F486100

General Info

Members Datasets Scaffolds Average Seq Length
933 486 1866 340

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0044542|Ga0373926_0044542_237_1220
Length 327
Sequence MTTRKMQQASILVTGVAGFIGFHTAIRLLERGERVIGLDNVNDYYDVRLKKARLAKLKPFKQFTFTKTDLADRVKMRRLFATRPIAKVVHLAAQAGVRYSLVNPHAYTDSNIEGFLNILEGCRHAKVEHLVYASSSSVYGGNTQMPFSIHDNVDHPVSLYAASKKANELMAHCYAHLYGVPCTGLRFFTKAILEGKPIEVYNHGKMRRDFTYVDDIVEGVIRTLDRPATPNRDWSGDRPDPGTSSAPARIYNIGNHQPVELLRFIEVLEQALGKHAKRKLLPIQPGDVPSTYADIEDLSRDVGFKPMTPIEVGIPRFVHWYREFYKT

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
189 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
225 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
226 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
229 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
239 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
241 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
247 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
254 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
260 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
261 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
262 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
263 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
264 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
265 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
266 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
267 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
268 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
273 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
274 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
275 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
276 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
277 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
278 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
279 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
280 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
281 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
284 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
285 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
286 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
289 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
292 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
293 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
294 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
309 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
336 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
337 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
338 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
339 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
340 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
341 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
342 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
343 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
344 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
345 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
346 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
347 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
348 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
371 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
372 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
373 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
374 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
375 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
376 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
377 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
378 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
379 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
380 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
381 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
382 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
383 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
384 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
385 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
386 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
387 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
388 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
389 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
390 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
391 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
392 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
393 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
394 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
395 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
396 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
397 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
398 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
399 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
400 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
401 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
402 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
403 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
404 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
405 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
406 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
407 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
408 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
409 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
410 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
411 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
412 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
413 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
414 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
415 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
416 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
417 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
418 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
419 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
420 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
421 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
422 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
423 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
428 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
429 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
430 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
431 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
432 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
433 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
434 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
435 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
436 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
437 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
438 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
439 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
440 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
441 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
442 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
443 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
444 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
445 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
446 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
447 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
448 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
449 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
450 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
451 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
452 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
453 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
454 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
455 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
456 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
457 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
458 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
459 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
460 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
461 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
462 2547132512 Azospira oryzae 6a3 Isolate Unclassified
463 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
464 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
465 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
466 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
467 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
468 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
469 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
470 2738541337 Pelomonas sp. BT06 Isolate Unclassified
471 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
472 2831864461 Roseateles noduli HZ7 Isolate Nodule
473 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
474 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
475 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
476 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
477 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
478 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
479 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
480 2932406140 Serratia sp. 2723 Isolate Rhizosphere
481 2937967321 Serratia sp. YC16 Isolate Unclassified
482 2939577877 Serratia sp. 509 Isolate Rhizosphere
483 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
484 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
485 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
486 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0.75
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0.75
Rhizoplane 0.86
Rhizosphere 85.74
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0044542 3300035083 Bacteria 1589
2 SwRhRL2b_contig_3393275 2162886007 Bacteria 12049
3 JGI25151J46595_10001564 3300003187 Bacteria 15277
4 JGI25153J46596_10012956 3300003215 Bacteria 3558
5 rootL2_10001457 3300003322 Bacteria 117785
6 Ga0055536_1006101 3300003781 Bacteria 5704
7 Ga0055531_10000007 3300003794 Bacteria 225289
8 Ga0055531_10000590 3300003794 Bacteria 31680
9 Ga0055531_10002046 3300003794 Bacteria 13906
10 Ga0055543_1001614 3300004625 Bacteria 8607
11 Ga0065165_1000220 3300005262 Bacteria 100027
12 Ga0065704_10071717 3300005289 Bacteria 10139
13 Ga0065704_10136477 3300005289 Bacteria 1565
14 Ga0065712_10023398 3300005290 Bacteria 1882
15 Ga0070676_10002671 3300005328 Bacteria 9182
16 Ga0070676_10027542 3300005328 Bacteria 3224
17 Ga0070683_100008919 3300005329 Bacteria 8545
18 Ga0070683_100022579 3300005329 Bacteria 5625
19 Ga0070683_100081488 3300005329 Bacteria 3030
20 Ga0070683_100169616 3300005329 Bacteria 2071
21 Ga0070683_100221352 3300005329 Bacteria 1799
22 Ga0070690_100035263 3300005330 Bacteria 3138
23 Ga0070670_100002635 3300005331 Bacteria 14831
24 Ga0070670_100009911 3300005331 Bacteria 8135
25 Ga0070670_100015461 3300005331 Bacteria 6554
26 Ga0070670_100144225 3300005331 Bacteria 2060
27 Ga0070670_100177160 3300005331 Bacteria 1850
28 Ga0070677_10028749 3300005333 Bacteria 2103
29 Ga0068869_100001778 3300005334 Bacteria 12910
30 Ga0070680_100000104 3300005336 Bacteria 48678
31 Ga0070680_100078037 3300005336 Bacteria 2728
32 Ga0070680_100108354 3300005336 Bacteria 2311
33 Ga0070682_100153666 3300005337 Bacteria 1582
34 Ga0068868_100001614 3300005338 Bacteria 15378
35 Ga0068868_100011380 3300005338 Bacteria 6478
36 Ga0070660_100001166 3300005339 Bacteria 17764
37 Ga0070660_100083644 3300005339 Bacteria 2507
38 Ga0070689_100000037 3300005340 Bacteria 82373
39 Ga0070689_100018889 3300005340 Bacteria 5088
40 Ga0070689_100031289 3300005340 Bacteria 4043
41 Ga0070691_10012441 3300005341 Bacteria 3895
42 Ga0070691_10129483 3300005341 Bacteria 1277
43 Ga0070687_100027758 3300005343 Bacteria 2738
44 Ga0070661_100005692 3300005344 Bacteria 8586
45 Ga0070661_100019287 3300005344 Bacteria 4860
46 Ga0070661_100096789 3300005344 Bacteria 2190
47 Ga0070661_100113662 3300005344 Bacteria 2023
48 Ga0070692_10003770 3300005345 Bacteria 6232
49 Ga0070692_10049254 3300005345 Bacteria 2185
50 Ga0070692_10126578 3300005345 Bacteria 1431
51 Ga0070668_100020534 3300005347 Bacteria 4986
52 Ga0070668_100021491 3300005347 Bacteria 4876
53 Ga0070668_100022331 3300005347 Bacteria 4782
54 Ga0070668_100144657 3300005347 Bacteria 1918
55 Ga0070669_100013725 3300005353 Bacteria 5759
56 Ga0070669_100068954 3300005353 Bacteria 2611
57 Ga0070669_100110161 3300005353 Bacteria 2088
58 Ga0070675_100002461 3300005354 Bacteria 13846
59 Ga0070675_100228448 3300005354 Bacteria 1623
60 Ga0070671_100060204 3300005355 Bacteria 3161
61 Ga0070674_100000486 3300005356 Bacteria 19954
62 Ga0070674_100002888 3300005356 Bacteria 9511
63 Ga0070673_100094947 3300005364 Bacteria 2445
64 Ga0070673_100103372 3300005364 Bacteria 2351
65 Ga0070673_100182919 3300005364 Bacteria 1795
66 Ga0070673_100219894 3300005364 Bacteria 1643
67 Ga0070688_100000302 3300005365 Bacteria 25180
68 Ga0070688_100106111 3300005365 Bacteria 1860
69 Ga0070659_100025700 3300005366 Bacteria 4526
70 Ga0070667_100001691 3300005367 Bacteria 19735
71 Ga0070667_100025707 3300005367 Bacteria 4896
72 Ga0070701_10000286 3300005438 Bacteria 16535
73 Ga0070701_10006343 3300005438 Bacteria 4974
74 Ga0070711_100003177 3300005439 Bacteria 9531
75 Ga0070711_100038971 3300005439 Bacteria 3198
76 Ga0070711_100076174 3300005439 Bacteria 2378
77 Ga0070711_100131095 3300005439 Bacteria 1867
78 Ga0070700_100000989 3300005441 Bacteria 14024
79 Ga0070700_100001914 3300005441 Bacteria 10526
80 Ga0070700_100045133 3300005441 Bacteria 2718
81 Ga0070700_100172580 3300005441 Bacteria 1498
82 Ga0070694_100004184 3300005444 Bacteria 8669
83 Ga0070694_100051029 3300005444 Bacteria 2791
84 Ga0070694_100204064 3300005444 Bacteria 1475
85 Ga0070708_100124652 3300005445 Bacteria 2380
86 Ga0070663_100001167 3300005455 Bacteria 14466
87 Ga0070678_100000160 3300005456 Bacteria 28353
88 Ga0070662_100001385 3300005457 Bacteria 14914
89 Ga0070662_100043746 3300005457 Bacteria 3206
90 Ga0070662_100095465 3300005457 Bacteria 2241
91 Ga0070662_100206109 3300005457 Bacteria 1562
92 Ga0070681_10000472 3300005458 Bacteria 32805
93 Ga0070681_10003617 3300005458 Bacteria 14502
94 Ga0070681_10047105 3300005458 Bacteria 4309
95 Ga0070681_10133496 3300005458 Bacteria 2414
96 Ga0070681_10240969 3300005458 Bacteria 1722
97 Ga0068867_100000808 3300005459 Bacteria 21106
98 Ga0068867_100008811 3300005459 Bacteria 7123
99 Ga0068867_100133238 3300005459 Bacteria 1934
100 Ga0070685_10000066 3300005466 Bacteria 61531
101 Ga0070685_10034732 3300005466 Bacteria 2841
102 Ga0070685_10059640 3300005466 Bacteria 2228
103 Ga0070685_10232778 3300005466 Bacteria 1213
104 Ga0070707_100000688 3300005468 Bacteria 33517
105 Ga0070707_100293920 3300005468 Bacteria 1578
106 Ga0070698_100036840 3300005471 Bacteria 5048
107 Ga0070698_100079465 3300005471 Bacteria 3276
108 Ga0070699_100000908 3300005518 Bacteria 27634
109 Ga0070699_100044003 3300005518 Bacteria 3865
110 Ga0070679_100019737 3300005530 Bacteria 6560
111 Ga0070679_100050764 3300005530 Bacteria 4132
112 Ga0070679_100067794 3300005530 Bacteria 3558
113 Ga0070679_100140682 3300005530 Bacteria 2393
114 Ga0070679_100206471 3300005530 Bacteria 1929
115 Ga0070684_100025138 3300005535 Bacteria 5002
116 Ga0070697_100030388 3300005536 Bacteria 4340
117 Ga0070697_100194620 3300005536 Bacteria 1722
118 Ga0068853_100106105 3300005539 Bacteria 2489
119 Ga0070672_100010420 3300005543 Bacteria 6450
120 Ga0070672_100049950 3300005543 Bacteria 3256
121 Ga0070672_100056370 3300005543 Bacteria 3081
122 Ga0070672_100067279 3300005543 Bacteria 2838
123 Ga0070686_100000072 3300005544 Bacteria 75694
124 Ga0070695_100178520 3300005545 Bacteria 1503
125 Ga0070696_100005249 3300005546 Bacteria 8652
126 Ga0070696_100227001 3300005546 Bacteria 1403
127 Ga0070665_100016000 3300005548 Bacteria 7530
128 Ga0070665_100106948 3300005548 Bacteria 2800
129 Ga0070665_100125271 3300005548 Bacteria 2571
130 Ga0070704_100041998 3300005549 Bacteria 3161
131 Ga0068855_100116938 3300005563 Bacteria 3056
132 Ga0070664_100017724 3300005564 Bacteria 5850
133 Ga0070664_100021142 3300005564 Bacteria 5360
134 Ga0070664_100032048 3300005564 Bacteria 4395
135 Ga0070664_100138158 3300005564 Bacteria 2144
136 Ga0070664_100153839 3300005564 Bacteria 2031
137 Ga0068857_100003428 3300005577 Bacteria 13227
138 Ga0068857_100036006 3300005577 Bacteria 4385
139 Ga0068857_100079618 3300005577 Bacteria 2925
140 Ga0068857_100085320 3300005577 Bacteria 2822
141 Ga0068857_100220805 3300005577 Bacteria 1731
142 Ga0068854_100078849 3300005578 Bacteria 2427
143 Ga0068856_100230693 3300005614 Bacteria 1866
144 Ga0070702_100166013 3300005615 Bacteria 1432
145 Ga0068852_100041382 3300005616 Bacteria 3894
146 Ga0068852_100150328 3300005616 Bacteria 2165
147 Ga0068859_100004724 3300005617 Bacteria 13835
148 Ga0068859_100114284 3300005617 Bacteria 2763
149 Ga0068859_100228023 3300005617 Bacteria 1951
150 Ga0068864_100038084 3300005618 Bacteria 4105
151 Ga0068864_100044054 3300005618 Bacteria 3823
152 Ga0068864_100438277 3300005618 Bacteria 1248
153 Ga0068866_10006291 3300005718 Bacteria 4943
154 Ga0068866_10027590 3300005718 Bacteria 2695
155 Ga0068866_10037890 3300005718 Bacteria 2371
156 Ga0068861_100000547 3300005719 Bacteria 22140
157 Ga0068861_100039398 3300005719 Bacteria 3526
158 Ga0068861_100060220 3300005719 Bacteria 2909
159 Ga0068870_10134328 3300005840 Bacteria 1441
160 Ga0068863_100004375 3300005841 Bacteria 13926
161 Ga0068863_100064796 3300005841 Bacteria 3456
162 Ga0068863_100111404 3300005841 Bacteria 2607
163 Ga0068858_100002138 3300005842 Bacteria 20024
164 Ga0068858_100009568 3300005842 Bacteria 9246
165 Ga0068858_100088128 3300005842 Bacteria 2887
166 Ga0068860_100000724 3300005843 Bacteria 37558
167 Ga0068860_100017184 3300005843 Bacteria 7052
168 Ga0068862_100026859 3300005844 Bacteria 4842
169 Ga0068862_100068840 3300005844 Bacteria 3054
170 Ga0081455_10000748 3300005937 Bacteria 42232
171 Ga0081538_10002825 3300005981 Bacteria 16615
172 Ga0081538_10017469 3300005981 Bacteria 5443
173 Ga0081540_1002896 3300005983 Bacteria 13841
174 Ga0081539_10000377 3300005985 Bacteria 97368
175 Ga0075365_10208309 3300006038 Bacteria 1370
176 Ga0075364_10224207 3300006051 Bacteria 1276
177 Ga0070715_10013975 3300006163 Bacteria 2962
178 Ga0070712_100358240 3300006175 Bacteria 1196
179 Ga0075427_10004202 3300006194 Bacteria 2011
180 Ga0075366_10030409 3300006195 Bacteria 3174
181 Ga0075366_10050085 3300006195 Bacteria 2480
182 Ga0097621_100008369 3300006237 Bacteria 7445
183 Ga0097621_100028041 3300006237 Bacteria 4434
184 Ga0097621_100091965 3300006237 Bacteria 2540
185 Ga0075370_10008046 3300006353 Bacteria 5408
186 Ga0068871_100001153 3300006358 Bacteria 17733
187 Ga0068871_100015047 3300006358 Bacteria 5784
188 Ga0068871_100412430 3300006358 Bacteria 1205
189 Ga0075428_100021354 3300006844 Bacteria 7168
190 Ga0075428_100032802 3300006844 Bacteria 5735
191 Ga0075428_100267295 3300006844 Bacteria 1840
192 Ga0075430_100005409 3300006846 Bacteria 10785
193 Ga0075430_100011721 3300006846 Bacteria 7462
194 Ga0075430_100016531 3300006846 Bacteria 6283
195 Ga0075430_100038581 3300006846 Bacteria 4045
196 Ga0075430_100039982 3300006846 Bacteria 3970
197 Ga0075430_100158537 3300006846 Bacteria 1884
198 Ga0075430_100323197 3300006846 Bacteria 1275
199 Ga0075431_100012496 3300006847 Bacteria 8574
200 Ga0075431_100015026 3300006847 Bacteria 7838
201 Ga0075431_100025026 3300006847 Bacteria 6120
202 Ga0075431_100066146 3300006847 Bacteria 3732
203 Ga0075431_100089659 3300006847 Bacteria 3174
204 Ga0075431_100243393 3300006847 Bacteria 1829
205 Ga0075431_100293199 3300006847 Bacteria 1645
206 Ga0075433_10183067 3300006852 Bacteria 1864
207 Ga0075429_100007108 3300006880 Bacteria 9721
208 Ga0075429_100102818 3300006880 Bacteria 2495
209 Ga0075429_100265718 3300006880 Bacteria 1502
210 Ga0068865_100000347 3300006881 Bacteria 25605
211 Ga0068865_100130839 3300006881 Bacteria 1880
212 Ga0068865_100211500 3300006881 Bacteria 1512
213 Ga0075436_100047308 3300006914 Bacteria 2967
214 Ga0097620_100004725 3300006931 Bacteria 13835
215 Ga0097620_100114278 3300006931 Bacteria 2763
216 Ga0097620_100228028 3300006931 Bacteria 1951
217 Ga0099823_1000072 3300006944 Bacteria 48607
218 Ga0075435_100157847 3300007076 Bacteria 1909
219 Ga0111539_10029483 3300009094 Bacteria 6683
220 Ga0111539_10092822 3300009094 Bacteria 3546
221 Ga0105245_10002275 3300009098 Bacteria 17377
222 Ga0105245_10012094 3300009098 Bacteria 7505
223 Ga0105245_10594905 3300009098 Bacteria 1132
224 Ga0105247_10008325 3300009101 Bacteria 6326
225 Ga0114129_10002222 3300009147 Bacteria 26769
226 Ga0114129_10066413 3300009147 Bacteria 5032
227 Ga0114129_10085939 3300009147 Bacteria 4364
228 Ga0105243_10007579 3300009148 Bacteria 8340
229 Ga0105243_10353096 3300009148 Bacteria 1351
230 Ga0105242_10000984 3300009176 Bacteria 22276
231 Ga0105242_10013917 3300009176 Bacteria 6225
232 Ga0105242_10142522 3300009176 Bacteria 2081
233 Ga0105248_10013070 3300009177 Bacteria 9145
234 Ga0105248_10013719 3300009177 Bacteria 8921
235 Ga0105248_10243683 3300009177 Bacteria 2023
236 Ga0105237_10098751 3300009545 Bacteria 2911
237 Ga0105238_10000047 3300009551 Bacteria 147271
238 Ga0105238_10051887 3300009551 Bacteria 4124
239 Ga0105238_10297124 3300009551 Bacteria 1598
240 Ga0105249_10001249 3300009553 Bacteria 22324
241 Ga0105249_10008436 3300009553 Bacteria 8976
242 Ga0105249_10013823 3300009553 Bacteria 7132
243 Ga0105249_10143247 3300009553 Bacteria 2294
244 Ga0105239_10013072 3300010375 Bacteria 9225
245 Ga0105239_10203739 3300010375 Bacteria 2217
246 Ga0105239_10338241 3300010375 Bacteria 1698
247 Ga0105246_10000314 3300011119 Bacteria 25702
248 Ga0157319_1000003 3300012497 Bacteria 397199
249 Ga0157371_10042542 3300013102 Bacteria 3238
250 Ga0157369_10035090 3300013105 Bacteria 5501
251 Ga0157369_10179231 3300013105 Bacteria 2230
252 Ga0157374_10026638 3300013296 Bacteria 5204
253 Ga0157374_10027231 3300013296 Bacteria 5153
254 Ga0157374_10537063 3300013296 Bacteria 1176
255 Ga0157378_10000510 3300013297 Bacteria 36887
256 Ga0157378_10026511 3300013297 Bacteria 5109
257 Ga0157378_10185747 3300013297 Bacteria 1958
258 Ga0157378_10238130 3300013297 Bacteria 1738
259 Ga0157378_10248482 3300013297 Bacteria 1702
260 Ga0163162_10015245 3300013306 Bacteria 7507
261 Ga0163162_10024261 3300013306 Bacteria 5986
262 Ga0163162_10056153 3300013306 Bacteria 3966
263 Ga0163162_10093494 3300013306 Bacteria 3092
264 Ga0157372_10250093 3300013307 Bacteria 2058
265 Ga0157375_10102730 3300013308 Bacteria 2944
266 Ga0157375_10108641 3300013308 Bacteria 2869
267 Ga0157375_10213232 3300013308 Bacteria 2089
268 Ga0163163_10022696 3300014325 Bacteria 5947
269 Ga0157380_10033936 3300014326 Bacteria 3932
270 Ga0157377_10007461 3300014745 Bacteria 5283
271 Ga0157379_10003252 3300014968 Bacteria 13770
272 Ga0157379_10046333 3300014968 Bacteria 3879
273 Ga0157379_10093167 3300014968 Bacteria 2703
274 Ga0157376_10000407 3300014969 Bacteria 28001
275 Ga0157376_10341226 3300014969 Bacteria 1431
276 Ga0182005_1017051 3300015265 Bacteria 2012
277 Ga0163161_10015626 3300017792 Bacteria 5295
278 Ga0197907_10122923 3300020069 Bacteria 1579
279 Ga0213873_10000002 3300021358 Bacteria 1164195
280 Ga0213872_10000036 3300021361 Bacteria 129233
281 Ga0213872_10000093 3300021361 Bacteria 83513
282 Ga0213872_10000145 3300021361 Bacteria 64663
283 Ga0213876_10000001 3300021384 Bacteria 1186326
284 Ga0213876_10104967 3300021384 Bacteria 1499
285 Ga0209676_1000024 3300025292 Bacteria 578839
286 Ga0209025_1000685 3300025294 Bacteria 58093
287 Ga0209758_1000264 3300025297 Bacteria 104107
288 Ga0209050_1011452 3300025298 Bacteria 4201
289 Ga0209256_1000150 3300025299 Bacteria 146086
290 Ga0209256_1000344 3300025299 Bacteria 75635
291 Ga0209051_1002006 3300025303 Bacteria 15531
292 Ga0209051_1009784 3300025303 Bacteria 4911
293 Ga0209257_1000021 3300025304 Bacteria 771986
294 Ga0209257_1000318 3300025304 Bacteria 101186
295 Ga0209257_1000399 3300025304 Bacteria 85231
296 Ga0207656_10024662 3300025321 Bacteria 2434
297 Ga0207710_10016627 3300025900 Bacteria 3114
298 Ga0207688_10003209 3300025901 Bacteria 8928
299 Ga0207680_10017306 3300025903 Bacteria 3806
300 Ga0207685_10029875 3300025905 Bacteria 1934
301 Ga0207645_10000191 3300025907 Bacteria 49623
302 Ga0207645_10000220 3300025907 Bacteria 47303
303 Ga0207643_10010943 3300025908 Bacteria 4894
304 Ga0207643_10011505 3300025908 Bacteria 4778
305 Ga0207705_10001754 3300025909 Bacteria 17142
306 Ga0207707_10006675 3300025912 Bacteria 10066
307 Ga0207707_10028861 3300025912 Bacteria 4849
308 Ga0207707_10080983 3300025912 Bacteria 2834
309 Ga0207707_10176732 3300025912 Bacteria 1865
310 Ga0207707_10298511 3300025912 Bacteria 1393
311 Ga0207695_10305378 3300025913 Bacteria 1482
312 Ga0207693_10139038 3300025915 Bacteria 1910
313 Ga0207663_10062640 3300025916 Bacteria 2365
314 Ga0207660_10042836 3300025917 Bacteria 3180
315 Ga0207660_10068165 3300025917 Bacteria 2580
316 Ga0207660_10100693 3300025917 Bacteria 2158
317 Ga0207662_10028939 3300025918 Bacteria 3207
318 Ga0207657_10000462 3300025919 Bacteria 43108
319 Ga0207657_10000971 3300025919 Bacteria 30433
320 Ga0207649_10019166 3300025920 Bacteria 3907
321 Ga0207649_10065426 3300025920 Bacteria 2301
322 Ga0207652_10035821 3300025921 Bacteria 4192
323 Ga0207646_10000002 3300025922 Bacteria 550880
324 Ga0207646_10240301 3300025922 Bacteria 1636
325 Ga0207681_10011871 3300025923 Bacteria 5362
326 Ga0207681_10013639 3300025923 Bacteria 5032
327 Ga0207681_10072696 3300025923 Bacteria 2403
328 Ga0207681_10084142 3300025923 Bacteria 2254
329 Ga0207681_10174923 3300025923 Bacteria 1630
330 Ga0207694_10001495 3300025924 Bacteria 19964
331 Ga0207694_10059741 3300025924 Bacteria 2966
332 Ga0207650_10032484 3300025925 Bacteria 3775
333 Ga0207650_10044526 3300025925 Bacteria 3262
334 Ga0207650_10045921 3300025925 Bacteria 3215
335 Ga0207659_10047366 3300025926 Bacteria 3040
336 Ga0207687_10020522 3300025927 Bacteria 4384
337 Ga0207690_10045117 3300025932 Bacteria 2910
338 Ga0207706_10000337 3300025933 Bacteria 50976
339 Ga0207706_10000402 3300025933 Bacteria 46603
340 Ga0207706_10017957 3300025933 Bacteria 6366
341 Ga0207706_10088553 3300025933 Bacteria 2721
342 Ga0207686_10122602 3300025934 Bacteria 1771
343 Ga0207709_10041534 3300025935 Bacteria 2760
344 Ga0207709_10212582 3300025935 Bacteria 1389
345 Ga0207670_10000048 3300025936 Bacteria 90133
346 Ga0207670_10144424 3300025936 Bacteria 1758
347 Ga0207670_10176175 3300025936 Bacteria 1607
348 Ga0207669_10201369 3300025937 Bacteria 1445
349 Ga0207691_10000103 3300025940 Bacteria 75136
350 Ga0207691_10000210 3300025940 Bacteria 56666
351 Ga0207691_10007470 3300025940 Bacteria 10522
352 Ga0207691_10011003 3300025940 Bacteria 8680
353 Ga0207691_10135376 3300025940 Bacteria 2173
354 Ga0207711_10008233 3300025941 Bacteria 8730
355 Ga0207711_10014681 3300025941 Bacteria 6509
356 Ga0207711_10367378 3300025941 Bacteria 1334
357 Ga0207689_10004087 3300025942 Bacteria 13271
358 Ga0207689_10011248 3300025942 Bacteria 7682
359 Ga0207661_10025384 3300025944 Bacteria 4503
360 Ga0207661_10060720 3300025944 Bacteria 3052
361 Ga0207661_10309235 3300025944 Bacteria 1418
362 Ga0207679_10002283 3300025945 Bacteria 11828
363 Ga0207679_10003409 3300025945 Bacteria 9805
364 Ga0207679_10005021 3300025945 Bacteria 8265
365 Ga0207679_10029718 3300025945 Bacteria 3807
366 Ga0207679_10033793 3300025945 Bacteria 3602
367 Ga0207679_10265685 3300025945 Bacteria 1465
368 Ga0207679_10376538 3300025945 Bacteria 1243
369 Ga0207667_10011997 3300025949 Bacteria 10032
370 Ga0207667_10147330 3300025949 Bacteria 2423
371 Ga0207651_10078600 3300025960 Bacteria 2367
372 Ga0207651_10322329 3300025960 Bacteria 1292
373 Ga0207712_10000836 3300025961 Bacteria 22606
374 Ga0207712_10001069 3300025961 Bacteria 19176
375 Ga0207712_10023948 3300025961 Bacteria 4035
376 Ga0207712_10129603 3300025961 Bacteria 1920
377 Ga0207668_10011892 3300025972 Bacteria 5308
378 Ga0207668_10034569 3300025972 Bacteria 3358
379 Ga0207668_10149121 3300025972 Bacteria 1808
380 Ga0207640_10116135 3300025981 Bacteria 1907
381 Ga0207677_10000002 3300026023 Bacteria 478921
382 Ga0207677_10100199 3300026023 Bacteria 2129
383 Ga0207703_10010390 3300026035 Bacteria 7283
384 Ga0207703_10036147 3300026035 Bacteria 3929
385 Ga0207703_10057763 3300026035 Bacteria 3165
386 Ga0207703_10088882 3300026035 Bacteria 2594
387 Ga0207639_10000006 3300026041 Bacteria 544415
388 Ga0207678_10000126 3300026067 Bacteria 63715
389 Ga0207678_10111448 3300026067 Bacteria 2334
390 Ga0207708_10000334 3300026075 Bacteria 37101
391 Ga0207708_10001747 3300026075 Bacteria 16057
392 Ga0207708_10194631 3300026075 Bacteria 1615
393 Ga0207702_10205562 3300026078 Bacteria 1828
394 Ga0207702_10503314 3300026078 Bacteria 1181
395 Ga0207641_10039357 3300026088 Bacteria 3954
396 Ga0207641_10071721 3300026088 Bacteria 2980
397 Ga0207641_10396179 3300026088 Bacteria 1325
398 Ga0207648_10000177 3300026089 Bacteria 66625
399 Ga0207648_10000321 3300026089 Bacteria 52564
400 Ga0207648_10040680 3300026089 Bacteria 4084
401 Ga0207648_10087379 3300026089 Bacteria 2721
402 Ga0207676_10022269 3300026095 Bacteria 4659
403 Ga0207676_10025563 3300026095 Bacteria 4381
404 Ga0207676_10056569 3300026095 Bacteria 3085
405 Ga0207676_10061217 3300026095 Bacteria 2980
406 Ga0207674_10022113 3300026116 Bacteria 6835
407 Ga0207674_10030571 3300026116 Bacteria 5661
408 Ga0207674_10044893 3300026116 Bacteria 4550
409 Ga0207674_10060062 3300026116 Bacteria 3845
410 Ga0207675_100003121 3300026118 Bacteria 16253
411 Ga0207675_100034714 3300026118 Bacteria 4704
412 Ga0207675_100083910 3300026118 Bacteria 2989
413 Ga0207675_100103610 3300026118 Bacteria 2681
414 Ga0207683_10000032 3300026121 Bacteria 105638
415 Ga0209389_1003332 3300027296 Bacteria 12882
416 Ga0209969_1000124 3300027360 Bacteria 9808
417 Ga0209967_1000045 3300027364 Bacteria 15798
418 Ga0209981_1003554 3300027378 Bacteria 2024
419 Ga0209996_1000003 3300027395 Bacteria 45389
420 Ga0210000_1000023 3300027462 Bacteria 24358
421 Ga0209995_1000001 3300027471 Bacteria 75174
422 Ga0209968_1000162 3300027526 Bacteria 11692
423 Ga0209999_1000137 3300027543 Bacteria 9494
424 Ga0209982_1000127 3300027552 Bacteria 8413
425 Ga0209970_1000390 3300027614 Bacteria 7403
426 Ga0210002_1000088 3300027617 Bacteria 14345
427 Ga0209983_1004975 3300027665 Bacteria 2776
428 Ga0209971_1000124 3300027682 Bacteria 22906
429 Ga0209966_1000047 3300027695 Bacteria 51668
430 Ga0209998_10000037 3300027717 Bacteria 54301
431 Ga0209974_10000103 3300027876 Bacteria 24061
432 Ga0209974_10003956 3300027876 Bacteria 5305
433 Ga0207428_10000038 3300027907 Bacteria 216105
434 Ga0207428_10009119 3300027907 Bacteria 8915
435 Ga0207428_10079000 3300027907 Bacteria 2573
436 Ga0268266_10077674 3300028379 Bacteria 2887
437 Ga0268266_10361557 3300028379 Bacteria 1366
438 Ga0268265_10005184 3300028380 Bacteria 8929
439 Ga0268265_10059487 3300028380 Bacteria 2923
440 Ga0268265_10365882 3300028380 Bacteria 1322
441 Ga0268264_10000096 3300028381 Bacteria 230188
442 Ga0268264_10169179 3300028381 Bacteria 1975
443 Ga0265323_10037209 3300028653 Bacteria 1784
444 Ga0307515_10000089 3300028794 Bacteria 215736
445 Ga0307515_10000096 3300028794 Bacteria 206366
446 Ga0307515_10009616 3300028794 Bacteria 18663
447 Ga0307515_10015292 3300028794 Bacteria 14149
448 Ga0307515_10026976 3300028794 Bacteria 9850
449 Ga0307515_10077592 3300028794 Bacteria 4385
450 Ga0265330_10029888 3300031235 Bacteria 2449
451 Ga0265332_10000286 3300031238 Bacteria 39704
452 Ga0265340_10027836 3300031247 Bacteria 2847
453 Ga0265331_10014504 3300031250 Bacteria 4196
454 Ga0265331_10027155 3300031250 Bacteria 2872
455 Ga0265331_10098029 3300031250 Bacteria 1351
456 Ga0265327_10000012 3300031251 Bacteria 530403
457 Ga0307513_10012840 3300031456 Bacteria 10312
458 Ga0307513_10025908 3300031456 Bacteria 6775
459 Ga0307509_10016306 3300031507 Bacteria 8602
460 Ga0307408_100000023 3300031548 Bacteria 295931
461 Ga0307408_100019873 3300031548 Bacteria 4525
462 Ga0307408_100034978 3300031548 Bacteria 3522
463 Ga0265313_10003764 3300031595 Bacteria 12042
464 Ga0307508_10014707 3300031616 Bacteria 7136
465 Ga0316579_10071803 3300031691 Bacteria 1641
466 Ga0265314_10030734 3300031711 Bacteria 3972
467 Ga0265314_10111853 3300031711 Bacteria 1734
468 Ga0265342_10011277 3300031712 Bacteria 6128
469 Ga0316576_10008039 3300031727 Bacteria 6690
470 Ga0316576_10016038 3300031727 Bacteria 5048
471 Ga0316576_10026391 3300031727 Bacteria 4076
472 Ga0316576_10041752 3300031727 Bacteria 3304
473 Ga0316576_10068406 3300031727 Bacteria 2616
474 Ga0316576_10090528 3300031727 Bacteria 2279
475 Ga0316576_10097169 3300031727 Bacteria 2199
476 Ga0316578_10003901 3300031728 Bacteria 6936
477 Ga0316578_10009454 3300031728 Bacteria 5017
478 Ga0316578_10023649 3300031728 Bacteria 3440
479 Ga0316578_10106356 3300031728 Bacteria 1684
480 Ga0307516_10066897 3300031730 Bacteria 3464
481 Ga0307405_10018461 3300031731 Bacteria 3848
482 Ga0307405_10217041 3300031731 Bacteria 1401
483 Ga0316577_10022788 3300031733 Bacteria 3478
484 Ga0316577_10117180 3300031733 Bacteria 1496
485 Ga0307413_10052822 3300031824 Bacteria 2457
486 Ga0307413_10164111 3300031824 Bacteria 1564
487 Ga0307413_10297423 3300031824 Bacteria 1222
488 Ga0307406_10005283 3300031901 Bacteria 7062
489 Ga0307406_10035715 3300031901 Bacteria 3058
490 Ga0307407_10108047 3300031903 Bacteria 1741
491 Ga0307412_10033677 3300031911 Bacteria 3258
492 Ga0307409_100017567 3300031995 Bacteria 4774
493 Ga0307409_100019722 3300031995 Bacteria 4575
494 Ga0307409_100046167 3300031995 Bacteria 3296
495 Ga0307409_100085678 3300031995 Bacteria 2562
496 Ga0307409_100145262 3300031995 Bacteria 2050
497 Ga0307416_100001542 3300032002 Bacteria 12596
498 Ga0307416_100007205 3300032002 Bacteria 7044
499 Ga0307416_100095467 3300032002 Bacteria 2568
500 Ga0307414_10055597 3300032004 Bacteria 2772
501 Ga0307411_10042413 3300032005 Bacteria 2903
502 Ga0307411_10049851 3300032005 Bacteria 2723
503 Ga0307415_100031012 3300032126 Bacteria 3439
504 Ga0307415_100035330 3300032126 Bacteria 3263
505 Ga0307507_10108905 3300033179 Bacteria 2275
506 Ga0316596_1005795 3300033541 Bacteria 2842
507 Ga0373950_0002749 3300034818 Bacteria 2455
508 Ga0373926_0000008 3300035083 Bacteria 33567
509 Ga0373923_0000070 3300035111 Bacteria 16728
510 Ga0373945_0044781 3300035116 Bacteria 1610
511 Ga0373960_0025329 3300035121 Bacteria 1612
512 Ga0373943_0000139 3300035170 Bacteria 27513
513 Ga0373946_0004804 3300035171 Bacteria 4863
514 Ga0373961_0011494 3300035241 Bacteria 2198
515 Ga0316574_0002610 3300035398 Bacteria 9081
516 Ga0316574_0002765 3300035398 Bacteria 8906
517 Ga0373924_0000002 3300035410 Bacteria 86598
518 Ga0373935_0019756 3300035692 Bacteria 4109
519 Ga0373927_0000083 3300035695 Bacteria 71354
520 Ga0373927_0183518 3300035695 Bacteria 1373
521 Ga0373933_0000020 3300035724 Bacteria 97124
522 Ga0373933_0034263 3300035724 Bacteria 2958
523 Ga0373947_0000317 3300035725 Bacteria 27335
524 Ga0316582_0006341 3300036647 Bacteria 6203
525 Ga0316582_0038600 3300036647 Bacteria 2969
526 Ga0316582_0084292 3300036647 Bacteria 2080
527 Ga0316584_0044462 3300036712 Bacteria 3311
528 Ga0316584_0045188 3300036712 Bacteria 3287
529 Ga0316584_0094672 3300036712 Bacteria 2236
530 Ga0316584_0138054 3300036712 Bacteria 1819
531 Ga0316584_0151280 3300036712 Bacteria 1727
532 Ga0373925_0000861 3300037068 Bacteria 27790
533 Ga0373925_0006634 3300037068 Bacteria 8500
534 Ga0373925_0078324 3300037068 Bacteria 2510
535 Ga0395900_0000050 3300037418 Bacteria 224616
536 Ga0395898_0001226 3300037466 Bacteria 38522
537 Ga0395905_0008461 3300037471 Bacteria 10144
538 Ga0395905_0065433 3300037471 Bacteria 3403
539 Ga0395905_0098212 3300037471 Bacteria 2750
540 Ga0436364_0298290 3300037853 Bacteria 2316
541 Ga0400484_04971 3300038725 Bacteria 1647
542 Ga0400484_14150 3300038725 Bacteria 2078
543 Ga0400484_21144 3300038725 Bacteria 1491
544 Ga0400490_29571 3300038726 Bacteria 33032
545 Ga0400490_50108 3300038726 Bacteria 5088
546 Ga0400491_07309 3300038727 Bacteria 3263
547 Ga0400491_20615 3300038727 Bacteria 1778
548 Ga0400485_13900 3300038735 Bacteria 5231
549 Ga0400485_19406 3300038735 Bacteria 31218
550 Ga0400485_19725 3300038735 Bacteria 10520
551 Ga0400488_07945 3300038741 Bacteria 2727
552 Ga0400488_53590 3300038741 Bacteria 4259
553 Ga0400486_04376 3300038742 Bacteria 7542
554 Ga0400486_09168 3300038742 Bacteria 54825
555 Ga0400486_20498 3300038742 Bacteria 29785
556 Ga0400483_057472 3300039062 Bacteria 3030
557 Ga0400483_101355 3300039062 Bacteria 3328
558 Ga0400483_195086 3300039062 Bacteria 2036
559 Ga0400483_280975 3300039062 Bacteria 2614
560 Ga0400483_282299 3300039062 Bacteria 1754
561 Ga0400489_54455 3300039093 Bacteria 62028
562 Ga0400487_01582 3300039110 Bacteria 17788
563 Ga0400487_20123 3300039110 Bacteria 2723
564 Ga0400487_29557 3300039110 Bacteria 4996
565 Ga0400487_41538 3300039110 Bacteria 9976
566 Ga0436365_0332720 3300039437 Bacteria 227622
567 Ga0436365_0861952 3300039437 Bacteria 3366
568 Ga0436361_0190331 3300039447 Bacteria 52299
569 Ga0436361_0872820 3300039447 Bacteria 1445
570 Ga0436362_0660519 3300039453 Bacteria 832172
571 Ga0439465_0010617 3300041413 Bacteria 2890
572 Ga0439441_000140 3300042001 Bacteria 6125
573 Ga0439443_010820 3300042003 Bacteria 1329
574 Ga0439448_0026160 3300042005 Bacteria 1834
575 Ga0439449_0002726 3300042007 Bacteria 6876
576 Ga0439449_0050846 3300042007 Bacteria 1533
577 Ga0450888_000025 3300042126 Bacteria 10884
578 Ga0450890_000206 3300042127 Bacteria 9031
579 Ga0450891_000045 3300042129 Bacteria 9236
580 Ga0450892_000023 3300042130 Bacteria 16403
581 Ga0450899_002729 3300042135 Bacteria 1910
582 Ga0439434_0003978 3300042435 Bacteria 4314
583 Ga0439435_0017424 3300042436 Bacteria 1816
584 Ga0439444_0003078 3300042437 Bacteria 2332
585 Ga0439459_0000720 3300042438 Bacteria 4515
586 Ga0450893_0001110 3300042532 Bacteria 4057
587 Ga0451577_0000035 3300042876 Bacteria 373467
588 Ga0451577_0001096 3300042876 Bacteria 38706
589 Ga0451577_0001321 3300042876 Bacteria 33791
590 Ga0451577_0001858 3300042876 Bacteria 26914
591 Ga0451577_0002792 3300042876 Bacteria 20149
592 Ga0451577_0003495 3300042876 Bacteria 17459
593 Ga0451577_0039896 3300042876 Bacteria 4217
594 Ga0451577_0060775 3300042876 Bacteria 3369
595 Ga0451577_0111237 3300042876 Bacteria 2451
596 Ga0451577_0173328 3300042876 Bacteria 1944
597 Ga0451577_0198538 3300042876 Bacteria 1811
598 Ga0451577_0249962 3300042876 Bacteria 1605
599 Ga0453683_0000184 3300044673 Bacteria 86818
600 Ga0453683_0001691 3300044673 Bacteria 18388
601 Ga0453683_0026828 3300044673 Bacteria 3656
602 Ga0453683_0031658 3300044673 Bacteria 3340
603 Ga0453683_0042076 3300044673 Bacteria 2869
604 Ga0466961_0001392 3300044693 Bacteria 14972
605 Ga0466961_0035959 3300044693 Bacteria 3179
606 Ga0466963_0050735 3300044694 Bacteria 2747
607 Ga0466963_0118086 3300044694 Bacteria 1824
608 Ga0466964_0016965 3300044706 Bacteria 2784
609 Ga0466964_0032704 3300044706 Bacteria 2068
610 Ga0453684_0000097 3300044712 Bacteria 377772
611 Ga0453684_0000443 3300044712 Bacteria 168617
612 Ga0453684_0000502 3300044712 Bacteria 153452
613 Ga0453684_0000710 3300044712 Bacteria 117944
614 Ga0453684_0001117 3300044712 Bacteria 84116
615 Ga0453684_0006132 3300044712 Bacteria 23146
616 Ga0453684_0007328 3300044712 Bacteria 20385
617 Ga0453684_0008233 3300044712 Bacteria 18795
618 Ga0453684_0013067 3300044712 Bacteria 13562
619 Ga0453684_0019151 3300044712 Bacteria 10442
620 Ga0453684_0020808 3300044712 Bacteria 9860
621 Ga0453684_0060559 3300044712 Bacteria 4867
622 Ga0453684_0159592 3300044712 Bacteria 2668
623 Ga0453684_0197368 3300044712 Bacteria 2349
624 Ga0453684_0202270 3300044712 Bacteria 2315
625 Ga0453684_0209588 3300044712 Bacteria 2266
626 Ga0453684_0212157 3300044712 Bacteria 2249
627 Ga0453684_0220467 3300044712 Bacteria 2197
628 Ga0453684_0299611 3300044712 Bacteria 1828
629 Ga0453684_0417844 3300044712 Bacteria 1499
630 Ga0453684_0600459 3300044712 Bacteria 1206
631 Ga0466971_0058697 3300044719 Bacteria 1737
632 Ga0466970_0002719 3300044765 Bacteria 8542
633 Ga0466970_0037187 3300044765 Bacteria 2580
634 Ga0466959_0000041 3300045049 Bacteria 100097
635 Ga0466959_0144236 3300045049 Bacteria 1681
636 Ga0451576_0000096 3300045051 Bacteria 221078
637 Ga0451576_0000412 3300045051 Bacteria 99303
638 Ga0451576_0001510 3300045051 Bacteria 39222
639 Ga0451576_0002396 3300045051 Bacteria 28162
640 Ga0451576_0008271 3300045051 Bacteria 12232
641 Ga0451576_0011483 3300045051 Bacteria 10056
642 Ga0451576_0039041 3300045051 Bacteria 5025
643 Ga0451576_0044610 3300045051 Unclassified 4673
644 Ga0451576_0078766 3300045051 Bacteria 3429
645 Ga0451576_0114165 3300045051 Bacteria 2811
646 Ga0451576_0198204 3300045051 Bacteria 2097
647 Ga0451576_0231653 3300045051 Bacteria 1929
648 Ga0451576_0323942 3300045051 Bacteria 1613
649 Ga0451576_0426484 3300045051 Bacteria 1392
650 Ga0466967_0033372 3300045976 Bacteria 4356
651 Ga0466967_0093114 3300045976 Bacteria 2741
652 Ga0495629_0162918 3300046459 Bacteria 1549
653 Ga0495580_0052390 3300046472 Bacteria 2882
654 Ga0495582_0117127 3300046473 Bacteria 1499
655 Ga0495594_0003823 3300046499 Bacteria 7733
656 Ga0495620_0000926 3300046515 Bacteria 18056
657 Ga0495630_0012507 3300046517 Bacteria 6164
658 Ga0495630_0235119 3300046517 Bacteria 1400
659 Ga0495648_0006136 3300046524 Bacteria 9851
660 Ga0495586_0034929 3300046535 Bacteria 2701
661 Ga0495634_0153508 3300046642 Bacteria 1455
662 Ga0495635_0108001 3300046663 Bacteria 1901
663 Ga0495659_0012156 3300046664 Bacteria 2784
664 Ga0495657_0001201 3300046675 Bacteria 22685
665 Ga0495670_0013798 3300046691 Bacteria 3973
666 Ga0495581_0132983 3300047315 Bacteria 1450
667 Ga0495636_0058457 3300047318 Bacteria 1626
668 Ga0495686_0183736 3300047472 Bacteria 1210
669 Ga0496102_0009318 3300048905 Bacteria 8431
670 Ga0496105_0045823 3300048908 Bacteria 3608
671 Ga0496106_0100859 3300048909 Bacteria 2239
672 Ga0496110_0082911 3300048913 Bacteria 2860
673 Ga0496111_0001591 3300048914 Bacteria 13121
674 Ga0496112_0010797 3300048915 Bacteria 8307
675 Ga0496114_0007537 3300048917 Bacteria 8608
676 Ga0496115_0084745 3300048918 Bacteria 2584
677 Ga0496116_0007473 3300048919 Bacteria 9681
678 Ga0496117_0000209 3300048920 Bacteria 113908
679 Ga0496118_0000019 3300048921 Bacteria 489649
680 Ga0496119_0011523 3300048922 Bacteria 7306
681 Ga0496120_0012032 3300048923 Bacteria 5912
682 Ga0496121_0003238 3300048924 Bacteria 23400
683 Ga0496121_0038803 3300048924 Bacteria 4209
684 Ga0496122_0013543 3300048925 Bacteria 7972
685 Ga0496124_0023711 3300048927 Bacteria 5595
686 Ga0496124_0197075 3300048927 Bacteria 1535
687 Ga0496125_0005139 3300048928 Bacteria 14720
688 Ga0496125_0047533 3300048928 Bacteria 3587
689 Ga0496126_0006720 3300048929 Bacteria 12774
690 Ga0496126_0008429 3300048929 Bacteria 11116
691 Ga0496126_0013233 3300048929 Bacteria 8412
692 Ga0496126_0128479 3300048929 Bacteria 2191
693 Ga0501308_001789 3300049128 Bacteria 1794
694 Ga0501309_003513 3300049129 Bacteria 1780
695 Ga0501310_002285 3300049130 Bacteria 1809
696 Ga0501290_000043 3300049513 Bacteria 16533
697 Ga0501290_000937 3300049513 Bacteria 4231
698 Ga0501291_001099 3300049514 Bacteria 3104
699 Ga0501292_000033 3300049515 Bacteria 35457
700 Ga0501293_000638 3300049516 Bacteria 2626
701 Ga0501294_000556 3300049517 Bacteria 4315
702 Ga0501295_000788 3300049518 Bacteria 2996
703 Ga0501296_000102 3300049519 Bacteria 10005
704 Ga0501297_000079 3300049520 Bacteria 9967
705 Ga0501297_000530 3300049520 Bacteria 3441
706 Ga0501298_001186 3300049521 Bacteria 3781
707 Ga0501298_003087 3300049521 Bacteria 2568
708 Ga0501299_000327 3300049522 Bacteria 5506
709 Ga0501300_000813 3300049523 Bacteria 4736
710 Ga0501300_002032 3300049523 Bacteria 3021
711 Ga0501302_000306 3300049525 Bacteria 2582
712 Ga0501303_000416 3300049526 Bacteria 3437
713 Ga0501311_003710 3300049527 Bacteria 1582
714 Ga0501314_000461 3300049530 Bacteria 2536
715 Ga0501031_0002512 3300049568 Bacteria 11686
716 Ga0501031_0010013 3300049568 Bacteria 6176
717 Ga0501031_0026475 3300049568 Bacteria 3781
718 Ga0501032_0019245 3300049569 Bacteria 4777
719 Ga0501034_0000122 3300049571 Bacteria 144085
720 Ga0501034_0180816 3300049571 Bacteria 2074
721 Ga0501034_0271244 3300049571 Bacteria 1637
722 Ga0501036_0053579 3300049572 Bacteria 3416
723 Ga0501037_0009043 3300049573 Bacteria 7301
724 Ga0501037_0037270 3300049573 Bacteria 3584
725 Ga0501037_0080292 3300049573 Bacteria 2367
726 Ga0501038_0010129 3300049574 Bacteria 8629
727 Ga0501038_0021314 3300049574 Bacteria 5818
728 Ga0501038_0041663 3300049574 Bacteria 4004
729 Ga0501039_0003507 3300049575 Bacteria 11740
730 Ga0501039_0012714 3300049575 Bacteria 6431
731 Ga0501039_0057589 3300049575 Bacteria 3009
732 Ga0501039_0124729 3300049575 Bacteria 2020
733 Ga0501041_0002040 3300049577 Bacteria 11365
734 Ga0501041_0007229 3300049577 Bacteria 6515
735 Ga0501041_0031221 3300049577 Bacteria 3217
736 Ga0501041_0042665 3300049577 Bacteria 2757
737 Ga0501041_0044647 3300049577 Bacteria 2693
738 Ga0501042_0073726 3300049578 Bacteria 2441
739 Ga0501042_0085165 3300049578 Bacteria 2266
740 Ga0501043_0011719 3300049579 Bacteria 6865
741 Ga0501046_0000649 3300049580 Bacteria 33919
742 Ga0501046_0009746 3300049580 Bacteria 8283
743 Ga0501046_0015077 3300049580 Bacteria 6499
744 Ga0501047_0000450 3300049581 Bacteria 45480
745 Ga0501048_0000194 3300049582 Bacteria 39334
746 Ga0501048_0000871 3300049582 Bacteria 22279
747 Ga0501048_0030631 3300049582 Bacteria 3892
748 Ga0501070_0026180 3300049586 Bacteria 4896
749 Ga0501070_0194761 3300049586 Bacteria 1665
750 Ga0501071_0048105 3300049587 Bacteria 3065
751 Ga0501071_0219857 3300049587 Bacteria 1429
752 Ga0501071_0243578 3300049587 Bacteria 1356
753 Ga0501072_0156920 3300049588 Bacteria 1814
754 Ga0501073_0155360 3300049589 Bacteria 1585
755 Ga0501074_0080302 3300049590 Bacteria 2340
756 Ga0501075_0042537 3300049591 Bacteria 3406
757 Ga0501075_0052696 3300049591 Bacteria 3059
758 Ga0501076_0054387 3300049592 Bacteria 3172
759 Ga0501076_0124248 3300049592 Bacteria 2090
760 Ga0501076_0178325 3300049592 Bacteria 1732
761 Ga0501077_0005495 3300049593 Bacteria 7707
762 Ga0501077_0101889 3300049593 Bacteria 1819
763 Ga0501199_000176 3300049650 Bacteria 5322
764 Ga0501201_000139 3300049651 Bacteria 6098
765 Ga0501202_000086 3300049652 Bacteria 10038
766 Ga0501207_000560 3300049654 Bacteria 4249
767 Ga0501208_000149 3300049655 Bacteria 4570
768 Ga0501209_000313 3300049656 Bacteria 5816
769 Ga0501209_005420 3300049656 Bacteria 2301
770 Ga0501211_000368 3300049658 Bacteria 4229
771 Ga0501216_000910 3300049660 Bacteria 3760
772 Ga0501217_000381 3300049661 Bacteria 7101
773 Ga0501222_004187 3300049662 Bacteria 1961
774 Ga0501227_008844 3300049665 Bacteria 2163
775 Ga0501228_000227 3300049666 Bacteria 3345
776 Ga0501230_002747 3300049667 Bacteria 2266
777 Ga0501233_000592 3300049668 Bacteria 5900
778 Ga0501235_000047 3300049669 Bacteria 19301
779 Ga0501238_004581 3300049671 Bacteria 1733
780 Ga0501239_001613 3300049672 Bacteria 1961
781 Ga0501243_000951 3300049675 Bacteria 4057
782 Ga0501246_000086 3300049676 Bacteria 5334
783 Ga0501247_000433 3300049677 Bacteria 3265
784 Ga0501249_001241 3300049679 Bacteria 5351
785 Ga0501249_003541 3300049679 Bacteria 3136
786 Ga0501251_000314 3300049681 Bacteria 4269
787 Ga0501252_000387 3300049682 Bacteria 3252
788 Ga0501255_000108 3300049684 Bacteria 5032
789 Ga0501256_000622 3300049685 Bacteria 2341
790 Ga0501257_003284 3300049686 Bacteria 3457
791 Ga0501258_005450 3300049687 Bacteria 1235
792 Ga0501260_000584 3300049689 Bacteria 2810
793 Ga0501260_000906 3300049689 Bacteria 2373
794 Ga0501261_000349 3300049690 Bacteria 6223
795 Ga0501219_002331 3300049703 Bacteria 1479
796 Ga0501221_000033 3300049704 Bacteria 13541
797 Ga0501221_000556 3300049704 Bacteria 5953
798 Ga0501225_0001264 3300049705 Bacteria 7853
799 Ga0501229_000039 3300049706 Bacteria 12869
800 Ga0501229_000784 3300049706 Bacteria 3583
801 Ga0501234_001101 3300049707 Bacteria 4268
802 Ga0501245_000334 3300049708 Bacteria 5613
803 Ga0501079_0099670 3300049741 Bacteria 2252
804 Ga0501080_0098328 3300049742 Bacteria 2716
805 Ga0501232_000447 3300049757 Bacteria 2751
806 Ga0501232_000733 3300049757 Bacteria 2337
807 Ga0501262_005597 3300049759 Bacteria 1486
808 Ga0501264_000787 3300049761 Bacteria 4141
809 Ga0501265_000413 3300049762 Bacteria 4457
810 Ga0501265_001328 3300049762 Bacteria 2785
811 Ga0501266_000386 3300049763 Bacteria 5907
812 Ga0501270_001870 3300049767 Bacteria 2088
813 Ga0501271_000315 3300049768 Bacteria 4227
814 Ga0501272_000010 3300049769 Bacteria 12503
815 Ga0501273_000880 3300049770 Bacteria 2644
816 Ga0501274_000408 3300049771 Bacteria 3014
817 Ga0501275_000065 3300049772 Bacteria 10759
818 Ga0501275_000115 3300049772 Bacteria 8507
819 Ga0501276_000126 3300049773 Bacteria 3989
820 Ga0501278_000115 3300049774 Bacteria 6042
821 Ga0501280_001365 3300049776 Bacteria 4603
822 Ga0501282_002724 3300049778 Bacteria 1912
823 Ga0501283_000320 3300049779 Bacteria 6343
824 Ga0501035_0012516 3300049822 Bacteria 7836
825 Ga0501035_0026482 3300049822 Bacteria 5305
826 Ga0501035_0055367 3300049822 Bacteria 3541
827 Ga0501035_0062228 3300049822 Bacteria 3321
828 Ga0501035_0145994 3300049822 Bacteria 2054
829 Ga0501035_0163748 3300049822 Bacteria 1924
830 Ga0501044_0121089 3300049823 Bacteria 2618
831 Ga0501044_0407496 3300049823 Bacteria 1271
832 Ga0501044_0440582 3300049823 Bacteria 1211
833 Ga0501045_0025778 3300049824 Bacteria 4227
834 Ga0501200_00709 3300049849 Bacteria 1161
835 Ga0501212_000225 3300049851 Bacteria 5014
836 nmdc:mga03683_20344_c3 3300050489 Bacteria 1614
837 nmdc:mga0k408_84991_c1 3300050493 Bacteria 1857
838 nmdc:mga07m45_6465_c2 3300050496 Bacteria 4980
839 nmdc:mga05p37_15626_c1 3300050507 Bacteria 9122
840 nmdc:mga05p37_19435_c1 3300050507 Bacteria 8218
841 nmdc:mga05p37_21361_c1 3300050507 Bacteria 7839
842 nmdc:mga05p37_50452_c1 3300050507 Bacteria 5117
843 nmdc:mga05p37_758117_c1 3300050507 Bacteria 1069
844 nmdc:mga05p37_82757_c1 3300050507 Bacteria 3955
845 nmdc:mga09592_181772_c1 3300050508 Bacteria 1819
846 nmdc:mga09592_50646_c1 3300050508 Bacteria 3502
847 nmdc:mga09592_58475_c1 3300050508 Bacteria 2020
848 nmdc:mga0qj67_1662_c1 3300050509 Bacteria 15675
849 nmdc:mga0qj67_21835_c1 3300050509 Bacteria 4911
850 nmdc:mga0qj67_33359_c1 3300050509 Bacteria 4017
851 nmdc:mga0qj67_49287_c1 3300050509 Bacteria 3329
852 nmdc:mga0qj67_5235_c1 3300050509 Bacteria 9460
853 nmdc:mga0qj67_67497_c1 3300050509 Bacteria 2849
854 nmdc:mga06r32_10556_c1 3300050510 Bacteria 8328
855 nmdc:mga06r32_128352_c1 3300050510 Bacteria 2506
856 nmdc:mga06r32_247476_c1 3300050510 Bacteria 1770
857 nmdc:mga06r32_262012_c1 3300050510 Bacteria 1716
858 nmdc:mga06r32_28584_c1 3300050510 Bacteria 5220
859 nmdc:mga06r32_345332_c1 3300050510 Bacteria 1473
860 nmdc:mga06r32_35557_c1 3300050510 Bacteria 4700
861 nmdc:mga06r32_362845_c1 3300050510 Bacteria 1432
862 nmdc:mga06r32_781_c1 3300050510 Bacteria 26964
863 nmdc:mga08y16_199510_c1 3300050511 Bacteria 2073
864 nmdc:mga08y16_201552_c1 3300050511 Bacteria 2062
865 nmdc:mga08y16_27_c1 3300050511 Bacteria 214573
866 nmdc:mga08y16_343213_c1 3300050511 Bacteria 1535
867 nmdc:mga08y16_40791_c1 3300050511 Bacteria 4864
868 nmdc:mga08y16_60623_c1 3300050511 Bacteria 3951
869 nmdc:mga0n895_144461_c1 3300050512 Bacteria 2408
870 nmdc:mga0n895_24449_c1 3300050512 Bacteria 5693
871 nmdc:mga0n895_27168_c1 3300050512 Bacteria 5434
872 nmdc:mga0n895_370562_c1 3300050512 Bacteria 1450
873 nmdc:mga08x19_141354_c1 3300050514 Bacteria 1626
874 nmdc:mga08x19_68100_c1 3300050514 Bacteria 2316
875 nmdc:mga08x19_96745_c1 3300050514 Bacteria 1954
876 nmdc:mga0a205_1345_c1 3300050515 Bacteria 20729
877 nmdc:mga0a205_164292_c1 3300050515 Bacteria 2116
878 nmdc:mga0a205_34303_c1 3300050515 Bacteria 4870
879 nmdc:mga0a205_50350_c1 3300050515 Bacteria 4021
880 Ga0495612_0090372 3300053078 Bacteria 1295
881 Ga0495619_0046021 3300053085 Bacteria 2868
882 Ga0500644_0001834 3300053088 Bacteria 5493
883 Ga0500646_0047059 3300053090 Bacteria 1233
884 Ga0500651_0010441 3300053093 Bacteria 5566
885 Ga0500562_005206 3300053108 Bacteria 3267
886 Ga0500655_002607 3300053133 Bacteria 3272
887 Ga0500559_0071681 3300053136 Bacteria 1561
888 Ga0500568_0000040 3300053139 Bacteria 130557
889 Ga0500573_0064818 3300053140 Bacteria 2089
890 Ga0500586_002682 3300053145 Bacteria 4075
891 Ga0500616_0000006 3300053153 Bacteria 944738
892 Ga0500616_0036782 3300053153 Bacteria 2655
893 Ga0500622_0000048 3300053156 Bacteria 147112
894 Ga0500622_0000052 3300053156 Bacteria 145201
895 Ga0500622_0002708 3300053156 Bacteria 12532
896 Ga0500637_0006924 3300053178 Bacteria 5634
897 Ga0500637_0029805 3300053178 Bacteria 3030
898 Ga0500637_0043986 3300053178 Bacteria 2530
899 Ga0501084_0012154 3300054114 Bacteria 7127
900 Ga0590074_009099 3300059423 Bacteria 1656
901 Ga0590075_021442 3300059424 Bacteria 1612
902 Ga0501082_0078303 3300060353 Bacteria 2851
903 Ga0501082_0193760 3300060353 Bacteria 1768
904 Ga0466962_0015348 3300061719 Bacteria 3693
905 Ga0530510_0020121 3300061734 Bacteria 4745
906 Ga0530510_0243216 3300061734 Bacteria 1340
907 2513659088 2513237096 Bacteria 8722461
908 2513921351 2513237145 Bacteria 8979722
909 2548847104 2547132512 Bacteria 3416496
910 2617916640 2617270889 Bacteria 9064343
911 2643743811 2643221544 Bacteria 5886209
912 2643755341 2643221547 Bacteria 4740017
913 2643908677 2643221579 Bacteria 4443405
914 2643916106 2643221581 Bacteria 3893603
915 2644222738 2643221639 Bacteria 6649903
916 2644260665 2643221646 Bacteria 6433402
917 2739058958 2738541337 Bacteria 6183410
918 2792310362 2791355010 Bacteria 4864581
919 2831865877 2831864461 Bacteria 6502356
920 2847934211 2847930680 Bacteria 9342022
921 2869168813 2869162929 Bacteria 6399702
922 2886848732 2886848708 Bacteria 5632523
923 2888369351 2888366609 Bacteria 5155009
924 2888378005 2888373701 Bacteria 5098052
925 2923517894 2923516293 Bacteria 3716336
926 2925334322 2925326138 Bacteria 9652120
927 2932407768 2932406140 Bacteria 5134491
928 2937967923 2937967321 Bacteria 5094075
929 2939580173 2939577877 Bacteria 5132791
930 2977944457 2977942078 Bacteria 7570577
931 642600636 642555144 Bacteria 9059191
932 8004642307 8004640170 Bacteria 6723001
933 8015396446 8015394850 Bacteria 5064660
934 Ga0373926_0044542
935 SwRhRL2b_contig_3393275
936 JGI25151J46595_10001564
937 JGI25153J46596_10012956
938 rootL2_10001457
939 Ga0055536_1006101
940 Ga0055531_10000007
941 Ga0055531_10000590
942 Ga0055531_10002046
943 Ga0055543_1001614
944 Ga0065165_1000220
945 Ga0065704_10071717
946 Ga0065704_10136477
947 Ga0065712_10023398
948 Ga0070676_10002671
949 Ga0070676_10027542
950 Ga0070683_100008919
951 Ga0070683_100022579
952 Ga0070683_100081488
953 Ga0070683_100169616
954 Ga0070683_100221352
955 Ga0070690_100035263
956 Ga0070670_100002635
957 Ga0070670_100009911
958 Ga0070670_100015461
959 Ga0070670_100144225
960 Ga0070670_100177160
961 Ga0070677_10028749
962 Ga0068869_100001778
963 Ga0070680_100000104
964 Ga0070680_100078037
965 Ga0070680_100108354
966 Ga0070682_100153666
967 Ga0068868_100001614
968 Ga0068868_100011380
969 Ga0070660_100001166
970 Ga0070660_100083644
971 Ga0070689_100000037
972 Ga0070689_100018889
973 Ga0070689_100031289
974 Ga0070691_10012441
975 Ga0070691_10129483
976 Ga0070687_100027758
977 Ga0070661_100005692
978 Ga0070661_100019287
979 Ga0070661_100096789
980 Ga0070661_100113662
981 Ga0070692_10003770
982 Ga0070692_10049254
983 Ga0070692_10126578
984 Ga0070668_100020534
985 Ga0070668_100021491
986 Ga0070668_100022331
987 Ga0070668_100144657
988 Ga0070669_100013725
989 Ga0070669_100068954
990 Ga0070669_100110161
991 Ga0070675_100002461
992 Ga0070675_100228448
993 Ga0070671_100060204
994 Ga0070674_100000486
995 Ga0070674_100002888
996 Ga0070673_100094947
997 Ga0070673_100103372
998 Ga0070673_100182919
999 Ga0070673_100219894
1000 Ga0070688_100000302
1001 Ga0070688_100106111
1002 Ga0070659_100025700
1003 Ga0070667_100001691
1004 Ga0070667_100025707
1005 Ga0070701_10000286
1006 Ga0070701_10006343
1007 Ga0070711_100003177
1008 Ga0070711_100038971
1009 Ga0070711_100076174
1010 Ga0070711_100131095
1011 Ga0070700_100000989
1012 Ga0070700_100001914
1013 Ga0070700_100045133
1014 Ga0070700_100172580
1015 Ga0070694_100004184
1016 Ga0070694_100051029
1017 Ga0070694_100204064
1018 Ga0070708_100124652
1019 Ga0070663_100001167
1020 Ga0070678_100000160
1021 Ga0070662_100001385
1022 Ga0070662_100043746
1023 Ga0070662_100095465
1024 Ga0070662_100206109
1025 Ga0070681_10000472
1026 Ga0070681_10003617
1027 Ga0070681_10047105
1028 Ga0070681_10133496
1029 Ga0070681_10240969
1030 Ga0068867_100000808
1031 Ga0068867_100008811
1032 Ga0068867_100133238
1033 Ga0070685_10000066
1034 Ga0070685_10034732
1035 Ga0070685_10059640
1036 Ga0070685_10232778
1037 Ga0070707_100000688
1038 Ga0070707_100293920
1039 Ga0070698_100036840
1040 Ga0070698_100079465
1041 Ga0070699_100000908
1042 Ga0070699_100044003
1043 Ga0070679_100019737
1044 Ga0070679_100050764
1045 Ga0070679_100067794
1046 Ga0070679_100140682
1047 Ga0070679_100206471
1048 Ga0070684_100025138
1049 Ga0070697_100030388
1050 Ga0070697_100194620
1051 Ga0068853_100106105
1052 Ga0070672_100010420
1053 Ga0070672_100049950
1054 Ga0070672_100056370
1055 Ga0070672_100067279
1056 Ga0070686_100000072
1057 Ga0070695_100178520
1058 Ga0070696_100005249
1059 Ga0070696_100227001
1060 Ga0070665_100016000
1061 Ga0070665_100106948
1062 Ga0070665_100125271
1063 Ga0070704_100041998
1064 Ga0068855_100116938
1065 Ga0070664_100017724
1066 Ga0070664_100021142
1067 Ga0070664_100032048
1068 Ga0070664_100138158
1069 Ga0070664_100153839
1070 Ga0068857_100003428
1071 Ga0068857_100036006
1072 Ga0068857_100079618
1073 Ga0068857_100085320
1074 Ga0068857_100220805
1075 Ga0068854_100078849
1076 Ga0068856_100230693
1077 Ga0070702_100166013
1078 Ga0068852_100041382
1079 Ga0068852_100150328
1080 Ga0068859_100004724
1081 Ga0068859_100114284
1082 Ga0068859_100228023
1083 Ga0068864_100038084
1084 Ga0068864_100044054
1085 Ga0068864_100438277
1086 Ga0068866_10006291
1087 Ga0068866_10027590
1088 Ga0068866_10037890
1089 Ga0068861_100000547
1090 Ga0068861_100039398
1091 Ga0068861_100060220
1092 Ga0068870_10134328
1093 Ga0068863_100004375
1094 Ga0068863_100064796
1095 Ga0068863_100111404
1096 Ga0068858_100002138
1097 Ga0068858_100009568
1098 Ga0068858_100088128
1099 Ga0068860_100000724
1100 Ga0068860_100017184
1101 Ga0068862_100026859
1102 Ga0068862_100068840
1103 Ga0081455_10000748
1104 Ga0081538_10002825
1105 Ga0081538_10017469
1106 Ga0081540_1002896
1107 Ga0081539_10000377
1108 Ga0075365_10208309
1109 Ga0075364_10224207
1110 Ga0070715_10013975
1111 Ga0070712_100358240
1112 Ga0075427_10004202
1113 Ga0075366_10030409
1114 Ga0075366_10050085
1115 Ga0097621_100008369
1116 Ga0097621_100028041
1117 Ga0097621_100091965
1118 Ga0075370_10008046
1119 Ga0068871_100001153
1120 Ga0068871_100015047
1121 Ga0068871_100412430
1122 Ga0075428_100021354
1123 Ga0075428_100032802
1124 Ga0075428_100267295
1125 Ga0075430_100005409
1126 Ga0075430_100011721
1127 Ga0075430_100016531
1128 Ga0075430_100038581
1129 Ga0075430_100039982
1130 Ga0075430_100158537
1131 Ga0075430_100323197
1132 Ga0075431_100012496
1133 Ga0075431_100015026
1134 Ga0075431_100025026
1135 Ga0075431_100066146
1136 Ga0075431_100089659
1137 Ga0075431_100243393
1138 Ga0075431_100293199
1139 Ga0075433_10183067
1140 Ga0075429_100007108
1141 Ga0075429_100102818
1142 Ga0075429_100265718
1143 Ga0068865_100000347
1144 Ga0068865_100130839
1145 Ga0068865_100211500
1146 Ga0075436_100047308
1147 Ga0097620_100004725
1148 Ga0097620_100114278
1149 Ga0097620_100228028
1150 Ga0099823_1000072
1151 Ga0075435_100157847
1152 Ga0111539_10029483
1153 Ga0111539_10092822
1154 Ga0105245_10002275
1155 Ga0105245_10012094
1156 Ga0105245_10594905
1157 Ga0105247_10008325
1158 Ga0114129_10002222
1159 Ga0114129_10066413
1160 Ga0114129_10085939
1161 Ga0105243_10007579
1162 Ga0105243_10353096
1163 Ga0105242_10000984
1164 Ga0105242_10013917
1165 Ga0105242_10142522
1166 Ga0105248_10013070
1167 Ga0105248_10013719
1168 Ga0105248_10243683
1169 Ga0105237_10098751
1170 Ga0105238_10000047
1171 Ga0105238_10051887
1172 Ga0105238_10297124
1173 Ga0105249_10001249
1174 Ga0105249_10008436
1175 Ga0105249_10013823
1176 Ga0105249_10143247
1177 Ga0105239_10013072
1178 Ga0105239_10203739
1179 Ga0105239_10338241
1180 Ga0105246_10000314
1181 Ga0157319_1000003
1182 Ga0157371_10042542
1183 Ga0157369_10035090
1184 Ga0157369_10179231
1185 Ga0157374_10026638
1186 Ga0157374_10027231
1187 Ga0157374_10537063
1188 Ga0157378_10000510
1189 Ga0157378_10026511
1190 Ga0157378_10185747
1191 Ga0157378_10238130
1192 Ga0157378_10248482
1193 Ga0163162_10015245
1194 Ga0163162_10024261
1195 Ga0163162_10056153
1196 Ga0163162_10093494
1197 Ga0157372_10250093
1198 Ga0157375_10102730
1199 Ga0157375_10108641
1200 Ga0157375_10213232
1201 Ga0163163_10022696
1202 Ga0157380_10033936
1203 Ga0157377_10007461
1204 Ga0157379_10003252
1205 Ga0157379_10046333
1206 Ga0157379_10093167
1207 Ga0157376_10000407
1208 Ga0157376_10341226
1209 Ga0182005_1017051
1210 Ga0163161_10015626
1211 Ga0197907_10122923
1212 Ga0213873_10000002
1213 Ga0213872_10000036
1214 Ga0213872_10000093
1215 Ga0213872_10000145
1216 Ga0213876_10000001
1217 Ga0213876_10104967
1218 Ga0209676_1000024
1219 Ga0209025_1000685
1220 Ga0209758_1000264
1221 Ga0209050_1011452
1222 Ga0209256_1000150
1223 Ga0209256_1000344
1224 Ga0209051_1002006
1225 Ga0209051_1009784
1226 Ga0209257_1000021
1227 Ga0209257_1000318
1228 Ga0209257_1000399
1229 Ga0207656_10024662
1230 Ga0207710_10016627
1231 Ga0207688_10003209
1232 Ga0207680_10017306
1233 Ga0207685_10029875
1234 Ga0207645_10000191
1235 Ga0207645_10000220
1236 Ga0207643_10010943
1237 Ga0207643_10011505
1238 Ga0207705_10001754
1239 Ga0207707_10006675
1240 Ga0207707_10028861
1241 Ga0207707_10080983
1242 Ga0207707_10176732
1243 Ga0207707_10298511
1244 Ga0207695_10305378
1245 Ga0207693_10139038
1246 Ga0207663_10062640
1247 Ga0207660_10042836
1248 Ga0207660_10068165
1249 Ga0207660_10100693
1250 Ga0207662_10028939
1251 Ga0207657_10000462
1252 Ga0207657_10000971
1253 Ga0207649_10019166
1254 Ga0207649_10065426
1255 Ga0207652_10035821
1256 Ga0207646_10000002
1257 Ga0207646_10240301
1258 Ga0207681_10011871
1259 Ga0207681_10013639
1260 Ga0207681_10072696
1261 Ga0207681_10084142
1262 Ga0207681_10174923
1263 Ga0207694_10001495
1264 Ga0207694_10059741
1265 Ga0207650_10032484
1266 Ga0207650_10044526
1267 Ga0207650_10045921
1268 Ga0207659_10047366
1269 Ga0207687_10020522
1270 Ga0207690_10045117
1271 Ga0207706_10000337
1272 Ga0207706_10000402
1273 Ga0207706_10017957
1274 Ga0207706_10088553
1275 Ga0207686_10122602
1276 Ga0207709_10041534
1277 Ga0207709_10212582
1278 Ga0207670_10000048
1279 Ga0207670_10144424
1280 Ga0207670_10176175
1281 Ga0207669_10201369
1282 Ga0207691_10000103
1283 Ga0207691_10000210
1284 Ga0207691_10007470
1285 Ga0207691_10011003
1286 Ga0207691_10135376
1287 Ga0207711_10008233
1288 Ga0207711_10014681
1289 Ga0207711_10367378
1290 Ga0207689_10004087
1291 Ga0207689_10011248
1292 Ga0207661_10025384
1293 Ga0207661_10060720
1294 Ga0207661_10309235
1295 Ga0207679_10002283
1296 Ga0207679_10003409
1297 Ga0207679_10005021
1298 Ga0207679_10029718
1299 Ga0207679_10033793
1300 Ga0207679_10265685
1301 Ga0207679_10376538
1302 Ga0207667_10011997
1303 Ga0207667_10147330
1304 Ga0207651_10078600
1305 Ga0207651_10322329
1306 Ga0207712_10000836
1307 Ga0207712_10001069
1308 Ga0207712_10023948
1309 Ga0207712_10129603
1310 Ga0207668_10011892
1311 Ga0207668_10034569
1312 Ga0207668_10149121
1313 Ga0207640_10116135
1314 Ga0207677_10000002
1315 Ga0207677_10100199
1316 Ga0207703_10010390
1317 Ga0207703_10036147
1318 Ga0207703_10057763
1319 Ga0207703_10088882
1320 Ga0207639_10000006
1321 Ga0207678_10000126
1322 Ga0207678_10111448
1323 Ga0207708_10000334
1324 Ga0207708_10001747
1325 Ga0207708_10194631
1326 Ga0207702_10205562
1327 Ga0207702_10503314
1328 Ga0207641_10039357
1329 Ga0207641_10071721
1330 Ga0207641_10396179
1331 Ga0207648_10000177
1332 Ga0207648_10000321
1333 Ga0207648_10040680
1334 Ga0207648_10087379
1335 Ga0207676_10022269
1336 Ga0207676_10025563
1337 Ga0207676_10056569
1338 Ga0207676_10061217
1339 Ga0207674_10022113
1340 Ga0207674_10030571
1341 Ga0207674_10044893
1342 Ga0207674_10060062
1343 Ga0207675_100003121
1344 Ga0207675_100034714
1345 Ga0207675_100083910
1346 Ga0207675_100103610
1347 Ga0207683_10000032
1348 Ga0209389_1003332
1349 Ga0209969_1000124
1350 Ga0209967_1000045
1351 Ga0209981_1003554
1352 Ga0209996_1000003
1353 Ga0210000_1000023
1354 Ga0209995_1000001
1355 Ga0209968_1000162
1356 Ga0209999_1000137
1357 Ga0209982_1000127
1358 Ga0209970_1000390
1359 Ga0210002_1000088
1360 Ga0209983_1004975
1361 Ga0209971_1000124
1362 Ga0209966_1000047
1363 Ga0209998_10000037
1364 Ga0209974_10000103
1365 Ga0209974_10003956
1366 Ga0207428_10000038
1367 Ga0207428_10009119
1368 Ga0207428_10079000
1369 Ga0268266_10077674
1370 Ga0268266_10361557
1371 Ga0268265_10005184
1372 Ga0268265_10059487
1373 Ga0268265_10365882
1374 Ga0268264_10000096
1375 Ga0268264_10169179
1376 Ga0265323_10037209
1377 Ga0307515_10000089
1378 Ga0307515_10000096
1379 Ga0307515_10009616
1380 Ga0307515_10015292
1381 Ga0307515_10026976
1382 Ga0307515_10077592
1383 Ga0265330_10029888
1384 Ga0265332_10000286
1385 Ga0265340_10027836
1386 Ga0265331_10014504
1387 Ga0265331_10027155
1388 Ga0265331_10098029
1389 Ga0265327_10000012
1390 Ga0307513_10012840
1391 Ga0307513_10025908
1392 Ga0307509_10016306
1393 Ga0307408_100000023
1394 Ga0307408_100019873
1395 Ga0307408_100034978
1396 Ga0265313_10003764
1397 Ga0307508_10014707
1398 Ga0316579_10071803
1399 Ga0265314_10030734
1400 Ga0265314_10111853
1401 Ga0265342_10011277
1402 Ga0316576_10008039
1403 Ga0316576_10016038
1404 Ga0316576_10026391
1405 Ga0316576_10041752
1406 Ga0316576_10068406
1407 Ga0316576_10090528
1408 Ga0316576_10097169
1409 Ga0316578_10003901
1410 Ga0316578_10009454
1411 Ga0316578_10023649
1412 Ga0316578_10106356
1413 Ga0307516_10066897
1414 Ga0307405_10018461
1415 Ga0307405_10217041
1416 Ga0316577_10022788
1417 Ga0316577_10117180
1418 Ga0307413_10052822
1419 Ga0307413_10164111
1420 Ga0307413_10297423
1421 Ga0307406_10005283
1422 Ga0307406_10035715
1423 Ga0307407_10108047
1424 Ga0307412_10033677
1425 Ga0307409_100017567
1426 Ga0307409_100019722
1427 Ga0307409_100046167
1428 Ga0307409_100085678
1429 Ga0307409_100145262
1430 Ga0307416_100001542
1431 Ga0307416_100007205
1432 Ga0307416_100095467
1433 Ga0307414_10055597
1434 Ga0307411_10042413
1435 Ga0307411_10049851
1436 Ga0307415_100031012
1437 Ga0307415_100035330
1438 Ga0307507_10108905
1439 Ga0316596_1005795
1440 Ga0373950_0002749
1441 Ga0373926_0000008
1442 Ga0373923_0000070
1443 Ga0373945_0044781
1444 Ga0373960_0025329
1445 Ga0373943_0000139
1446 Ga0373946_0004804
1447 Ga0373961_0011494
1448 Ga0316574_0002610
1449 Ga0316574_0002765
1450 Ga0373924_0000002
1451 Ga0373935_0019756
1452 Ga0373927_0000083
1453 Ga0373927_0183518
1454 Ga0373933_0000020
1455 Ga0373933_0034263
1456 Ga0373947_0000317
1457 Ga0316582_0006341
1458 Ga0316582_0038600
1459 Ga0316582_0084292
1460 Ga0316584_0044462
1461 Ga0316584_0045188
1462 Ga0316584_0094672
1463 Ga0316584_0138054
1464 Ga0316584_0151280
1465 Ga0373925_0000861
1466 Ga0373925_0006634
1467 Ga0373925_0078324
1468 Ga0395900_0000050
1469 Ga0395898_0001226
1470 Ga0395905_0008461
1471 Ga0395905_0065433
1472 Ga0395905_0098212
1473 Ga0436364_0298290
1474 Ga0400484_04971
1475 Ga0400484_14150
1476 Ga0400484_21144
1477 Ga0400490_29571
1478 Ga0400490_50108
1479 Ga0400491_07309
1480 Ga0400491_20615
1481 Ga0400485_13900
1482 Ga0400485_19406
1483 Ga0400485_19725
1484 Ga0400488_07945
1485 Ga0400488_53590
1486 Ga0400486_04376
1487 Ga0400486_09168
1488 Ga0400486_20498
1489 Ga0400483_057472
1490 Ga0400483_101355
1491 Ga0400483_195086
1492 Ga0400483_280975
1493 Ga0400483_282299
1494 Ga0400489_54455
1495 Ga0400487_01582
1496 Ga0400487_20123
1497 Ga0400487_29557
1498 Ga0400487_41538
1499 Ga0436365_0332720
1500 Ga0436365_0861952
1501 Ga0436361_0190331
1502 Ga0436361_0872820
1503 Ga0436362_0660519
1504 Ga0439465_0010617
1505 Ga0439441_000140
1506 Ga0439443_010820
1507 Ga0439448_0026160
1508 Ga0439449_0002726
1509 Ga0439449_0050846
1510 Ga0450888_000025
1511 Ga0450890_000206
1512 Ga0450891_000045
1513 Ga0450892_000023
1514 Ga0450899_002729
1515 Ga0439434_0003978
1516 Ga0439435_0017424
1517 Ga0439444_0003078
1518 Ga0439459_0000720
1519 Ga0450893_0001110
1520 Ga0451577_0000035
1521 Ga0451577_0001096
1522 Ga0451577_0001321
1523 Ga0451577_0001858
1524 Ga0451577_0002792
1525 Ga0451577_0003495
1526 Ga0451577_0039896
1527 Ga0451577_0060775
1528 Ga0451577_0111237
1529 Ga0451577_0173328
1530 Ga0451577_0198538
1531 Ga0451577_0249962
1532 Ga0453683_0000184
1533 Ga0453683_0001691
1534 Ga0453683_0026828
1535 Ga0453683_0031658
1536 Ga0453683_0042076
1537 Ga0466961_0001392
1538 Ga0466961_0035959
1539 Ga0466963_0050735
1540 Ga0466963_0118086
1541 Ga0466964_0016965
1542 Ga0466964_0032704
1543 Ga0453684_0000097
1544 Ga0453684_0000443
1545 Ga0453684_0000502
1546 Ga0453684_0000710
1547 Ga0453684_0001117
1548 Ga0453684_0006132
1549 Ga0453684_0007328
1550 Ga0453684_0008233
1551 Ga0453684_0013067
1552 Ga0453684_0019151
1553 Ga0453684_0020808
1554 Ga0453684_0060559
1555 Ga0453684_0159592
1556 Ga0453684_0197368
1557 Ga0453684_0202270
1558 Ga0453684_0209588
1559 Ga0453684_0212157
1560 Ga0453684_0220467
1561 Ga0453684_0299611
1562 Ga0453684_0417844
1563 Ga0453684_0600459
1564 Ga0466971_0058697
1565 Ga0466970_0002719
1566 Ga0466970_0037187
1567 Ga0466959_0000041
1568 Ga0466959_0144236
1569 Ga0451576_0000096
1570 Ga0451576_0000412
1571 Ga0451576_0001510
1572 Ga0451576_0002396
1573 Ga0451576_0008271
1574 Ga0451576_0011483
1575 Ga0451576_0039041
1576 Ga0451576_0044610
1577 Ga0451576_0078766
1578 Ga0451576_0114165
1579 Ga0451576_0198204
1580 Ga0451576_0231653
1581 Ga0451576_0323942
1582 Ga0451576_0426484
1583 Ga0466967_0033372
1584 Ga0466967_0093114
1585 Ga0495629_0162918
1586 Ga0495580_0052390
1587 Ga0495582_0117127
1588 Ga0495594_0003823
1589 Ga0495620_0000926
1590 Ga0495630_0012507
1591 Ga0495630_0235119
1592 Ga0495648_0006136
1593 Ga0495586_0034929
1594 Ga0495634_0153508
1595 Ga0495635_0108001
1596 Ga0495659_0012156
1597 Ga0495657_0001201
1598 Ga0495670_0013798
1599 Ga0495581_0132983
1600 Ga0495636_0058457
1601 Ga0495686_0183736
1602 Ga0496102_0009318
1603 Ga0496105_0045823
1604 Ga0496106_0100859
1605 Ga0496110_0082911
1606 Ga0496111_0001591
1607 Ga0496112_0010797
1608 Ga0496114_0007537
1609 Ga0496115_0084745
1610 Ga0496116_0007473
1611 Ga0496117_0000209
1612 Ga0496118_0000019
1613 Ga0496119_0011523
1614 Ga0496120_0012032
1615 Ga0496121_0003238
1616 Ga0496121_0038803
1617 Ga0496122_0013543
1618 Ga0496124_0023711
1619 Ga0496124_0197075
1620 Ga0496125_0005139
1621 Ga0496125_0047533
1622 Ga0496126_0006720
1623 Ga0496126_0008429
1624 Ga0496126_0013233
1625 Ga0496126_0128479
1626 Ga0501308_001789
1627 Ga0501309_003513
1628 Ga0501310_002285
1629 Ga0501290_000043
1630 Ga0501290_000937
1631 Ga0501291_001099
1632 Ga0501292_000033
1633 Ga0501293_000638
1634 Ga0501294_000556
1635 Ga0501295_000788
1636 Ga0501296_000102
1637 Ga0501297_000079
1638 Ga0501297_000530
1639 Ga0501298_001186
1640 Ga0501298_003087
1641 Ga0501299_000327
1642 Ga0501300_000813
1643 Ga0501300_002032
1644 Ga0501302_000306
1645 Ga0501303_000416
1646 Ga0501311_003710
1647 Ga0501314_000461
1648 Ga0501031_0002512
1649 Ga0501031_0010013
1650 Ga0501031_0026475
1651 Ga0501032_0019245
1652 Ga0501034_0000122
1653 Ga0501034_0180816
1654 Ga0501034_0271244
1655 Ga0501036_0053579
1656 Ga0501037_0009043
1657 Ga0501037_0037270
1658 Ga0501037_0080292
1659 Ga0501038_0010129
1660 Ga0501038_0021314
1661 Ga0501038_0041663
1662 Ga0501039_0003507
1663 Ga0501039_0012714
1664 Ga0501039_0057589
1665 Ga0501039_0124729
1666 Ga0501041_0002040
1667 Ga0501041_0007229
1668 Ga0501041_0031221
1669 Ga0501041_0042665
1670 Ga0501041_0044647
1671 Ga0501042_0073726
1672 Ga0501042_0085165
1673 Ga0501043_0011719
1674 Ga0501046_0000649
1675 Ga0501046_0009746
1676 Ga0501046_0015077
1677 Ga0501047_0000450
1678 Ga0501048_0000194
1679 Ga0501048_0000871
1680 Ga0501048_0030631
1681 Ga0501070_0026180
1682 Ga0501070_0194761
1683 Ga0501071_0048105
1684 Ga0501071_0219857
1685 Ga0501071_0243578
1686 Ga0501072_0156920
1687 Ga0501073_0155360
1688 Ga0501074_0080302
1689 Ga0501075_0042537
1690 Ga0501075_0052696
1691 Ga0501076_0054387
1692 Ga0501076_0124248
1693 Ga0501076_0178325
1694 Ga0501077_0005495
1695 Ga0501077_0101889
1696 Ga0501199_000176
1697 Ga0501201_000139
1698 Ga0501202_000086
1699 Ga0501207_000560
1700 Ga0501208_000149
1701 Ga0501209_000313
1702 Ga0501209_005420
1703 Ga0501211_000368
1704 Ga0501216_000910
1705 Ga0501217_000381
1706 Ga0501222_004187
1707 Ga0501227_008844
1708 Ga0501228_000227
1709 Ga0501230_002747
1710 Ga0501233_000592
1711 Ga0501235_000047
1712 Ga0501238_004581
1713 Ga0501239_001613
1714 Ga0501243_000951
1715 Ga0501246_000086
1716 Ga0501247_000433
1717 Ga0501249_001241
1718 Ga0501249_003541
1719 Ga0501251_000314
1720 Ga0501252_000387
1721 Ga0501255_000108
1722 Ga0501256_000622
1723 Ga0501257_003284
1724 Ga0501258_005450
1725 Ga0501260_000584
1726 Ga0501260_000906
1727 Ga0501261_000349
1728 Ga0501219_002331
1729 Ga0501221_000033
1730 Ga0501221_000556
1731 Ga0501225_0001264
1732 Ga0501229_000039
1733 Ga0501229_000784
1734 Ga0501234_001101
1735 Ga0501245_000334
1736 Ga0501079_0099670
1737 Ga0501080_0098328
1738 Ga0501232_000447
1739 Ga0501232_000733
1740 Ga0501262_005597
1741 Ga0501264_000787
1742 Ga0501265_000413
1743 Ga0501265_001328
1744 Ga0501266_000386
1745 Ga0501270_001870
1746 Ga0501271_000315
1747 Ga0501272_000010
1748 Ga0501273_000880
1749 Ga0501274_000408
1750 Ga0501275_000065
1751 Ga0501275_000115
1752 Ga0501276_000126
1753 Ga0501278_000115
1754 Ga0501280_001365
1755 Ga0501282_002724
1756 Ga0501283_000320
1757 Ga0501035_0012516
1758 Ga0501035_0026482
1759 Ga0501035_0055367
1760 Ga0501035_0062228
1761 Ga0501035_0145994
1762 Ga0501035_0163748
1763 Ga0501044_0121089
1764 Ga0501044_0407496
1765 Ga0501044_0440582
1766 Ga0501045_0025778
1767 Ga0501200_00709
1768 Ga0501212_000225
1769 nmdc:mga03683_20344_c3
1770 nmdc:mga0k408_84991_c1
1771 nmdc:mga07m45_6465_c2
1772 nmdc:mga05p37_15626_c1
1773 nmdc:mga05p37_19435_c1
1774 nmdc:mga05p37_21361_c1
1775 nmdc:mga05p37_50452_c1
1776 nmdc:mga05p37_758117_c1
1777 nmdc:mga05p37_82757_c1
1778 nmdc:mga09592_181772_c1
1779 nmdc:mga09592_50646_c1
1780 nmdc:mga09592_58475_c1
1781 nmdc:mga0qj67_1662_c1
1782 nmdc:mga0qj67_21835_c1
1783 nmdc:mga0qj67_33359_c1
1784 nmdc:mga0qj67_49287_c1
1785 nmdc:mga0qj67_5235_c1
1786 nmdc:mga0qj67_67497_c1
1787 nmdc:mga06r32_10556_c1
1788 nmdc:mga06r32_128352_c1
1789 nmdc:mga06r32_247476_c1
1790 nmdc:mga06r32_262012_c1
1791 nmdc:mga06r32_28584_c1
1792 nmdc:mga06r32_345332_c1
1793 nmdc:mga06r32_35557_c1
1794 nmdc:mga06r32_362845_c1
1795 nmdc:mga06r32_781_c1
1796 nmdc:mga08y16_199510_c1
1797 nmdc:mga08y16_201552_c1
1798 nmdc:mga08y16_27_c1
1799 nmdc:mga08y16_343213_c1
1800 nmdc:mga08y16_40791_c1
1801 nmdc:mga08y16_60623_c1
1802 nmdc:mga0n895_144461_c1
1803 nmdc:mga0n895_24449_c1
1804 nmdc:mga0n895_27168_c1
1805 nmdc:mga0n895_370562_c1
1806 nmdc:mga08x19_141354_c1
1807 nmdc:mga08x19_68100_c1
1808 nmdc:mga08x19_96745_c1
1809 nmdc:mga0a205_1345_c1
1810 nmdc:mga0a205_164292_c1
1811 nmdc:mga0a205_34303_c1
1812 nmdc:mga0a205_50350_c1
1813 Ga0495612_0090372
1814 Ga0495619_0046021
1815 Ga0500644_0001834
1816 Ga0500646_0047059
1817 Ga0500651_0010441
1818 Ga0500562_005206
1819 Ga0500655_002607
1820 Ga0500559_0071681
1821 Ga0500568_0000040
1822 Ga0500573_0064818
1823 Ga0500586_002682
1824 Ga0500616_0000006
1825 Ga0500616_0036782
1826 Ga0500622_0000048
1827 Ga0500622_0000052
1828 Ga0500622_0002708
1829 Ga0500637_0006924
1830 Ga0500637_0029805
1831 Ga0500637_0043986
1832 Ga0501084_0012154
1833 Ga0590074_009099
1834 Ga0590075_021442
1835 Ga0501082_0078303
1836 Ga0501082_0193760
1837 Ga0466962_0015348
1838 Ga0530510_0020121
1839 Ga0530510_0243216
1840 2513659088
1841 2513921351
1842 2548847104
1843 2617916640
1844 2643743811
1845 2643755341
1846 2643908677
1847 2643916106
1848 2644222738
1849 2644260665
1850 2739058958
1851 2792310362
1852 2831865877
1853 2847934211
1854 2869168813
1855 2886848732
1856 2888369351
1857 2888378005
1858 2923517894
1859 2925334322
1860 2932407768
1861 2937967923
1862 2939580173
1863 2977944457
1864 642600636
1865 8004642307
1866 8015396446

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

9

177

0.95

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

11

254

0.92

PF08659

KR

KR domain

9

152

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

12

317

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

12

175

0.83

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

11

229

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4q-assembly1.cif.gz_B 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9779 1 333
5u4q-assembly1.cif.gz_B 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9684 1 333
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9596 1 335
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9537 1 335
6zlj-assembly1.cif.gz_B-2 crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and nad 0.941 1 333
ID Description Score Start End Superfamily
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9591 1 335 3.40.50.720
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9561 1 335 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9294 1 262 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9255 1 262 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9249 1 262 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D6C3I5-F1-model_v4 Capsular biosynthesis protein CpsI 0.9944 1 335
AF-A0A7C7MZJ3-F1-model_v4 NAD-dependent epimerase 0.9939 1 335
AF-I3UIB1-F1-model_v4 Capsular polysaccharide biosynthesis protein I-like protein 0.9911 111 290
AF-A0A7C7MZJ3-F1-model_v4 NAD-dependent epimerase 0.9909 1 335
AF-V7FNM4-F1-model_v4 NAD dependent epimerase/dehydratase 0.9908 2 334

Map