F486103

General Info

Members Datasets Scaffolds Average Seq Length
933 482 1866 193

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0057863|Ga0495594_0057863_997_1662
Length 221
Sequence MTPDGLLRFARNDEKQLRRHIMLREIRPAIIILVALTLITGLGYPLVMTAIAGVIFPEQAQGSLIERHGKVVGSALIGQEFKDDRYFHGRPSVTLAPDPADATKTVPAPYNAANSGGSNLGPTSKALNDRVKEDVEKLKAENPSAAVPMDLVTTSASGLDPDISPEGALFQVPRVAKARNIPEDRIRELVNQNTQGRLAGLLGEPRVNVLALNLALDTASR

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
171 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
172 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
173 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
174 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
211 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
241 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
242 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
243 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
244 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
245 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
274 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
318 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
337 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
340 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
341 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
342 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
343 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
344 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
354 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
355 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
371 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
375 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
376 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
377 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
378 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
379 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
380 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
381 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
382 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
383 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
384 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
385 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
386 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
387 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
388 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
389 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
390 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
391 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
392 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
393 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
394 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
395 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
396 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
399 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
400 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
401 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
402 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
403 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
404 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
407 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
408 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
409 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
410 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
411 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
412 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
413 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
414 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
415 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
416 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
417 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
418 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
419 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
420 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
421 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
422 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
423 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
424 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
425 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
426 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
427 2643221651 Afipia sp. Root123D2 Isolate Unclassified
428 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
429 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
430 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
431 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
432 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
433 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
434 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
435 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
436 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
437 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
438 2791355199
439 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
440 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
441 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
442 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
443 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
444 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
445 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
446 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
447 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
448 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
449 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
450 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
451 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
452 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
453 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
454 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
455 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
456 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
457 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
458 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
459 2904699407
460 2906610324
461 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
462 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
463 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
464 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
465 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
466 2922425934
467 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
468 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
469 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
470 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
471 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
472 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
473 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
474 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
475 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
476 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
477 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
478 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
479 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
480 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
481 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere
482 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93
Metatranscriptomes 0.43
Isolates 6.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.65
Nodule 2.89
Rhizoplane 4.61
Rhizosphere 67.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0057863 3300046499 Bacteria 2141
2 Ga0006562J51391_1003321 3300003578 Bacteria 6795
3 JGI25404J52841_10006939 3300003659 Bacteria 2381
4 JGI25404J52841_10014450 3300003659 Bacteria 1713
5 Ga0065714_10020481 3300005288 Bacteria 1770
6 Ga0065714_10113277 3300005288 Bacteria 1444
7 Ga0070683_100105299 3300005329 Bacteria 2659
8 Ga0070683_100803955 3300005329 Bacteria 901
9 Ga0070690_100162859 3300005330 Bacteria 1530
10 Ga0070670_100578064 3300005331 Bacteria 1004
11 Ga0070670_100616356 3300005331 Bacteria 972
12 Ga0068869_100105616 3300005334 Bacteria 2136
13 Ga0070666_10393464 3300005335 Bacteria 996
14 Ga0070680_100035600 3300005336 Bacteria 4020
15 Ga0070680_100080850 3300005336 Bacteria 2681
16 Ga0070680_100313351 3300005336 Bacteria 1332
17 Ga0070680_100484130 3300005336 Bacteria 1058
18 Ga0070680_100653867 3300005336 Bacteria 903
19 Ga0070682_100583978 3300005337 Bacteria 880
20 Ga0070682_101084095 3300005337 Bacteria 670
21 Ga0068868_100024604 3300005338 Bacteria 4571
22 Ga0068868_100133850 3300005338 Bacteria 2030
23 Ga0068868_100171022 3300005338 Bacteria 1799
24 Ga0068868_100727153 3300005338 Bacteria 890
25 Ga0070689_100189175 3300005340 Bacteria 1676
26 Ga0070661_100469950 3300005344 Bacteria 1003
27 Ga0070668_100052378 3300005347 Bacteria 3145
28 Ga0070669_100305578 3300005353 Bacteria 1280
29 Ga0070669_100561433 3300005353 Bacteria 953
30 Ga0070675_100509938 3300005354 Bacteria 1085
31 Ga0070671_100159052 3300005355 Bacteria 1909
32 Ga0070674_100010034 3300005356 Bacteria 5702
33 Ga0070673_100273760 3300005364 Bacteria 1479
34 Ga0070673_100308190 3300005364 Bacteria 1396
35 Ga0070709_10010623 3300005434 Bacteria 5105
36 Ga0070709_10045320 3300005434 Bacteria 2728
37 Ga0070709_10534851 3300005434 Bacteria 895
38 Ga0070714_100125058 3300005435 Bacteria 2292
39 Ga0070714_100140062 3300005435 Bacteria 2170
40 Ga0070714_100462778 3300005435 Bacteria 1206
41 Ga0070714_100724255 3300005435 Bacteria 961
42 Ga0070714_101498952 3300005435 Bacteria 659
43 Ga0070713_100005895 3300005436 Bacteria 8424
44 Ga0070713_100042023 3300005436 Bacteria 3728
45 Ga0070713_100311887 3300005436 Bacteria 1451
46 Ga0070710_10001143 3300005437 Bacteria 12589
47 Ga0070710_10033830 3300005437 Bacteria 2778
48 Ga0070710_10052491 3300005437 Bacteria 2293
49 Ga0070711_100012156 3300005439 Bacteria 5372
50 Ga0070711_100031547 3300005439 Bacteria 3518
51 Ga0070711_100034394 3300005439 Bacteria 3380
52 Ga0070711_100051498 3300005439 Bacteria 2828
53 Ga0070663_100000663 3300005455 Bacteria 18514
54 Ga0070663_100003769 3300005455 Bacteria 8803
55 Ga0070663_100154109 3300005455 Bacteria 1764
56 Ga0070663_100437482 3300005455 Bacteria 1076
57 Ga0070663_100793618 3300005455 Bacteria 811
58 Ga0070678_100124675 3300005456 Bacteria 2037
59 Ga0070678_100875200 3300005456 Bacteria 820
60 Ga0070662_100083552 3300005457 Bacteria 2384
61 Ga0070662_100367278 3300005457 Bacteria 1182
62 Ga0070662_100456000 3300005457 Bacteria 1062
63 Ga0070681_10007338 3300005458 Bacteria 10769
64 Ga0070681_10029849 3300005458 Bacteria 5472
65 Ga0070681_10241859 3300005458 Bacteria 1718
66 Ga0070681_10244768 3300005458 Bacteria 1706
67 Ga0070706_100328218 3300005467 Bacteria 1427
68 Ga0070706_100685249 3300005467 Bacteria 951
69 Ga0070707_100054244 3300005468 Bacteria 3843
70 Ga0070679_100005095 3300005530 Bacteria 12139
71 Ga0070679_100016927 3300005530 Bacteria 7048
72 Ga0070679_100346489 3300005530 Bacteria 1433
73 Ga0070679_100367653 3300005530 Bacteria 1385
74 Ga0070684_100041425 3300005535 Bacteria 3970
75 Ga0070684_100524651 3300005535 Bacteria 1098
76 Ga0070697_100273753 3300005536 Bacteria 1448
77 Ga0068853_100080396 3300005539 Bacteria 2852
78 Ga0068853_100107081 3300005539 Bacteria 2478
79 Ga0068853_100133162 3300005539 Bacteria 2227
80 Ga0068853_100277430 3300005539 Bacteria 1545
81 Ga0068853_100367411 3300005539 Bacteria 1342
82 Ga0068853_100393568 3300005539 Bacteria 1296
83 Ga0068853_100568823 3300005539 Bacteria 1075
84 Ga0070672_100069324 3300005543 Bacteria 2799
85 Ga0070693_100125435 3300005547 Bacteria 1598
86 Ga0070665_100021352 3300005548 Bacteria 6512
87 Ga0070665_100211972 3300005548 Bacteria 1938
88 Ga0068855_100037802 3300005563 Bacteria 5738
89 Ga0068855_100081956 3300005563 Bacteria 3739
90 Ga0070664_100058833 3300005564 Bacteria 3269
91 Ga0068856_100195698 3300005614 Bacteria 2036
92 Ga0068856_100335042 3300005614 Bacteria 1531
93 Ga0068856_100547268 3300005614 Bacteria 1178
94 Ga0068852_100656393 3300005616 Bacteria 1057
95 Ga0068859_100365258 3300005617 Bacteria 1538
96 Ga0068859_100459923 3300005617 Bacteria 1369
97 Ga0068864_100033892 3300005618 Bacteria 4342
98 Ga0068864_100075572 3300005618 Bacteria 2942
99 Ga0068866_10134581 3300005718 Bacteria 1410
100 Ga0068866_10716785 3300005718 Bacteria 688
101 Ga0068851_10184853 3300005834 Bacteria 1156
102 Ga0068860_100000277 3300005843 Bacteria 73951
103 Ga0068860_100117686 3300005843 Bacteria 2543
104 Ga0068860_100869843 3300005843 Bacteria 917
105 Ga0068862_100062919 3300005844 Bacteria 3192
106 Ga0068862_100090098 3300005844 Bacteria 2669
107 Ga0068862_100264347 3300005844 Bacteria 1572
108 Ga0068862_101052977 3300005844 Bacteria 807
109 Ga0081538_10070951 3300005981 Bacteria 1920
110 Ga0081540_1013761 3300005983 Bacteria 5241
111 Ga0081540_1033497 3300005983 Bacteria 2788
112 Ga0081540_1118869 3300005983 Bacteria 1101
113 Ga0081540_1123610 3300005983 Bacteria 1069
114 Ga0081539_10000008 3300005985 Bacteria 525071
115 Ga0070717_10001012 3300006028 Bacteria 18845
116 Ga0070717_10010060 3300006028 Bacteria 7122
117 Ga0070717_10868436 3300006028 Bacteria 821
118 Ga0075365_10023316 3300006038 Bacteria 3891
119 Ga0075365_10037498 3300006038 Bacteria 3147
120 Ga0075365_10554861 3300006038 Bacteria 812
121 Ga0075365_10649226 3300006038 Bacteria 746
122 Ga0075368_10006100 3300006042 Bacteria 4190
123 Ga0075368_10016532 3300006042 Bacteria 2750
124 Ga0075363_100001432 3300006048 Bacteria 9037
125 Ga0075364_10082823 3300006051 Bacteria 2123
126 Ga0075364_10096903 3300006051 Bacteria 1962
127 Ga0070715_10001321 3300006163 Bacteria 7144
128 Ga0070715_10105174 3300006163 Bacteria 1323
129 Ga0070715_10120794 3300006163 Bacteria 1249
130 Ga0070712_100051705 3300006175 Bacteria 2863
131 Ga0070712_100056148 3300006175 Bacteria 2761
132 Ga0070712_100061639 3300006175 Bacteria 2650
133 Ga0070712_100082461 3300006175 Bacteria 2332
134 Ga0070712_100182730 3300006175 Bacteria 1635
135 Ga0070712_100437604 3300006175 Bacteria 1087
136 Ga0075367_10124456 3300006178 Bacteria 1590
137 Ga0075367_10139253 3300006178 Bacteria 1503
138 Ga0075367_10156884 3300006178 Bacteria 1414
139 Ga0075367_10277714 3300006178 Bacteria 1053
140 Ga0075367_10372824 3300006178 Bacteria 901
141 Ga0075369_10032995 3300006186 Bacteria 2193
142 Ga0075369_10125173 3300006186 Bacteria 1165
143 Ga0075369_10260556 3300006186 Bacteria 806
144 Ga0075366_10021253 3300006195 Bacteria 3772
145 Ga0075366_10234456 3300006195 Bacteria 1118
146 Ga0097621_100426171 3300006237 Bacteria 1191
147 Ga0075370_10002046 3300006353 Bacteria 9161
148 Ga0068871_100150747 3300006358 Bacteria 1983
149 Ga0075434_100202779 3300006871 Bacteria 2004
150 Ga0068865_100024418 3300006881 Bacteria 3966
151 Ga0097620_100365266 3300006931 Bacteria 1538
152 Ga0097620_100459907 3300006931 Bacteria 1369
153 Ga0099824_1000172 3300006942 Bacteria 59875
154 Ga0079104_1002074 3300006946 Bacteria 11539
155 Ga0099826_10003676 3300006948 Bacteria 10512
156 Ga0099794_10080457 3300007265 Bacteria 1607
157 Ga0099795_10013641 3300007788 Bacteria 2499
158 Ga0099795_10065454 3300007788 Bacteria 1359
159 Ga0105244_10000220 3300009036 Bacteria 59527
160 Ga0105250_10093730 3300009092 Bacteria 1223
161 Ga0105240_10283276 3300009093 Bacteria 1903
162 Ga0111539_10878068 3300009094 Bacteria 1043
163 Ga0105245_10003690 3300009098 Bacteria 13668
164 Ga0105245_10039286 3300009098 Bacteria 4212
165 Ga0105247_10064943 3300009101 Bacteria 2269
166 Ga0105247_10077113 3300009101 Bacteria 2094
167 Ga0105247_10171998 3300009101 Bacteria 1441
168 Ga0105247_10337342 3300009101 Bacteria 1056
169 Ga0105247_10523984 3300009101 Bacteria 867
170 Ga0105243_10030847 3300009148 Bacteria 4131
171 Ga0105243_10370817 3300009148 Bacteria 1321
172 Ga0105241_10028994 3300009174 Bacteria 4125
173 Ga0105241_10346459 3300009174 Bacteria 1289
174 Ga0105242_10751558 3300009176 Bacteria 960
175 Ga0105248_10181813 3300009177 Bacteria 2369
176 Ga0105248_10379042 3300009177 Bacteria 1592
177 Ga0105248_10953830 3300009177 Bacteria 969
178 Ga0105237_10028140 3300009545 Bacteria 5727
179 Ga0105237_10106301 3300009545 Bacteria 2798
180 Ga0105237_10405235 3300009545 Bacteria 1368
181 Ga0105237_10441326 3300009545 Bacteria 1307
182 Ga0105237_10860629 3300009545 Bacteria 913
183 Ga0105237_11560090 3300009545 Bacteria 667
184 Ga0105238_10165404 3300009551 Bacteria 2188
185 Ga0105238_10387209 3300009551 Bacteria 1390
186 Ga0105238_10461242 3300009551 Bacteria 1268
187 Ga0105238_10833406 3300009551 Bacteria 939
188 Ga0105249_10444343 3300009553 Bacteria 1334
189 Ga0105249_10652496 3300009553 Bacteria 1110
190 Ga0105249_10784814 3300009553 Bacteria 1016
191 Ga0105249_10993234 3300009553 Bacteria 908
192 Ga0099796_10002212 3300010159 Bacteria 4215
193 Ga0099796_10031337 3300010159 Bacteria 1734
194 Ga0099796_10096360 3300010159 Bacteria 1107
195 Ga0105239_10231182 3300010375 Bacteria 2074
196 Ga0105239_10340450 3300010375 Bacteria 1692
197 Ga0105239_10444192 3300010375 Bacteria 1471
198 Ga0105239_11086610 3300010375 Bacteria 921
199 Ga0105239_11203714 3300010375 Bacteria 873
200 Ga0105246_10043334 3300011119 Bacteria 3053
201 Ga0105246_10177024 3300011119 Bacteria 1639
202 Ga0157373_10000154 3300013100 Bacteria 55480
203 Ga0157371_10001090 3300013102 Bacteria 29420
204 Ga0157370_10011837 3300013104 Bacteria 9102
205 Ga0157370_10017169 3300013104 Bacteria 7306
206 Ga0157370_10153449 3300013104 Bacteria 2143
207 Ga0157370_10281617 3300013104 Bacteria 1536
208 Ga0157370_10831742 3300013104 Bacteria 839
209 Ga0157369_10006035 3300013105 Bacteria 14061
210 Ga0157369_10030336 3300013105 Bacteria 5964
211 Ga0157369_10031238 3300013105 Bacteria 5867
212 Ga0157374_10252842 3300013296 Bacteria 1734
213 Ga0157378_10075410 3300013297 Bacteria 3036
214 Ga0163162_10262558 3300013306 Bacteria 1858
215 Ga0163162_10433499 3300013306 Bacteria 1446
216 Ga0163162_10614187 3300013306 Bacteria 1213
217 Ga0163162_10731645 3300013306 Bacteria 1109
218 Ga0163162_10740168 3300013306 Bacteria 1103
219 Ga0163162_11176457 3300013306 Bacteria 870
220 Ga0157372_11281893 3300013307 Bacteria 846
221 Ga0157375_10163452 3300013308 Bacteria 2370
222 Ga0157375_11071290 3300013308 Bacteria 943
223 Ga0157375_11108084 3300013308 Bacteria 927
224 Ga0163163_10097723 3300014325 Bacteria 2957
225 Ga0163163_10627358 3300014325 Bacteria 1138
226 Ga0157380_10148137 3300014326 Bacteria 2025
227 Ga0157380_11927802 3300014326 Bacteria 652
228 Ga0157377_10385355 3300014745 Bacteria 950
229 Ga0157379_10308402 3300014968 Bacteria 1443
230 Ga0157376_10012280 3300014969 Bacteria 6352
231 Ga0157376_10590371 3300014969 Bacteria 1104
232 Ga0182006_1019298 3300015261 Bacteria 2870
233 Ga0182007_10228968 3300015262 Bacteria 659
234 Ga0163161_10000009 3300017792 Bacteria 287918
235 Ga0213872_10106103 3300021361 Bacteria 1250
236 Ga0213872_10186591 3300021361 Bacteria 894
237 Ga0213874_10002170 3300021377 Bacteria 4163
238 Ga0213875_10065129 3300021388 Bacteria 1703
239 Ga0213871_10044641 3300021441 Bacteria 1198
240 Ga0209233_1012045 3300025261 Bacteria 2523
241 Ga0209564_1000838 3300025295 Bacteria 41472
242 Ga0209564_1004046 3300025295 Bacteria 9247
243 Ga0209758_1005774 3300025297 Bacteria 9284
244 Ga0209758_1014924 3300025297 Bacteria 4076
245 Ga0207655_1000093 3300025728 Bacteria 196813
246 Ga0207692_10018645 3300025898 Bacteria 3119
247 Ga0207692_10034640 3300025898 Bacteria 2446
248 Ga0207642_10082545 3300025899 Bacteria 1565
249 Ga0207710_10032580 3300025900 Bacteria 2283
250 Ga0207710_10060437 3300025900 Bacteria 1718
251 Ga0207710_10110687 3300025900 Bacteria 1304
252 Ga0207710_10159759 3300025900 Bacteria 1097
253 Ga0207710_10278680 3300025900 Bacteria 841
254 Ga0207688_10313376 3300025901 Bacteria 961
255 Ga0207680_10511659 3300025903 Bacteria 856
256 Ga0207647_10115510 3300025904 Bacteria 1585
257 Ga0207647_10170469 3300025904 Bacteria 1267
258 Ga0207647_10208699 3300025904 Bacteria 1128
259 Ga0207647_10340943 3300025904 Bacteria 849
260 Ga0207685_10044852 3300025905 Bacteria 1674
261 Ga0207699_10004047 3300025906 Bacteria 7017
262 Ga0207699_10007087 3300025906 Bacteria 5464
263 Ga0207699_10120152 3300025906 Bacteria 1698
264 Ga0207699_10434158 3300025906 Bacteria 940
265 Ga0207643_10214045 3300025908 Bacteria 1177
266 Ga0207705_10080396 3300025909 Bacteria 2375
267 Ga0207705_10294003 3300025909 Bacteria 1245
268 Ga0207684_10099173 3300025910 Bacteria 2488
269 Ga0207684_10414347 3300025910 Bacteria 1158
270 Ga0207654_10026493 3300025911 Bacteria 3140
271 Ga0207654_10704555 3300025911 Bacteria 725
272 Ga0207707_10001782 3300025912 Bacteria 19762
273 Ga0207707_10007981 3300025912 Bacteria 9195
274 Ga0207707_10014876 3300025912 Bacteria 6776
275 Ga0207707_10018060 3300025912 Bacteria 6144
276 Ga0207707_10270590 3300025912 Bacteria 1472
277 Ga0207695_10192784 3300025913 Bacteria 1955
278 Ga0207695_10291026 3300025913 Bacteria 1525
279 Ga0207671_10032987 3300025914 Bacteria 3854
280 Ga0207671_10194201 3300025914 Bacteria 1583
281 Ga0207671_10198960 3300025914 Bacteria 1564
282 Ga0207671_10275572 3300025914 Bacteria 1326
283 Ga0207671_10352642 3300025914 Bacteria 1167
284 Ga0207693_10005601 3300025915 Bacteria 10440
285 Ga0207693_10008235 3300025915 Bacteria 8534
286 Ga0207693_10062151 3300025915 Bacteria 2926
287 Ga0207693_10249330 3300025915 Bacteria 1393
288 Ga0207693_10380858 3300025915 Bacteria 1103
289 Ga0207693_10522981 3300025915 Bacteria 926
290 Ga0207663_10001398 3300025916 Bacteria 11185
291 Ga0207663_10022867 3300025916 Bacteria 3579
292 Ga0207663_10092502 3300025916 Bacteria 2011
293 Ga0207663_10369470 3300025916 Bacteria 1090
294 Ga0207660_10040027 3300025917 Bacteria 3279
295 Ga0207660_10184025 3300025917 Bacteria 1624
296 Ga0207660_10336141 3300025917 Bacteria 1208
297 Ga0207660_10342013 3300025917 Bacteria 1198
298 Ga0207657_10056536 3300025919 Bacteria 3385
299 Ga0207657_10295701 3300025919 Bacteria 1283
300 Ga0207649_10022284 3300025920 Bacteria 3658
301 Ga0207649_10358769 3300025920 Bacteria 1081
302 Ga0207652_10051895 3300025921 Bacteria 3517
303 Ga0207652_10056236 3300025921 Bacteria 3387
304 Ga0207652_10203106 3300025921 Bacteria 1784
305 Ga0207652_10216647 3300025921 Bacteria 1725
306 Ga0207646_10048329 3300025922 Bacteria 3814
307 Ga0207694_10083594 3300025924 Bacteria 2510
308 Ga0207650_10636693 3300025925 Bacteria 898
309 Ga0207659_11056527 3300025926 Bacteria 699
310 Ga0207687_10053267 3300025927 Bacteria 2826
311 Ga0207687_10646127 3300025927 Bacteria 895
312 Ga0207700_10084304 3300025928 Bacteria 2490
313 Ga0207700_10107253 3300025928 Bacteria 2241
314 Ga0207700_10161091 3300025928 Bacteria 1863
315 Ga0207700_10390818 3300025928 Bacteria 1218
316 Ga0207700_10986955 3300025928 Bacteria 754
317 Ga0207664_10036855 3300025929 Bacteria 3782
318 Ga0207664_10082338 3300025929 Bacteria 2621
319 Ga0207664_10289764 3300025929 Bacteria 1438
320 Ga0207644_10200455 3300025931 Bacteria 1574
321 Ga0207644_10202299 3300025931 Bacteria 1567
322 Ga0207706_10100767 3300025933 Bacteria 2541
323 Ga0207686_10451123 3300025934 Bacteria 989
324 Ga0207709_10392212 3300025935 Bacteria 1059
325 Ga0207704_10469001 3300025938 Bacteria 1008
326 Ga0207665_10002091 3300025939 Bacteria 13489
327 Ga0207665_10157384 3300025939 Bacteria 1632
328 Ga0207665_10567849 3300025939 Bacteria 883
329 Ga0207691_10243439 3300025940 Bacteria 1554
330 Ga0207691_10441470 3300025940 Bacteria 1108
331 Ga0207711_10048559 3300025941 Bacteria 3630
332 Ga0207711_10729508 3300025941 Bacteria 924
333 Ga0207689_10020778 3300025942 Bacteria 5522
334 Ga0207661_10000190 3300025944 Bacteria 39991
335 Ga0207661_10542975 3300025944 Bacteria 1064
336 Ga0207661_10780741 3300025944 Bacteria 879
337 Ga0207679_10042437 3300025945 Bacteria 3269
338 Ga0207679_10065681 3300025945 Bacteria 2716
339 Ga0207679_10269357 3300025945 Bacteria 1456
340 Ga0207667_10049550 3300025949 Bacteria 4435
341 Ga0207667_10244077 3300025949 Bacteria 1838
342 Ga0207667_11197033 3300025949 Bacteria 740
343 Ga0207712_10283424 3300025961 Bacteria 1353
344 Ga0207712_10389711 3300025961 Bacteria 1168
345 Ga0207712_10479016 3300025961 Bacteria 1060
346 Ga0207712_10840000 3300025961 Bacteria 809
347 Ga0207668_10144149 3300025972 Bacteria 1835
348 Ga0207668_10389182 3300025972 Bacteria 1176
349 Ga0207668_10446789 3300025972 Bacteria 1102
350 Ga0207658_10230137 3300025986 Bacteria 1564
351 Ga0207677_10069783 3300026023 Bacteria 2473
352 Ga0207703_10055664 3300026035 Bacteria 3219
353 Ga0207639_10359959 3300026041 Bacteria 1302
354 Ga0207639_10671839 3300026041 Bacteria 959
355 Ga0207639_11445727 3300026041 Bacteria 645
356 Ga0207678_10002185 3300026067 Bacteria 17669
357 Ga0207678_10020155 3300026067 Bacteria 5856
358 Ga0207678_10043771 3300026067 Bacteria 3873
359 Ga0207678_10112761 3300026067 Bacteria 2319
360 Ga0207678_10250842 3300026067 Bacteria 1516
361 Ga0207708_10280829 3300026075 Bacteria 1349
362 Ga0207702_10154922 3300026078 Bacteria 2088
363 Ga0207702_10396336 3300026078 Bacteria 1330
364 Ga0207702_10520431 3300026078 Bacteria 1161
365 Ga0207641_10187867 3300026088 Bacteria 1897
366 Ga0207641_10829394 3300026088 Bacteria 916
367 Ga0207648_10084644 3300026089 Bacteria 2766
368 Ga0207676_10044071 3300026095 Bacteria 3440
369 Ga0207676_10827244 3300026095 Bacteria 905
370 Ga0207674_10092137 3300026116 Bacteria 3020
371 Ga0207675_100415476 3300026118 Bacteria 1328
372 Ga0207683_10232246 3300026121 Bacteria 1682
373 Ga0207683_10337721 3300026121 Bacteria 1381
374 Ga0207698_10632426 3300026142 Bacteria 1058
375 Ga0209281_1001726 3300027111 Bacteria 11270
376 Ga0209589_1000007 3300027357 Bacteria 425699
377 Ga0209489_100008 3300027361 Bacteria 425699
378 Ga0209489_113034 3300027361 Bacteria 7046
379 Ga0209700_100009 3300027363 Bacteria 425699
380 Ga0209179_1002862 3300027512 Bacteria 2404
381 Ga0209179_1019423 3300027512 Bacteria 1309
382 Ga0209282_1041324 3300027666 Bacteria 2730
383 Ga0209588_1044785 3300027671 Bacteria 1431
384 Ga0209813_10002581 3300027866 Bacteria 4161
385 Ga0209813_10181179 3300027866 Bacteria 771
386 Ga0268266_10000519 3300028379 Bacteria 54346
387 Ga0268266_10002731 3300028379 Bacteria 18479
388 Ga0268266_10137996 3300028379 Bacteria 2186
389 Ga0268266_10348397 3300028379 Bacteria 1391
390 Ga0268266_10458540 3300028379 Bacteria 1212
391 Ga0268265_10223805 3300028380 Bacteria 1648
392 Ga0268265_10454170 3300028380 Bacteria 1197
393 Ga0268264_10000158 3300028381 Bacteria 153433
394 Ga0268264_10570141 3300028381 Bacteria 1112
395 Ga0307515_10366410 3300028794 Bacteria 1079
396 Ga0307515_10462367 3300028794 Bacteria 883
397 Ga0265762_1075796 3300030760 Bacteria 713
398 Ga0265760_10117531 3300031090 Bacteria 851
399 Ga0265330_10002705 3300031235 Bacteria 9571
400 Ga0265330_10032551 3300031235 Bacteria 2336
401 Ga0265330_10128626 3300031235 Bacteria 1078
402 Ga0265332_10041565 3300031238 Bacteria 1988
403 Ga0265328_10085695 3300031239 Bacteria 1163
404 Ga0265325_10147305 3300031241 Bacteria 1116
405 Ga0265340_10004356 3300031247 Bacteria 7931
406 Ga0265340_10037134 3300031247 Bacteria 2414
407 Ga0265340_10058103 3300031247 Bacteria 1857
408 Ga0265339_10140041 3300031249 Bacteria 1231
409 Ga0265316_10286550 3300031344 Bacteria 1203
410 Ga0307513_10162521 3300031456 Bacteria 2123
411 Ga0307513_10281549 3300031456 Bacteria 1440
412 Ga0307509_10064386 3300031507 Bacteria 3856
413 Ga0307509_10266251 3300031507 Bacteria 1485
414 Ga0307509_10344614 3300031507 Bacteria 1216
415 Ga0307509_10354790 3300031507 Bacteria 1188
416 Ga0307509_10361230 3300031507 Bacteria 1171
417 Ga0307408_100001992 3300031548 Bacteria 14752
418 Ga0307408_100389953 3300031548 Bacteria 1193
419 Ga0307508_10056026 3300031616 Bacteria 3492
420 Ga0307508_10323107 3300031616 Bacteria 1135
421 Ga0265314_10003471 3300031711 Bacteria 15228
422 Ga0265314_10015898 3300031711 Bacteria 5960
423 Ga0265314_10054499 3300031711 Bacteria 2768
424 Ga0265342_10001311 3300031712 Bacteria 23336
425 Ga0265342_10149797 3300031712 Bacteria 1296
426 Ga0307516_10020861 3300031730 Bacteria 6762
427 Ga0307516_10049982 3300031730 Bacteria 4104
428 Ga0307516_10205794 3300031730 Bacteria 1685
429 Ga0307516_10583235 3300031730 Bacteria 772
430 Ga0307405_10687664 3300031731 Bacteria 846
431 Ga0307413_10001735 3300031824 Bacteria 8521
432 Ga0307410_10000035 3300031852 Bacteria 48358
433 Ga0307410_10640635 3300031852 Bacteria 890
434 Ga0307406_10000074 3300031901 Bacteria 54985
435 Ga0307406_10757314 3300031901 Bacteria 816
436 Ga0307406_10899799 3300031901 Bacteria 753
437 Ga0307407_10005469 3300031903 Bacteria 5516
438 Ga0307412_10019898 3300031911 Bacteria 4075
439 Ga0307412_10336482 3300031911 Bacteria 1206
440 Ga0307409_100106356 3300031995 Bacteria 2341
441 Ga0307416_100000314 3300032002 Bacteria 25123
442 Ga0307416_100278360 3300032002 Bacteria 1648
443 Ga0307414_10000005 3300032004 Bacteria 452161
444 Ga0307414_10242644 3300032004 Bacteria 1492
445 Ga0307411_10000010 3300032005 Bacteria 238134
446 Ga0307411_10092691 3300032005 Bacteria 2113
447 Ga0307411_10684732 3300032005 Bacteria 891
448 Ga0307415_100117332 3300032126 Bacteria 1987
449 Ga0307415_100295402 3300032126 Bacteria 1339
450 Ga0307510_10021151 3300033180 Bacteria 7586
451 Ga0307510_10267207 3300033180 Bacteria 1188
452 Ga0315911_1000031 3300033442 Bacteria 74171
453 Ga0316215_1010659 3300033544 Bacteria 908
454 Ga0373926_0034984 3300035083 Bacteria 1781
455 Ga0373926_0058823 3300035083 Bacteria 1398
456 Ga0373926_0116674 3300035083 Bacteria 1005
457 Ga0373923_0135455 3300035111 Bacteria 1110
458 Ga0373936_0005021 3300035113 Bacteria 4983
459 Ga0373936_0050752 3300035113 Bacteria 1678
460 Ga0373936_0331935 3300035113 Bacteria 690
461 Ga0373945_0011409 3300035116 Bacteria 2938
462 Ga0373953_0080186 3300035117 Bacteria 1356
463 Ga0373954_0018549 3300035118 Bacteria 3133
464 Ga0373954_0083764 3300035118 Bacteria 1526
465 Ga0373943_0026672 3300035170 Bacteria 2708
466 Ga0373943_0028731 3300035170 Bacteria 2622
467 Ga0373943_0353569 3300035170 Bacteria 842
468 Ga0373946_0140996 3300035171 Bacteria 1117
469 Ga0373955_0008771 3300035172 Bacteria 4709
470 Ga0373955_0013641 3300035172 Bacteria 3936
471 Ga0373955_0046000 3300035172 Bacteria 2357
472 Ga0373955_0325514 3300035172 Bacteria 929
473 Ga0373955_0390559 3300035172 Bacteria 845
474 Ga0373924_0007833 3300035410 Bacteria 3863
475 Ga0373924_0130054 3300035410 Bacteria 1095
476 Ga0373931_0295483 3300035691 Bacteria 999
477 Ga0373935_0015493 3300035692 Bacteria 4609
478 Ga0373935_0165141 3300035692 Bacteria 1511
479 Ga0373935_0214126 3300035692 Bacteria 1336
480 Ga0373935_0265607 3300035692 Bacteria 1204
481 Ga0373935_0305204 3300035692 Bacteria 1126
482 Ga0373927_0000420 3300035695 Bacteria 32580
483 Ga0373927_0003336 3300035695 Bacteria 11548
484 Ga0373927_0003671 3300035695 Bacteria 10930
485 Ga0373927_0011561 3300035695 Bacteria 5881
486 Ga0373927_0031037 3300035695 Bacteria 3485
487 Ga0373927_0041477 3300035695 Bacteria 2985
488 Ga0373927_0048082 3300035695 Bacteria 2758
489 Ga0373927_0130887 3300035695 Bacteria 1639
490 Ga0373933_0000106 3300035724 Bacteria 53181
491 Ga0373933_0015224 3300035724 Bacteria 4287
492 Ga0373947_0000233 3300035725 Bacteria 31215
493 Ga0373947_0012043 3300035725 Bacteria 4953
494 Ga0373947_0129700 3300035725 Bacteria 1608
495 Ga0373937_0021564 3300036401 Bacteria 5780
496 Ga0373937_1129752 3300036401 Bacteria 732
497 Ga0372808_017541 3300036459 Bacteria 1028
498 Ga0373925_0002578 3300037068 Bacteria 14426
499 Ga0373925_0011103 3300037068 Bacteria 6536
500 Ga0395899_0143740 3300037312 Bacteria 1696
501 Ga0395900_0031133 3300037418 Bacteria 5481
502 Ga0395900_0783441 3300037418 Bacteria 882
503 Ga0395898_0002276 3300037466 Bacteria 23184
504 Ga0395898_0038790 3300037466 Bacteria 4718
505 Ga0395898_0095957 3300037466 Bacteria 2849
506 Ga0395905_0347782 3300037471 Bacteria 1374
507 Ga0436364_0058409 3300037853 Bacteria 901
508 Ga0436364_0350531 3300037853 Bacteria 5930
509 Ga0395901_0848664 3300038443 Bacteria 899
510 Ga0436365_1788547 3300039437 Bacteria 1451
511 Ga0436360_1066772 3300039438 Bacteria 829
512 Ga0436360_1126519 3300039438 Bacteria 1268
513 Ga0436360_1130528 3300039438 Bacteria 3542
514 Ga0436361_0054977 3300039447 Bacteria 1725
515 Ga0436361_0552215 3300039447 Bacteria 927
516 Ga0436363_0229744 3300039450 Bacteria 1621
517 Ga0436363_0781366 3300039450 Bacteria 7969
518 Ga0439447_001735 3300041407 Bacteria 7985
519 Ga0439461_0029953 3300041410 Bacteria 1129
520 Ga0451797_0376578 3300041453 Bacteria 1384
521 Ga0451795_1417182 3300041456 Bacteria 746
522 Ga0439431_0065962 3300041997 Bacteria 959
523 Ga0450891_020265 3300042129 Bacteria 651
524 Ga0466963_0610996 3300044694 Bacteria 770
525 Ga0466959_0090977 3300045049 Bacteria 2191
526 Ga0466967_0142117 3300045976 Bacteria 2236
527 Ga0466967_0372317 3300045976 Bacteria 1385
528 Ga0466967_0864040 3300045976 Bacteria 899
529 Ga0495617_072887 3300046452 Bacteria 1129
530 Ga0495627_121723 3300046453 Bacteria 737
531 Ga0495592_0185618 3300046454 Bacteria 1413
532 Ga0495603_0000240 3300046455 Bacteria 28510
533 Ga0495603_0014900 3300046455 Bacteria 4703
534 Ga0495603_0061580 3300046455 Bacteria 2216
535 Ga0495590_0090359 3300046457 Bacteria 1083
536 Ga0495629_0007933 3300046459 Bacteria 7809
537 Ga0495638_0002321 3300046460 Bacteria 15670
538 Ga0495638_0010623 3300046460 Bacteria 6377
539 Ga0495641_0030287 3300046461 Bacteria 2597
540 Ga0495651_0091868 3300046462 Bacteria 2274
541 Ga0495651_0103374 3300046462 Bacteria 2117
542 Ga0495651_0154772 3300046462 Bacteria 1649
543 Ga0495653_0027066 3300046463 Bacteria 4592
544 Ga0495580_0008282 3300046472 Bacteria 8274
545 Ga0495580_0384661 3300046472 Bacteria 947
546 Ga0495582_0000658 3300046473 Bacteria 19047
547 Ga0495582_0060194 3300046473 Bacteria 2095
548 Ga0495582_0072967 3300046473 Bacteria 1900
549 Ga0495605_0050469 3300046474 Bacteria 2030
550 Ga0495639_0000432 3300046475 Bacteria 19998
551 Ga0495662_0000041 3300046476 Bacteria 43651
552 Ga0495662_0098053 3300046476 Bacteria 1433
553 Ga0495664_0014937 3300046477 Bacteria 4410
554 Ga0495664_0115171 3300046477 Bacteria 1624
555 Ga0495664_0223363 3300046477 Bacteria 1140
556 Ga0495594_0000722 3300046499 Bacteria 16979
557 Ga0495594_0068159 3300046499 Bacteria 1976
558 Ga0495594_0107165 3300046499 Bacteria 1574
559 Ga0495594_0545586 3300046499 Bacteria 658
560 Ga0495606_0080080 3300046507 Bacteria 2033
561 Ga0495608_0014874 3300046511 Bacteria 5399
562 Ga0495608_0181062 3300046511 Bacteria 1333
563 Ga0495610_0036179 3300046512 Bacteria 2525
564 Ga0495616_0066807 3300046513 Bacteria 1749
565 Ga0495618_0061195 3300046514 Bacteria 2388
566 Ga0495620_0090099 3300046515 Bacteria 1231
567 Ga0495628_0052691 3300046516 Bacteria 3213
568 Ga0495628_0287205 3300046516 Bacteria 1220
569 Ga0495630_0004307 3300046517 Bacteria 9985
570 Ga0495630_0299661 3300046517 Bacteria 1228
571 Ga0495632_0126398 3300046519 Bacteria 1192
572 Ga0495637_0132024 3300046520 Bacteria 953
573 Ga0495643_0014806 3300046522 Bacteria 4631
574 Ga0495648_0000854 3300046524 Bacteria 32146
575 Ga0495666_0041503 3300046526 Bacteria 2228
576 Ga0495666_0175365 3300046526 Bacteria 991
577 Ga0495652_0170705 3300046529 Bacteria 1679
578 Ga0495652_0678312 3300046529 Bacteria 695
579 Ga0495665_0007581 3300046531 Bacteria 5877
580 Ga0495640_0035093 3300046533 Bacteria 3552
581 Ga0495640_0212272 3300046533 Bacteria 1223
582 Ga0495640_0335488 3300046533 Bacteria 935
583 Ga0495586_0057321 3300046535 Bacteria 2114
584 Ga0495586_0250005 3300046535 Bacteria 1011
585 Ga0495587_0083509 3300046536 Bacteria 1850
586 Ga0495598_0097557 3300046537 Bacteria 968
587 Ga0495645_0008137 3300046543 Bacteria 7313
588 Ga0495645_0058553 3300046543 Bacteria 2795
589 Ga0495645_0187009 3300046543 Bacteria 1415
590 Ga0495622_0021034 3300046557 Bacteria 3039
591 Ga0495622_0029335 3300046557 Bacteria 2570
592 Ga0495622_0111066 3300046557 Bacteria 1255
593 Ga0495633_0192722 3300046558 Bacteria 937
594 Ga0495667_0016424 3300046559 Bacteria 5002
595 Ga0495667_0059967 3300046559 Bacteria 2496
596 Ga0495668_0044964 3300046616 Bacteria 2454
597 Ga0495668_0140335 3300046616 Bacteria 1322
598 Ga0495668_0184271 3300046616 Bacteria 1144
599 Ga0495634_0000417 3300046642 Bacteria 42219
600 Ga0495634_0021915 3300046642 Bacteria 4507
601 Ga0495634_0035361 3300046642 Bacteria 3422
602 Ga0495634_0195675 3300046642 Bacteria 1258
603 Ga0495625_0162031 3300046660 Bacteria 1498
604 Ga0495625_0265311 3300046660 Bacteria 1110
605 Ga0495625_0448225 3300046660 Bacteria 798
606 Ga0495635_0010004 3300046663 Bacteria 6631
607 Ga0495635_0035402 3300046663 Bacteria 3461
608 Ga0495659_0051083 3300046664 Bacteria 1505
609 Ga0495588_0034998 3300046674 Bacteria 2543
610 Ga0495588_0189863 3300046674 Bacteria 1085
611 Ga0495657_0263231 3300046675 Bacteria 1035
612 Ga0495599_0012081 3300046678 Bacteria 5314
613 Ga0495599_0117889 3300046678 Bacteria 1651
614 Ga0495599_0390495 3300046678 Bacteria 830
615 Ga0495623_0012982 3300046679 Bacteria 5393
616 Ga0495646_0209127 3300046680 Bacteria 1059
617 Ga0495647_0203874 3300046681 Bacteria 868
618 Ga0495647_0355020 3300046681 Bacteria 668
619 Ga0495658_0000331 3300046683 Bacteria 26505
620 Ga0495658_0214645 3300046683 Bacteria 1203
621 Ga0495613_0154731 3300046689 Bacteria 1634
622 Ga0495613_0483192 3300046689 Bacteria 836
623 Ga0495624_0002925 3300046690 Bacteria 12772
624 Ga0495670_0011578 3300046691 Bacteria 4339
625 Ga0495671_0077051 3300046692 Bacteria 1635
626 Ga0495671_0138157 3300046692 Bacteria 1188
627 Ga0495600_0058222 3300046809 Bacteria 2524
628 Ga0495600_0205161 3300046809 Bacteria 1264
629 Ga0495581_0000820 3300047315 Bacteria 16540
630 Ga0495581_0119230 3300047315 Bacteria 1535
631 Ga0495581_0181667 3300047315 Bacteria 1230
632 Ga0495581_0235275 3300047315 Bacteria 1071
633 Ga0495604_0005878 3300047317 Bacteria 9726
634 Ga0495604_0245291 3300047317 Bacteria 1223
635 Ga0495674_0000400 3300047319 Bacteria 38852
636 Ga0495674_0034685 3300047319 Bacteria 4559
637 Ga0495674_0128501 3300047319 Bacteria 2136
638 Ga0495674_0315421 3300047319 Bacteria 1275
639 Ga0495674_0482119 3300047319 Bacteria 994
640 Ga0495672_0066584 3300047320 Bacteria 2055
641 Ga0495672_0163988 3300047320 Bacteria 1140
642 Ga0495672_0171394 3300047320 Bacteria 1107
643 Ga0495672_0259280 3300047320 Bacteria 840
644 Ga0495676_0200653 3300047321 Bacteria 1386
645 Ga0495676_0237234 3300047321 Bacteria 1250
646 Ga0495676_0248311 3300047321 Bacteria 1215
647 Ga0495675_0014001 3300047444 Bacteria 5070
648 Ga0495673_0022859 3300047469 Bacteria 3056
649 Ga0495681_0164195 3300047470 Bacteria 923
650 Ga0495684_0005946 3300047471 Bacteria 9478
651 Ga0495686_0036626 3300047472 Bacteria 3149
652 Ga0495686_0051321 3300047472 Bacteria 2588
653 Ga0495686_0059413 3300047472 Bacteria 2380
654 Ga0495593_0000029 3300047673 Bacteria 60282
655 Ga0495593_0234113 3300047673 Bacteria 921
656 Ga0495602_0198397 3300048088 Bacteria 1533
657 Ga0495614_0158752 3300048089 Bacteria 1011
658 Ga0495626_0060446 3300048091 Bacteria 1726
659 Ga0496100_0010673 3300048903 Bacteria 5207
660 Ga0496101_0019376 3300048904 Bacteria 4644
661 Ga0496101_0180650 3300048904 Bacteria 1625
662 Ga0496101_0408596 3300048904 Bacteria 1070
663 Ga0496101_0756961 3300048904 Bacteria 766
664 Ga0496102_0043103 3300048905 Bacteria 4090
665 Ga0496102_0147579 3300048905 Bacteria 2208
666 Ga0496102_0237435 3300048905 Bacteria 1719
667 Ga0496104_0097168 3300048907 Bacteria 2819
668 Ga0496104_0155849 3300048907 Bacteria 2191
669 Ga0496106_0026275 3300048909 Bacteria 4334
670 Ga0496106_0170513 3300048909 Bacteria 1725
671 Ga0496106_0249980 3300048909 Bacteria 1417
672 Ga0496107_0001289 3300048910 Bacteria 15330
673 Ga0496107_0018602 3300048910 Bacteria 4893
674 Ga0496108_0230257 3300048911 Bacteria 1611
675 Ga0496108_0372948 3300048911 Bacteria 1246
676 Ga0496109_0106503 3300048912 Bacteria 2604
677 Ga0496109_0373815 3300048912 Bacteria 1346
678 Ga0496109_0399154 3300048912 Bacteria 1299
679 Ga0496110_0047110 3300048913 Bacteria 3773
680 Ga0496110_0290122 3300048913 Bacteria 1490
681 Ga0496110_0305825 3300048913 Bacteria 1448
682 Ga0496110_0447167 3300048913 Bacteria 1178
683 Ga0496111_0132962 3300048914 Bacteria 1842
684 Ga0496111_0521847 3300048914 Bacteria 873
685 Ga0496112_0012973 3300048915 Bacteria 7680
686 Ga0496112_0090833 3300048915 Bacteria 3023
687 Ga0496112_0168577 3300048915 Bacteria 2155
688 Ga0496112_0195734 3300048915 Bacteria 1982
689 Ga0496112_0217379 3300048915 Bacteria 1867
690 Ga0496113_0017700 3300048916 Bacteria 4954
691 Ga0496113_0507341 3300048916 Bacteria 968
692 Ga0496114_0054595 3300048917 Bacteria 3332
693 Ga0496115_0026487 3300048918 Bacteria 4525
694 Ga0496115_0120542 3300048918 Bacteria 2158
695 Ga0496115_0218202 3300048918 Bacteria 1574
696 Ga0496115_0315906 3300048918 Bacteria 1278
697 Ga0496115_0782106 3300048918 Bacteria 744
698 Ga0496116_0000156 3300048919 Bacteria 140734
699 Ga0496116_0003708 3300048919 Bacteria 14940
700 Ga0496116_0081672 3300048919 Bacteria 2003
701 Ga0496117_0016897 3300048920 Bacteria 6121
702 Ga0496117_0046138 3300048920 Bacteria 3137
703 Ga0496117_0123343 3300048920 Bacteria 1587
704 Ga0496118_0003787 3300048921 Bacteria 18652
705 Ga0496118_0020426 3300048921 Bacteria 5873
706 Ga0496118_0119464 3300048921 Bacteria 1723
707 Ga0496118_0151850 3300048921 Bacteria 1448
708 Ga0496118_0421559 3300048921 Bacteria 686
709 Ga0496119_0163482 3300048922 Bacteria 1181
710 Ga0496120_0057897 3300048923 Bacteria 2179
711 Ga0496121_0000287 3300048924 Bacteria 104774
712 Ga0496121_0000654 3300048924 Bacteria 64945
713 Ga0496121_0001942 3300048924 Bacteria 32958
714 Ga0496121_0004461 3300048924 Bacteria 18799
715 Ga0496121_0011661 3300048924 Bacteria 9714
716 Ga0496121_0017149 3300048924 Bacteria 7418
717 Ga0496121_0023934 3300048924 Bacteria 5856
718 Ga0496121_0063315 3300048924 Bacteria 3023
719 Ga0496121_0123202 3300048924 Bacteria 1954
720 Ga0496122_0040623 3300048925 Bacteria 3693
721 Ga0496122_0063148 3300048925 Bacteria 2705
722 Ga0496122_0137175 3300048925 Bacteria 1539
723 Ga0496123_0005902 3300048926 Bacteria 12090
724 Ga0496123_0065089 3300048926 Bacteria 2319
725 Ga0496124_0014134 3300048927 Bacteria 7735
726 Ga0496124_0042607 3300048927 Bacteria 3907
727 Ga0496124_0152607 3300048927 Bacteria 1810
728 Ga0496124_0160927 3300048927 Bacteria 1750
729 Ga0496124_0346307 3300048927 Bacteria 1053
730 Ga0496124_0434459 3300048927 Bacteria 900
731 Ga0496124_0481917 3300048927 Bacteria 837
732 Ga0496125_0000062 3300048928 Bacteria 259277
733 Ga0496125_0029695 3300048928 Bacteria 4907
734 Ga0496125_0030363 3300048928 Bacteria 4836
735 Ga0496125_0049990 3300048928 Bacteria 3467
736 Ga0496125_0133648 3300048928 Bacteria 1740
737 Ga0496126_0002702 3300048929 Bacteria 23441
738 Ga0496126_0015438 3300048929 Bacteria 7680
739 Ga0496126_0020844 3300048929 Bacteria 6416
740 Ga0496126_0031702 3300048929 Bacteria 4988
741 Ga0496126_0033666 3300048929 Bacteria 4819
742 Ga0496126_0036969 3300048929 Bacteria 4561
743 Ga0496126_0060746 3300048929 Bacteria 3398
744 Ga0496126_0094092 3300048929 Bacteria 2630
745 Ga0496126_0095456 3300048929 Bacteria 2608
746 Ga0496126_0120351 3300048929 Bacteria 2278
747 Ga0496126_0188652 3300048929 Bacteria 1747
748 Ga0496126_0203567 3300048929 Bacteria 1670
749 Ga0496126_0213724 3300048929 Bacteria 1622
750 Ga0496126_0296085 3300048929 Bacteria 1337
751 Ga0496126_0386977 3300048929 Bacteria 1137
752 Ga0496126_0486888 3300048929 Bacteria 988
753 Ga0495682_0111110 3300049460 Bacteria 982
754 Ga0501034_0004212 3300049571 Bacteria 16059
755 Ga0501046_0283892 3300049580 Bacteria 1212
756 Ga0501047_0037283 3300049581 Bacteria 4701
757 Ga0501070_0182172 3300049586 Bacteria 1728
758 Ga0501073_0198189 3300049589 Bacteria 1389
759 Ga0501074_0097698 3300049590 Bacteria 2102
760 Ga0501076_0393712 3300049592 Bacteria 1139
761 Ga0501080_0139999 3300049742 Bacteria 2237
762 Ga0501266_000009 3300049763 Bacteria 233584
763 Ga0501269_016886 3300049766 Bacteria 901
764 Ga0501280_000138 3300049776 Bacteria 18855
765 Ga0501044_0168479 3300049823 Bacteria 2163
766 nmdc:mga03n38_38549_c1 3300050490 Bacteria 2068
767 nmdc:mga00v17_126180_c1 3300050491 Bacteria 1633
768 nmdc:mga0yw44_22227_c1 3300050492 Bacteria 3553
769 nmdc:mga0yw44_626673_c1 3300050492 Bacteria 731
770 nmdc:mga0yw44_70232_c1 3300050492 Bacteria 2171
771 nmdc:mga0yw44_80807_c1 3300050492 Bacteria 2037
772 nmdc:mga0k408_200256_c1 3300050493 Bacteria 1192
773 nmdc:mga06z11_110522_c1 3300050494 Bacteria 1521
774 nmdc:mga06z11_233871_c1 3300050494 Bacteria 1077
775 nmdc:mga04h51_23583_c1 3300050495 Bacteria 1875
776 nmdc:mga07m45_71243_c1 3300050496 Bacteria 1978
777 nmdc:mga07m45_94827_c1 3300050496 Bacteria 1711
778 nmdc:mga08y16_666078_c1 3300050511 Bacteria 1043
779 nmdc:mga0n895_1350195_c1 3300050512 Bacteria 682
780 nmdc:mga0rr50_472012_c1 3300050513 Bacteria 1065
781 nmdc:mga0sz30_248260_c1 3300050516 Bacteria 792
782 nmdc:mga0sz30_256775_c1 3300050516 Bacteria 778
783 nmdc:mga0sz30_4129_c1 3300050516 Bacteria 5233
784 Ga0495601_0048187 3300053077 Bacteria 2684
785 Ga0495601_0053196 3300053077 Bacteria 2559
786 Ga0495601_0067973 3300053077 Bacteria 2270
787 Ga0495601_0112009 3300053077 Bacteria 1768
788 Ga0495612_0070811 3300053078 Bacteria 1454
789 Ga0495612_0124933 3300053078 Bacteria 1109
790 Ga0500610_0116119 3300053079 Bacteria 1372
791 Ga0500635_0006579 3300053080 Bacteria 3110
792 Ga0500635_0041540 3300053080 Bacteria 1538
793 Ga0495595_0054361 3300053084 Bacteria 1862
794 Ga0495595_0220899 3300053084 Bacteria 945
795 Ga0495619_0072998 3300053085 Bacteria 2299
796 Ga0500578_0260334 3300053086 Bacteria 1042
797 Ga0500643_114089 3300053087 Bacteria 729
798 Ga0500644_0109321 3300053088 Bacteria 1062
799 Ga0500646_0017782 3300053090 Bacteria 1868
800 Ga0500646_0032846 3300053090 Bacteria 1433
801 Ga0500647_0017416 3300053091 Bacteria 3313
802 Ga0500651_0010775 3300053093 Bacteria 5493
803 Ga0500651_0077466 3300053093 Bacteria 2063
804 Ga0500566_0006566 3300053094 Bacteria 6894
805 Ga0500566_0039533 3300053094 Bacteria 2727
806 Ga0500566_0089348 3300053094 Bacteria 1704
807 Ga0500641_0000048 3300053096 Bacteria 57304
808 Ga0500641_0004479 3300053096 Bacteria 4939
809 Ga0500641_0008186 3300053096 Bacteria 3727
810 Ga0500641_0026021 3300053096 Bacteria 2269
811 Ga0500641_0038356 3300053096 Bacteria 1925
812 Ga0500641_0099847 3300053096 Bacteria 1244
813 Ga0500650_0005311 3300053098 Bacteria 4785
814 Ga0500554_000916 3300053102 Bacteria 5756
815 Ga0500556_0000006 3300053104 Bacteria 453982
816 Ga0500562_019863 3300053108 Bacteria 1741
817 Ga0500569_010012 3300053109 Bacteria 2219
818 Ga0500572_000429 3300053111 Bacteria 14783
819 Ga0500572_000888 3300053111 Bacteria 9260
820 Ga0500594_0008460 3300053118 Bacteria 2347
821 Ga0500594_0019210 3300053118 Bacteria 1691
822 Ga0500595_003393 3300053119 Bacteria 7456
823 Ga0500607_110191 3300053121 Bacteria 1351
824 Ga0500608_002124 3300053122 Bacteria 7119
825 Ga0500618_034742 3300053125 Bacteria 1172
826 Ga0500618_067534 3300053125 Bacteria 803
827 Ga0500642_0000004 3300053130 Bacteria 433122
828 Ga0500642_0001875 3300053130 Bacteria 6074
829 Ga0500652_002335 3300053131 Bacteria 5705
830 Ga0500655_083004 3300053133 Bacteria 661
831 Ga0500658_0000006 3300053134 Bacteria 290380
832 Ga0500559_0000276 3300053136 Bacteria 39738
833 Ga0500559_0001054 3300053136 Bacteria 16776
834 Ga0500559_0010860 3300053136 Bacteria 3903
835 Ga0500559_0026459 3300053136 Bacteria 2471
836 Ga0500559_0169136 3300053136 Bacteria 1028
837 Ga0500568_0006697 3300053139 Bacteria 5758
838 Ga0500577_0000077 3300053142 Bacteria 22872
839 Ga0500577_0157188 3300053142 Bacteria 967
840 Ga0500586_178060 3300053145 Bacteria 711
841 Ga0500588_0037432 3300053146 Bacteria 1441
842 Ga0500590_116094 3300053148 Bacteria 1262
843 Ga0500603_000241 3300053150 Bacteria 14295
844 Ga0500603_000290 3300053150 Bacteria 13270
845 Ga0500604_0066126 3300053151 Bacteria 1145
846 Ga0500616_0000022 3300053153 Bacteria 460463
847 Ga0500619_049810 3300053154 Bacteria 1352
848 Ga0500622_0006743 3300053156 Bacteria 6613
849 Ga0500627_0211392 3300053158 Bacteria 868
850 Ga0500638_002209 3300053162 Bacteria 6649
851 Ga0500639_000076 3300053163 Bacteria 45936
852 Ga0500639_095322 3300053163 Bacteria 1475
853 Ga0500636_0001192 3300053177 Bacteria 14043
854 Ga0500636_0018817 3300053177 Bacteria 4085
855 Ga0500636_0106876 3300053177 Bacteria 1585
856 Ga0500636_0229678 3300053177 Bacteria 961
857 Ga0500637_0004134 3300053178 Bacteria 6835
858 Ga0500637_0006951 3300053178 Bacteria 5625
859 Ga0500637_0053341 3300053178 Bacteria 2308
860 Ga0500637_0211937 3300053178 Bacteria 1098
861 Ga0500576_071640 3300053725 Bacteria 1487
862 Ga0500584_054540 3300053726 Bacteria 1796
863 Ga0500645_019080 3300053730 Bacteria 2136
864 Ga0500645_036492 3300053730 Bacteria 1462
865 Ga0500645_077286 3300053730 Bacteria 951
866 Ga0500596_014498 3300053735 Bacteria 1185
867 Ga0500596_018145 3300053735 Bacteria 1055
868 Ga0500661_000404 3300055283 Bacteria 7983
869 2513676672 2513237098 Bacteria 9902361
870 2513861452 2513237137 Bacteria 9558895
871 2513915776 2513237145 Bacteria 8979722
872 2517894918 2517572143 Bacteria 9484767
873 2520881068 2519899754 Bacteria 5336938
874 2524466608 2524023210 Bacteria 9029266
875 2524534689 2524023228 Bacteria 10118060
876 2603858439 2602042107 Bacteria 6226103
877 2644011066 2643221600 Bacteria 5530138
878 2644287299 2643221651 Bacteria 4798932
879 2644371987 2643221667 Bacteria 5627472
880 2644643556 2643221716 Bacteria 4986332
881 2644683909 2643221725 Bacteria 5087956
882 2671123027 2667528175 Bacteria 7532676
883 2728748803 2728368998 Bacteria 8720350
884 2738737097 2738541279 Bacteria 6149495
885 2738769637 2738541285 Bacteria 6150075
886 2739218679 2738543007 Bacteria 6149845
887 2739999394 2739367857 Bacteria 5433684
888 2740004211 2739367858 Bacteria 5432813
889 2793079593
890 2802652202 2802428842 Bacteria 4926114
891 2817415060 2816332280 Bacteria 5109718
892 2852626252 2852623160 Bacteria 4376875
893 2857526469 2857524615 Bacteria 6615449
894 2857617480 2857613821 Bacteria 4917088
895 2857621293 2857618242 Bacteria 5635925
896 2874607463 2874604998 Bacteria 7834745
897 2876814798 2876808645 Bacteria 8824342
898 2879111058 2879110137 Bacteria 8907982
899 2881359919 2881359912 Bacteria 4935907
900 2884934703 2884933994 Bacteria 4535041
901 2885383074 2885374607 Bacteria 8927485
902 2885385937 2885383462 Bacteria 9473874
903 2889037151 2889033259 Bacteria 9099371
904 2893067289 2893066018 Bacteria 6158120
905 2903756549 2903748898 Bacteria 9972761
906 2903769780 2903768456 Bacteria 9749579
907 2903896176 2903895155 Bacteria 5258610
908 2904421782 2904419702 Bacteria 5166287
909 2904559918 2904555929 Bacteria 5218588
910 2904706172
911 2906611653
912 2906639632 2906635258 Bacteria 8601019
913 2906660625 2906660503 Bacteria 8595048
914 2908745239 2908739725 Bacteria 8628932
915 2919073714 2919073203 Bacteria 6531949
916 2919195785 2919191525 Bacteria 5765973
917 2922427694
918 2929152234 2929150217 Bacteria 5462483
919 2958460066 2958458903 Bacteria 5301041
920 2977268934 2977268062 Bacteria 5243061
921 2996315358 2996310559 Bacteria 6357320
922 3005477408 3005474847 Bacteria 9259049
923 8006933827 8006933436 Bacteria 10410654
924 8006969627 8006964411 Bacteria 8966052
925 8006983499 8006973647 Bacteria 10679141
926 8006990667 8006984368 Bacteria 9651211
927 8006998704 8006994254 Bacteria 8309700
928 8019559756 8019555841 Bacteria 9642137
929 8054309768 8054307821 Bacteria 5212224
930 8055419112 8055419101 Bacteria 5289643
931 8055594237 8055592153 Bacteria 5961247
932 8056442527 8056440228 Bacteria 4946504
933 8056676663 8056673599 Bacteria 7871253
934 Ga0495594_0057863
935 Ga0006562J51391_1003321
936 JGI25404J52841_10006939
937 JGI25404J52841_10014450
938 Ga0065714_10020481
939 Ga0065714_10113277
940 Ga0070683_100105299
941 Ga0070683_100803955
942 Ga0070690_100162859
943 Ga0070670_100578064
944 Ga0070670_100616356
945 Ga0068869_100105616
946 Ga0070666_10393464
947 Ga0070680_100035600
948 Ga0070680_100080850
949 Ga0070680_100313351
950 Ga0070680_100484130
951 Ga0070680_100653867
952 Ga0070682_100583978
953 Ga0070682_101084095
954 Ga0068868_100024604
955 Ga0068868_100133850
956 Ga0068868_100171022
957 Ga0068868_100727153
958 Ga0070689_100189175
959 Ga0070661_100469950
960 Ga0070668_100052378
961 Ga0070669_100305578
962 Ga0070669_100561433
963 Ga0070675_100509938
964 Ga0070671_100159052
965 Ga0070674_100010034
966 Ga0070673_100273760
967 Ga0070673_100308190
968 Ga0070709_10010623
969 Ga0070709_10045320
970 Ga0070709_10534851
971 Ga0070714_100125058
972 Ga0070714_100140062
973 Ga0070714_100462778
974 Ga0070714_100724255
975 Ga0070714_101498952
976 Ga0070713_100005895
977 Ga0070713_100042023
978 Ga0070713_100311887
979 Ga0070710_10001143
980 Ga0070710_10033830
981 Ga0070710_10052491
982 Ga0070711_100012156
983 Ga0070711_100031547
984 Ga0070711_100034394
985 Ga0070711_100051498
986 Ga0070663_100000663
987 Ga0070663_100003769
988 Ga0070663_100154109
989 Ga0070663_100437482
990 Ga0070663_100793618
991 Ga0070678_100124675
992 Ga0070678_100875200
993 Ga0070662_100083552
994 Ga0070662_100367278
995 Ga0070662_100456000
996 Ga0070681_10007338
997 Ga0070681_10029849
998 Ga0070681_10241859
999 Ga0070681_10244768
1000 Ga0070706_100328218
1001 Ga0070706_100685249
1002 Ga0070707_100054244
1003 Ga0070679_100005095
1004 Ga0070679_100016927
1005 Ga0070679_100346489
1006 Ga0070679_100367653
1007 Ga0070684_100041425
1008 Ga0070684_100524651
1009 Ga0070697_100273753
1010 Ga0068853_100080396
1011 Ga0068853_100107081
1012 Ga0068853_100133162
1013 Ga0068853_100277430
1014 Ga0068853_100367411
1015 Ga0068853_100393568
1016 Ga0068853_100568823
1017 Ga0070672_100069324
1018 Ga0070693_100125435
1019 Ga0070665_100021352
1020 Ga0070665_100211972
1021 Ga0068855_100037802
1022 Ga0068855_100081956
1023 Ga0070664_100058833
1024 Ga0068856_100195698
1025 Ga0068856_100335042
1026 Ga0068856_100547268
1027 Ga0068852_100656393
1028 Ga0068859_100365258
1029 Ga0068859_100459923
1030 Ga0068864_100033892
1031 Ga0068864_100075572
1032 Ga0068866_10134581
1033 Ga0068866_10716785
1034 Ga0068851_10184853
1035 Ga0068860_100000277
1036 Ga0068860_100117686
1037 Ga0068860_100869843
1038 Ga0068862_100062919
1039 Ga0068862_100090098
1040 Ga0068862_100264347
1041 Ga0068862_101052977
1042 Ga0081538_10070951
1043 Ga0081540_1013761
1044 Ga0081540_1033497
1045 Ga0081540_1118869
1046 Ga0081540_1123610
1047 Ga0081539_10000008
1048 Ga0070717_10001012
1049 Ga0070717_10010060
1050 Ga0070717_10868436
1051 Ga0075365_10023316
1052 Ga0075365_10037498
1053 Ga0075365_10554861
1054 Ga0075365_10649226
1055 Ga0075368_10006100
1056 Ga0075368_10016532
1057 Ga0075363_100001432
1058 Ga0075364_10082823
1059 Ga0075364_10096903
1060 Ga0070715_10001321
1061 Ga0070715_10105174
1062 Ga0070715_10120794
1063 Ga0070712_100051705
1064 Ga0070712_100056148
1065 Ga0070712_100061639
1066 Ga0070712_100082461
1067 Ga0070712_100182730
1068 Ga0070712_100437604
1069 Ga0075367_10124456
1070 Ga0075367_10139253
1071 Ga0075367_10156884
1072 Ga0075367_10277714
1073 Ga0075367_10372824
1074 Ga0075369_10032995
1075 Ga0075369_10125173
1076 Ga0075369_10260556
1077 Ga0075366_10021253
1078 Ga0075366_10234456
1079 Ga0097621_100426171
1080 Ga0075370_10002046
1081 Ga0068871_100150747
1082 Ga0075434_100202779
1083 Ga0068865_100024418
1084 Ga0097620_100365266
1085 Ga0097620_100459907
1086 Ga0099824_1000172
1087 Ga0079104_1002074
1088 Ga0099826_10003676
1089 Ga0099794_10080457
1090 Ga0099795_10013641
1091 Ga0099795_10065454
1092 Ga0105244_10000220
1093 Ga0105250_10093730
1094 Ga0105240_10283276
1095 Ga0111539_10878068
1096 Ga0105245_10003690
1097 Ga0105245_10039286
1098 Ga0105247_10064943
1099 Ga0105247_10077113
1100 Ga0105247_10171998
1101 Ga0105247_10337342
1102 Ga0105247_10523984
1103 Ga0105243_10030847
1104 Ga0105243_10370817
1105 Ga0105241_10028994
1106 Ga0105241_10346459
1107 Ga0105242_10751558
1108 Ga0105248_10181813
1109 Ga0105248_10379042
1110 Ga0105248_10953830
1111 Ga0105237_10028140
1112 Ga0105237_10106301
1113 Ga0105237_10405235
1114 Ga0105237_10441326
1115 Ga0105237_10860629
1116 Ga0105237_11560090
1117 Ga0105238_10165404
1118 Ga0105238_10387209
1119 Ga0105238_10461242
1120 Ga0105238_10833406
1121 Ga0105249_10444343
1122 Ga0105249_10652496
1123 Ga0105249_10784814
1124 Ga0105249_10993234
1125 Ga0099796_10002212
1126 Ga0099796_10031337
1127 Ga0099796_10096360
1128 Ga0105239_10231182
1129 Ga0105239_10340450
1130 Ga0105239_10444192
1131 Ga0105239_11086610
1132 Ga0105239_11203714
1133 Ga0105246_10043334
1134 Ga0105246_10177024
1135 Ga0157373_10000154
1136 Ga0157371_10001090
1137 Ga0157370_10011837
1138 Ga0157370_10017169
1139 Ga0157370_10153449
1140 Ga0157370_10281617
1141 Ga0157370_10831742
1142 Ga0157369_10006035
1143 Ga0157369_10030336
1144 Ga0157369_10031238
1145 Ga0157374_10252842
1146 Ga0157378_10075410
1147 Ga0163162_10262558
1148 Ga0163162_10433499
1149 Ga0163162_10614187
1150 Ga0163162_10731645
1151 Ga0163162_10740168
1152 Ga0163162_11176457
1153 Ga0157372_11281893
1154 Ga0157375_10163452
1155 Ga0157375_11071290
1156 Ga0157375_11108084
1157 Ga0163163_10097723
1158 Ga0163163_10627358
1159 Ga0157380_10148137
1160 Ga0157380_11927802
1161 Ga0157377_10385355
1162 Ga0157379_10308402
1163 Ga0157376_10012280
1164 Ga0157376_10590371
1165 Ga0182006_1019298
1166 Ga0182007_10228968
1167 Ga0163161_10000009
1168 Ga0213872_10106103
1169 Ga0213872_10186591
1170 Ga0213874_10002170
1171 Ga0213875_10065129
1172 Ga0213871_10044641
1173 Ga0209233_1012045
1174 Ga0209564_1000838
1175 Ga0209564_1004046
1176 Ga0209758_1005774
1177 Ga0209758_1014924
1178 Ga0207655_1000093
1179 Ga0207692_10018645
1180 Ga0207692_10034640
1181 Ga0207642_10082545
1182 Ga0207710_10032580
1183 Ga0207710_10060437
1184 Ga0207710_10110687
1185 Ga0207710_10159759
1186 Ga0207710_10278680
1187 Ga0207688_10313376
1188 Ga0207680_10511659
1189 Ga0207647_10115510
1190 Ga0207647_10170469
1191 Ga0207647_10208699
1192 Ga0207647_10340943
1193 Ga0207685_10044852
1194 Ga0207699_10004047
1195 Ga0207699_10007087
1196 Ga0207699_10120152
1197 Ga0207699_10434158
1198 Ga0207643_10214045
1199 Ga0207705_10080396
1200 Ga0207705_10294003
1201 Ga0207684_10099173
1202 Ga0207684_10414347
1203 Ga0207654_10026493
1204 Ga0207654_10704555
1205 Ga0207707_10001782
1206 Ga0207707_10007981
1207 Ga0207707_10014876
1208 Ga0207707_10018060
1209 Ga0207707_10270590
1210 Ga0207695_10192784
1211 Ga0207695_10291026
1212 Ga0207671_10032987
1213 Ga0207671_10194201
1214 Ga0207671_10198960
1215 Ga0207671_10275572
1216 Ga0207671_10352642
1217 Ga0207693_10005601
1218 Ga0207693_10008235
1219 Ga0207693_10062151
1220 Ga0207693_10249330
1221 Ga0207693_10380858
1222 Ga0207693_10522981
1223 Ga0207663_10001398
1224 Ga0207663_10022867
1225 Ga0207663_10092502
1226 Ga0207663_10369470
1227 Ga0207660_10040027
1228 Ga0207660_10184025
1229 Ga0207660_10336141
1230 Ga0207660_10342013
1231 Ga0207657_10056536
1232 Ga0207657_10295701
1233 Ga0207649_10022284
1234 Ga0207649_10358769
1235 Ga0207652_10051895
1236 Ga0207652_10056236
1237 Ga0207652_10203106
1238 Ga0207652_10216647
1239 Ga0207646_10048329
1240 Ga0207694_10083594
1241 Ga0207650_10636693
1242 Ga0207659_11056527
1243 Ga0207687_10053267
1244 Ga0207687_10646127
1245 Ga0207700_10084304
1246 Ga0207700_10107253
1247 Ga0207700_10161091
1248 Ga0207700_10390818
1249 Ga0207700_10986955
1250 Ga0207664_10036855
1251 Ga0207664_10082338
1252 Ga0207664_10289764
1253 Ga0207644_10200455
1254 Ga0207644_10202299
1255 Ga0207706_10100767
1256 Ga0207686_10451123
1257 Ga0207709_10392212
1258 Ga0207704_10469001
1259 Ga0207665_10002091
1260 Ga0207665_10157384
1261 Ga0207665_10567849
1262 Ga0207691_10243439
1263 Ga0207691_10441470
1264 Ga0207711_10048559
1265 Ga0207711_10729508
1266 Ga0207689_10020778
1267 Ga0207661_10000190
1268 Ga0207661_10542975
1269 Ga0207661_10780741
1270 Ga0207679_10042437
1271 Ga0207679_10065681
1272 Ga0207679_10269357
1273 Ga0207667_10049550
1274 Ga0207667_10244077
1275 Ga0207667_11197033
1276 Ga0207712_10283424
1277 Ga0207712_10389711
1278 Ga0207712_10479016
1279 Ga0207712_10840000
1280 Ga0207668_10144149
1281 Ga0207668_10389182
1282 Ga0207668_10446789
1283 Ga0207658_10230137
1284 Ga0207677_10069783
1285 Ga0207703_10055664
1286 Ga0207639_10359959
1287 Ga0207639_10671839
1288 Ga0207639_11445727
1289 Ga0207678_10002185
1290 Ga0207678_10020155
1291 Ga0207678_10043771
1292 Ga0207678_10112761
1293 Ga0207678_10250842
1294 Ga0207708_10280829
1295 Ga0207702_10154922
1296 Ga0207702_10396336
1297 Ga0207702_10520431
1298 Ga0207641_10187867
1299 Ga0207641_10829394
1300 Ga0207648_10084644
1301 Ga0207676_10044071
1302 Ga0207676_10827244
1303 Ga0207674_10092137
1304 Ga0207675_100415476
1305 Ga0207683_10232246
1306 Ga0207683_10337721
1307 Ga0207698_10632426
1308 Ga0209281_1001726
1309 Ga0209589_1000007
1310 Ga0209489_100008
1311 Ga0209489_113034
1312 Ga0209700_100009
1313 Ga0209179_1002862
1314 Ga0209179_1019423
1315 Ga0209282_1041324
1316 Ga0209588_1044785
1317 Ga0209813_10002581
1318 Ga0209813_10181179
1319 Ga0268266_10000519
1320 Ga0268266_10002731
1321 Ga0268266_10137996
1322 Ga0268266_10348397
1323 Ga0268266_10458540
1324 Ga0268265_10223805
1325 Ga0268265_10454170
1326 Ga0268264_10000158
1327 Ga0268264_10570141
1328 Ga0307515_10366410
1329 Ga0307515_10462367
1330 Ga0265762_1075796
1331 Ga0265760_10117531
1332 Ga0265330_10002705
1333 Ga0265330_10032551
1334 Ga0265330_10128626
1335 Ga0265332_10041565
1336 Ga0265328_10085695
1337 Ga0265325_10147305
1338 Ga0265340_10004356
1339 Ga0265340_10037134
1340 Ga0265340_10058103
1341 Ga0265339_10140041
1342 Ga0265316_10286550
1343 Ga0307513_10162521
1344 Ga0307513_10281549
1345 Ga0307509_10064386
1346 Ga0307509_10266251
1347 Ga0307509_10344614
1348 Ga0307509_10354790
1349 Ga0307509_10361230
1350 Ga0307408_100001992
1351 Ga0307408_100389953
1352 Ga0307508_10056026
1353 Ga0307508_10323107
1354 Ga0265314_10003471
1355 Ga0265314_10015898
1356 Ga0265314_10054499
1357 Ga0265342_10001311
1358 Ga0265342_10149797
1359 Ga0307516_10020861
1360 Ga0307516_10049982
1361 Ga0307516_10205794
1362 Ga0307516_10583235
1363 Ga0307405_10687664
1364 Ga0307413_10001735
1365 Ga0307410_10000035
1366 Ga0307410_10640635
1367 Ga0307406_10000074
1368 Ga0307406_10757314
1369 Ga0307406_10899799
1370 Ga0307407_10005469
1371 Ga0307412_10019898
1372 Ga0307412_10336482
1373 Ga0307409_100106356
1374 Ga0307416_100000314
1375 Ga0307416_100278360
1376 Ga0307414_10000005
1377 Ga0307414_10242644
1378 Ga0307411_10000010
1379 Ga0307411_10092691
1380 Ga0307411_10684732
1381 Ga0307415_100117332
1382 Ga0307415_100295402
1383 Ga0307510_10021151
1384 Ga0307510_10267207
1385 Ga0315911_1000031
1386 Ga0316215_1010659
1387 Ga0373926_0034984
1388 Ga0373926_0058823
1389 Ga0373926_0116674
1390 Ga0373923_0135455
1391 Ga0373936_0005021
1392 Ga0373936_0050752
1393 Ga0373936_0331935
1394 Ga0373945_0011409
1395 Ga0373953_0080186
1396 Ga0373954_0018549
1397 Ga0373954_0083764
1398 Ga0373943_0026672
1399 Ga0373943_0028731
1400 Ga0373943_0353569
1401 Ga0373946_0140996
1402 Ga0373955_0008771
1403 Ga0373955_0013641
1404 Ga0373955_0046000
1405 Ga0373955_0325514
1406 Ga0373955_0390559
1407 Ga0373924_0007833
1408 Ga0373924_0130054
1409 Ga0373931_0295483
1410 Ga0373935_0015493
1411 Ga0373935_0165141
1412 Ga0373935_0214126
1413 Ga0373935_0265607
1414 Ga0373935_0305204
1415 Ga0373927_0000420
1416 Ga0373927_0003336
1417 Ga0373927_0003671
1418 Ga0373927_0011561
1419 Ga0373927_0031037
1420 Ga0373927_0041477
1421 Ga0373927_0048082
1422 Ga0373927_0130887
1423 Ga0373933_0000106
1424 Ga0373933_0015224
1425 Ga0373947_0000233
1426 Ga0373947_0012043
1427 Ga0373947_0129700
1428 Ga0373937_0021564
1429 Ga0373937_1129752
1430 Ga0372808_017541
1431 Ga0373925_0002578
1432 Ga0373925_0011103
1433 Ga0395899_0143740
1434 Ga0395900_0031133
1435 Ga0395900_0783441
1436 Ga0395898_0002276
1437 Ga0395898_0038790
1438 Ga0395898_0095957
1439 Ga0395905_0347782
1440 Ga0436364_0058409
1441 Ga0436364_0350531
1442 Ga0395901_0848664
1443 Ga0436365_1788547
1444 Ga0436360_1066772
1445 Ga0436360_1126519
1446 Ga0436360_1130528
1447 Ga0436361_0054977
1448 Ga0436361_0552215
1449 Ga0436363_0229744
1450 Ga0436363_0781366
1451 Ga0439447_001735
1452 Ga0439461_0029953
1453 Ga0451797_0376578
1454 Ga0451795_1417182
1455 Ga0439431_0065962
1456 Ga0450891_020265
1457 Ga0466963_0610996
1458 Ga0466959_0090977
1459 Ga0466967_0142117
1460 Ga0466967_0372317
1461 Ga0466967_0864040
1462 Ga0495617_072887
1463 Ga0495627_121723
1464 Ga0495592_0185618
1465 Ga0495603_0000240
1466 Ga0495603_0014900
1467 Ga0495603_0061580
1468 Ga0495590_0090359
1469 Ga0495629_0007933
1470 Ga0495638_0002321
1471 Ga0495638_0010623
1472 Ga0495641_0030287
1473 Ga0495651_0091868
1474 Ga0495651_0103374
1475 Ga0495651_0154772
1476 Ga0495653_0027066
1477 Ga0495580_0008282
1478 Ga0495580_0384661
1479 Ga0495582_0000658
1480 Ga0495582_0060194
1481 Ga0495582_0072967
1482 Ga0495605_0050469
1483 Ga0495639_0000432
1484 Ga0495662_0000041
1485 Ga0495662_0098053
1486 Ga0495664_0014937
1487 Ga0495664_0115171
1488 Ga0495664_0223363
1489 Ga0495594_0000722
1490 Ga0495594_0068159
1491 Ga0495594_0107165
1492 Ga0495594_0545586
1493 Ga0495606_0080080
1494 Ga0495608_0014874
1495 Ga0495608_0181062
1496 Ga0495610_0036179
1497 Ga0495616_0066807
1498 Ga0495618_0061195
1499 Ga0495620_0090099
1500 Ga0495628_0052691
1501 Ga0495628_0287205
1502 Ga0495630_0004307
1503 Ga0495630_0299661
1504 Ga0495632_0126398
1505 Ga0495637_0132024
1506 Ga0495643_0014806
1507 Ga0495648_0000854
1508 Ga0495666_0041503
1509 Ga0495666_0175365
1510 Ga0495652_0170705
1511 Ga0495652_0678312
1512 Ga0495665_0007581
1513 Ga0495640_0035093
1514 Ga0495640_0212272
1515 Ga0495640_0335488
1516 Ga0495586_0057321
1517 Ga0495586_0250005
1518 Ga0495587_0083509
1519 Ga0495598_0097557
1520 Ga0495645_0008137
1521 Ga0495645_0058553
1522 Ga0495645_0187009
1523 Ga0495622_0021034
1524 Ga0495622_0029335
1525 Ga0495622_0111066
1526 Ga0495633_0192722
1527 Ga0495667_0016424
1528 Ga0495667_0059967
1529 Ga0495668_0044964
1530 Ga0495668_0140335
1531 Ga0495668_0184271
1532 Ga0495634_0000417
1533 Ga0495634_0021915
1534 Ga0495634_0035361
1535 Ga0495634_0195675
1536 Ga0495625_0162031
1537 Ga0495625_0265311
1538 Ga0495625_0448225
1539 Ga0495635_0010004
1540 Ga0495635_0035402
1541 Ga0495659_0051083
1542 Ga0495588_0034998
1543 Ga0495588_0189863
1544 Ga0495657_0263231
1545 Ga0495599_0012081
1546 Ga0495599_0117889
1547 Ga0495599_0390495
1548 Ga0495623_0012982
1549 Ga0495646_0209127
1550 Ga0495647_0203874
1551 Ga0495647_0355020
1552 Ga0495658_0000331
1553 Ga0495658_0214645
1554 Ga0495613_0154731
1555 Ga0495613_0483192
1556 Ga0495624_0002925
1557 Ga0495670_0011578
1558 Ga0495671_0077051
1559 Ga0495671_0138157
1560 Ga0495600_0058222
1561 Ga0495600_0205161
1562 Ga0495581_0000820
1563 Ga0495581_0119230
1564 Ga0495581_0181667
1565 Ga0495581_0235275
1566 Ga0495604_0005878
1567 Ga0495604_0245291
1568 Ga0495674_0000400
1569 Ga0495674_0034685
1570 Ga0495674_0128501
1571 Ga0495674_0315421
1572 Ga0495674_0482119
1573 Ga0495672_0066584
1574 Ga0495672_0163988
1575 Ga0495672_0171394
1576 Ga0495672_0259280
1577 Ga0495676_0200653
1578 Ga0495676_0237234
1579 Ga0495676_0248311
1580 Ga0495675_0014001
1581 Ga0495673_0022859
1582 Ga0495681_0164195
1583 Ga0495684_0005946
1584 Ga0495686_0036626
1585 Ga0495686_0051321
1586 Ga0495686_0059413
1587 Ga0495593_0000029
1588 Ga0495593_0234113
1589 Ga0495602_0198397
1590 Ga0495614_0158752
1591 Ga0495626_0060446
1592 Ga0496100_0010673
1593 Ga0496101_0019376
1594 Ga0496101_0180650
1595 Ga0496101_0408596
1596 Ga0496101_0756961
1597 Ga0496102_0043103
1598 Ga0496102_0147579
1599 Ga0496102_0237435
1600 Ga0496104_0097168
1601 Ga0496104_0155849
1602 Ga0496106_0026275
1603 Ga0496106_0170513
1604 Ga0496106_0249980
1605 Ga0496107_0001289
1606 Ga0496107_0018602
1607 Ga0496108_0230257
1608 Ga0496108_0372948
1609 Ga0496109_0106503
1610 Ga0496109_0373815
1611 Ga0496109_0399154
1612 Ga0496110_0047110
1613 Ga0496110_0290122
1614 Ga0496110_0305825
1615 Ga0496110_0447167
1616 Ga0496111_0132962
1617 Ga0496111_0521847
1618 Ga0496112_0012973
1619 Ga0496112_0090833
1620 Ga0496112_0168577
1621 Ga0496112_0195734
1622 Ga0496112_0217379
1623 Ga0496113_0017700
1624 Ga0496113_0507341
1625 Ga0496114_0054595
1626 Ga0496115_0026487
1627 Ga0496115_0120542
1628 Ga0496115_0218202
1629 Ga0496115_0315906
1630 Ga0496115_0782106
1631 Ga0496116_0000156
1632 Ga0496116_0003708
1633 Ga0496116_0081672
1634 Ga0496117_0016897
1635 Ga0496117_0046138
1636 Ga0496117_0123343
1637 Ga0496118_0003787
1638 Ga0496118_0020426
1639 Ga0496118_0119464
1640 Ga0496118_0151850
1641 Ga0496118_0421559
1642 Ga0496119_0163482
1643 Ga0496120_0057897
1644 Ga0496121_0000287
1645 Ga0496121_0000654
1646 Ga0496121_0001942
1647 Ga0496121_0004461
1648 Ga0496121_0011661
1649 Ga0496121_0017149
1650 Ga0496121_0023934
1651 Ga0496121_0063315
1652 Ga0496121_0123202
1653 Ga0496122_0040623
1654 Ga0496122_0063148
1655 Ga0496122_0137175
1656 Ga0496123_0005902
1657 Ga0496123_0065089
1658 Ga0496124_0014134
1659 Ga0496124_0042607
1660 Ga0496124_0152607
1661 Ga0496124_0160927
1662 Ga0496124_0346307
1663 Ga0496124_0434459
1664 Ga0496124_0481917
1665 Ga0496125_0000062
1666 Ga0496125_0029695
1667 Ga0496125_0030363
1668 Ga0496125_0049990
1669 Ga0496125_0133648
1670 Ga0496126_0002702
1671 Ga0496126_0015438
1672 Ga0496126_0020844
1673 Ga0496126_0031702
1674 Ga0496126_0033666
1675 Ga0496126_0036969
1676 Ga0496126_0060746
1677 Ga0496126_0094092
1678 Ga0496126_0095456
1679 Ga0496126_0120351
1680 Ga0496126_0188652
1681 Ga0496126_0203567
1682 Ga0496126_0213724
1683 Ga0496126_0296085
1684 Ga0496126_0386977
1685 Ga0496126_0486888
1686 Ga0495682_0111110
1687 Ga0501034_0004212
1688 Ga0501046_0283892
1689 Ga0501047_0037283
1690 Ga0501070_0182172
1691 Ga0501073_0198189
1692 Ga0501074_0097698
1693 Ga0501076_0393712
1694 Ga0501080_0139999
1695 Ga0501266_000009
1696 Ga0501269_016886
1697 Ga0501280_000138
1698 Ga0501044_0168479
1699 nmdc:mga03n38_38549_c1
1700 nmdc:mga00v17_126180_c1
1701 nmdc:mga0yw44_22227_c1
1702 nmdc:mga0yw44_626673_c1
1703 nmdc:mga0yw44_70232_c1
1704 nmdc:mga0yw44_80807_c1
1705 nmdc:mga0k408_200256_c1
1706 nmdc:mga06z11_110522_c1
1707 nmdc:mga06z11_233871_c1
1708 nmdc:mga04h51_23583_c1
1709 nmdc:mga07m45_71243_c1
1710 nmdc:mga07m45_94827_c1
1711 nmdc:mga08y16_666078_c1
1712 nmdc:mga0n895_1350195_c1
1713 nmdc:mga0rr50_472012_c1
1714 nmdc:mga0sz30_248260_c1
1715 nmdc:mga0sz30_256775_c1
1716 nmdc:mga0sz30_4129_c1
1717 Ga0495601_0048187
1718 Ga0495601_0053196
1719 Ga0495601_0067973
1720 Ga0495601_0112009
1721 Ga0495612_0070811
1722 Ga0495612_0124933
1723 Ga0500610_0116119
1724 Ga0500635_0006579
1725 Ga0500635_0041540
1726 Ga0495595_0054361
1727 Ga0495595_0220899
1728 Ga0495619_0072998
1729 Ga0500578_0260334
1730 Ga0500643_114089
1731 Ga0500644_0109321
1732 Ga0500646_0017782
1733 Ga0500646_0032846
1734 Ga0500647_0017416
1735 Ga0500651_0010775
1736 Ga0500651_0077466
1737 Ga0500566_0006566
1738 Ga0500566_0039533
1739 Ga0500566_0089348
1740 Ga0500641_0000048
1741 Ga0500641_0004479
1742 Ga0500641_0008186
1743 Ga0500641_0026021
1744 Ga0500641_0038356
1745 Ga0500641_0099847
1746 Ga0500650_0005311
1747 Ga0500554_000916
1748 Ga0500556_0000006
1749 Ga0500562_019863
1750 Ga0500569_010012
1751 Ga0500572_000429
1752 Ga0500572_000888
1753 Ga0500594_0008460
1754 Ga0500594_0019210
1755 Ga0500595_003393
1756 Ga0500607_110191
1757 Ga0500608_002124
1758 Ga0500618_034742
1759 Ga0500618_067534
1760 Ga0500642_0000004
1761 Ga0500642_0001875
1762 Ga0500652_002335
1763 Ga0500655_083004
1764 Ga0500658_0000006
1765 Ga0500559_0000276
1766 Ga0500559_0001054
1767 Ga0500559_0010860
1768 Ga0500559_0026459
1769 Ga0500559_0169136
1770 Ga0500568_0006697
1771 Ga0500577_0000077
1772 Ga0500577_0157188
1773 Ga0500586_178060
1774 Ga0500588_0037432
1775 Ga0500590_116094
1776 Ga0500603_000241
1777 Ga0500603_000290
1778 Ga0500604_0066126
1779 Ga0500616_0000022
1780 Ga0500619_049810
1781 Ga0500622_0006743
1782 Ga0500627_0211392
1783 Ga0500638_002209
1784 Ga0500639_000076
1785 Ga0500639_095322
1786 Ga0500636_0001192
1787 Ga0500636_0018817
1788 Ga0500636_0106876
1789 Ga0500636_0229678
1790 Ga0500637_0004134
1791 Ga0500637_0006951
1792 Ga0500637_0053341
1793 Ga0500637_0211937
1794 Ga0500576_071640
1795 Ga0500584_054540
1796 Ga0500645_019080
1797 Ga0500645_036492
1798 Ga0500645_077286
1799 Ga0500596_014498
1800 Ga0500596_018145
1801 Ga0500661_000404
1802 2513676672
1803 2513861452
1804 2513915776
1805 2517894918
1806 2520881068
1807 2524466608
1808 2524534689
1809 2603858439
1810 2644011066
1811 2644287299
1812 2644371987
1813 2644643556
1814 2644683909
1815 2671123027
1816 2728748803
1817 2738737097
1818 2738769637
1819 2739218679
1820 2739999394
1821 2740004211
1822 2793079593
1823 2802652202
1824 2817415060
1825 2852626252
1826 2857526469
1827 2857617480
1828 2857621293
1829 2874607463
1830 2876814798
1831 2879111058
1832 2881359919
1833 2884934703
1834 2885383074
1835 2885385937
1836 2889037151
1837 2893067289
1838 2903756549
1839 2903769780
1840 2903896176
1841 2904421782
1842 2904559918
1843 2904706172
1844 2906611653
1845 2906639632
1846 2906660625
1847 2908745239
1848 2919073714
1849 2919195785
1850 2922427694
1851 2929152234
1852 2958460066
1853 2977268934
1854 2996315358
1855 3005477408
1856 8006933827
1857 8006969627
1858 8006983499
1859 8006990667
1860 8006998704
1861 8019559756
1862 8054309768
1863 8055419112
1864 8055594237
1865 8056442527
1866 8056676663

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

26

218

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8491 6 182
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8473 1 182
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.839 1 182
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8199 6 182
3h0d-assembly1.cif.gz_B crystal structure of ctsr in complex with a 26bp dna duplex 0.5412 96 159
ID Description Score Start End Superfamily
af_F1M484_325_591_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6907 129 158 3.20.20.140
af_Q06596_231_293_1.10.238.100 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;YAP1 redox domain. Chain B 0.5423 128 183 1.10.238.100
af_O94265_1_284_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.5392 131 175 3.40.1190.20
5i44K00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5317 138 182 1.10.1660.10
af_A0A1D6IKH7_71_178_1.10.238.200 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Cullin, PONY binding domain 0.512 91 180 1.10.238.200
ID Description Score Start End GO Terms
AF-A0A8B3G858-F1-model_v4 deleted 0.9813 129 183
AF-A0A2N8BCP5-F1-model_v4 deleted 0.9786 127 182
AF-A0A4Q6CGJ9-F1-model_v4 deleted 0.9785 129 183
AF-Q8VTB5-F1-model_v4 FrrA 0.9642 126 182 GO:0005524
GO:0005886
GO:0008556
AF-A0A2V6URK3-F1-model_v4 Potassium-transporting ATPase subunit C (EC 3.6.3.12) 0.9595 113 181 GO:0005524
GO:0005886
GO:0008556
GO:0016787

Map