F486105

General Info

Members Datasets Scaffolds Average Seq Length
933 322 1864 270

Family's Representative Sequence

Representative Sequence 3300046810|Ga0495660_0019720|Ga0495660_0019720_542_1453
Length 303
Sequence MLIHPMPDPVAIHLGPVAIHWYGLMYVLAFALFITLGRVRIKQPHIAAQLWRKEDLDDMLFYGMLGVVIGGRLGEVLFYEPVKYFSDPIEIFKVWHGGMSFHGGFIGVLIAMSLWARKAGRNILDVYDFIAPLVPLGYAAGRMGNFINAELPGRVVADQSLPWAMLWPDNSFPLHPNPIFLQGLRHPSPIYQMLIDGLLVFILLWLYARKERPRLAVGAFYTLLYGCARFFTEYFRTPDWETTVLGMPITSGQVLSLPMVVAAIAMLVWAYKVRQRATAPTINPQSQAGVGPQGTTLGSDPKR

Samples

Sample ID Description Type Environment
1 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
107 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
111 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
112 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
113 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
151 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
231 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
259 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
260 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
261 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
262 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
266 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
267 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
268 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
270 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
271 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
272 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
273 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
274 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
275 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
276 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
277 2643221556 Massilia sp. Root1485 Isolate Unclassified
278 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
279 2643221638 Duganella sp. Root336D2 Isolate Unclassified
280 2643221645 Massilia sp. Root351 Isolate Unclassified
281 2643221664 Massilia sp. Root418 Isolate Unclassified
282 2643221684 Massilia sp. Root133 Isolate Unclassified
283 2738541280 Massilia sp. GV090 Isolate Unclassified
284 2738541297 Duganella sp. GV083 Isolate Unclassified
285 2738541300 Massilia sp. GV016 Isolate Unclassified
286 2738541357 Duganella sp. GV053 Isolate Unclassified
287 2738543003 Duganella sp. GV066 Isolate Unclassified
288 2738543018 Massilia sp. GV045 Isolate Unclassified
289 2738543026 Duganella sp. GV089 Isolate Unclassified
290 2738543029 Duganella sp. GV039 Isolate Unclassified
291 2738543030 Massilia sp. GV097 Isolate Unclassified
292 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
293 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
294 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
295 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
296 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
297 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
298 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
299 2821131069 Duganella sp. 1224 Isolate Unclassified
300 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
301 2842711865 Duganella sp. R-73148 Isolate Unclassified
302 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
303 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
304 2857553236 Duganella sp. R-74557 Isolate Unclassified
305 2857558681 Duganella sp. R-74565 Isolate Unclassified
306 2857564685 Duganella sp. R-74599 Isolate Unclassified
307 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
308 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
309 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
310 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
311 2904424332 Duganella sp. 1411 Isolate Rhizosphere
312 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
313 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
314 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
315 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
316 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
317 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
318 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
319 2919476304 Duganella sp. 3397 Isolate Unclassified
320 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
321 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
322 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.89
Metatranscriptomes 0.32
Isolates 5.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.9
Nodule 0.75
Rhizoplane 3.86
Rhizosphere 76.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495660_0019720 3300046810 Bacteria 3869
2 JGI25155J39150_1000145 3300002704 Bacteria 32917
3 JGI25155J39150_1000235 3300002704 Bacteria 21541
4 JGI25156J39149_1000290 3300002705 Bacteria 33901
5 JGI25156J39149_1005361 3300002705 Bacteria 3714
6 JGI25154J39366_1000265 3300002738 Bacteria 33226
7 JGI25154J39366_1000422 3300002738 Bacteria 22674
8 JGI25154J39366_1004266 3300002738 Bacteria 2618
9 JGI25158J39367_1012821 3300002739 Bacteria 1102
10 JGI25157J39369_1000186 3300002741 Bacteria 52214
11 JGI25152J39213_1000522 3300002773 Bacteria 21318
12 JGI25150J39212_1001085 3300002774 Bacteria 8224
13 JGI25150J39212_1001168 3300002774 Bacteria 7858
14 JGI25150J39212_1001539 3300002774 Bacteria 6322
15 JGI25159J45721_1013961 3300002987 Bacteria 1833
16 JGI25159J45721_1020762 3300002987 Bacteria 1257
17 JGI25151J46595_10041231 3300003187 Bacteria 1680
18 JGI25153J46596_10011966 3300003215 Bacteria 3794
19 rootL2_10025195 3300003322 Bacteria 4583
20 rootL2_10047912 3300003322 Bacteria 4050
21 rootL2_10050900 3300003322 Bacteria 2017
22 JGI25161J50226_1000765 3300003374 Bacteria 12284
23 JGI25161J50226_1003266 3300003374 Bacteria 3776
24 Ga0007417J51691_1037979 3300003544 Bacteria 1853
25 Ga0007409J51694_1101127 3300003575 Bacteria 993
26 Ga0055538_1000008 3300003751 Bacteria 398547
27 Ga0055539_1000012 3300003752 Bacteria 398547
28 Ga0055533_1000015 3300003756 Bacteria 398547
29 Ga0055532_1000077 3300003758 Bacteria 122193
30 Ga0055525_1000009 3300003759 Bacteria 596899
31 Ga0055525_1000017 3300003759 Bacteria 398547
32 Ga0055542_1008906 3300003762 Bacteria 1927
33 Ga0055529_1000166 3300003763 Bacteria 90973
34 Ga0055526_1000020 3300003771 Bacteria 188230
35 Ga0055526_1000031 3300003771 Bacteria 143136
36 Ga0055526_1013214 3300003771 Bacteria 3512
37 Ga0055526_1050757 3300003771 Bacteria 948
38 Ga0055537_1003068 3300003773 Bacteria 5263
39 Ga0055524_1000015 3300003775 Bacteria 246493
40 Ga0055524_1001394 3300003775 Bacteria 13927
41 Ga0055534_1010859 3300003784 Bacteria 1880
42 Ga0055530_10010273 3300003791 Bacteria 3483
43 Ga0055530_10012515 3300003791 Bacteria 2953
44 Ga0055541_1000009 3300003841 Bacteria 398547
45 Ga0055543_1000896 3300004625 Bacteria 14105
46 Ga0065165_1002937 3300005262 Bacteria 12990
47 Ga0065165_1008414 3300005262 Bacteria 4832
48 Ga0070658_10198453 3300005327 Bacteria 1692
49 Ga0070658_10350199 3300005327 Bacteria 1264
50 Ga0070670_100084758 3300005331 Bacteria 2723
51 Ga0070670_100195283 3300005331 Bacteria 1758
52 Ga0070680_100314907 3300005336 Bacteria 1328
53 Ga0070660_100137617 3300005339 Bacteria 1957
54 Ga0070661_100057532 3300005344 Bacteria 2849
55 Ga0070661_100254229 3300005344 Bacteria 1357
56 Ga0070659_100032348 3300005366 Bacteria 4056
57 Ga0068853_100529555 3300005539 Bacteria 1115
58 Ga0068855_100000175 3300005563 Bacteria 82401
59 Ga0068855_100043396 3300005563 Bacteria 5326
60 Ga0068855_100569380 3300005563 Bacteria 1224
61 Ga0070664_100241530 3300005564 Bacteria 1621
62 Ga0068854_100186254 3300005578 Bacteria 1624
63 Ga0068856_100348653 3300005614 Bacteria 1499
64 Ga0068852_100006257 3300005616 Bacteria 8589
65 Ga0068852_100063685 3300005616 Bacteria 3211
66 Ga0075363_100086922 3300006048 Bacteria 1717
67 Ga0068871_100176706 3300006358 Bacteria 1833
68 Ga0079104_1012129 3300006946 Bacteria 2730
69 Ga0099826_10000003 3300006948 Bacteria 1067817
70 Ga0105244_10002015 3300009036 Bacteria 15661
71 Ga0105244_10025306 3300009036 Bacteria 3227
72 Ga0105244_10057492 3300009036 Bacteria 1965
73 Ga0105244_10102057 3300009036 Bacteria 1402
74 Ga0105240_10029943 3300009093 Bacteria 7083
75 Ga0105240_10068329 3300009093 Bacteria 4401
76 Ga0105240_10142117 3300009093 Bacteria 2869
77 Ga0105245_10133899 3300009098 Bacteria 2327
78 Ga0105243_10079915 3300009148 Bacteria 2666
79 Ga0105241_10022159 3300009174 Bacteria 4702
80 Ga0105242_10099896 3300009176 Bacteria 2457
81 Ga0105242_10465082 3300009176 Bacteria 1195
82 Ga0105238_10000111 3300009551 Bacteria 89931
83 Ga0105238_10030799 3300009551 Bacteria 5461
84 Ga0105239_10013354 3300010375 Bacteria 9124
85 Ga0157373_10142503 3300013100 Bacteria 1686
86 Ga0157371_10000001 3300013102 Bacteria 1162285
87 Ga0157374_10462305 3300013296 Bacteria 1271
88 Ga0182008_10002625 3300014497 Bacteria 11157
89 Ga0182006_1000014 3300015261 Bacteria 340159
90 Ga0182006_1001932 3300015261 Bacteria 11769
91 Ga0182006_1037827 3300015261 Bacteria 1911
92 Ga0182007_10000011 3300015262 Bacteria 264045
93 Ga0182005_1000014 3300015265 Bacteria 389763
94 Ga0182005_1000018 3300015265 Bacteria 324307
95 Ga0163161_10034197 3300017792 Bacteria 3635
96 Ga0163161_10046068 3300017792 Bacteria 3146
97 Ga0213872_10000002 3300021361 Bacteria 554092
98 Ga0213872_10000868 3300021361 Bacteria 21870
99 Ga0213872_10031932 3300021361 Bacteria 2413
100 Ga0213872_10063169 3300021361 Bacteria 1673
101 Ga0209435_100048 3300025206 Bacteria 92746
102 Ga0209435_100655 3300025206 Bacteria 6154
103 Ga0209436_100266 3300025208 Bacteria 23956
104 Ga0209436_108447 3300025208 Bacteria 2049
105 Ga0209784_100005 3300025224 Bacteria 1040422
106 Ga0209566_100005 3300025225 Bacteria 1040422
107 Ga0209674_100009 3300025226 Bacteria 1040422
108 Ga0209147_100122 3300025229 Bacteria 138553
109 Ga0209563_100012 3300025230 Bacteria 1040422
110 Ga0209563_100015 3300025230 Bacteria 879901
111 Ga0209437_100081 3300025233 Bacteria 271072
112 Ga0209258_100230 3300025242 Bacteria 104468
113 Ga0207425_1000001 3300025245 Bacteria 2525432
114 Ga0207425_1000256 3300025245 Bacteria 39487
115 Ga0207425_1000362 3300025245 Bacteria 31451
116 Ga0209646_1000028 3300025246 Bacteria 387986
117 Ga0209646_1000130 3300025246 Bacteria 128556
118 Ga0209646_1000152 3300025246 Bacteria 97484
119 Ga0209026_1000126 3300025250 Bacteria 122422
120 Ga0209677_100006 3300025253 Bacteria 1040422
121 Ga0209148_1000727 3300025254 Bacteria 25803
122 Ga0209759_1000193 3300025256 Bacteria 97484
123 Ga0209759_1000509 3300025256 Bacteria 42206
124 Ga0209129_1000093 3300025258 Bacteria 173163
125 Ga0209565_1004105 3300025263 Bacteria 4534
126 Ga0209565_1012013 3300025263 Bacteria 2082
127 Ga0209565_1014868 3300025263 Bacteria 1772
128 Ga0209565_1020304 3300025263 Bacteria 1403
129 Ga0209455_1000049 3300025272 Bacteria 374414
130 Ga0209455_1001546 3300025272 Bacteria 10213
131 Ga0209130_1001139 3300025284 Bacteria 19467
132 Ga0209130_1001693 3300025284 Bacteria 13332
133 Ga0209675_1013453 3300025291 Bacteria 2556
134 Ga0209675_1018523 3300025291 Bacteria 1946
135 Ga0209675_1037188 3300025291 Bacteria 1096
136 Ga0209025_1002442 3300025294 Bacteria 19677
137 Ga0209564_1000006 3300025295 Bacteria 1100927
138 Ga0209564_1000038 3300025295 Bacteria 414357
139 Ga0209564_1000134 3300025295 Bacteria 188346
140 Ga0209564_1002238 3300025295 Bacteria 15946
141 Ga0209758_1000055 3300025297 Bacteria 336183
142 Ga0209758_1001248 3300025297 Bacteria 31567
143 Ga0209050_1000085 3300025298 Bacteria 263219
144 Ga0209050_1000092 3300025298 Bacteria 252702
145 Ga0209256_1000005 3300025299 Bacteria 1315082
146 Ga0209256_1001714 3300025299 Bacteria 21051
147 Ga0209256_1003252 3300025299 Bacteria 11684
148 Ga0209256_1036568 3300025299 Bacteria 1287
149 Ga0207426_1007690 3300025302 Bacteria 4475
150 Ga0209051_1019016 3300025303 Bacteria 3015
151 Ga0209257_1000010 3300025304 Bacteria 1158682
152 Ga0207655_1015696 3300025728 Bacteria 4193
153 Ga0207655_1018407 3300025728 Bacteria 3705
154 Ga0207705_10232947 3300025909 Bacteria 1401
155 Ga0207695_10001512 3300025913 Bacteria 38639
156 Ga0207695_10019273 3300025913 Bacteria 7856
157 Ga0207695_10058955 3300025913 Bacteria 3983
158 Ga0207695_10300398 3300025913 Bacteria 1497
159 Ga0207671_10016832 3300025914 Bacteria 5666
160 Ga0207671_10342602 3300025914 Bacteria 1184
161 Ga0207657_10029684 3300025919 Bacteria 4973
162 Ga0207657_10158041 3300025919 Bacteria 1842
163 Ga0207694_10000413 3300025924 Bacteria 39834
164 Ga0207650_10165058 3300025925 Bacteria 1757
165 Ga0207687_10213222 3300025927 Bacteria 1516
166 Ga0207690_10078377 3300025932 Bacteria 2299
167 Ga0207706_10105266 3300025933 Bacteria 2482
168 Ga0207667_10000028 3300025949 Bacteria 334510
169 Ga0207667_10021117 3300025949 Bacteria 7221
170 Ga0207667_10205389 3300025949 Bacteria 2020
171 Ga0207640_10055076 3300025981 Bacteria 2603
172 Ga0207640_10403385 3300025981 Bacteria 1114
173 Ga0207674_10136597 3300026116 Bacteria 2413
174 Ga0207698_10200163 3300026142 Bacteria 1788
175 Ga0209281_1010109 3300027111 Bacteria 2177
176 Ga0209282_1000002 3300027666 Bacteria 1067825
177 Ga0265323_10017196 3300028653 Bacteria 2812
178 Ga0307515_10283524 3300028794 Bacteria 1361
179 Ga0316177_1099066 3300030731 Bacteria 5558
180 Ga0316178_1130629 3300030735 Bacteria 2199
181 Ga0316180_1146827 3300030736 Bacteria 3817
182 Ga0316181_1101234 3300030744 Bacteria 4508
183 Ga0307509_10000009 3300031507 Bacteria 350890
184 Ga0307408_100004177 3300031548 Bacteria 9842
185 Ga0307408_100035363 3300031548 Bacteria 3505
186 Ga0307408_100284841 3300031548 Bacteria 1377
187 Ga0307408_100383373 3300031548 Bacteria 1202
188 Ga0265314_10079030 3300031711 Bacteria 2176
189 Ga0307412_10162337 3300031911 Bacteria 1662
190 Ga0307416_100078626 3300032002 Bacteria 2776
191 Ga0307414_10074288 3300032004 Bacteria 2462
192 Ga0316583_10000115 3300032133 Bacteria 18648
193 Ga0373931_0059990 3300035691 Bacteria 2047
194 Ga0395899_0000330 3300037312 Bacteria 60063
195 Ga0395899_0037882 3300037312 Bacteria 3614
196 Ga0395899_0040773 3300037312 Bacteria 3471
197 Ga0395900_0002680 3300037418 Bacteria 19461
198 Ga0395900_0098989 3300037418 Bacteria 2996
199 Ga0395900_0105392 3300037418 Bacteria 2896
200 Ga0395900_0114655 3300037418 Bacteria 2765
201 Ga0395900_0238206 3300037418 Bacteria 1826
202 Ga0395900_0282980 3300037418 Bacteria 1649
203 Ga0395900_0511549 3300037418 Bacteria 1150
204 Ga0395900_0781841 3300037418 Bacteria 883
205 Ga0395898_0125754 3300037466 Bacteria 2456
206 Ga0395905_0014222 3300037471 Bacteria 7602
207 Ga0395905_0045973 3300037471 Bacteria 4095
208 Ga0395905_0082892 3300037471 Bacteria 3004
209 Ga0395901_0000229 3300038443 Bacteria 70261
210 Ga0395901_0348538 3300038443 Bacteria 1528
211 Ga0395901_0668015 3300038443 Bacteria 1040
212 Ga0436361_0448498 3300039447 Bacteria 15659
213 Ga0436361_0488682 3300039447 Bacteria 4126
214 Ga0436361_0491527 3300039447 Bacteria 29855
215 Ga0436361_0572129 3300039447 Bacteria 17740
216 Ga0439448_0001795 3300042005 Bacteria 5671
217 Ga0439448_0017550 3300042005 Bacteria 2186
218 Ga0439449_0030934 3300042007 Bacteria 1995
219 Ga0439455_0003644 3300042012 Bacteria 2970
220 Ga0450904_000265 3300042139 Bacteria 11278
221 Ga0451577_0003922 3300042876 Bacteria 16074
222 Ga0451577_0073588 3300042876 Bacteria 3049
223 Ga0466972_0000275 3300044658 Bacteria 32437
224 Ga0466972_0003253 3300044658 Bacteria 8051
225 Ga0466982_0056167 3300044672 Bacteria 2418
226 Ga0466965_0002351 3300044683 Bacteria 8001
227 Ga0466965_0009582 3300044683 Bacteria 4502
228 Ga0466965_0060595 3300044683 Bacteria 1890
229 Ga0466966_0043959 3300044684 Bacteria 2861
230 Ga0466966_0194785 3300044684 Bacteria 1227
231 Ga0466966_0204090 3300044684 Bacteria 1195
232 Ga0466961_0055842 3300044693 Bacteria 2516
233 Ga0466961_0251825 3300044693 Bacteria 1084
234 Ga0466964_0000266 3300044706 Bacteria 15085
235 Ga0466964_0010922 3300044706 Bacteria 3431
236 Ga0453684_0000014 3300044712 Bacteria 993311
237 Ga0453684_0016719 3300044712 Bacteria 11441
238 Ga0453684_0089959 3300044712 Bacteria 3794
239 Ga0466968_0005250 3300044735 Bacteria 4852
240 Ga0466968_0050463 3300044735 Bacteria 1775
241 Ga0466968_0054539 3300044735 Bacteria 1714
242 Ga0466970_0150416 3300044765 Bacteria 1285
243 Ga0466970_0153396 3300044765 Bacteria 1272
244 Ga0466970_0170142 3300044765 Bacteria 1207
245 Ga0466970_0293150 3300044765 Bacteria 916
246 Ga0466957_0002503 3300044842 Bacteria 9883
247 Ga0466957_0210012 3300044842 Bacteria 1281
248 Ga0466959_0014282 3300045049 Bacteria 5764
249 Ga0451576_0065292 3300045051 Bacteria 3790
250 Ga0451576_0317511 3300045051 Bacteria 1630
251 Ga0466958_0058609 3300045836 Bacteria 2341
252 Ga0466958_0196444 3300045836 Bacteria 1283
253 Ga0466967_0131066 3300045976 Bacteria 2327
254 Ga0495617_000002 3300046452 Bacteria 710121
255 Ga0495617_000007 3300046452 Bacteria 369986
256 Ga0495617_002281 3300046452 Bacteria 7768
257 Ga0495617_018000 3300046452 Bacteria 2388
258 Ga0495617_031222 3300046452 Bacteria 1789
259 Ga0495627_000006 3300046453 Bacteria 581750
260 Ga0495627_001759 3300046453 Bacteria 11666
261 Ga0495627_005262 3300046453 Bacteria 5244
262 Ga0495627_015428 3300046453 Bacteria 2637
263 Ga0495627_022893 3300046453 Bacteria 2051
264 Ga0495627_041896 3300046453 Bacteria 1405
265 Ga0495603_0031384 3300046455 Bacteria 3198
266 Ga0495603_0078404 3300046455 Bacteria 1937
267 Ga0495590_0000004 3300046457 Bacteria 402091
268 Ga0495590_0000025 3300046457 Bacteria 165221
269 Ga0495590_0004859 3300046457 Bacteria 5376
270 Ga0495590_0077353 3300046457 Bacteria 1171
271 Ga0495591_002012 3300046458 Bacteria 11829
272 Ga0495591_044772 3300046458 Bacteria 1238
273 Ga0495629_0015303 3300046459 Bacteria 5509
274 Ga0495629_0055623 3300046459 Bacteria 2766
275 Ga0495629_0082754 3300046459 Bacteria 2240
276 Ga0495629_0137233 3300046459 Bacteria 1702
277 Ga0495638_0000366 3300046460 Bacteria 55970
278 Ga0495638_0017461 3300046460 Bacteria 4781
279 Ga0495638_0023339 3300046460 Bacteria 4046
280 Ga0495638_0036727 3300046460 Bacteria 3119
281 Ga0495638_0050570 3300046460 Bacteria 2595
282 Ga0495638_0097987 3300046460 Bacteria 1757
283 Ga0495638_0108410 3300046460 Bacteria 1652
284 Ga0495638_0139516 3300046460 Bacteria 1416
285 Ga0495653_0000037 3300046463 Bacteria 120575
286 Ga0495653_0027529 3300046463 Bacteria 4547
287 Ga0495653_0047088 3300046463 Bacteria 3336
288 Ga0495653_0286312 3300046463 Bacteria 1079
289 Ga0495653_0294829 3300046463 Bacteria 1059
290 Ga0495650_0000124 3300046471 Bacteria 180310
291 Ga0495650_0000169 3300046471 Bacteria 145238
292 Ga0495650_0000177 3300046471 Bacteria 139376
293 Ga0495650_0000817 3300046471 Bacteria 37911
294 Ga0495650_0005858 3300046471 Bacteria 7822
295 Ga0495650_0014418 3300046471 Bacteria 4115
296 Ga0495650_0028456 3300046471 Bacteria 2565
297 Ga0495650_0061752 3300046471 Bacteria 1499
298 Ga0495580_0007578 3300046472 Bacteria 8706
299 Ga0495580_0263109 3300046472 Bacteria 1179
300 Ga0495582_0008500 3300046473 Bacteria 5663
301 Ga0495582_0013806 3300046473 Bacteria 4447
302 Ga0495582_0031184 3300046473 Bacteria 2929
303 Ga0495582_0079049 3300046473 Bacteria 1825
304 Ga0495605_0000003 3300046474 Bacteria 491502
305 Ga0495605_0000293 3300046474 Bacteria 55067
306 Ga0495605_0000717 3300046474 Bacteria 24406
307 Ga0495605_0018951 3300046474 Bacteria 3683
308 Ga0495605_0022435 3300046474 Bacteria 3334
309 Ga0495605_0055775 3300046474 Bacteria 1907
310 Ga0495605_0105105 3300046474 Bacteria 1293
311 Ga0495605_0141422 3300046474 Bacteria 1079
312 Ga0495605_0182994 3300046474 Bacteria 920
313 Ga0495639_0055223 3300046475 Bacteria 1811
314 Ga0495584_0000017 3300046491 Bacteria 149686
315 Ga0495584_0000996 3300046491 Bacteria 17777
316 Ga0495584_0002122 3300046491 Bacteria 11352
317 Ga0495584_0003871 3300046491 Bacteria 8110
318 Ga0495584_0006023 3300046491 Bacteria 6388
319 Ga0495584_0007133 3300046491 Bacteria 5838
320 Ga0495584_0009419 3300046491 Bacteria 5031
321 Ga0495584_0011609 3300046491 Bacteria 4513
322 Ga0495584_0013975 3300046491 Bacteria 4090
323 Ga0495584_0016617 3300046491 Bacteria 3752
324 Ga0495584_0021219 3300046491 Bacteria 3299
325 Ga0495584_0021944 3300046491 Bacteria 3241
326 Ga0495584_0028586 3300046491 Bacteria 2826
327 Ga0495584_0052231 3300046491 Bacteria 2057
328 Ga0495584_0065493 3300046491 Bacteria 1827
329 Ga0495584_0136415 3300046491 Bacteria 1245
330 Ga0495584_0409082 3300046491 Bacteria 689
331 Ga0495585_0000006 3300046492 Bacteria 320556
332 Ga0495585_0000425 3300046492 Bacteria 40655
333 Ga0495585_0001636 3300046492 Bacteria 17134
334 Ga0495585_0001963 3300046492 Bacteria 15324
335 Ga0495585_0004151 3300046492 Bacteria 9473
336 Ga0495585_0004277 3300046492 Bacteria 9297
337 Ga0495585_0005707 3300046492 Bacteria 7809
338 Ga0495585_0013410 3300046492 Bacteria 4797
339 Ga0495585_0014698 3300046492 Bacteria 4553
340 Ga0495585_0017373 3300046492 Bacteria 4155
341 Ga0495585_0018212 3300046492 Bacteria 4052
342 Ga0495585_0036513 3300046492 Bacteria 2770
343 Ga0495585_0041916 3300046492 Bacteria 2566
344 Ga0495585_0042662 3300046492 Bacteria 2539
345 Ga0495585_0049139 3300046492 Bacteria 2343
346 Ga0495585_0063184 3300046492 Bacteria 2032
347 Ga0495585_0079410 3300046492 Bacteria 1779
348 Ga0495585_0082684 3300046492 Bacteria 1738
349 Ga0495585_0117493 3300046492 Bacteria 1409
350 Ga0495594_0012837 3300046499 Bacteria 4368
351 Ga0495594_0043729 3300046499 Bacteria 2455
352 Ga0495594_0084941 3300046499 Bacteria 1770
353 Ga0495594_0090907 3300046499 Bacteria 1710
354 Ga0495594_0117159 3300046499 Bacteria 1504
355 Ga0495594_0298092 3300046499 Bacteria 918
356 Ga0495596_0001127 3300046500 Bacteria 15769
357 Ga0495596_0001627 3300046500 Bacteria 12752
358 Ga0495596_0004826 3300046500 Bacteria 6478
359 Ga0495596_0008781 3300046500 Bacteria 4474
360 Ga0495596_0009392 3300046500 Bacteria 4303
361 Ga0495596_0010585 3300046500 Bacteria 4008
362 Ga0495596_0012162 3300046500 Bacteria 3690
363 Ga0495596_0012515 3300046500 Bacteria 3631
364 Ga0495596_0017481 3300046500 Bacteria 2966
365 Ga0495596_0060880 3300046500 Bacteria 1470
366 Ga0495607_0005031 3300046501 Bacteria 9585
367 Ga0495607_0009609 3300046501 Bacteria 6537
368 Ga0495607_0011316 3300046501 Bacteria 5947
369 Ga0495607_0012165 3300046501 Bacteria 5690
370 Ga0495607_0017602 3300046501 Bacteria 4581
371 Ga0495607_0070734 3300046501 Bacteria 1948
372 Ga0495607_0084408 3300046501 Bacteria 1737
373 Ga0495607_0086642 3300046501 Bacteria 1707
374 Ga0495607_0089094 3300046501 Bacteria 1675
375 Ga0495607_0105988 3300046501 Bacteria 1497
376 Ga0495607_0225989 3300046501 Bacteria 913
377 Ga0495583_0000056 3300046506 Bacteria 200858
378 Ga0495583_0000195 3300046506 Bacteria 101598
379 Ga0495583_0000508 3300046506 Bacteria 55961
380 Ga0495583_0001466 3300046506 Bacteria 23712
381 Ga0495583_0002716 3300046506 Bacteria 14661
382 Ga0495583_0003773 3300046506 Bacteria 11258
383 Ga0495583_0007357 3300046506 Bacteria 6935
384 Ga0495583_0010817 3300046506 Bacteria 5283
385 Ga0495583_0016948 3300046506 Bacteria 3890
386 Ga0495583_0021442 3300046506 Bacteria 3323
387 Ga0495583_0022781 3300046506 Bacteria 3185
388 Ga0495606_0000024 3300046507 Bacteria 262080
389 Ga0495606_0000043 3300046507 Bacteria 214367
390 Ga0495606_0000268 3300046507 Bacteria 91857
391 Ga0495606_0002980 3300046507 Bacteria 18621
392 Ga0495606_0004126 3300046507 Bacteria 14749
393 Ga0495606_0006090 3300046507 Bacteria 11260
394 Ga0495606_0011577 3300046507 Bacteria 7173
395 Ga0495606_0022103 3300046507 Bacteria 4646
396 Ga0495606_0023725 3300046507 Bacteria 4437
397 Ga0495606_0025426 3300046507 Bacteria 4240
398 Ga0495606_0037058 3300046507 Bacteria 3314
399 Ga0495606_0043331 3300046507 Bacteria 3002
400 Ga0495606_0045018 3300046507 Bacteria 2929
401 Ga0495606_0046220 3300046507 Bacteria 2879
402 Ga0495606_0055716 3300046507 Bacteria 2556
403 Ga0495606_0055955 3300046507 Bacteria 2548
404 Ga0495606_0213178 3300046507 Bacteria 1092
405 Ga0495606_0213420 3300046507 Bacteria 1091
406 Ga0495610_0000004 3300046512 Bacteria 1006135
407 Ga0495610_0000688 3300046512 Bacteria 32625
408 Ga0495610_0001096 3300046512 Bacteria 24679
409 Ga0495610_0031088 3300046512 Bacteria 2789
410 Ga0495610_0043018 3300046512 Bacteria 2253
411 Ga0495616_0001644 3300046513 Bacteria 15317
412 Ga0495616_0001999 3300046513 Bacteria 13720
413 Ga0495616_0002635 3300046513 Bacteria 11797
414 Ga0495616_0002826 3300046513 Bacteria 11330
415 Ga0495616_0003400 3300046513 Bacteria 10203
416 Ga0495616_0010927 3300046513 Bacteria 5228
417 Ga0495616_0011036 3300046513 Bacteria 5193
418 Ga0495616_0018869 3300046513 Bacteria 3772
419 Ga0495616_0020152 3300046513 Bacteria 3633
420 Ga0495616_0022819 3300046513 Bacteria 3374
421 Ga0495616_0026346 3300046513 Bacteria 3096
422 Ga0495616_0051953 3300046513 Bacteria 2042
423 Ga0495616_0073339 3300046513 Bacteria 1651
424 Ga0495616_0107033 3300046513 Bacteria 1303
425 Ga0495620_0032708 3300046515 Bacteria 2366
426 Ga0495630_0029626 3300046517 Bacteria 4068
427 Ga0495630_0069729 3300046517 Bacteria 2645
428 Ga0495631_0000378 3300046518 Bacteria 30608
429 Ga0495631_0007497 3300046518 Bacteria 5546
430 Ga0495631_0009016 3300046518 Bacteria 4999
431 Ga0495631_0019405 3300046518 Bacteria 3188
432 Ga0495631_0022077 3300046518 Bacteria 2959
433 Ga0495631_0077462 3300046518 Bacteria 1435
434 Ga0495631_0081212 3300046518 Bacteria 1399
435 Ga0495631_0092534 3300046518 Bacteria 1301
436 Ga0495631_0150335 3300046518 Bacteria 999
437 Ga0495631_0188712 3300046518 Bacteria 882
438 Ga0495632_0002064 3300046519 Bacteria 15767
439 Ga0495632_0003086 3300046519 Bacteria 12087
440 Ga0495632_0003136 3300046519 Bacteria 11952
441 Ga0495632_0016891 3300046519 Bacteria 4045
442 Ga0495632_0025606 3300046519 Bacteria 3118
443 Ga0495637_0000019 3300046520 Bacteria 185953
444 Ga0495637_0002406 3300046520 Bacteria 10356
445 Ga0495637_0004798 3300046520 Bacteria 6975
446 Ga0495637_0008681 3300046520 Bacteria 4985
447 Ga0495637_0019830 3300046520 Bacteria 3102
448 Ga0495637_0026565 3300046520 Bacteria 2596
449 Ga0495643_0000182 3300046522 Bacteria 100196
450 Ga0495643_0000425 3300046522 Bacteria 54854
451 Ga0495643_0002040 3300046522 Bacteria 16783
452 Ga0495643_0009259 3300046522 Bacteria 6137
453 Ga0495643_0019442 3300046522 Bacteria 3929
454 Ga0495643_0114713 3300046522 Bacteria 1366
455 Ga0495643_0158441 3300046522 Bacteria 1115
456 Ga0495643_0166761 3300046522 Bacteria 1079
457 Ga0495644_0008943 3300046523 Bacteria 3850
458 Ga0495644_0013584 3300046523 Bacteria 3123
459 Ga0495644_0017551 3300046523 Bacteria 2735
460 Ga0495644_0030180 3300046523 Bacteria 2047
461 Ga0495644_0030231 3300046523 Bacteria 2046
462 Ga0495644_0032760 3300046523 Bacteria 1963
463 Ga0495648_0000007 3300046524 Bacteria 347305
464 Ga0495648_0000045 3300046524 Bacteria 172587
465 Ga0495648_0003804 3300046524 Bacteria 13113
466 Ga0495648_0006049 3300046524 Bacteria 9928
467 Ga0495648_0007904 3300046524 Bacteria 8445
468 Ga0495648_0028790 3300046524 Bacteria 3695
469 Ga0495648_0030316 3300046524 Bacteria 3578
470 Ga0495648_0032791 3300046524 Bacteria 3402
471 Ga0495648_0050440 3300046524 Bacteria 2542
472 Ga0495648_0051782 3300046524 Bacteria 2498
473 Ga0495648_0063983 3300046524 Bacteria 2169
474 Ga0495648_0088980 3300046524 Bacteria 1734
475 Ga0495648_0100901 3300046524 Bacteria 1593
476 Ga0495663_0009880 3300046525 Bacteria 2649
477 Ga0495663_0022008 3300046525 Bacteria 1839
478 Ga0495663_0058463 3300046525 Bacteria 1208
479 Ga0495666_0001537 3300046526 Bacteria 11323
480 Ga0495666_0016839 3300046526 Bacteria 3639
481 Ga0495666_0017370 3300046526 Bacteria 3583
482 Ga0495666_0021636 3300046526 Bacteria 3184
483 Ga0495666_0023207 3300046526 Bacteria 3068
484 Ga0495666_0041794 3300046526 Bacteria 2219
485 Ga0495642_0001065 3300046528 Bacteria 12701
486 Ga0495642_0001266 3300046528 Bacteria 11467
487 Ga0495642_0001585 3300046528 Bacteria 9960
488 Ga0495642_0001979 3300046528 Bacteria 8596
489 Ga0495642_0005730 3300046528 Bacteria 4765
490 Ga0495642_0034193 3300046528 Bacteria 2046
491 Ga0495642_0055418 3300046528 Bacteria 1636
492 Ga0495642_0059816 3300046528 Bacteria 1579
493 Ga0495642_0188771 3300046528 Bacteria 898
494 Ga0495642_0217219 3300046528 Bacteria 834
495 Ga0495652_0077703 3300046529 Bacteria 2750
496 Ga0495652_0109961 3300046529 Bacteria 2218
497 Ga0495654_0000004 3300046530 Bacteria 515304
498 Ga0495654_0023167 3300046530 Bacteria 3217
499 Ga0495654_0061168 3300046530 Bacteria 1809
500 Ga0495665_0008344 3300046531 Bacteria 5617
501 Ga0495665_0030022 3300046531 Bacteria 2909
502 Ga0495665_0075946 3300046531 Bacteria 1768
503 Ga0495665_0087256 3300046531 Bacteria 1639
504 Ga0495640_0046521 3300046533 Bacteria 3006
505 Ga0495586_0005600 3300046535 Bacteria 6722
506 Ga0495586_0037863 3300046535 Bacteria 2589
507 Ga0495586_0129445 3300046535 Bacteria 1413
508 Ga0495587_0089354 3300046536 Bacteria 1780
509 Ga0495587_0270243 3300046536 Bacteria 954
510 Ga0495609_0000002 3300046538 Bacteria 739816
511 Ga0495609_0003408 3300046538 Bacteria 9119
512 Ga0495609_0003793 3300046538 Bacteria 8509
513 Ga0495609_0010274 3300046538 Bacteria 4497
514 Ga0495609_0010957 3300046538 Bacteria 4331
515 Ga0495609_0012173 3300046538 Bacteria 4080
516 Ga0495609_0019527 3300046538 Bacteria 3134
517 Ga0495609_0020523 3300046538 Bacteria 3052
518 Ga0495609_0029810 3300046538 Bacteria 2483
519 Ga0495609_0046284 3300046538 Bacteria 1948
520 Ga0495621_0002326 3300046539 Bacteria 5101
521 Ga0495597_0001284 3300046542 Bacteria 18462
522 Ga0495597_0002599 3300046542 Bacteria 11264
523 Ga0495597_0004149 3300046542 Bacteria 8041
524 Ga0495597_0004160 3300046542 Bacteria 8027
525 Ga0495597_0018336 3300046542 Bacteria 3285
526 Ga0495597_0019643 3300046542 Bacteria 3158
527 Ga0495597_0036670 3300046542 Bacteria 2206
528 Ga0495597_0075559 3300046542 Bacteria 1446
529 Ga0495622_0000003 3300046557 Bacteria 268681
530 Ga0495622_0000780 3300046557 Bacteria 17715
531 Ga0495622_0006320 3300046557 Bacteria 5500
532 Ga0495622_0018067 3300046557 Bacteria 3284
533 Ga0495633_0000356 3300046558 Bacteria 49639
534 Ga0495633_0000522 3300046558 Bacteria 38445
535 Ga0495633_0001186 3300046558 Bacteria 20926
536 Ga0495633_0007624 3300046558 Bacteria 6195
537 Ga0495633_0009485 3300046558 Bacteria 5371
538 Ga0495633_0011434 3300046558 Bacteria 4786
539 Ga0495633_0014652 3300046558 Bacteria 4089
540 Ga0495633_0021067 3300046558 Bacteria 3265
541 Ga0495633_0021273 3300046558 Bacteria 3246
542 Ga0495633_0023039 3300046558 Bacteria 3088
543 Ga0495633_0024493 3300046558 Bacteria 2982
544 Ga0495633_0026633 3300046558 Bacteria 2835
545 Ga0495633_0041414 3300046558 Bacteria 2190
546 Ga0495633_0131871 3300046558 Bacteria 1156
547 Ga0495633_0148274 3300046558 Bacteria 1084
548 Ga0495667_0044762 3300046559 Bacteria 2931
549 Ga0495656_0014511 3300046615 Bacteria 2956
550 Ga0495656_0021111 3300046615 Bacteria 2532
551 Ga0495656_0079476 3300046615 Bacteria 1476
552 Ga0495656_0171390 3300046615 Bacteria 1061
553 Ga0495656_0208379 3300046615 Bacteria 973
554 Ga0495668_0000126 3300046616 Bacteria 114185
555 Ga0495668_0000764 3300046616 Bacteria 37666
556 Ga0495668_0000998 3300046616 Bacteria 30582
557 Ga0495668_0003229 3300046616 Bacteria 12434
558 Ga0495668_0003576 3300046616 Bacteria 11537
559 Ga0495668_0004008 3300046616 Bacteria 10724
560 Ga0495668_0007175 3300046616 Bacteria 7163
561 Ga0495668_0011019 3300046616 Bacteria 5437
562 Ga0495668_0011314 3300046616 Bacteria 5352
563 Ga0495668_0025440 3300046616 Bacteria 3363
564 Ga0495668_0030197 3300046616 Bacteria 3061
565 Ga0495668_0036280 3300046616 Bacteria 2762
566 Ga0495668_0070030 3300046616 Bacteria 1928
567 Ga0495668_0070141 3300046616 Bacteria 1926
568 Ga0495668_0098374 3300046616 Bacteria 1601
569 Ga0495634_0027074 3300046642 Bacteria 3993
570 Ga0495611_0001415 3300046648 Bacteria 11968
571 Ga0495611_0001975 3300046648 Bacteria 9728
572 Ga0495611_0011264 3300046648 Bacteria 3791
573 Ga0495611_0045316 3300046648 Bacteria 1969
574 Ga0495611_0073264 3300046648 Bacteria 1567
575 Ga0495611_0076785 3300046648 Bacteria 1531
576 Ga0495611_0115343 3300046648 Bacteria 1251
577 Ga0495625_0001394 3300046660 Bacteria 29641
578 Ga0495625_0002147 3300046660 Bacteria 21938
579 Ga0495625_0002594 3300046660 Bacteria 19346
580 Ga0495625_0003216 3300046660 Bacteria 16563
581 Ga0495625_0011222 3300046660 Bacteria 7325
582 Ga0495625_0021838 3300046660 Bacteria 4916
583 Ga0495625_0050910 3300046660 Bacteria 2970
584 Ga0495625_0058574 3300046660 Bacteria 2737
585 Ga0495625_0068006 3300046660 Bacteria 2504
586 Ga0495625_0181307 3300046660 Bacteria 1400
587 Ga0495625_0439909 3300046660 Bacteria 807
588 Ga0495635_0009799 3300046663 Bacteria 6697
589 Ga0495635_0467613 3300046663 Bacteria 832
590 Ga0495659_0000124 3300046664 Bacteria 33876
591 Ga0495659_0003381 3300046664 Bacteria 5110
592 Ga0495659_0092444 3300046664 Bacteria 1163
593 Ga0495661_0002730 3300046665 Bacteria 13435
594 Ga0495661_0002951 3300046665 Bacteria 12848
595 Ga0495661_0003461 3300046665 Bacteria 11653
596 Ga0495661_0004001 3300046665 Bacteria 10745
597 Ga0495661_0008554 3300046665 Bacteria 7074
598 Ga0495661_0014772 3300046665 Bacteria 5226
599 Ga0495661_0021525 3300046665 Bacteria 4203
600 Ga0495661_0034652 3300046665 Bacteria 3174
601 Ga0495661_0037804 3300046665 Bacteria 3011
602 Ga0495661_0056091 3300046665 Bacteria 2358
603 Ga0495661_0071336 3300046665 Bacteria 2030
604 Ga0495661_0072470 3300046665 Bacteria 2009
605 Ga0495661_0092399 3300046665 Bacteria 1719
606 Ga0495661_0105148 3300046665 Bacteria 1581
607 Ga0495661_0152517 3300046665 Bacteria 1247
608 Ga0495588_0000127 3300046674 Bacteria 125854
609 Ga0495588_0003809 3300046674 Bacteria 6606
610 Ga0495588_0010058 3300046674 Bacteria 4385
611 Ga0495588_0030834 3300046674 Bacteria 2696
612 Ga0495588_0043775 3300046674 Bacteria 2291
613 Ga0495588_0145278 3300046674 Bacteria 1253
614 Ga0495623_0030020 3300046679 Bacteria 3499
615 Ga0495623_0045319 3300046679 Bacteria 2793
616 Ga0495646_0153861 3300046680 Bacteria 1277
617 Ga0495669_0001026 3300046684 Bacteria 11641
618 Ga0495669_0009035 3300046684 Bacteria 4199
619 Ga0495669_0014091 3300046684 Bacteria 3416
620 Ga0495669_0025720 3300046684 Bacteria 2568
621 Ga0495613_0023586 3300046689 Bacteria 4585
622 Ga0495613_0124182 3300046689 Bacteria 1852
623 Ga0495613_0144691 3300046689 Bacteria 1697
624 Ga0495624_0012355 3300046690 Bacteria 5840
625 Ga0495624_0237276 3300046690 Bacteria 1104
626 Ga0495670_0000883 3300046691 Bacteria 14534
627 Ga0495670_0001258 3300046691 Bacteria 12388
628 Ga0495670_0006735 3300046691 Bacteria 5652
629 Ga0495670_0009988 3300046691 Bacteria 4667
630 Ga0495670_0015716 3300046691 Bacteria 3721
631 Ga0495670_0025089 3300046691 Bacteria 2948
632 Ga0495670_0034583 3300046691 Bacteria 2517
633 Ga0495670_0065429 3300046691 Bacteria 1832
634 Ga0495670_0078386 3300046691 Bacteria 1680
635 Ga0495670_0097598 3300046691 Bacteria 1510
636 Ga0495670_0136401 3300046691 Bacteria 1281
637 Ga0495670_0159242 3300046691 Bacteria 1185
638 Ga0495670_0224590 3300046691 Bacteria 998
639 Ga0495671_0000001 3300046692 Bacteria 1169494
640 Ga0495671_0001026 3300046692 Bacteria 19429
641 Ga0495671_0002227 3300046692 Bacteria 12333
642 Ga0495671_0002525 3300046692 Bacteria 11502
643 Ga0495671_0009809 3300046692 Bacteria 5333
644 Ga0495671_0104468 3300046692 Bacteria 1383
645 Ga0495671_0234480 3300046692 Bacteria 887
646 Ga0495649_0002201 3300046694 Bacteria 13922
647 Ga0495649_0003656 3300046694 Bacteria 10260
648 Ga0495649_0033852 3300046694 Bacteria 2812
649 Ga0495649_0036416 3300046694 Bacteria 2703
650 Ga0495649_0046314 3300046694 Bacteria 2368
651 Ga0495649_0049449 3300046694 Bacteria 2284
652 Ga0495649_0122820 3300046694 Bacteria 1372
653 Ga0495589_0000083 3300046794 Bacteria 87058
654 Ga0495589_0000357 3300046794 Bacteria 35496
655 Ga0495589_0001877 3300046794 Bacteria 11902
656 Ga0495589_0010868 3300046794 Bacteria 4731
657 Ga0495589_0011320 3300046794 Bacteria 4630
658 Ga0495589_0012582 3300046794 Bacteria 4378
659 Ga0495589_0013474 3300046794 Bacteria 4217
660 Ga0495589_0027374 3300046794 Bacteria 2882
661 Ga0495589_0131917 3300046794 Bacteria 1199
662 Ga0495600_0049259 3300046809 Bacteria 2749
663 Ga0495600_0300983 3300046809 Bacteria 1012
664 Ga0495660_0001996 3300046810 Bacteria 13266
665 Ga0495660_0003082 3300046810 Bacteria 10391
666 Ga0495660_0006718 3300046810 Bacteria 6795
667 Ga0495660_0008032 3300046810 Bacteria 6199
668 Ga0495660_0023130 3300046810 Bacteria 3547
669 Ga0495660_0025157 3300046810 Bacteria 3383
670 Ga0495660_0039985 3300046810 Bacteria 2601
671 Ga0495660_0048319 3300046810 Bacteria 2327
672 Ga0495660_0054317 3300046810 Bacteria 2170
673 Ga0495660_0092810 3300046810 Bacteria 1566
674 Ga0495660_0103271 3300046810 Bacteria 1464
675 Ga0495660_0188033 3300046810 Bacteria 994
676 Ga0495581_0006427 3300047315 Bacteria 6819
677 Ga0495581_0006784 3300047315 Bacteria 6637
678 Ga0495581_0153711 3300047315 Bacteria 1344
679 Ga0495604_0007527 3300047317 Bacteria 8616
680 Ga0495604_0014924 3300047317 Bacteria 6197
681 Ga0495604_0064409 3300047317 Bacteria 2793
682 Ga0495604_0107490 3300047317 Bacteria 2039
683 Ga0495636_0000259 3300047318 Bacteria 20836
684 Ga0495636_0021460 3300047318 Bacteria 2607
685 Ga0495636_0033986 3300047318 Bacteria 2097
686 Ga0495674_0012700 3300047319 Bacteria 7937
687 Ga0495674_0218870 3300047319 Bacteria 1575
688 Ga0495674_0237711 3300047319 Bacteria 1502
689 Ga0495672_0000041 3300047320 Bacteria 267545
690 Ga0495672_0000045 3300047320 Bacteria 255145
691 Ga0495672_0000050 3300047320 Bacteria 240336
692 Ga0495672_0000154 3300047320 Bacteria 100095
693 Ga0495672_0002883 3300047320 Bacteria 15219
694 Ga0495672_0003045 3300047320 Bacteria 14705
695 Ga0495672_0022757 3300047320 Bacteria 4067
696 Ga0495672_0028909 3300047320 Bacteria 3499
697 Ga0495672_0071242 3300047320 Bacteria 1967
698 Ga0495672_0172082 3300047320 Bacteria 1104
699 Ga0495676_0005037 3300047321 Bacteria 12118
700 Ga0495676_0038880 3300047321 Bacteria 3947
701 Ga0495676_0093787 3300047321 Bacteria 2238
702 Ga0495676_0198689 3300047321 Bacteria 1394
703 Ga0495680_0005811 3300047322 Bacteria 11549
704 Ga0495680_0041713 3300047322 Bacteria 3647
705 Ga0495683_0000543 3300047323 Bacteria 28655
706 Ga0495683_0004058 3300047323 Bacteria 8394
707 Ga0495683_0018235 3300047323 Bacteria 3630
708 Ga0495683_0027097 3300047323 Bacteria 2931
709 Ga0495683_0050618 3300047323 Bacteria 2078
710 Ga0495683_0119381 3300047323 Bacteria 1252
711 Ga0495687_000075 3300047443 Bacteria 152218
712 Ga0495687_000197 3300047443 Bacteria 86694
713 Ga0495687_001959 3300047443 Bacteria 17586
714 Ga0495687_002919 3300047443 Bacteria 13003
715 Ga0495687_003090 3300047443 Bacteria 12468
716 Ga0495687_005664 3300047443 Bacteria 7887
717 Ga0495687_007400 3300047443 Bacteria 6470
718 Ga0495687_008367 3300047443 Bacteria 5927
719 Ga0495687_012700 3300047443 Bacteria 4440
720 Ga0495687_013310 3300047443 Bacteria 4305
721 Ga0495687_033648 3300047443 Bacteria 2322
722 Ga0495675_0039633 3300047444 Bacteria 3000
723 Ga0495675_0046613 3300047444 Bacteria 2759
724 Ga0495677_0000030 3300047445 Bacteria 87817
725 Ga0495677_0001988 3300047445 Bacteria 8158
726 Ga0495677_0005111 3300047445 Bacteria 4996
727 Ga0495677_0005224 3300047445 Bacteria 4938
728 Ga0495677_0005767 3300047445 Bacteria 4690
729 Ga0495677_0025202 3300047445 Bacteria 2157
730 Ga0495677_0025717 3300047445 Bacteria 2135
731 Ga0495677_0026302 3300047445 Bacteria 2111
732 Ga0495677_0046078 3300047445 Bacteria 1600
733 Ga0495677_0059581 3300047445 Bacteria 1414
734 Ga0495677_0168633 3300047445 Bacteria 846
735 Ga0495679_012148 3300047446 Bacteria 3289
736 Ga0495679_023324 3300047446 Bacteria 2100
737 Ga0495679_024649 3300047446 Bacteria 2024
738 Ga0495679_025680 3300047446 Bacteria 1966
739 Ga0495679_029191 3300047446 Bacteria 1801
740 Ga0495685_000013 3300047447 Bacteria 79924
741 Ga0495685_001489 3300047447 Bacteria 7168
742 Ga0495685_010772 3300047447 Bacteria 3073
743 Ga0495685_026508 3300047447 Bacteria 1994
744 Ga0495673_0000006 3300047469 Bacteria 908691
745 Ga0495673_0000014 3300047469 Bacteria 599202
746 Ga0495673_0000017 3300047469 Bacteria 574970
747 Ga0495673_0015548 3300047469 Bacteria 3918
748 Ga0495673_0035495 3300047469 Bacteria 2296
749 Ga0495681_0002458 3300047470 Bacteria 13219
750 Ga0495681_0003565 3300047470 Bacteria 10831
751 Ga0495681_0003787 3300047470 Bacteria 10479
752 Ga0495681_0015439 3300047470 Bacteria 4320
753 Ga0495681_0018815 3300047470 Bacteria 3791
754 Ga0495681_0030917 3300047470 Bacteria 2719
755 Ga0495681_0036835 3300047470 Bacteria 2416
756 Ga0495681_0051271 3300047470 Bacteria 1941
757 Ga0495681_0070317 3300047470 Bacteria 1587
758 Ga0495686_0001793 3300047472 Bacteria 21777
759 Ga0495686_0003258 3300047472 Bacteria 14238
760 Ga0495686_0003588 3300047472 Bacteria 13323
761 Ga0495686_0040576 3300047472 Bacteria 2967
762 Ga0495686_0098352 3300047472 Bacteria 1768
763 Ga0495593_0011645 3300047673 Bacteria 5047
764 Ga0495593_0013788 3300047673 Bacteria 4604
765 Ga0495593_0020117 3300047673 Bacteria 3737
766 Ga0495593_0077905 3300047673 Bacteria 1717
767 Ga0495593_0256500 3300047673 Bacteria 875
768 Ga0495602_0025033 3300048088 Bacteria 5783
769 Ga0495602_0065726 3300048088 Bacteria 3129
770 Ga0495614_0012430 3300048089 Bacteria 3736
771 Ga0495614_0022084 3300048089 Bacteria 2747
772 Ga0495615_0002717 3300048090 Bacteria 2869
773 Ga0495626_0000102 3300048091 Bacteria 110315
774 Ga0495626_0000390 3300048091 Bacteria 45358
775 Ga0495626_0002136 3300048091 Bacteria 14309
776 Ga0495626_0003929 3300048091 Bacteria 9303
777 Ga0495626_0004107 3300048091 Bacteria 9050
778 Ga0495626_0008712 3300048091 Bacteria 5527
779 Ga0495626_0009990 3300048091 Bacteria 5096
780 Ga0495626_0029934 3300048091 Bacteria 2628
781 Ga0495626_0032022 3300048091 Bacteria 2527
782 Ga0495626_0044418 3300048091 Bacteria 2079
783 Ga0495626_0047765 3300048091 Bacteria 1989
784 Ga0495626_0047817 3300048091 Bacteria 1987
785 Ga0496100_0031921 3300048903 Bacteria 3278
786 Ga0496102_0000088 3300048905 Bacteria 129762
787 Ga0496102_0003622 3300048905 Bacteria 13072
788 Ga0496102_0062888 3300048905 Bacteria 3398
789 Ga0496102_0179897 3300048905 Bacteria 1992
790 Ga0496102_0193748 3300048905 Bacteria 1915
791 Ga0496102_0221849 3300048905 Bacteria 1782
792 Ga0496102_0322625 3300048905 Bacteria 1455
793 Ga0496103_0016343 3300048906 Bacteria 4428
794 Ga0496103_0018031 3300048906 Bacteria 4230
795 Ga0496103_0021699 3300048906 Bacteria 3864
796 Ga0496103_0050879 3300048906 Bacteria 2564
797 Ga0496103_0073352 3300048906 Bacteria 2144
798 Ga0496104_0062217 3300048907 Bacteria 3539
799 Ga0496104_0255763 3300048907 Bacteria 1664
800 Ga0496104_0319465 3300048907 Bacteria 1466
801 Ga0496105_0056845 3300048908 Bacteria 3230
802 Ga0496106_0036731 3300048909 Bacteria 3664
803 Ga0496107_0038161 3300048910 Bacteria 3447
804 Ga0496107_0047231 3300048910 Bacteria 3101
805 Ga0496107_0162017 3300048910 Bacteria 1658
806 Ga0496108_0083016 3300048911 Bacteria 2717
807 Ga0496109_0353461 3300048912 Bacteria 1388
808 Ga0496109_0357428 3300048912 Bacteria 1380
809 Ga0496110_0003394 3300048913 Bacteria 12175
810 Ga0496110_0715793 3300048913 Bacteria 903
811 Ga0496111_0015848 3300048914 Bacteria 5183
812 Ga0496113_0003066 3300048916 Bacteria 9912
813 Ga0496114_0053880 3300048917 Bacteria 3353
814 Ga0496114_0099595 3300048917 Bacteria 2479
815 Ga0496114_0201814 3300048917 Bacteria 1742
816 Ga0496115_0038148 3300048918 Bacteria 3811
817 Ga0496115_0051773 3300048918 Bacteria 3292
818 Ga0496115_0087415 3300048918 Bacteria 2543
819 Ga0496115_0352124 3300048918 Bacteria 1201
820 Ga0496116_0025207 3300048919 Bacteria 4376
821 Ga0496116_0078348 3300048919 Bacteria 2061
822 Ga0496116_0083351 3300048919 Bacteria 1974
823 Ga0496117_0000001 3300048920 Bacteria 2526244
824 Ga0496118_0000008 3300048921 Bacteria 644537
825 Ga0496120_0050826 3300048923 Bacteria 2371
826 Ga0496121_0034456 3300048924 Bacteria 4557
827 Ga0496121_0126052 3300048924 Bacteria 1924
828 Ga0496122_0000988 3300048925 Bacteria 50798
829 Ga0496122_0001677 3300048925 Bacteria 34347
830 Ga0496122_0025607 3300048925 Bacteria 5117
831 Ga0496122_0040842 3300048925 Bacteria 3679
832 Ga0496123_0000826 3300048926 Bacteria 49740
833 Ga0496123_0005439 3300048926 Bacteria 12825
834 Ga0496123_0005693 3300048926 Bacteria 12424
835 Ga0496123_0007548 3300048926 Bacteria 10194
836 Ga0496123_0007757 3300048926 Bacteria 10017
837 Ga0496123_0128019 3300048926 Bacteria 1413
838 Ga0496123_0227930 3300048926 Bacteria 935
839 Ga0496124_0008442 3300048927 Bacteria 10773
840 Ga0496124_0010180 3300048927 Bacteria 9563
841 Ga0496124_0037700 3300048927 Bacteria 4202
842 Ga0496124_0069464 3300048927 Bacteria 2925
843 Ga0496124_0136723 3300048927 Bacteria 1939
844 Ga0496124_0144157 3300048927 Bacteria 1876
845 Ga0496124_0171418 3300048927 Bacteria 1680
846 Ga0496125_0003401 3300048928 Bacteria 19355
847 Ga0496125_0004085 3300048928 Bacteria 17079
848 Ga0496125_0006646 3300048928 Bacteria 12445
849 Ga0496125_0073910 3300048928 Bacteria 2646
850 Ga0496126_0002274 3300048929 Bacteria 26481
851 Ga0496126_0169092 3300048929 Bacteria 1864
852 Ga0495678_000042 3300049459 Bacteria 174125
853 Ga0495678_000070 3300049459 Bacteria 131437
854 Ga0495678_000851 3300049459 Bacteria 27256
855 Ga0495678_002833 3300049459 Bacteria 11234
856 Ga0495678_002880 3300049459 Bacteria 11100
857 Ga0495678_003410 3300049459 Bacteria 9864
858 Ga0495678_028617 3300049459 Bacteria 2349
859 Ga0495678_122048 3300049459 Bacteria 873
860 Ga0495682_0001441 3300049460 Bacteria 12849
861 Ga0495682_0006752 3300049460 Bacteria 4627
862 Ga0495682_0010090 3300049460 Bacteria 3666
863 Ga0495682_0013523 3300049460 Bacteria 3104
864 Ga0495682_0014095 3300049460 Bacteria 3034
865 Ga0501230_011176 3300049667 Bacteria 1416
866 Ga0501238_007977 3300049671 Bacteria 1384
867 Ga0501249_001735 3300049679 Bacteria 4449
868 Ga0501269_000732 3300049766 Bacteria 5337
869 Ga0501279_008801 3300049775 Bacteria 1350
870 Ga0501279_018766 3300049775 Bacteria 976
871 Ga0501035_0024452 3300049822 Bacteria 5539
872 nmdc:mga03n38_72589_c1 3300050490 Bacteria 1596
873 Ga0500594_0008077 3300053118 Bacteria 2392
874 Ga0500618_000162 3300053125 Bacteria 55775
875 Ga0500618_008740 3300053125 Bacteria 2803
876 Ga0500586_000147 3300053145 Bacteria 12828
877 Ga0500586_005639 3300053145 Bacteria 3185
878 Ga0587082_009097 3300059504 Bacteria 1401
879 2511247980 2511231003 Bacteria 5606035
880 2511384578 2511231026 Bacteria 5225445
881 2521556982 2521172590 Bacteria 5047645
882 2524610540 2524023250 Bacteria 5457705
883 2550693390 2548876994 Bacteria 4904866
884 2553004783 2551306416 Bacteria 6152985
885 2601671035 2600255292 Bacteria 6300551
886 2643788412 2643221554 Bacteria 6603920
887 2643798044 2643221556 Bacteria 7251154
888 2644026916 2643221603 Bacteria 6147767
889 2644213662 2643221638 Bacteria 6579467
890 2644253783 2643221645 Bacteria 7207331
891 2644356564 2643221664 Bacteria 7272945
892 2644473222 2643221684 Bacteria 7145183
893 2738738809 2738541280 Bacteria 6630198
894 2738825201 2738541297 Bacteria 6549566
895 2738844699 2738541300 Bacteria 6675882
896 2739148998 2738541357 Bacteria 6549408
897 2739190917 2738543003 Bacteria 6549560
898 2739276224 2738543018 Bacteria 6718814
899 2739317394 2738543026 Bacteria 6549408
900 2739335635 2738543029 Bacteria 6549249
901 2739345252 2738543030 Bacteria 6719714
902 2765568164 2765235838 Bacteria 5445269
903 2808983600 2808606386 Bacteria 4471946
904 2809129264 2808606415 Bacteria 4576710
905 2809144526 2808606418 Bacteria 6724496
906 2809149681 2808606419 Bacteria 4576925
907 2819594961 2818991445 Bacteria 4955017
908 2819616830 2818991449 Bacteria 5518009
909 2821133794 2821131069 Bacteria 6108407
910 2839097541 2839094727 Bacteria 5534556
911 2842716747 2842711865 Bacteria 7155354
912 2852619834 2852618963 Bacteria 4577824
913 2857547807 2857547612 Bacteria 6179999
914 2857553903 2857553236 Bacteria 6166726
915 2857560309 2857558681 Bacteria 6617694
916 2857565586 2857564685 Bacteria 6290584
917 2884814111 2884811622 Bacteria 5552861
918 2884836655 2884836552 Bacteria 5219991
919 2884852948 2884852848 Bacteria 5221161
920 2896155936 2896154374 Bacteria 5221518
921 2904430654 2904424332 Bacteria 7633521
922 2904440309 2904439833 Bacteria 5931679
923 2904530777 2904530477 Bacteria 5876334
924 2904585808 2904584206 Bacteria 6028872
925 2904592379 2904589729 Bacteria 6113573
926 2904601488 2904601388 Bacteria 5884906
927 2919049795 2919046199 Bacteria 5567169
928 2919082862 2919079590 Bacteria 5946433
929 2919480519 2919476304 Bacteria 5888696
930 2923515616 2923510766 Bacteria 5926163
931 2928134520 2928130867 Bacteria 5467269
932 8047678052 8047673197 Bacteria 7395230
933 Ga0495660_0019720
934 JGI25155J39150_1000145
935 JGI25155J39150_1000235
936 JGI25156J39149_1000290
937 JGI25156J39149_1005361
938 JGI25154J39366_1000265
939 JGI25154J39366_1000422
940 JGI25154J39366_1004266
941 JGI25158J39367_1012821
942 JGI25157J39369_1000186
943 JGI25152J39213_1000522
944 JGI25150J39212_1001085
945 JGI25150J39212_1001168
946 JGI25150J39212_1001539
947 JGI25159J45721_1013961
948 JGI25159J45721_1020762
949 JGI25151J46595_10041231
950 JGI25153J46596_10011966
951 rootL2_10025195
952 rootL2_10047912
953 rootL2_10050900
954 JGI25161J50226_1000765
955 JGI25161J50226_1003266
956 Ga0007417J51691_1037979
957 Ga0007409J51694_1101127
958 Ga0055538_1000008
959 Ga0055539_1000012
960 Ga0055533_1000015
961 Ga0055532_1000077
962 Ga0055525_1000009
963 Ga0055525_1000017
964 Ga0055542_1008906
965 Ga0055529_1000166
966 Ga0055526_1000020
967 Ga0055526_1000031
968 Ga0055526_1013214
969 Ga0055526_1050757
970 Ga0055537_1003068
971 Ga0055524_1000015
972 Ga0055524_1001394
973 Ga0055534_1010859
974 Ga0055530_10010273
975 Ga0055530_10012515
976 Ga0055541_1000009
977 Ga0055543_1000896
978 Ga0065165_1002937
979 Ga0065165_1008414
980 Ga0070658_10198453
981 Ga0070658_10350199
982 Ga0070670_100084758
983 Ga0070670_100195283
984 Ga0070680_100314907
985 Ga0070660_100137617
986 Ga0070661_100057532
987 Ga0070661_100254229
988 Ga0070659_100032348
989 Ga0068853_100529555
990 Ga0068855_100000175
991 Ga0068855_100043396
992 Ga0068855_100569380
993 Ga0070664_100241530
994 Ga0068854_100186254
995 Ga0068856_100348653
996 Ga0068852_100006257
997 Ga0068852_100063685
998 Ga0075363_100086922
999 Ga0068871_100176706
1000 Ga0079104_1012129
1001 Ga0099826_10000003
1002 Ga0105244_10002015
1003 Ga0105244_10025306
1004 Ga0105244_10057492
1005 Ga0105244_10102057
1006 Ga0105240_10029943
1007 Ga0105240_10068329
1008 Ga0105240_10142117
1009 Ga0105245_10133899
1010 Ga0105243_10079915
1011 Ga0105241_10022159
1012 Ga0105242_10099896
1013 Ga0105242_10465082
1014 Ga0105238_10000111
1015 Ga0105238_10030799
1016 Ga0105239_10013354
1017 Ga0157373_10142503
1018 Ga0157371_10000001
1019 Ga0157374_10462305
1020 Ga0182008_10002625
1021 Ga0182006_1000014
1022 Ga0182006_1001932
1023 Ga0182006_1037827
1024 Ga0182007_10000011
1025 Ga0182005_1000014
1026 Ga0182005_1000018
1027 Ga0163161_10034197
1028 Ga0163161_10046068
1029 Ga0213872_10000002
1030 Ga0213872_10000868
1031 Ga0213872_10031932
1032 Ga0213872_10063169
1033 Ga0209435_100048
1034 Ga0209435_100655
1035 Ga0209436_100266
1036 Ga0209436_108447
1037 Ga0209784_100005
1038 Ga0209566_100005
1039 Ga0209674_100009
1040 Ga0209147_100122
1041 Ga0209563_100012
1042 Ga0209563_100015
1043 Ga0209437_100081
1044 Ga0209258_100230
1045 Ga0207425_1000001
1046 Ga0207425_1000256
1047 Ga0207425_1000362
1048 Ga0209646_1000028
1049 Ga0209646_1000130
1050 Ga0209646_1000152
1051 Ga0209026_1000126
1052 Ga0209677_100006
1053 Ga0209148_1000727
1054 Ga0209759_1000193
1055 Ga0209759_1000509
1056 Ga0209129_1000093
1057 Ga0209565_1004105
1058 Ga0209565_1012013
1059 Ga0209565_1014868
1060 Ga0209565_1020304
1061 Ga0209455_1000049
1062 Ga0209455_1001546
1063 Ga0209130_1001139
1064 Ga0209130_1001693
1065 Ga0209675_1013453
1066 Ga0209675_1018523
1067 Ga0209675_1037188
1068 Ga0209025_1002442
1069 Ga0209564_1000006
1070 Ga0209564_1000038
1071 Ga0209564_1000134
1072 Ga0209564_1002238
1073 Ga0209758_1000055
1074 Ga0209758_1001248
1075 Ga0209050_1000085
1076 Ga0209050_1000092
1077 Ga0209256_1000005
1078 Ga0209256_1001714
1079 Ga0209256_1003252
1080 Ga0209256_1036568
1081 Ga0207426_1007690
1082 Ga0209051_1019016
1083 Ga0209257_1000010
1084 Ga0207655_1015696
1085 Ga0207655_1018407
1086 Ga0207705_10232947
1087 Ga0207695_10001512
1088 Ga0207695_10019273
1089 Ga0207695_10058955
1090 Ga0207695_10300398
1091 Ga0207671_10016832
1092 Ga0207671_10342602
1093 Ga0207657_10029684
1094 Ga0207657_10158041
1095 Ga0207694_10000413
1096 Ga0207650_10165058
1097 Ga0207687_10213222
1098 Ga0207690_10078377
1099 Ga0207706_10105266
1100 Ga0207667_10000028
1101 Ga0207667_10021117
1102 Ga0207667_10205389
1103 Ga0207640_10055076
1104 Ga0207640_10403385
1105 Ga0207674_10136597
1106 Ga0207698_10200163
1107 Ga0209281_1010109
1108 Ga0209282_1000002
1109 Ga0265323_10017196
1110 Ga0307515_10283524
1111 Ga0316177_1099066
1112 Ga0316178_1130629
1113 Ga0316180_1146827
1114 Ga0316181_1101234
1115 Ga0307509_10000009
1116 Ga0307408_100004177
1117 Ga0307408_100035363
1118 Ga0307408_100284841
1119 Ga0307408_100383373
1120 Ga0265314_10079030
1121 Ga0307412_10162337
1122 Ga0307416_100078626
1123 Ga0307414_10074288
1124 Ga0316583_10000115
1125 Ga0373931_0059990
1126 Ga0395899_0000330
1127 Ga0395899_0037882
1128 Ga0395899_0040773
1129 Ga0395900_0002680
1130 Ga0395900_0098989
1131 Ga0395900_0105392
1132 Ga0395900_0114655
1133 Ga0395900_0238206
1134 Ga0395900_0282980
1135 Ga0395900_0511549
1136 Ga0395900_0781841
1137 Ga0395898_0125754
1138 Ga0395905_0014222
1139 Ga0395905_0045973
1140 Ga0395905_0082892
1141 Ga0395901_0000229
1142 Ga0395901_0348538
1143 Ga0395901_0668015
1144 Ga0436361_0448498
1145 Ga0436361_0488682
1146 Ga0436361_0491527
1147 Ga0436361_0572129
1148 Ga0439448_0001795
1149 Ga0439448_0017550
1150 Ga0439449_0030934
1151 Ga0439455_0003644
1152 Ga0450904_000265
1153 Ga0451577_0003922
1154 Ga0451577_0073588
1155 Ga0466972_0000275
1156 Ga0466972_0003253
1157 Ga0466982_0056167
1158 Ga0466965_0002351
1159 Ga0466965_0009582
1160 Ga0466965_0060595
1161 Ga0466966_0043959
1162 Ga0466966_0194785
1163 Ga0466966_0204090
1164 Ga0466961_0055842
1165 Ga0466961_0251825
1166 Ga0466964_0000266
1167 Ga0466964_0010922
1168 Ga0453684_0000014
1169 Ga0453684_0016719
1170 Ga0453684_0089959
1171 Ga0466968_0005250
1172 Ga0466968_0050463
1173 Ga0466968_0054539
1174 Ga0466970_0150416
1175 Ga0466970_0153396
1176 Ga0466970_0170142
1177 Ga0466970_0293150
1178 Ga0466957_0002503
1179 Ga0466957_0210012
1180 Ga0466959_0014282
1181 Ga0451576_0065292
1182 Ga0451576_0317511
1183 Ga0466958_0058609
1184 Ga0466958_0196444
1185 Ga0466967_0131066
1186 Ga0495617_000002
1187 Ga0495617_000007
1188 Ga0495617_002281
1189 Ga0495617_018000
1190 Ga0495617_031222
1191 Ga0495627_000006
1192 Ga0495627_001759
1193 Ga0495627_005262
1194 Ga0495627_015428
1195 Ga0495627_022893
1196 Ga0495627_041896
1197 Ga0495603_0031384
1198 Ga0495603_0078404
1199 Ga0495590_0000004
1200 Ga0495590_0000025
1201 Ga0495590_0004859
1202 Ga0495590_0077353
1203 Ga0495591_002012
1204 Ga0495591_044772
1205 Ga0495629_0015303
1206 Ga0495629_0055623
1207 Ga0495629_0082754
1208 Ga0495629_0137233
1209 Ga0495638_0000366
1210 Ga0495638_0017461
1211 Ga0495638_0023339
1212 Ga0495638_0036727
1213 Ga0495638_0050570
1214 Ga0495638_0097987
1215 Ga0495638_0108410
1216 Ga0495638_0139516
1217 Ga0495653_0000037
1218 Ga0495653_0027529
1219 Ga0495653_0047088
1220 Ga0495653_0286312
1221 Ga0495653_0294829
1222 Ga0495650_0000124
1223 Ga0495650_0000169
1224 Ga0495650_0000177
1225 Ga0495650_0000817
1226 Ga0495650_0005858
1227 Ga0495650_0014418
1228 Ga0495650_0028456
1229 Ga0495650_0061752
1230 Ga0495580_0007578
1231 Ga0495580_0263109
1232 Ga0495582_0008500
1233 Ga0495582_0013806
1234 Ga0495582_0031184
1235 Ga0495582_0079049
1236 Ga0495605_0000003
1237 Ga0495605_0000293
1238 Ga0495605_0000717
1239 Ga0495605_0018951
1240 Ga0495605_0022435
1241 Ga0495605_0055775
1242 Ga0495605_0105105
1243 Ga0495605_0141422
1244 Ga0495605_0182994
1245 Ga0495639_0055223
1246 Ga0495584_0000017
1247 Ga0495584_0000996
1248 Ga0495584_0002122
1249 Ga0495584_0003871
1250 Ga0495584_0006023
1251 Ga0495584_0007133
1252 Ga0495584_0009419
1253 Ga0495584_0011609
1254 Ga0495584_0013975
1255 Ga0495584_0016617
1256 Ga0495584_0021219
1257 Ga0495584_0021944
1258 Ga0495584_0028586
1259 Ga0495584_0052231
1260 Ga0495584_0065493
1261 Ga0495584_0136415
1262 Ga0495584_0409082
1263 Ga0495585_0000006
1264 Ga0495585_0000425
1265 Ga0495585_0001636
1266 Ga0495585_0001963
1267 Ga0495585_0004151
1268 Ga0495585_0004277
1269 Ga0495585_0005707
1270 Ga0495585_0013410
1271 Ga0495585_0014698
1272 Ga0495585_0017373
1273 Ga0495585_0018212
1274 Ga0495585_0036513
1275 Ga0495585_0041916
1276 Ga0495585_0042662
1277 Ga0495585_0049139
1278 Ga0495585_0063184
1279 Ga0495585_0079410
1280 Ga0495585_0082684
1281 Ga0495585_0117493
1282 Ga0495594_0012837
1283 Ga0495594_0043729
1284 Ga0495594_0084941
1285 Ga0495594_0090907
1286 Ga0495594_0117159
1287 Ga0495594_0298092
1288 Ga0495596_0001127
1289 Ga0495596_0001627
1290 Ga0495596_0004826
1291 Ga0495596_0008781
1292 Ga0495596_0009392
1293 Ga0495596_0010585
1294 Ga0495596_0012162
1295 Ga0495596_0012515
1296 Ga0495596_0017481
1297 Ga0495596_0060880
1298 Ga0495607_0005031
1299 Ga0495607_0009609
1300 Ga0495607_0011316
1301 Ga0495607_0012165
1302 Ga0495607_0017602
1303 Ga0495607_0070734
1304 Ga0495607_0084408
1305 Ga0495607_0086642
1306 Ga0495607_0089094
1307 Ga0495607_0105988
1308 Ga0495607_0225989
1309 Ga0495583_0000056
1310 Ga0495583_0000195
1311 Ga0495583_0000508
1312 Ga0495583_0001466
1313 Ga0495583_0002716
1314 Ga0495583_0003773
1315 Ga0495583_0007357
1316 Ga0495583_0010817
1317 Ga0495583_0016948
1318 Ga0495583_0021442
1319 Ga0495583_0022781
1320 Ga0495606_0000024
1321 Ga0495606_0000043
1322 Ga0495606_0000268
1323 Ga0495606_0002980
1324 Ga0495606_0004126
1325 Ga0495606_0006090
1326 Ga0495606_0011577
1327 Ga0495606_0022103
1328 Ga0495606_0023725
1329 Ga0495606_0025426
1330 Ga0495606_0037058
1331 Ga0495606_0043331
1332 Ga0495606_0045018
1333 Ga0495606_0046220
1334 Ga0495606_0055716
1335 Ga0495606_0055955
1336 Ga0495606_0213178
1337 Ga0495606_0213420
1338 Ga0495610_0000004
1339 Ga0495610_0000688
1340 Ga0495610_0001096
1341 Ga0495610_0031088
1342 Ga0495610_0043018
1343 Ga0495616_0001644
1344 Ga0495616_0001999
1345 Ga0495616_0002635
1346 Ga0495616_0002826
1347 Ga0495616_0003400
1348 Ga0495616_0010927
1349 Ga0495616_0011036
1350 Ga0495616_0018869
1351 Ga0495616_0020152
1352 Ga0495616_0022819
1353 Ga0495616_0026346
1354 Ga0495616_0051953
1355 Ga0495616_0073339
1356 Ga0495616_0107033
1357 Ga0495620_0032708
1358 Ga0495630_0029626
1359 Ga0495630_0069729
1360 Ga0495631_0000378
1361 Ga0495631_0007497
1362 Ga0495631_0009016
1363 Ga0495631_0019405
1364 Ga0495631_0022077
1365 Ga0495631_0077462
1366 Ga0495631_0081212
1367 Ga0495631_0092534
1368 Ga0495631_0150335
1369 Ga0495631_0188712
1370 Ga0495632_0002064
1371 Ga0495632_0003086
1372 Ga0495632_0003136
1373 Ga0495632_0016891
1374 Ga0495632_0025606
1375 Ga0495637_0000019
1376 Ga0495637_0002406
1377 Ga0495637_0004798
1378 Ga0495637_0008681
1379 Ga0495637_0019830
1380 Ga0495637_0026565
1381 Ga0495643_0000182
1382 Ga0495643_0000425
1383 Ga0495643_0002040
1384 Ga0495643_0009259
1385 Ga0495643_0019442
1386 Ga0495643_0114713
1387 Ga0495643_0158441
1388 Ga0495643_0166761
1389 Ga0495644_0008943
1390 Ga0495644_0013584
1391 Ga0495644_0017551
1392 Ga0495644_0030180
1393 Ga0495644_0030231
1394 Ga0495644_0032760
1395 Ga0495648_0000007
1396 Ga0495648_0000045
1397 Ga0495648_0003804
1398 Ga0495648_0006049
1399 Ga0495648_0007904
1400 Ga0495648_0028790
1401 Ga0495648_0030316
1402 Ga0495648_0032791
1403 Ga0495648_0050440
1404 Ga0495648_0051782
1405 Ga0495648_0063983
1406 Ga0495648_0088980
1407 Ga0495648_0100901
1408 Ga0495663_0009880
1409 Ga0495663_0022008
1410 Ga0495663_0058463
1411 Ga0495666_0001537
1412 Ga0495666_0016839
1413 Ga0495666_0017370
1414 Ga0495666_0021636
1415 Ga0495666_0023207
1416 Ga0495666_0041794
1417 Ga0495642_0001065
1418 Ga0495642_0001266
1419 Ga0495642_0001585
1420 Ga0495642_0001979
1421 Ga0495642_0005730
1422 Ga0495642_0034193
1423 Ga0495642_0055418
1424 Ga0495642_0059816
1425 Ga0495642_0188771
1426 Ga0495642_0217219
1427 Ga0495652_0077703
1428 Ga0495652_0109961
1429 Ga0495654_0000004
1430 Ga0495654_0023167
1431 Ga0495654_0061168
1432 Ga0495665_0008344
1433 Ga0495665_0030022
1434 Ga0495665_0075946
1435 Ga0495665_0087256
1436 Ga0495640_0046521
1437 Ga0495586_0005600
1438 Ga0495586_0037863
1439 Ga0495586_0129445
1440 Ga0495587_0089354
1441 Ga0495587_0270243
1442 Ga0495609_0000002
1443 Ga0495609_0003408
1444 Ga0495609_0003793
1445 Ga0495609_0010274
1446 Ga0495609_0010957
1447 Ga0495609_0012173
1448 Ga0495609_0019527
1449 Ga0495609_0020523
1450 Ga0495609_0029810
1451 Ga0495609_0046284
1452 Ga0495621_0002326
1453 Ga0495597_0001284
1454 Ga0495597_0002599
1455 Ga0495597_0004149
1456 Ga0495597_0004160
1457 Ga0495597_0018336
1458 Ga0495597_0019643
1459 Ga0495597_0036670
1460 Ga0495597_0075559
1461 Ga0495622_0000003
1462 Ga0495622_0000780
1463 Ga0495622_0006320
1464 Ga0495622_0018067
1465 Ga0495633_0000356
1466 Ga0495633_0000522
1467 Ga0495633_0001186
1468 Ga0495633_0007624
1469 Ga0495633_0009485
1470 Ga0495633_0011434
1471 Ga0495633_0014652
1472 Ga0495633_0021067
1473 Ga0495633_0021273
1474 Ga0495633_0023039
1475 Ga0495633_0024493
1476 Ga0495633_0026633
1477 Ga0495633_0041414
1478 Ga0495633_0131871
1479 Ga0495633_0148274
1480 Ga0495667_0044762
1481 Ga0495656_0014511
1482 Ga0495656_0021111
1483 Ga0495656_0079476
1484 Ga0495656_0171390
1485 Ga0495656_0208379
1486 Ga0495668_0000126
1487 Ga0495668_0000764
1488 Ga0495668_0000998
1489 Ga0495668_0003229
1490 Ga0495668_0003576
1491 Ga0495668_0004008
1492 Ga0495668_0007175
1493 Ga0495668_0011019
1494 Ga0495668_0011314
1495 Ga0495668_0025440
1496 Ga0495668_0030197
1497 Ga0495668_0036280
1498 Ga0495668_0070030
1499 Ga0495668_0070141
1500 Ga0495668_0098374
1501 Ga0495634_0027074
1502 Ga0495611_0001415
1503 Ga0495611_0001975
1504 Ga0495611_0011264
1505 Ga0495611_0045316
1506 Ga0495611_0073264
1507 Ga0495611_0076785
1508 Ga0495611_0115343
1509 Ga0495625_0001394
1510 Ga0495625_0002147
1511 Ga0495625_0002594
1512 Ga0495625_0003216
1513 Ga0495625_0011222
1514 Ga0495625_0021838
1515 Ga0495625_0050910
1516 Ga0495625_0058574
1517 Ga0495625_0068006
1518 Ga0495625_0181307
1519 Ga0495625_0439909
1520 Ga0495635_0009799
1521 Ga0495635_0467613
1522 Ga0495659_0000124
1523 Ga0495659_0003381
1524 Ga0495659_0092444
1525 Ga0495661_0002730
1526 Ga0495661_0002951
1527 Ga0495661_0003461
1528 Ga0495661_0004001
1529 Ga0495661_0008554
1530 Ga0495661_0014772
1531 Ga0495661_0021525
1532 Ga0495661_0034652
1533 Ga0495661_0037804
1534 Ga0495661_0056091
1535 Ga0495661_0071336
1536 Ga0495661_0072470
1537 Ga0495661_0092399
1538 Ga0495661_0105148
1539 Ga0495661_0152517
1540 Ga0495588_0000127
1541 Ga0495588_0003809
1542 Ga0495588_0010058
1543 Ga0495588_0030834
1544 Ga0495588_0043775
1545 Ga0495588_0145278
1546 Ga0495623_0030020
1547 Ga0495623_0045319
1548 Ga0495646_0153861
1549 Ga0495669_0001026
1550 Ga0495669_0009035
1551 Ga0495669_0014091
1552 Ga0495669_0025720
1553 Ga0495613_0023586
1554 Ga0495613_0124182
1555 Ga0495613_0144691
1556 Ga0495624_0012355
1557 Ga0495624_0237276
1558 Ga0495670_0000883
1559 Ga0495670_0001258
1560 Ga0495670_0006735
1561 Ga0495670_0009988
1562 Ga0495670_0015716
1563 Ga0495670_0025089
1564 Ga0495670_0034583
1565 Ga0495670_0065429
1566 Ga0495670_0078386
1567 Ga0495670_0097598
1568 Ga0495670_0136401
1569 Ga0495670_0159242
1570 Ga0495670_0224590
1571 Ga0495671_0000001
1572 Ga0495671_0001026
1573 Ga0495671_0002227
1574 Ga0495671_0002525
1575 Ga0495671_0009809
1576 Ga0495671_0104468
1577 Ga0495671_0234480
1578 Ga0495649_0002201
1579 Ga0495649_0003656
1580 Ga0495649_0033852
1581 Ga0495649_0036416
1582 Ga0495649_0046314
1583 Ga0495649_0049449
1584 Ga0495649_0122820
1585 Ga0495589_0000083
1586 Ga0495589_0000357
1587 Ga0495589_0001877
1588 Ga0495589_0010868
1589 Ga0495589_0011320
1590 Ga0495589_0012582
1591 Ga0495589_0013474
1592 Ga0495589_0027374
1593 Ga0495589_0131917
1594 Ga0495600_0049259
1595 Ga0495600_0300983
1596 Ga0495660_0001996
1597 Ga0495660_0003082
1598 Ga0495660_0006718
1599 Ga0495660_0008032
1600 Ga0495660_0023130
1601 Ga0495660_0025157
1602 Ga0495660_0039985
1603 Ga0495660_0048319
1604 Ga0495660_0054317
1605 Ga0495660_0092810
1606 Ga0495660_0103271
1607 Ga0495660_0188033
1608 Ga0495581_0006427
1609 Ga0495581_0006784
1610 Ga0495581_0153711
1611 Ga0495604_0007527
1612 Ga0495604_0014924
1613 Ga0495604_0064409
1614 Ga0495604_0107490
1615 Ga0495636_0000259
1616 Ga0495636_0021460
1617 Ga0495636_0033986
1618 Ga0495674_0012700
1619 Ga0495674_0218870
1620 Ga0495674_0237711
1621 Ga0495672_0000041
1622 Ga0495672_0000045
1623 Ga0495672_0000050
1624 Ga0495672_0000154
1625 Ga0495672_0002883
1626 Ga0495672_0003045
1627 Ga0495672_0022757
1628 Ga0495672_0028909
1629 Ga0495672_0071242
1630 Ga0495672_0172082
1631 Ga0495676_0005037
1632 Ga0495676_0038880
1633 Ga0495676_0093787
1634 Ga0495676_0198689
1635 Ga0495680_0005811
1636 Ga0495680_0041713
1637 Ga0495683_0000543
1638 Ga0495683_0004058
1639 Ga0495683_0018235
1640 Ga0495683_0027097
1641 Ga0495683_0050618
1642 Ga0495683_0119381
1643 Ga0495687_000075
1644 Ga0495687_000197
1645 Ga0495687_001959
1646 Ga0495687_002919
1647 Ga0495687_003090
1648 Ga0495687_005664
1649 Ga0495687_007400
1650 Ga0495687_008367
1651 Ga0495687_012700
1652 Ga0495687_013310
1653 Ga0495687_033648
1654 Ga0495675_0039633
1655 Ga0495675_0046613
1656 Ga0495677_0000030
1657 Ga0495677_0001988
1658 Ga0495677_0005111
1659 Ga0495677_0005224
1660 Ga0495677_0005767
1661 Ga0495677_0025202
1662 Ga0495677_0025717
1663 Ga0495677_0026302
1664 Ga0495677_0046078
1665 Ga0495677_0059581
1666 Ga0495677_0168633
1667 Ga0495679_012148
1668 Ga0495679_023324
1669 Ga0495679_024649
1670 Ga0495679_025680
1671 Ga0495679_029191
1672 Ga0495685_000013
1673 Ga0495685_001489
1674 Ga0495685_010772
1675 Ga0495685_026508
1676 Ga0495673_0000006
1677 Ga0495673_0000014
1678 Ga0495673_0000017
1679 Ga0495673_0015548
1680 Ga0495673_0035495
1681 Ga0495681_0002458
1682 Ga0495681_0003565
1683 Ga0495681_0003787
1684 Ga0495681_0015439
1685 Ga0495681_0018815
1686 Ga0495681_0030917
1687 Ga0495681_0036835
1688 Ga0495681_0051271
1689 Ga0495681_0070317
1690 Ga0495686_0001793
1691 Ga0495686_0003258
1692 Ga0495686_0003588
1693 Ga0495686_0040576
1694 Ga0495686_0098352
1695 Ga0495593_0011645
1696 Ga0495593_0013788
1697 Ga0495593_0020117
1698 Ga0495593_0077905
1699 Ga0495593_0256500
1700 Ga0495602_0025033
1701 Ga0495602_0065726
1702 Ga0495614_0012430
1703 Ga0495614_0022084
1704 Ga0495615_0002717
1705 Ga0495626_0000102
1706 Ga0495626_0000390
1707 Ga0495626_0002136
1708 Ga0495626_0003929
1709 Ga0495626_0004107
1710 Ga0495626_0008712
1711 Ga0495626_0009990
1712 Ga0495626_0029934
1713 Ga0495626_0032022
1714 Ga0495626_0044418
1715 Ga0495626_0047765
1716 Ga0495626_0047817
1717 Ga0496100_0031921
1718 Ga0496102_0000088
1719 Ga0496102_0003622
1720 Ga0496102_0062888
1721 Ga0496102_0179897
1722 Ga0496102_0193748
1723 Ga0496102_0221849
1724 Ga0496102_0322625
1725 Ga0496103_0016343
1726 Ga0496103_0018031
1727 Ga0496103_0021699
1728 Ga0496103_0050879
1729 Ga0496103_0073352
1730 Ga0496104_0062217
1731 Ga0496104_0255763
1732 Ga0496104_0319465
1733 Ga0496105_0056845
1734 Ga0496106_0036731
1735 Ga0496107_0038161
1736 Ga0496107_0047231
1737 Ga0496107_0162017
1738 Ga0496108_0083016
1739 Ga0496109_0353461
1740 Ga0496109_0357428
1741 Ga0496110_0003394
1742 Ga0496110_0715793
1743 Ga0496111_0015848
1744 Ga0496113_0003066
1745 Ga0496114_0053880
1746 Ga0496114_0099595
1747 Ga0496114_0201814
1748 Ga0496115_0038148
1749 Ga0496115_0051773
1750 Ga0496115_0087415
1751 Ga0496115_0352124
1752 Ga0496116_0025207
1753 Ga0496116_0078348
1754 Ga0496116_0083351
1755 Ga0496117_0000001
1756 Ga0496118_0000008
1757 Ga0496120_0050826
1758 Ga0496121_0034456
1759 Ga0496121_0126052
1760 Ga0496122_0000988
1761 Ga0496122_0001677
1762 Ga0496122_0025607
1763 Ga0496122_0040842
1764 Ga0496123_0000826
1765 Ga0496123_0005439
1766 Ga0496123_0005693
1767 Ga0496123_0007548
1768 Ga0496123_0007757
1769 Ga0496123_0128019
1770 Ga0496123_0227930
1771 Ga0496124_0008442
1772 Ga0496124_0010180
1773 Ga0496124_0037700
1774 Ga0496124_0069464
1775 Ga0496124_0136723
1776 Ga0496124_0144157
1777 Ga0496124_0171418
1778 Ga0496125_0003401
1779 Ga0496125_0004085
1780 Ga0496125_0006646
1781 Ga0496125_0073910
1782 Ga0496126_0002274
1783 Ga0496126_0169092
1784 Ga0495678_000042
1785 Ga0495678_000070
1786 Ga0495678_000851
1787 Ga0495678_002833
1788 Ga0495678_002880
1789 Ga0495678_003410
1790 Ga0495678_028617
1791 Ga0495678_122048
1792 Ga0495682_0001441
1793 Ga0495682_0006752
1794 Ga0495682_0010090
1795 Ga0495682_0013523
1796 Ga0495682_0014095
1797 Ga0501230_011176
1798 Ga0501238_007977
1799 Ga0501249_001735
1800 Ga0501269_000732
1801 Ga0501279_008801
1802 Ga0501279_018766
1803 Ga0501035_0024452
1804 nmdc:mga03n38_72589_c1
1805 Ga0500594_0008077
1806 Ga0500618_000162
1807 Ga0500618_008740
1808 Ga0500586_000147
1809 Ga0500586_005639
1810 Ga0587082_009097
1811 2511247980
1812 2511384578
1813 2521556982
1814 2524610540
1815 2550693390
1816 2553004783
1817 2601671035
1818 2643788412
1819 2643798044
1820 2644026916
1821 2644213662
1822 2644253783
1823 2644356564
1824 2644473222
1825 2738738809
1826 2738825201
1827 2738844699
1828 2739148998
1829 2739190917
1830 2739276224
1831 2739317394
1832 2739335635
1833 2739345252
1834 2765568164
1835 2808983600
1836 2809129264
1837 2809144526
1838 2809149681
1839 2819594961
1840 2819616830
1841 2821133794
1842 2839097541
1843 2842716747
1844 2852619834
1845 2857547807
1846 2857553903
1847 2857560309
1848 2857565586
1849 2884814111
1850 2884836655
1851 2884852948
1852 2896155936
1853 2904430654
1854 2904440309
1855 2904530777
1856 2904585808
1857 2904592379
1858 2904601488
1859 2919049795
1860 2919082862
1861 2919480519
1862 2923515616
1863 2928134520
1864 8047678052

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

9

269

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.8729 2 262
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.8456 2 262
7ocf-assembly1.cif.gz_J active state glua1/a2 ampa receptor in complex with tarp gamma 8 and cnih2 (lbd-tmd) 0.4551 177 263
6wxu-assembly1.cif.gz_D cryoem structure of mouse duox1-duoxa1 complex in the dimer-of-dimer state 0.4447 172 258
8f6q-assembly1.cif.gz_A cryoem structure of designed modular protein oligomer c8-71 0.4288 57 262
ID Description Score Start End Superfamily
af_K7KAW4_24_173_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6173 123 262 1.20.140.40
af_K7KAW4_24_173_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4853 123 262 1.20.140.40
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.478 177 261 3.90.1420.10
af_Q06432_1_222_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4646 177 259 1.20.140.150
af_I1JDC8_29_172_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4601 123 260 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A3A6P1T9-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9598 1 262 GO:0005886
GO:0008961
GO:0042158
AF-A0A8B2EFU9-F1-model_v4 deleted 0.9557 2 263
AF-A0A2M7Y5X3-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9545 2 263 GO:0005886
GO:0008961
GO:0042158
AF-C3XCT1-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9506 1 262 GO:0005886
GO:0008961
GO:0042158
AF-A0A1A9T0V9-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9501 1 263 GO:0005886
GO:0008961
GO:0042158

Map