296325_c1 nmdc:mga09592_296325_c1_686_1390 234
688 3300050510 nmdc:mga06r32_84513_c1 nmdc:mga06r32_84513_c1_1447_2151 234
689 3300050511 nmdc:mga08y16_249954_c1 nmdc:mga08y16_249954_c1_897_1601 234
690 3300050512 nmdc:mga0n895_208421_c1 nmdc:mga0n895_208421_c1_49_753 234
691 3300050512 nmdc:mga0n895_28312_c1 nmdc:mga0n895_28312_c1_3657_4361 234
692 3300050513 nmdc:mga0rr50_280591_c1 nmdc:mga0rr50_280591_c1_675_1379 234
693 3300050514 nmdc:mga08x19_304343_c1 nmdc:mga08x19_304343_c1_294_998 234
694 3300050515 nmdc:mga0a205_218116_c1 nmdc:mga0a205_218116_c1_658_1362 234
695 3300050515 nmdc:mga0a205_30462_c1 nmdc:mga0a205_30462_c1_322_1026 234
696 3300050515 nmdc:mga0a205_398057_c1 nmdc:mga0a205_398057_c1_251_955 234
697 3300053077 Ga0495601_0195274 Ga0495601_0195274_555_1259 234
698 3300053078 Ga0495612_0003944 Ga0495612_0003944_2648_3352 234
699 3300053085 Ga0495619_0300394 Ga0495619_0300394_109_813 234
700 3300053085 Ga0495619_0551672 Ga0495619_0551672_68_772 234
701 3300053139 Ga0500568_0008529 Ga0500568_0008529_2663_3367 234
702 3300005295 Ga0065707_10150567 Ga0065707_101505671 235
703 3300005328 Ga0070676_10217763 Ga0070676_102177632 235
704 3300005330 Ga0070690_100032320 Ga0070690_1000323205 235
705 3300005331 Ga0070670_100010330 Ga0070670_1000103303 235
706 3300005333 Ga0070677_10059985 Ga0070677_100599852 235
707 3300005334 Ga0068869_100002089 Ga0068869_1000020897 235
708 3300005334 Ga0068869_100058052 Ga0068869_1000580523 235
709 3300005335 Ga0070666_10167662 Ga0070666_101676622 235
710 3300005338 Ga0068868_100047539 Ga0068868_1000475393 235
711 3300005338 Ga0068868_100206923 Ga0068868_1002069233 235
712 3300005340 Ga0070689_100223763 Ga0070689_1002237632 235
713 3300005345 Ga0070692_10062155 Ga0070692_100621553 235
714 3300005353 Ga0070669_100033005 Ga0070669_1000330053 235
715 3300005354 Ga0070675_100000819 Ga0070675_1000008196 235
716 3300005354 Ga0070675_100004909 Ga0070675_1000049093 235
717 3300005354 Ga0070675_100005091 Ga0070675_1000050913 235
718 3300005354 Ga0070675_100129004 Ga0070675_1001290041 235
719 3300005355 Ga0070671_100046964 Ga0070671_1000469642 235
720 3300005355 Ga0070671_100351943 Ga0070671_1003519432 235
721 3300005356 Ga0070674_100081645 Ga0070674_1000816454 235
722 3300005356 Ga0070674_100145780 Ga0070674_1001457803 235
723 3300005356 Ga0070674_100187972 Ga0070674_1001879722 235
724 3300005364 Ga0070673_100023649 Ga0070673_1000236493 235
725 3300005364 Ga0070673_100201593 Ga0070673_1002015932 235
726 3300005364 Ga0070673_100246687 Ga0070673_1002466872 235
727 3300005365 Ga0070688_100443521 Ga0070688_1004435211 235
728 3300005367 Ga0070667_100082948 Ga0070667_1000829482 235
729 3300005438 Ga0070701_10049956 Ga0070701_100499562 235
730 3300005440 Ga0070705_100305830 Ga0070705_1003058302 235
731 3300005441 Ga0070700_100001632 Ga0070700_1000016327 235
732 3300005444 Ga0070694_100065444 Ga0070694_1000654443 235
733 3300005444 Ga0070694_100387784 Ga0070694_1003877842 235
734 3300005455 Ga0070663_100087079 Ga0070663_1000870793 235
735 3300005456 Ga0070678_100273146 Ga0070678_1002731462 235
736 3300005457 Ga0070662_100101600 Ga0070662_1001016002 235
737 3300005459 Ga0068867_100021545 Ga0068867_1000215452 235
738 3300005467 Ga0070706_100077523 Ga0070706_1000775233 235
739 3300005468 Ga0070707_100203689 Ga0070707_1002036892 235
740 3300005471 Ga0070698_100108751 Ga0070698_1001087514 235
741 3300005518 Ga0070699_100000875 Ga0070699_10000087524 235
742 3300005543 Ga0070672_100082506 Ga0070672_1000825062 235
743 3300005543 Ga0070672_100126706 Ga0070672_1001267062 235
744 3300005544 Ga0070686_100044340 Ga0070686_1000443402 235
745 3300005545 Ga0070695_100081632 Ga0070695_1000816323 235
746 3300005546 Ga0070696_100088620 Ga0070696_1000886203 235
747 3300005548 Ga0070665_100583453 Ga0070665_1005834532 235
748 3300005549 Ga0070704_100105274 Ga0070704_1001052742 235
749 3300005549 Ga0070704_100825013 Ga0070704_1008250131 235
750 3300005564 Ga0070664_100007317 Ga0070664_10000731711 235
751 3300005617 Ga0068859_100001734 Ga0068859_10000173412 235
752 3300005617 Ga0068859_100004423 Ga0068859_10000442312 235
753 3300005618 Ga0068864_100263442 Ga0068864_1002634421 235
754 3300005718 Ga0068866_10010753 Ga0068866_100107535 235
755 3300005719 Ga0068861_100051526 Ga0068861_1000515264 235
756 3300005719 Ga0068861_100153647 Ga0068861_1001536472 235
757 3300005719 Ga0068861_100204700 Ga0068861_1002047001 235
758 3300005719 Ga0068861_100453585 Ga0068861_1004535852 235
759 3300005719 Ga0068861_100725587 Ga0068861_1007255871 235
760 3300005840 Ga0068870_10201428 Ga0068870_102014282 235
761 3300005841 Ga0068863_100475219 Ga0068863_1004752191 235
762 3300005842 Ga0068858_100015353 Ga0068858_1000153531 235
763 3300005843 Ga0068860_100031737 Ga0068860_1000317373 235
764 3300005843 Ga0068860_100297603 Ga0068860_1002976032 235
765 3300005844 Ga0068862_100154944 Ga0068862_1001549443 235
766 3300005844 Ga0068862_100259555 Ga0068862_1002595551 235
767 3300005844 Ga0068862_100327219 Ga0068862_1003272192 235
768 3300006237 Ga0097621_100007326 Ga0097621_1000073269 235
769 3300006358 Ga0068871_100005892 Ga0068871_1000058922 235
770 3300006358 Ga0068871_100023980 Ga0068871_1000239802 235
771 3300006358 Ga0068871_100575110 Ga0068871_1005751102 235
772 3300006358 Ga0068871_100681286 Ga0068871_1006812861 235
773 3300006844 Ga0075428_100000019 Ga0075428_100000019135 235
774 3300006844 Ga0075428_100006790 Ga0075428_1000067902 235
775 3300006844 Ga0075428_100009289 Ga0075428_1000092899 235
776 3300006846 Ga0075430_100034914 Ga0075430_1000349144 235
777 3300006847 Ga0075431_100023001 Ga0075431_1000230014 235
778 3300006847 Ga0075431_100040152 Ga0075431_1000401524 235
779 3300006880 Ga0075429_100012100 Ga0075429_1000121006 235
780 3300006881 Ga0068865_100008234 Ga0068865_1000082348 235
781 3300006881 Ga0068865_100011766 Ga0068865_1000117667 235
782 3300006931 Ga0097620_100001734 Ga0097620_10000173414 235
783 3300006931 Ga0097620_100004423 Ga0097620_10000442312 235
784 3300009094 Ga0111539_10000002 Ga0111539_10000002605 235
785 3300009094 Ga0111539_10058550 Ga0111539_100585506 235
786 3300009094 Ga0111539_11241595 Ga0111539_112415951 235
787 3300009098 Ga0105245_10015086 Ga0105245_100150864 235
788 3300009147 Ga0114129_10017965 Ga0114129_100179653 235
789 3300009147 Ga0114129_10259513 Ga0114129_102595132 235
790 3300009148 Ga0105243_10019430 Ga0105243_100194303 235
791 3300009148 Ga0105243_10199346 Ga0105243_101993462 235
792 3300009148 Ga0105243_10291081 Ga0105243_102910813 235
793 3300009176 Ga0105242_10004802 Ga0105242_1000480211 235
794 3300009176 Ga0105242_10013007 Ga0105242_100130078 235
795 3300009176 Ga0105242_10086644 Ga0105242_100866442 235
796 3300009177 Ga0105248_10116151 Ga0105248_101161513 235
797 3300009177 Ga0105248_10767645 Ga0105248_107676452 235
798 3300009177 Ga0105248_10771186 Ga0105248_107711861 235
799 3300011119 Ga0105246_10285079 Ga0105246_102850792 235
800 3300013297 Ga0157378_10180595 Ga0157378_101805953 235
801 3300013306 Ga0163162_10253751 Ga0163162_102537512 235
802 3300013308 Ga0157375_10623852 Ga0157375_106238522 235
803 3300013308 Ga0157375_11344250 Ga0157375_113442502 235
804 3300014325 Ga0163163_10897605 Ga0163163_108976051 235
805 3300014325 Ga0163163_10899258 Ga0163163_108992582 235
806 3300014326 Ga0157380_10089306 Ga0157380_100893062 235
807 3300014326 Ga0157380_10120262 Ga0157380_101202623 235
808 3300014326 Ga0157380_10150459 Ga0157380_101504591 235
809 3300014326 Ga0157380_10268174 Ga0157380_102681742 235
810 3300014326 Ga0157380_10469449 Ga0157380_104694492 235
811 3300014969 Ga0157376_10010212 Ga0157376_100102128 235
812 3300014969 Ga0157376_10143468 Ga0157376_101434682 235
813 3300017792 Ga0163161_10292902 Ga0163161_102929022 235
814 3300025901 Ga0207688_10149985 Ga0207688_101499852 235
815 3300025903 Ga0207680_10034792 Ga0207680_100347924 235
816 3300025907 Ga0207645_10001872 Ga0207645_1000187210 235
817 3300025907 Ga0207645_10064264 Ga0207645_100642643 235
818 3300025907 Ga0207645_10075966 Ga0207645_100759662 235
819 3300025910 Ga0207684_10071202 Ga0207684_100712023 235
820 3300025918 Ga0207662_10137907 Ga0207662_101379072 235
821 3300025922 Ga0207646_10062415 Ga0207646_100624153 235
822 3300025923 Ga0207681_10027372 Ga0207681_100273722 235
823 3300025923 Ga0207681_10037039 Ga0207681_100370392 235
824 3300025923 Ga0207681_10104848 Ga0207681_101048483 235
825 3300025923 Ga0207681_10168940 Ga0207681_101689402 235
826 3300025925 Ga0207650_10052007 Ga0207650_100520075 235
827 3300025926 Ga0207659_10031579 Ga0207659_100315792 235
828 3300025926 Ga0207659_10033418 Ga0207659_100334182 235
829 3300025926 Ga0207659_10085404 Ga0207659_100854042 235
830 3300025926 Ga0207659_10619435 Ga0207659_106194351 235
831 3300025931 Ga0207644_10014418 Ga0207644_100144184 235
832 3300025934 Ga0207686_10001799 Ga0207686_1000179910 235
833 3300025934 Ga0207686_10112162 Ga0207686_101121623 235
834 3300025935 Ga0207709_10006604 Ga0207709_100066045 235
835 3300025935 Ga0207709_10258662 Ga0207709_102586623 235
836 3300025936 Ga0207670_10177664 Ga0207670_101776643 235
837 3300025936 Ga0207670_10457480 Ga0207670_104574801 235
838 3300025937 Ga0207669_10004816 Ga0207669_100048165 235
839 3300025938 Ga0207704_10016459 Ga0207704_100164592 235
840 3300025940 Ga0207691_10077819 Ga0207691_100778193 235
841 3300025940 Ga0207691_10101394 Ga0207691_101013942 235
842 3300025940 Ga0207691_10107778 Ga0207691_101077782 235
843 3300025941 Ga0207711_10006493 Ga0207711_100064939 235
844 3300025941 Ga0207711_10534334 Ga0207711_105343342 235
845 3300025942 Ga0207689_10002878 Ga0207689_100028789 235
846 3300025942 Ga0207689_10017739 Ga0207689_100177392 235
847 3300025945 Ga0207679_10146409 Ga0207679_101464092 235
848 3300025960 Ga0207651_10001469 Ga0207651_100014699 235
849 3300025960 Ga0207651_10034021 Ga0207651_100340213 235
850 3300025960 Ga0207651_10041524 Ga0207651_100415244 235
851 3300025961 Ga0207712_10074850 Ga0207712_100748501 235
852 3300025961 Ga0207712_10473253 Ga0207712_104732532 235
853 3300025972 Ga0207668_10036119 Ga0207668_100361192 235
854 3300025981 Ga0207640_10088904 Ga0207640_100889043 235
855 3300026023 Ga0207677_10050312 Ga0207677_100503123 235
856 3300026023 Ga0207677_10342878 Ga0207677_103428782 235
857 3300026035 Ga0207703_10331621 Ga0207703_103316212 235
858 3300026035 Ga0207703_10522471 Ga0207703_105224711 235
859 3300026067 Ga0207678_10085842 Ga0207678_100858422 235
860 3300026067 Ga0207678_10565836 Ga0207678_105658362 235
861 3300026075 Ga0207708_10003022 Ga0207708_100030228 235
862 3300026075 Ga0207708_10144762 Ga0207708_101447623 235
863 3300026075 Ga0207708_10374943 Ga0207708_103749432 235
864 3300026088 Ga0207641_10238156 Ga0207641_102381562 235
865 3300026089 Ga0207648_10002253 Ga0207648_100022536 235
866 3300026089 Ga0207648_10415245 Ga0207648_104152452 235
867 3300026095 Ga0207676_10117918 Ga0207676_101179182 235
868 3300026116 Ga0207674_10768156 Ga0207674_107681562 235
869 3300026118 Ga0207675_100043589 Ga0207675_1000435893 235
870 3300026118 Ga0207675_100069545 Ga0207675_1000695454 235
871 3300026118 Ga0207675_100140132 Ga0207675_1001401322 235
872 3300026118 Ga0207675_100189308 Ga0207675_1001893083 235
873 3300026118 Ga0207675_100733535 Ga0207675_1007335352 235
874 3300026121 Ga0207683_10277629 Ga0207683_102776292 235
875 3300027907 Ga0207428_10000004 Ga0207428_1000000450 235
876 3300028379 Ga0268266_10070530 Ga0268266_100705303 235
877 3300028380 Ga0268265_10073994 Ga0268265_100739942 235
878 3300028380 Ga0268265_10196908 Ga0268265_101969083 235
879 3300031731 Ga0307405_10030145 Ga0307405_100301452 235
880 3300031911 Ga0307412_10064463 Ga0307412_100644634 235
881 3300031995 Ga0307409_100148400 Ga0307409_1001484002 235
882 3300032002 Ga0307416_100007255 Ga0307416_1000072553 235
883 3300032005 Ga0307411_10533578 Ga0307411_105335781 235
884 3300035172 Ga0373955_0295581 Ga0373955_0295581_141_848 235
885 3300035692 Ga0373935_0037190 Ga0373935_0037190_667_1374 235
886 3300035725 Ga0373947_0596161 Ga0373947_0596161_17_724 235
887 3300037068 Ga0373925_0018646 Ga0373925_0018646_3715_4422 235
888 3300046455 Ga0495603_0409420 Ga0495603_0409420_49_762 235
889 3300046462 Ga0495651_0486437 Ga0495651_0486437_29_736 235
890 3300046472 Ga0495580_0053551 Ga0495580_0053551_1687_2394 235
891 3300046499 Ga0495594_0106000 Ga0495594_0106000_331_1044 235
892 3300046511 Ga0495608_0002023 Ga0495608_0002023_11097_11804 235
893 3300046516 Ga0495628_0066816 Ga0495628_0066816_1562_2269 235
894 3300046516 Ga0495628_0232312 Ga0495628_0232312_95_802 235
895 3300046517 Ga0495630_0001268 Ga0495630_0001268_7198_7905 235
896 3300046539 Ga0495621_0054027 Ga0495621_0054027_277_990 235
897 3300046543 Ga0495645_0038923 Ga0495645_0038923_1785_2492 235
898 3300046559 Ga0495667_0042162 Ga0495667_0042162_1610_2317 235
899 3300046642 Ga0495634_0141460 Ga0495634_0141460_428_1135 235
900 3300046679 Ga0495623_0081568 Ga0495623_0081568_1213_1920 235
901 3300046689 Ga0495613_0001706 Ga0495613_0001706_6016_6723 235
902 3300047322 Ga0495680_0186848 Ga0495680_0186848_623_1330 235
903 3300047444 Ga0495675_0148243 Ga0495675_0148243_220_927 235
904 3300047471 Ga0495684_0000125 Ga0495684_0000125_4994_5701 235
905 3300048903 Ga0496100_0005245 Ga0496100_0005245_2935_3642 235
906 3300048904 Ga0496101_0018969 Ga0496101_0018969_1361_2068 235
907 3300048907 Ga0496104_0170139 Ga0496104_0170139_670_1377 235
908 3300048907 Ga0496104_0195870 Ga0496104_0195870_1209_1916 235
909 3300048907 Ga0496104_0298439 Ga0496104_0298439_55_762 235
910 3300048910 Ga0496107_0062033 Ga0496107_0062033_1057_1764 235
911 3300048917 Ga0496114_0002302 Ga0496114_0002302_10014_10721 235
912 3300049580 Ga0501046_0234035 Ga0501046_0234035_219_926 235
913 3300049582 Ga0501048_0135796 Ga0501048_0135796_29_736 235
914 3300049590 Ga0501074_0088039 Ga0501074_0088039_307_1014 235
915 3300049591 Ga0501075_0021304 Ga0501075_0021304_2434_3141 235
916 3300049592 Ga0501076_0046871 Ga0501076_0046871_1872_2579 235
917 3300049741 Ga0501079_0042736 Ga0501079_0042736_1189_1896 235
918 3300049742 Ga0501080_0098430 Ga0501080_0098430_1666_2373 235
919 3300050508 nmdc:mga09592_3004_c1 nmdc:mga09592_3004_c1_5491_6198 235
920 3300050510 nmdc:mga06r32_149771_c1 nmdc:mga06r32_149771_c1_627_1334 235
921 3300050510 nmdc:mga06r32_208333_c1 nmdc:mga06r32_208333_c1_81_788 235
922 3300050510 nmdc:mga06r32_29148_c1 nmdc:mga06r32_29148_c1_708_1415 235
923 3300050510 nmdc:mga06r32_5990_c1 nmdc:mga06r32_5990_c1_3947_4654 235
924 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_312263_312970 235
925 3300053077 Ga0495601_0022203 Ga0495601_0022203_477_1184 235
926 3300053084 Ga0495595_0103462 Ga0495595_0103462_68_775 235
927 3300053085 Ga0495619_0021501 Ga0495619_0021501_1904_2611 235
928 3300053085 Ga0495619_0081684 Ga0495619_0081684_413_1120 235
929 3300054114 Ga0501084_0042671 Ga0501084_0042671_736_1443 235
930 3300060353 Ga0501082_0129189 Ga0501082_0129189_1249_1956 235
931 3300061734 Ga0530510_0018388 Ga0530510_0018388_3207_3914 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

235

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

246

0.92

PF08659

KR

KR domain

46

217

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9539 6 234
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9518 6 228
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9454 6 234
2ehd-assembly1.cif.gz_B crystal structure analysis of oxidoreductase 0.945 6 231
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9358 7 228
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9719 3 176 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9664 85 184 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9627 2 87 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9589 3 163 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.953 3 74 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q7S4T9-F1-model_v4 Short-chain dehydrogenase 0.9927 1 235 GO:0016491
AF-A0A7V2AD82-F1-model_v4 SDR family oxidoreductase 0.9903 1 186 GO:0016491
AF-A0A2V8KVA2-F1-model_v4 Short-chain dehydrogenase 0.9889 27 235 GO:0016491
AF-A0A1Q7S4T9-F1-model_v4 Short-chain dehydrogenase 0.9885 1 235 GO:0016491
AF-A0A496UUZ4-F1-model_v4 Short-chain dehydrogenase 0.9849 1 234 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.49 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map