F486121

General Info

Members Datasets Scaffolds Average Seq Length
934 488 1868 385

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1000037|Ga0079104_1000037165
Length 405
Sequence MNKPTSRDLLRSLVGFPTVSRDSNLALIGFIQRYLADLGVQSELLHNAEGTKANLFATIGPRDRGGIVLSGHTDVVPVDGQAWTMEPFRLTEAHGRLYGRGTADMKGFIASVLAAVPLFLRQPLSMPVHLAFSYDEEVGCLGVRSLLSELQNRPHRPRLCLIGEPTELQPVLGHKGKLAMRCRIQGAACHSAHAPRGVNAIGYAARVIRKLDEIAARLSRPEHHDPRFDPPFSTVQVGVIQGGRALNIVPAECEFDFEVRALPGFDAHEVAYELQDYAETDLQPLMQAVQPGTGIRLQPLSAYPGLATPPESEAAQLLTLLSGRRDFGTVAFGTEGGLFDQAGIPTVVCGPASMDQGHKPDEFITVEQLQACDAMLARLAAHLTQVDGATQDPARPQAEDSRHPQ

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
133 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
139 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
140 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
143 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
144 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
145 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
146 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
147 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
148 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
149 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
277 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
278 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
279 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
280 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
281 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
282 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
283 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
284 2511231006 Pseudomonas sp. GM17 Isolate Nodule
285 2511231010 Pseudomonas sp. GM25 Isolate Nodule
286 2511231012 Pseudomonas sp. GM33 Isolate Nodule
287 2511231019 Pseudomonas sp. GM67 Isolate Nodule
288 2511231024 Pseudomonas sp. GM84 Isolate Nodule
289 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
290 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
291 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
292 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
293 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
294 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
295 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
296 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
297 2519103095 Burkholderia sp. KJ006 Isolate Nodule
298 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
299 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
300 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
301 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
302 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
303 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
304 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
305 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
306 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
307 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
308 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
309 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
310 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
311 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
312 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
313 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
314 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
315 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
316 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
317 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
318 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
319 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
320 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
321 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
322 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
323 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
324 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
325 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
326 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
327 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
328 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
329 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
330 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
331 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
332 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
333 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
334 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
335 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
336 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
337 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
338 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
339 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
340 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
341 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
342 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
343 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
344 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
345 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
346 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
347 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
348 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
349 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
350 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
351 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
352 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
353 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
354 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
355 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
356 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
357 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
358 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
359 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
360 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
361 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
362 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
363 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
364 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
365 2721755523 Delftia sp. HK171 Isolate Unclassified
366 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
367 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
368 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
369 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
370 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
371 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
372 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
373 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
374 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
375 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
376 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
377 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
378 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
379 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
380 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
381 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
382 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
383 2765235841 Pseudomonas putida AA7 Isolate Unclassified
384 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
385 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
386 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
387 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
388 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
389 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
390 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
391 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
392 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
393 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
394 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
395 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
396 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
397 2818991450 Burkholderia sp. 604 Isolate Unclassified
398 2818991452 Burkholderia cepacia 561 Isolate Unclassified
399 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
400 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
401 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
402 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
403 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
404 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
405 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
406 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
407 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
408 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
409 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
410 2876601092 Pantoea endophytica 596 Isolate Unclassified
411 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
412 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
413 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
414 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
415 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
416 2904564687 Burkholderia sp. 571 Isolate Unclassified
417 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
418 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
419 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
420 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
421 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
422 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
423 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
424 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
425 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
426 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
427 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
428 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
429 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
430 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
431 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
432 2928163908 Burkholderia sp. 567 Isolate Unclassified
433 2928170801 Burkholderia sp. 572 Isolate Unclassified
434 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
435 2928536128 Burkholderia sola 565 Isolate Unclassified
436 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
437 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
438 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
439 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
440 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
441 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
442 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
443 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
444 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
445 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
446 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
447 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
448 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
449 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
450 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
451 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
452 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
453 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
454 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
455 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
456 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
457 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
458 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
459 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
460 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
461 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
462 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
463 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
464 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
465 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
466 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
467 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
468 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
469 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
470 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
471 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
472 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
473 8052494512 Pseudomonas putida LD6 Isolate Unclassified
474 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
475 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
476 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
477 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
478 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
479 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
480 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
481 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
482 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
483 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
484 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
485 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
486 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
487 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
488 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.3
Metatranscriptomes 0
Isolates 22.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.28
Nodule 2.68
Rhizoplane 8.78
Rhizosphere 63.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1000037 3300006946 Bacteria 189207
2 SwRhRL2b_contig_2621290 2162886007 Bacteria 2519
3 SwRhRL2b_contig_3688828 2162886007 Bacteria 1913
4 JGI24739J22299_10007158 3300001989 Bacteria 4199
5 JGI24735J21928_10000299 3300002067 Bacteria 17255
6 JGI24735J21928_10002925 3300002067 Bacteria 5878
7 JGI24735J21928_10007036 3300002067 Bacteria 3677
8 JGI25156J39149_1000506 3300002705 Bacteria 22799
9 JGI25162J39368_1000164 3300002737 Bacteria 73373
10 JGI25163J39215_1000025 3300002771 Bacteria 69682
11 JGI25164J39214_1000126 3300002772 Bacteria 73373
12 JGI25165J46597_1000247 3300003214 Bacteria 73373
13 rootH2_10164091 3300003320 Bacteria 4273
14 rootH2_10197494 3300003320 Bacteria 1703
15 rootL2_10002460 3300003322 Bacteria 22027
16 JGI25160J50197_1000074 3300003354 Bacteria 103621
17 Ga0055538_1000537 3300003751 Bacteria 13347
18 Ga0055539_1000466 3300003752 Bacteria 13347
19 Ga0055533_1000551 3300003756 Bacteria 13347
20 Ga0055533_1000984 3300003756 Bacteria 8317
21 Ga0055532_1000055 3300003758 Bacteria 160192
22 Ga0055532_1000358 3300003758 Bacteria 24185
23 Ga0055532_1000652 3300003758 Bacteria 13347
24 Ga0055525_1000658 3300003759 Bacteria 13347
25 Ga0055527_1000030 3300003760 Bacteria 160175
26 Ga0055535_1000038 3300003761 Bacteria 160192
27 Ga0055542_1000063 3300003762 Bacteria 160175
28 Ga0055529_1000071 3300003763 Bacteria 160192
29 Ga0055536_1000005 3300003781 Bacteria 383598
30 Ga0055536_1000037 3300003781 Bacteria 138437
31 Ga0055530_10000001 3300003791 Bacteria 383067
32 Ga0055530_10000606 3300003791 Bacteria 31097
33 Ga0055530_10000865 3300003791 Bacteria 24933
34 Ga0055540_1000025 3300003792 Bacteria 197801
35 Ga0055540_1000302 3300003792 Bacteria 43687
36 Ga0055531_10000301 3300003794 Bacteria 49074
37 Ga0055541_1000388 3300003841 Bacteria 13347
38 Ga0058692_1000515 3300003856 Bacteria 17069
39 Ga0065165_1000203 3300005262 Bacteria 103001
40 Ga0065714_10064945 3300005288 Bacteria 15037
41 Ga0065714_10067899 3300005288 Bacteria 5125
42 Ga0065704_10071472 3300005289 Bacteria 11004
43 Ga0065704_10071534 3300005289 Bacteria 10781
44 Ga0070670_100000390 3300005331 Bacteria 36385
45 Ga0070666_10030121 3300005335 Bacteria 3573
46 Ga0070682_100117693 3300005337 Bacteria 1779
47 Ga0070660_100000188 3300005339 Bacteria 41185
48 Ga0070661_100076456 3300005344 Bacteria 2467
49 Ga0070669_100132752 3300005353 Bacteria 1912
50 Ga0070659_100000006 3300005366 Bacteria 229954
51 Ga0070667_100046498 3300005367 Bacteria 3651
52 Ga0070667_100187346 3300005367 Bacteria 1832
53 Ga0070663_100011648 3300005455 Bacteria 5529
54 Ga0070662_100018038 3300005457 Bacteria 4768
55 Ga0070679_100037174 3300005530 Bacteria 4835
56 Ga0068855_100104269 3300005563 Bacteria 3262
57 Ga0068852_100155803 3300005616 Bacteria 2128
58 Ga0068851_10001228 3300005834 Bacteria 11138
59 Ga0075364_10000318 3300006051 Bacteria 23710
60 Ga0075364_10193052 3300006051 Bacteria 1379
61 Ga0099823_1000017 3300006944 Bacteria 86474
62 Ga0079104_1000060 3300006946 Bacteria 161936
63 Ga0079104_1000142 3300006946 Bacteria 101403
64 Ga0105251_10001555 3300009011 Bacteria 19680
65 Ga0105251_10005237 3300009011 Bacteria 8548
66 Ga0105251_10012466 3300009011 Bacteria 4809
67 Ga0105251_10015734 3300009011 Bacteria 4122
68 Ga0105251_10050949 3300009011 Bacteria 1976
69 Ga0105251_10050950 3300009011 Bacteria 1976
70 Ga0105251_10090437 3300009011 Bacteria 1406
71 Ga0105251_10091778 3300009011 Bacteria 1394
72 Ga0105244_10000533 3300009036 Bacteria 33932
73 Ga0105244_10000804 3300009036 Bacteria 26699
74 Ga0105244_10001274 3300009036 Bacteria 20663
75 Ga0105244_10015346 3300009036 Bacteria 4394
76 Ga0105244_10021413 3300009036 Bacteria 3575
77 Ga0105244_10031342 3300009036 Bacteria 2822
78 Ga0105244_10048150 3300009036 Bacteria 2183
79 Ga0105250_10026427 3300009092 Bacteria 2338
80 Ga0105250_10032517 3300009092 Bacteria 2095
81 Ga0105240_10005736 3300009093 Bacteria 18419
82 Ga0105240_10339894 3300009093 Bacteria 1706
83 Ga0105243_10000099 3300009148 Bacteria 99838
84 Ga0105243_10001355 3300009148 Bacteria 21785
85 Ga0105243_10012812 3300009148 Bacteria 6335
86 Ga0105237_10211339 3300009545 Bacteria 1940
87 Ga0105249_10359899 3300009553 Bacteria 1476
88 Ga0105239_10009639 3300010375 Bacteria 10862
89 Ga0105246_10000626 3300011119 Bacteria 19731
90 Ga0105246_10001438 3300011119 Bacteria 14095
91 Ga0157373_10000315 3300013100 Bacteria 38946
92 Ga0157373_10000596 3300013100 Bacteria 28045
93 Ga0157373_10005498 3300013100 Bacteria 9507
94 Ga0157371_10001604 3300013102 Bacteria 23194
95 Ga0157370_10000264 3300013104 Bacteria 66688
96 Ga0157370_10149938 3300013104 Bacteria 2170
97 Ga0157369_10019522 3300013105 Bacteria 7585
98 Ga0157369_10020661 3300013105 Bacteria 7364
99 Ga0157369_10021547 3300013105 Bacteria 7208
100 Ga0157369_10293892 3300013105 Bacteria 1691
101 Ga0157374_10027105 3300013296 Bacteria 5164
102 Ga0163162_10001693 3300013306 Bacteria 20666
103 Ga0157372_10084385 3300013307 Bacteria 3600
104 Ga0157375_10000602 3300013308 Bacteria 31951
105 Ga0157375_10002153 3300013308 Bacteria 17026
106 Ga0182008_10000425 3300014497 Bacteria 32600
107 Ga0182008_10001433 3300014497 Bacteria 15949
108 Ga0182008_10001892 3300014497 Bacteria 13592
109 Ga0182008_10011969 3300014497 Bacteria 4596
110 Ga0182007_10002722 3300015262 Bacteria 8650
111 Ga0182007_10012041 3300015262 Bacteria 3342
112 Ga0182005_1000533 3300015265 Bacteria 19274
113 Ga0182005_1019429 3300015265 Bacteria 1873
114 Ga0163161_10002303 3300017792 Bacteria 13689
115 Ga0163161_10002711 3300017792 Bacteria 12588
116 Ga0163161_10007270 3300017792 Bacteria 7646
117 Ga0163161_10010811 3300017792 Bacteria 6325
118 Ga0209760_100076 3300025207 Bacteria 78740
119 Ga0209784_100065 3300025224 Bacteria 155963
120 Ga0209566_100081 3300025225 Bacteria 155963
121 Ga0209566_100570 3300025225 Bacteria 23953
122 Ga0209674_100022 3300025226 Bacteria 563656
123 Ga0209674_100093 3300025226 Bacteria 170423
124 Ga0209674_100101 3300025226 Bacteria 155963
125 Ga0209674_102954 3300025226 Bacteria 3336
126 Ga0209672_100001 3300025228 Bacteria 2828210
127 Ga0209147_100001 3300025229 Bacteria 2384371
128 Ga0209147_100021 3300025229 Bacteria 464719
129 Ga0209147_100152 3300025229 Bacteria 100822
130 Ga0209563_100098 3300025230 Bacteria 155963
131 Ga0207427_100022 3300025231 Bacteria 469701
132 Ga0207427_101241 3300025231 Bacteria 9781
133 Ga0209437_100002 3300025233 Bacteria 1574801
134 Ga0209258_100001 3300025242 Bacteria 2384269
135 Ga0209258_100969 3300025242 Bacteria 13441
136 Ga0209646_1000363 3300025246 Bacteria 31020
137 Ga0209677_100059 3300025253 Bacteria 155963
138 Ga0209148_1000003 3300025254 Bacteria 2384288
139 Ga0209759_1000030 3300025256 Bacteria 285649
140 Ga0209759_1000039 3300025256 Bacteria 256444
141 Ga0209759_1000099 3300025256 Bacteria 156332
142 Ga0209759_1003695 3300025256 Bacteria 5999
143 Ga0209233_1000004 3300025261 Bacteria 1574798
144 Ga0209233_1000180 3300025261 Bacteria 140304
145 Ga0209455_1000001 3300025272 Bacteria 2384278
146 Ga0209673_1000520 3300025273 Bacteria 63002
147 Ga0209130_1010530 3300025284 Bacteria 2541
148 Ga0209675_1001483 3300025291 Bacteria 13473
149 Ga0209676_1000002 3300025292 Bacteria 1732948
150 Ga0209676_1000003 3300025292 Bacteria 1454178
151 Ga0209676_1000522 3300025292 Bacteria 60128
152 Ga0209564_1020289 3300025295 Bacteria 2440
153 Ga0209050_1000004 3300025298 Bacteria 1600040
154 Ga0209050_1000006 3300025298 Bacteria 1359702
155 Ga0207426_1000018 3300025302 Bacteria 566740
156 Ga0207426_1001166 3300025302 Bacteria 23536
157 Ga0209051_1000001 3300025303 Bacteria 1732974
158 Ga0209051_1000006 3300025303 Bacteria 1015785
159 Ga0209257_1000056 3300025304 Bacteria 403132
160 Ga0207656_10000679 3300025321 Bacteria 11160
161 Ga0207696_1000006 3300025711 Bacteria 616498
162 Ga0207696_1000013 3300025711 Bacteria 524881
163 Ga0207696_1015699 3300025711 Bacteria 2559
164 Ga0207696_1023591 3300025711 Bacteria 1939
165 Ga0207655_1000143 3300025728 Bacteria 137102
166 Ga0207655_1000338 3300025728 Bacteria 68161
167 Ga0207655_1000432 3300025728 Bacteria 56332
168 Ga0207655_1005437 3300025728 Bacteria 8660
169 Ga0207655_1021816 3300025728 Bacteria 3233
170 Ga0207655_1039816 3300025728 Bacteria 2036
171 Ga0207713_1000551 3300025735 Bacteria 37432
172 Ga0207713_1000698 3300025735 Bacteria 31417
173 Ga0207713_1001164 3300025735 Bacteria 22239
174 Ga0207713_1002903 3300025735 Bacteria 12004
175 Ga0207713_1008002 3300025735 Bacteria 6147
176 Ga0207713_1014678 3300025735 Bacteria 4054
177 Ga0207680_10019143 3300025903 Bacteria 3657
178 Ga0207647_10011975 3300025904 Bacteria 6055
179 Ga0207647_10012538 3300025904 Bacteria 5897
180 Ga0207695_10001620 3300025913 Bacteria 36495
181 Ga0207657_10000270 3300025919 Bacteria 55069
182 Ga0207652_10054097 3300025921 Bacteria 3450
183 Ga0207681_10026264 3300025923 Bacteria 3754
184 Ga0207694_10125640 3300025924 Bacteria 2052
185 Ga0207650_10000204 3300025925 Bacteria 68172
186 Ga0207644_10347968 3300025931 Bacteria 1203
187 Ga0207690_10000019 3300025932 Bacteria 235380
188 Ga0207706_10003884 3300025933 Bacteria 14189
189 Ga0207709_10000014 3300025935 Bacteria 526302
190 Ga0207709_10006726 3300025935 Bacteria 6439
191 Ga0207667_10076888 3300025949 Bacteria 3463
192 Ga0207640_10279697 3300025981 Bacteria 1310
193 Ga0207678_10005353 3300026067 Bacteria 11491
194 Ga0207683_10196510 3300026121 Bacteria 1833
195 Ga0207698_10012043 3300026142 Bacteria 5639
196 Ga0209281_1000002 3300027111 Bacteria 1924012
197 Ga0209281_1000064 3300027111 Bacteria 287876
198 Ga0209281_1000262 3300027111 Bacteria 101417
199 Ga0209389_1000022 3300027296 Bacteria 166756
200 Ga0209371_1000087 3300027312 Bacteria 175021
201 Ga0209371_1000203 3300027312 Bacteria 85883
202 Ga0209371_1000342 3300027312 Bacteria 50937
203 Ga0209371_1001734 3300027312 Bacteria 13743
204 Ga0207428_10056347 3300027907 Bacteria 3124
205 Ga0307515_10155884 3300028794 Bacteria 2357
206 Ga0268256_1000101 3300030500 Bacteria 130956
207 Ga0268256_1000291 3300030500 Bacteria 50937
208 Ga0268256_1001512 3300030500 Bacteria 13745
209 Ga0268256_1001704 3300030500 Bacteria 12540
210 Ga0307408_100000145 3300031548 Bacteria 79041
211 Ga0307408_100007984 3300031548 Bacteria 6997
212 Ga0307408_100241942 3300031548 Bacteria 1483
213 Ga0307514_10008864 3300031649 Bacteria 8509
214 Ga0307405_10000291 3300031731 Bacteria 18543
215 Ga0307405_10019036 3300031731 Bacteria 3803
216 Ga0307405_10020660 3300031731 Bacteria 3683
217 Ga0307405_10224191 3300031731 Bacteria 1381
218 Ga0307406_10004000 3300031901 Bacteria 8014
219 Ga0307412_10000005 3300031911 Bacteria 526194
220 Ga0307412_10007665 3300031911 Bacteria 6130
221 Ga0307412_10074752 3300031911 Bacteria 2322
222 Ga0307414_10012008 3300032004 Bacteria 5106
223 Ga0307411_10123024 3300032005 Bacteria 1881
224 Ga0395898_0019835 3300037466 Bacteria 6838
225 Ga0395905_0000009 3300037471 Bacteria 488729
226 Ga0395905_0001003 3300037471 Bacteria 36126
227 Ga0395905_0030642 3300037471 Bacteria 5066
228 Ga0395905_0036368 3300037471 Bacteria 4624
229 Ga0237819_00471 3300038705 Bacteria 13733
230 Ga0436365_1175663 3300039437 Bacteria 3189
231 Ga0439436_0000760 3300041404 Bacteria 8719
232 Ga0439438_000077 3300041405 Bacteria 45928
233 Ga0439438_000205 3300041405 Bacteria 26994
234 Ga0439438_000478 3300041405 Bacteria 18095
235 Ga0439438_001753 3300041405 Bacteria 9537
236 Ga0439438_001852 3300041405 Bacteria 9254
237 Ga0439438_010096 3300041405 Bacteria 3012
238 Ga0439438_010249 3300041405 Bacteria 2974
239 Ga0439447_001433 3300041407 Bacteria 8750
240 Ga0439447_002447 3300041407 Bacteria 6766
241 Ga0439447_006498 3300041407 Bacteria 3789
242 Ga0439447_015499 3300041407 Bacteria 2114
243 Ga0439466_0000298 3300041411 Bacteria 19175
244 Ga0439466_0003539 3300041411 Bacteria 6040
245 Ga0439466_0004779 3300041411 Bacteria 5205
246 Ga0439466_0018522 3300041411 Bacteria 2496
247 Ga0439466_0038296 3300041411 Bacteria 1610
248 Ga0439466_0040527 3300041411 Bacteria 1557
249 Ga0439431_0000666 3300041997 Bacteria 7322
250 Ga0439445_0008480 3300042004 Bacteria 2404
251 Ga0439432_000501 3300042006 Bacteria 14592
252 Ga0439432_002222 3300042006 Bacteria 7324
253 Ga0439432_007170 3300042006 Bacteria 3960
254 Ga0439432_009762 3300042006 Bacteria 3339
255 Ga0439452_000085 3300042010 Bacteria 79496
256 Ga0439452_000136 3300042010 Bacteria 55807
257 Ga0439452_002958 3300042010 Bacteria 6050
258 Ga0439452_003624 3300042010 Bacteria 5373
259 Ga0439456_000198 3300042013 Bacteria 17189
260 Ga0439456_002185 3300042013 Bacteria 3940
261 Ga0450911_003465 3300042115 Bacteria 2779
262 Ga0450920_006057 3300042122 Bacteria 2164
263 Ga0450922_000899 3300042124 Bacteria 3037
264 Ga0450902_008077 3300042137 Bacteria 1638
265 Ga0450903_003563 3300042138 Bacteria 2688
266 Ga0450905_003188 3300042142 Bacteria 2151
267 Ga0450906_009657 3300042145 Bacteria 1834
268 Ga0450907_003161 3300042146 Bacteria 2981
269 Ga0450910_001413 3300042147 Bacteria 3015
270 Ga0450910_001955 3300042147 Bacteria 2669
271 Ga0450909_002438 3300042185 Bacteria 2632
272 Ga0439434_0000582 3300042435 Bacteria 10554
273 Ga0439464_0011819 3300042439 Bacteria 2318
274 Ga0439440_0005583 3300042993 Bacteria 2501
275 Ga0466969_0010596 3300044656 Bacteria 4886
276 Ga0466977_0000224 3300044666 Bacteria 15372
277 Ga0466966_0005241 3300044684 Bacteria 8522
278 Ga0466970_0012731 3300044765 Bacteria 4304
279 Ga0466957_0117768 3300044842 Bacteria 1691
280 Ga0466958_0175341 3300045836 Bacteria 1359
281 Ga0495627_000504 3300046453 Bacteria 32717
282 Ga0495627_000781 3300046453 Bacteria 23497
283 Ga0495627_007203 3300046453 Bacteria 4291
284 Ga0495592_0062026 3300046454 Bacteria 2746
285 Ga0495603_0000871 3300046455 Bacteria 17318
286 Ga0495603_0055956 3300046455 Bacteria 2337
287 Ga0495590_0000173 3300046457 Bacteria 37961
288 Ga0495590_0002472 3300046457 Bacteria 7653
289 Ga0495591_000117 3300046458 Bacteria 89645
290 Ga0495591_002734 3300046458 Bacteria 9553
291 Ga0495591_003659 3300046458 Bacteria 7825
292 Ga0495629_0000310 3300046459 Bacteria 41782
293 Ga0495629_0005414 3300046459 Bacteria 9519
294 Ga0495629_0021205 3300046459 Bacteria 4637
295 Ga0495629_0021382 3300046459 Bacteria 4617
296 Ga0495629_0022413 3300046459 Bacteria 4504
297 Ga0495629_0054792 3300046459 Bacteria 2789
298 Ga0495638_0001452 3300046460 Bacteria 21411
299 Ga0495638_0007494 3300046460 Bacteria 7815
300 Ga0495638_0090744 3300046460 Bacteria 1841
301 Ga0495638_0111512 3300046460 Bacteria 1624
302 Ga0495641_0009924 3300046461 Bacteria 5599
303 Ga0495651_0051887 3300046462 Bacteria 3160
304 Ga0495653_0000937 3300046463 Bacteria 22475
305 Ga0495653_0006194 3300046463 Bacteria 9813
306 Ga0495653_0015189 3300046463 Bacteria 6277
307 Ga0495653_0017779 3300046463 Bacteria 5782
308 Ga0495653_0049902 3300046463 Bacteria 3220
309 Ga0495650_0000628 3300046471 Bacteria 47433
310 Ga0495650_0000802 3300046471 Bacteria 38263
311 Ga0495650_0001184 3300046471 Bacteria 27715
312 Ga0495650_0004910 3300046471 Bacteria 8937
313 Ga0495650_0006982 3300046471 Bacteria 6896
314 Ga0495650_0007178 3300046471 Bacteria 6755
315 Ga0495650_0012173 3300046471 Bacteria 4645
316 Ga0495650_0028536 3300046471 Bacteria 2560
317 Ga0495650_0028682 3300046471 Bacteria 2549
318 Ga0495580_0000047 3300046472 Bacteria 68842
319 Ga0495580_0001969 3300046472 Bacteria 18030
320 Ga0495580_0007575 3300046472 Bacteria 8710
321 Ga0495580_0023965 3300046472 Bacteria 4473
322 Ga0495580_0037797 3300046472 Bacteria 3461
323 Ga0495582_0002684 3300046473 Bacteria 9933
324 Ga0495582_0019964 3300046473 Bacteria 3665
325 Ga0495582_0036563 3300046473 Bacteria 2701
326 Ga0495605_0000036 3300046474 Bacteria 203902
327 Ga0495605_0000631 3300046474 Bacteria 27198
328 Ga0495605_0002926 3300046474 Bacteria 10351
329 Ga0495605_0003631 3300046474 Bacteria 9154
330 Ga0495605_0019021 3300046474 Bacteria 3677
331 Ga0495605_0022213 3300046474 Bacteria 3353
332 Ga0495662_0016913 3300046476 Bacteria 3529
333 Ga0495664_0002835 3300046477 Bacteria 9328
334 Ga0495664_0024889 3300046477 Bacteria 3481
335 Ga0495584_0001618 3300046491 Bacteria 13249
336 Ga0495584_0115241 3300046491 Bacteria 1360
337 Ga0495585_0000284 3300046492 Bacteria 50818
338 Ga0495585_0000711 3300046492 Bacteria 29916
339 Ga0495585_0029587 3300046492 Bacteria 3117
340 Ga0495585_0032050 3300046492 Bacteria 2980
341 Ga0495594_0006259 3300046499 Bacteria 6121
342 Ga0495596_0005767 3300046500 Bacteria 5807
343 Ga0495596_0007942 3300046500 Bacteria 4748
344 Ga0495596_0012731 3300046500 Bacteria 3590
345 Ga0495607_0036051 3300046501 Bacteria 2985
346 Ga0495607_0088520 3300046501 Bacteria 1683
347 Ga0495583_0000028 3300046506 Bacteria 255787
348 Ga0495583_0000109 3300046506 Bacteria 138768
349 Ga0495583_0000511 3300046506 Bacteria 55564
350 Ga0495583_0001837 3300046506 Bacteria 19806
351 Ga0495583_0006414 3300046506 Bacteria 7696
352 Ga0495583_0017299 3300046506 Bacteria 3832
353 Ga0495606_0000204 3300046507 Bacteria 103880
354 Ga0495606_0000270 3300046507 Bacteria 91423
355 Ga0495606_0001623 3300046507 Bacteria 29338
356 Ga0495606_0011345 3300046507 Bacteria 7278
357 Ga0495606_0011356 3300046507 Bacteria 7273
358 Ga0495606_0028555 3300046507 Bacteria 3932
359 Ga0495606_0033517 3300046507 Bacteria 3541
360 Ga0495606_0037710 3300046507 Bacteria 3279
361 Ga0495606_0078706 3300046507 Bacteria 2055
362 Ga0495608_0085761 3300046511 Bacteria 2041
363 Ga0495610_0006250 3300046512 Bacteria 8255
364 Ga0495610_0014560 3300046512 Bacteria 4615
365 Ga0495610_0024169 3300046512 Bacteria 3284
366 Ga0495610_0032287 3300046512 Bacteria 2721
367 Ga0495610_0037818 3300046512 Bacteria 2452
368 Ga0495610_0046618 3300046512 Bacteria 2137
369 Ga0495610_0049498 3300046512 Bacteria 2057
370 Ga0495610_0053315 3300046512 Bacteria 1959
371 Ga0495610_0053707 3300046512 Bacteria 1949
372 Ga0495616_0039330 3300046513 Bacteria 2423
373 Ga0495616_0083207 3300046513 Bacteria 1527
374 Ga0495618_0002049 3300046514 Bacteria 13240
375 Ga0495618_0013398 3300046514 Bacteria 4989
376 Ga0495618_0017322 3300046514 Bacteria 4415
377 Ga0495620_0000049 3300046515 Bacteria 106184
378 Ga0495620_0000073 3300046515 Bacteria 83446
379 Ga0495620_0009807 3300046515 Bacteria 5080
380 Ga0495620_0022114 3300046515 Bacteria 3071
381 Ga0495628_0005251 3300046516 Bacteria 11357
382 Ga0495628_0015580 3300046516 Bacteria 6348
383 Ga0495628_0031441 3300046516 Bacteria 4293
384 Ga0495628_0046817 3300046516 Bacteria 3434
385 Ga0495628_0047821 3300046516 Bacteria 3392
386 Ga0495628_0135357 3300046516 Bacteria 1883
387 Ga0495630_0001476 3300046517 Bacteria 16264
388 Ga0495630_0005335 3300046517 Bacteria 9069
389 Ga0495630_0028040 3300046517 Bacteria 4183
390 Ga0495630_0050899 3300046517 Bacteria 3099
391 Ga0495630_0061356 3300046517 Bacteria 2823
392 Ga0495631_0061618 3300046518 Bacteria 1627
393 Ga0495632_0000051 3300046519 Bacteria 133522
394 Ga0495632_0000742 3300046519 Bacteria 29442
395 Ga0495632_0001635 3300046519 Bacteria 18359
396 Ga0495632_0003365 3300046519 Bacteria 11396
397 Ga0495637_0007116 3300046520 Bacteria 5570
398 Ga0495637_0020012 3300046520 Bacteria 3083
399 Ga0495637_0022414 3300046520 Bacteria 2880
400 Ga0495637_0030956 3300046520 Bacteria 2370
401 Ga0495637_0042350 3300046520 Bacteria 1948
402 Ga0495643_0000150 3300046522 Bacteria 113560
403 Ga0495643_0000152 3300046522 Bacteria 112556
404 Ga0495643_0000445 3300046522 Bacteria 53349
405 Ga0495643_0001282 3300046522 Bacteria 24031
406 Ga0495644_0051973 3300046523 Bacteria 1538
407 Ga0495648_0000512 3300046524 Bacteria 41742
408 Ga0495648_0000560 3300046524 Bacteria 39735
409 Ga0495648_0001151 3300046524 Bacteria 26757
410 Ga0495648_0001307 3300046524 Bacteria 24712
411 Ga0495648_0002230 3300046524 Bacteria 18114
412 Ga0495648_0050276 3300046524 Bacteria 2548
413 Ga0495648_0061099 3300046524 Bacteria 2239
414 Ga0495648_0068855 3300046524 Bacteria 2062
415 Ga0495666_0004585 3300046526 Bacteria 6987
416 Ga0495642_0000018 3300046528 Bacteria 108992
417 Ga0495642_0003020 3300046528 Bacteria 6701
418 Ga0495642_0012506 3300046528 Bacteria 3272
419 Ga0495652_0010089 3300046529 Bacteria 8562
420 Ga0495652_0022094 3300046529 Bacteria 5650
421 Ga0495652_0068711 3300046529 Bacteria 2967
422 Ga0495652_0192799 3300046529 Bacteria 1553
423 Ga0495654_0000246 3300046530 Bacteria 50620
424 Ga0495654_0000432 3300046530 Bacteria 35485
425 Ga0495654_0002687 3300046530 Bacteria 11255
426 Ga0495654_0005855 3300046530 Bacteria 7073
427 Ga0495654_0010556 3300046530 Bacteria 5024
428 Ga0495654_0011171 3300046530 Bacteria 4874
429 Ga0495654_0062578 3300046530 Bacteria 1783
430 Ga0495654_0108985 3300046530 Bacteria 1265
431 Ga0495665_0005136 3300046531 Bacteria 7059
432 Ga0495665_0017762 3300046531 Bacteria 3823
433 Ga0495665_0025622 3300046531 Bacteria 3168
434 Ga0495665_0028537 3300046531 Bacteria 2991
435 Ga0495640_0007879 3300046533 Bacteria 8376
436 Ga0495586_0001052 3300046535 Bacteria 15580
437 Ga0495586_0008468 3300046535 Bacteria 5471
438 Ga0495586_0078806 3300046535 Bacteria 1808
439 Ga0495587_0004029 3300046536 Bacteria 9733
440 Ga0495587_0012559 3300046536 Bacteria 5326
441 Ga0495609_0000014 3300046538 Bacteria 326023
442 Ga0495609_0000115 3300046538 Bacteria 93419
443 Ga0495597_0000635 3300046542 Bacteria 28659
444 Ga0495597_0003598 3300046542 Bacteria 8922
445 Ga0495597_0016635 3300046542 Bacteria 3471
446 Ga0495597_0054975 3300046542 Bacteria 1747
447 Ga0495645_0000185 3300046543 Bacteria 44326
448 Ga0495645_0000915 3300046543 Bacteria 20101
449 Ga0495645_0086631 3300046543 Bacteria 2241
450 Ga0495645_0107292 3300046543 Bacteria 1980
451 Ga0495633_0000028 3300046558 Bacteria 203214
452 Ga0495667_0019337 3300046559 Bacteria 4596
453 Ga0495668_0021608 3300046616 Bacteria 3687
454 Ga0495634_0026224 3300046642 Bacteria 4068
455 Ga0495634_0046998 3300046642 Bacteria 2910
456 Ga0495611_0036346 3300046648 Bacteria 2185
457 Ga0495611_0041270 3300046648 Bacteria 2058
458 Ga0495625_0107485 3300046660 Bacteria 1909
459 Ga0495635_0003126 3300046663 Bacteria 11393
460 Ga0495635_0019568 3300046663 Bacteria 4717
461 Ga0495635_0026970 3300046663 Bacteria 3996
462 Ga0495635_0036214 3300046663 Bacteria 3421
463 Ga0495635_0039275 3300046663 Bacteria 3274
464 Ga0495661_0000007 3300046665 Bacteria 411832
465 Ga0495661_0000100 3300046665 Bacteria 104957
466 Ga0495661_0000144 3300046665 Bacteria 82961
467 Ga0495661_0000211 3300046665 Bacteria 67481
468 Ga0495661_0010888 3300046665 Bacteria 6184
469 Ga0495661_0014156 3300046665 Bacteria 5343
470 Ga0495661_0029189 3300046665 Bacteria 3523
471 Ga0495661_0061942 3300046665 Bacteria 2219
472 Ga0495588_0029072 3300046674 Bacteria 2770
473 Ga0495588_0050748 3300046674 Bacteria 2135
474 Ga0495657_0065714 3300046675 Bacteria 2385
475 Ga0495599_0001328 3300046678 Bacteria 14099
476 Ga0495599_0024802 3300046678 Bacteria 3750
477 Ga0495599_0068519 3300046678 Bacteria 2215
478 Ga0495623_0001986 3300046679 Bacteria 13723
479 Ga0495623_0006279 3300046679 Bacteria 7725
480 Ga0495623_0041565 3300046679 Bacteria 2931
481 Ga0495623_0055802 3300046679 Bacteria 2488
482 Ga0495623_0101012 3300046679 Bacteria 1757
483 Ga0495646_0001386 3300046680 Bacteria 14391
484 Ga0495646_0004735 3300046680 Bacteria 8585
485 Ga0495646_0082040 3300046680 Bacteria 1877
486 Ga0495646_0088712 3300046680 Bacteria 1790
487 Ga0495669_0019138 3300046684 Bacteria 2953
488 Ga0495669_0047114 3300046684 Bacteria 1925
489 Ga0495613_0023372 3300046689 Bacteria 4605
490 Ga0495624_0000502 3300046690 Bacteria 30600
491 Ga0495624_0001403 3300046690 Bacteria 18799
492 Ga0495624_0003505 3300046690 Bacteria 11628
493 Ga0495624_0005612 3300046690 Bacteria 9005
494 Ga0495624_0012833 3300046690 Bacteria 5718
495 Ga0495624_0018840 3300046690 Bacteria 4613
496 Ga0495624_0058746 3300046690 Bacteria 2415
497 Ga0495670_0000942 3300046691 Bacteria 14081
498 Ga0495671_0003839 3300046692 Bacteria 9132
499 Ga0495671_0004675 3300046692 Bacteria 8108
500 Ga0495671_0015247 3300046692 Bacteria 4124
501 Ga0495671_0027953 3300046692 Bacteria 2908
502 Ga0495671_0082985 3300046692 Bacteria 1570
503 Ga0495671_0095866 3300046692 Bacteria 1451
504 Ga0495649_0000110 3300046694 Bacteria 72175
505 Ga0495649_0000764 3300046694 Bacteria 25871
506 Ga0495649_0002230 3300046694 Bacteria 13787
507 Ga0495649_0007336 3300046694 Bacteria 6735
508 Ga0495649_0008267 3300046694 Bacteria 6270
509 Ga0495649_0015493 3300046694 Bacteria 4338
510 Ga0495649_0024949 3300046694 Bacteria 3331
511 Ga0495649_0027847 3300046694 Bacteria 3133
512 Ga0495649_0055582 3300046694 Bacteria 2138
513 Ga0495649_0057493 3300046694 Bacteria 2097
514 Ga0495649_0089239 3300046694 Bacteria 1644
515 Ga0495589_0000297 3300046794 Bacteria 39517
516 Ga0495589_0002558 3300046794 Bacteria 10112
517 Ga0495589_0003366 3300046794 Bacteria 8669
518 Ga0495589_0005324 3300046794 Bacteria 6795
519 Ga0495589_0019622 3300046794 Bacteria 3461
520 Ga0495589_0037158 3300046794 Bacteria 2440
521 Ga0495600_0005652 3300046809 Bacteria 7554
522 Ga0495660_0029420 3300046810 Bacteria 3099
523 Ga0495581_0002420 3300047315 Bacteria 10543
524 Ga0495581_0016499 3300047315 Bacteria 4292
525 Ga0495604_0000506 3300047317 Bacteria 34325
526 Ga0495604_0004171 3300047317 Bacteria 11459
527 Ga0495604_0017237 3300047317 Bacteria 5779
528 Ga0495604_0048542 3300047317 Bacteria 3302
529 Ga0495604_0119157 3300047317 Bacteria 1912
530 Ga0495674_0000598 3300047319 Bacteria 33806
531 Ga0495674_0004116 3300047319 Bacteria 14040
532 Ga0495674_0013144 3300047319 Bacteria 7784
533 Ga0495674_0019972 3300047319 Bacteria 6209
534 Ga0495674_0026139 3300047319 Bacteria 5343
535 Ga0495672_0000995 3300047320 Bacteria 29252
536 Ga0495672_0006835 3300047320 Bacteria 8712
537 Ga0495672_0009422 3300047320 Bacteria 7078
538 Ga0495672_0012784 3300047320 Bacteria 5832
539 Ga0495672_0039353 3300047320 Bacteria 2874
540 Ga0495676_0019606 3300047321 Bacteria 5948
541 Ga0495676_0028059 3300047321 Bacteria 4816
542 Ga0495676_0060712 3300047321 Bacteria 2961
543 Ga0495676_0076369 3300047321 Bacteria 2558
544 Ga0495676_0178149 3300047321 Bacteria 1491
545 Ga0495680_0005885 3300047322 Bacteria 11474
546 Ga0495680_0006126 3300047322 Bacteria 11223
547 Ga0495680_0034155 3300047322 Bacteria 4112
548 Ga0495683_0000091 3300047323 Bacteria 91313
549 Ga0495683_0000578 3300047323 Bacteria 27719
550 Ga0495683_0004864 3300047323 Bacteria 7522
551 Ga0495683_0004934 3300047323 Bacteria 7462
552 Ga0495683_0012413 3300047323 Bacteria 4471
553 Ga0495683_0049206 3300047323 Bacteria 2112
554 Ga0495683_0054009 3300047323 Bacteria 2003
555 Ga0495687_000294 3300047443 Bacteria 65644
556 Ga0495687_007776 3300047443 Bacteria 6242
557 Ga0495687_009595 3300047443 Bacteria 5394
558 Ga0495687_037994 3300047443 Bacteria 2140
559 Ga0495675_0004036 3300047444 Bacteria 8900
560 Ga0495675_0009198 3300047444 Bacteria 6144
561 Ga0495675_0019815 3300047444 Bacteria 4273
562 Ga0495675_0035887 3300047444 Bacteria 3165
563 Ga0495675_0066610 3300047444 Bacteria 2276
564 Ga0495675_0079450 3300047444 Bacteria 2066
565 Ga0495679_000012 3300047446 Bacteria 319098
566 Ga0495679_000083 3300047446 Bacteria 87051
567 Ga0495679_000836 3300047446 Bacteria 19590
568 Ga0495679_002695 3300047446 Bacteria 8870
569 Ga0495679_004048 3300047446 Bacteria 6882
570 Ga0495679_005142 3300047446 Bacteria 5860
571 Ga0495679_012643 3300047446 Bacteria 3201
572 Ga0495679_020535 3300047446 Bacteria 2298
573 Ga0495673_0002326 3300047469 Bacteria 13542
574 Ga0495673_0018789 3300047469 Bacteria 3478
575 Ga0495673_0024236 3300047469 Bacteria 2937
576 Ga0495673_0025962 3300047469 Bacteria 2808
577 Ga0495681_0000221 3300047470 Bacteria 47433
578 Ga0495681_0003291 3300047470 Bacteria 11263
579 Ga0495681_0003640 3300047470 Bacteria 10704
580 Ga0495681_0020343 3300047470 Bacteria 3603
581 Ga0495681_0020972 3300047470 Bacteria 3531
582 Ga0495681_0021981 3300047470 Bacteria 3423
583 Ga0495681_0050074 3300047470 Bacteria 1971
584 Ga0495684_0087175 3300047471 Bacteria 2366
585 Ga0495684_0209711 3300047471 Bacteria 1433
586 Ga0495686_0018124 3300047472 Bacteria 4730
587 Ga0495686_0104286 3300047472 Bacteria 1707
588 Ga0495593_0005316 3300047673 Bacteria 7611
589 Ga0495593_0009716 3300047673 Bacteria 5582
590 Ga0495593_0010034 3300047673 Bacteria 5487
591 Ga0495593_0048562 3300047673 Bacteria 2255
592 Ga0495593_0051621 3300047673 Bacteria 2175
593 Ga0495593_0056666 3300047673 Bacteria 2059
594 Ga0495602_0000273 3300048088 Bacteria 47682
595 Ga0495602_0004558 3300048088 Bacteria 14460
596 Ga0495602_0004974 3300048088 Bacteria 13929
597 Ga0495614_0000622 3300048089 Bacteria 14840
598 Ga0495614_0006093 3300048089 Bacteria 5423
599 Ga0495614_0025392 3300048089 Bacteria 2555
600 Ga0495626_0000079 3300048091 Bacteria 129922
601 Ga0495626_0000780 3300048091 Bacteria 28969
602 Ga0495626_0004861 3300048091 Bacteria 8085
603 Ga0495626_0009255 3300048091 Bacteria 5331
604 Ga0495626_0032337 3300048091 Bacteria 2513
605 Ga0495626_0046741 3300048091 Bacteria 2015
606 Ga0496100_0001296 3300048903 Bacteria 12196
607 Ga0496100_0001665 3300048903 Bacteria 11024
608 Ga0496100_0017056 3300048903 Bacteria 4279
609 Ga0496101_0002522 3300048904 Bacteria 11245
610 Ga0496101_0016831 3300048904 Bacteria 4949
611 Ga0496101_0040422 3300048904 Bacteria 3321
612 Ga0496101_0053450 3300048904 Bacteria 2914
613 Ga0496102_0001350 3300048905 Bacteria 21980
614 Ga0496102_0097094 3300048905 Bacteria 2732
615 Ga0496103_0001506 3300048906 Bacteria 15592
616 Ga0496103_0003909 3300048906 Bacteria 9064
617 Ga0496103_0120776 3300048906 Bacteria 1669
618 Ga0496104_0019780 3300048907 Bacteria 6164
619 Ga0496104_0050742 3300048907 Bacteria 3914
620 Ga0496104_0075968 3300048907 Bacteria 3199
621 Ga0496104_0248049 3300048907 Bacteria 1693
622 Ga0496105_0002749 3300048908 Bacteria 12838
623 Ga0496105_0081522 3300048908 Bacteria 2672
624 Ga0496105_0135066 3300048908 Bacteria 2032
625 Ga0496106_0000009 3300048909 Bacteria 238601
626 Ga0496106_0013618 3300048909 Bacteria 6004
627 Ga0496107_0049469 3300048910 Bacteria 3029
628 Ga0496107_0154554 3300048910 Bacteria 1698
629 Ga0496110_0101590 3300048913 Bacteria 2578
630 Ga0496112_0010241 3300048915 Bacteria 8500
631 Ga0496112_0018946 3300048915 Bacteria 6487
632 Ga0496113_0011172 3300048916 Bacteria 5976
633 Ga0496113_0343028 3300048916 Bacteria 1198
634 Ga0496114_0005479 3300048917 Bacteria 9932
635 Ga0496114_0009118 3300048917 Bacteria 7865
636 Ga0496115_0026182 3300048918 Bacteria 4550
637 Ga0496116_0000010 3300048919 Bacteria 665608
638 Ga0496116_0001291 3300048919 Bacteria 28769
639 Ga0496116_0011474 3300048919 Bacteria 7326
640 Ga0496116_0067790 3300048919 Bacteria 2277
641 Ga0496116_0081671 3300048919 Bacteria 2003
642 Ga0496117_0000359 3300048920 Bacteria 79857
643 Ga0496117_0000756 3300048920 Bacteria 50927
644 Ga0496117_0001866 3300048920 Bacteria 28433
645 Ga0496117_0002606 3300048920 Bacteria 22420
646 Ga0496117_0002873 3300048920 Bacteria 20920
647 Ga0496117_0003110 3300048920 Bacteria 19816
648 Ga0496117_0003258 3300048920 Bacteria 19091
649 Ga0496117_0007888 3300048920 Bacteria 10237
650 Ga0496117_0008340 3300048920 Bacteria 9855
651 Ga0496117_0146439 3300048920 Bacteria 1405
652 Ga0496118_0000206 3300048921 Bacteria 104093
653 Ga0496118_0001374 3300048921 Bacteria 36687
654 Ga0496118_0005183 3300048921 Bacteria 14915
655 Ga0496118_0008980 3300048921 Bacteria 10196
656 Ga0496118_0011627 3300048921 Bacteria 8561
657 Ga0496118_0023844 3300048921 Bacteria 5302
658 Ga0496118_0049864 3300048921 Bacteria 3219
659 Ga0496118_0052999 3300048921 Bacteria 3088
660 Ga0496118_0069082 3300048921 Bacteria 2561
661 Ga0496118_0071991 3300048921 Bacteria 2485
662 Ga0496118_0085903 3300048921 Bacteria 2188
663 Ga0496119_0001027 3300048922 Bacteria 35766
664 Ga0496119_0006480 3300048922 Bacteria 10815
665 Ga0496119_0027482 3300048922 Bacteria 3908
666 Ga0496119_0033096 3300048922 Bacteria 3435
667 Ga0496120_0000898 3300048923 Bacteria 41805
668 Ga0496120_0004791 3300048923 Bacteria 11095
669 Ga0496120_0014526 3300048923 Bacteria 5244
670 Ga0496121_0000050 3300048924 Bacteria 318295
671 Ga0496121_0000907 3300048924 Bacteria 53390
672 Ga0496121_0001440 3300048924 Bacteria 40172
673 Ga0496121_0002508 3300048924 Bacteria 27906
674 Ga0496121_0003075 3300048924 Bacteria 24164
675 Ga0496121_0004007 3300048924 Bacteria 20293
676 Ga0496121_0007922 3300048924 Bacteria 12702
677 Ga0496121_0011830 3300048924 Bacteria 9610
678 Ga0496121_0129280 3300048924 Bacteria 1894
679 Ga0496122_0008015 3300048925 Bacteria 11538
680 Ga0496122_0010856 3300048925 Bacteria 9324
681 Ga0496122_0013046 3300048925 Bacteria 8185
682 Ga0496122_0014275 3300048925 Bacteria 7694
683 Ga0496122_0023743 3300048925 Bacteria 5390
684 Ga0496122_0055368 3300048925 Bacteria 2968
685 Ga0496122_0083665 3300048925 Bacteria 2211
686 Ga0496122_0104113 3300048925 Bacteria 1886
687 Ga0496122_0126330 3300048925 Bacteria 1636
688 Ga0496123_0000609 3300048926 Bacteria 60290
689 Ga0496123_0000899 3300048926 Bacteria 47084
690 Ga0496123_0015526 3300048926 Bacteria 6240
691 Ga0496123_0022723 3300048926 Bacteria 4823
692 Ga0496123_0033203 3300048926 Bacteria 3718
693 Ga0496123_0072822 3300048926 Bacteria 2135
694 Ga0496124_0000309 3300048927 Bacteria 90452
695 Ga0496124_0004118 3300048927 Bacteria 17182
696 Ga0496124_0007907 3300048927 Bacteria 11201
697 Ga0496124_0025222 3300048927 Bacteria 5388
698 Ga0496124_0049493 3300048927 Bacteria 3585
699 Ga0496124_0059878 3300048927 Bacteria 3197
700 Ga0496124_0128445 3300048927 Bacteria 2017
701 Ga0496124_0167340 3300048927 Bacteria 1707
702 Ga0496125_0000080 3300048928 Bacteria 228514
703 Ga0496125_0000459 3300048928 Bacteria 73809
704 Ga0496125_0035903 3300048928 Bacteria 4338
705 Ga0496125_0040213 3300048928 Bacteria 4013
706 Ga0496125_0082063 3300048928 Bacteria 2459
707 Ga0496126_0000065 3300048929 Bacteria 252549
708 Ga0496126_0000503 3300048929 Bacteria 76786
709 Ga0496126_0015672 3300048929 Bacteria 7616
710 Ga0496126_0020710 3300048929 Bacteria 6440
711 Ga0496126_0037650 3300048929 Bacteria 4511
712 Ga0496126_0158007 3300048929 Bacteria 1939
713 Ga0495678_000020 3300049459 Bacteria 253654
714 Ga0495678_028928 3300049459 Bacteria 2332
715 Ga0495678_035143 3300049459 Bacteria 2057
716 Ga0495682_0015036 3300049460 Bacteria 2933
717 Ga0495682_0032221 3300049460 Bacteria 1936
718 Ga0501034_0000685 3300049571 Bacteria 51551
719 Ga0501222_000762 3300049662 Bacteria 4653
720 nmdc:mga08x19_194340_c1 3300050514 Bacteria 1389
721 nmdc:mga0sz30_855_c1 3300050516 Bacteria 6127
722 Ga0500659_0000721 3300053135 Bacteria 21335
723 2501075694 2501025501 Bacteria 7768574
724 2501085806 2501025502 Bacteria 9641094
725 2501408664 2501025504 Bacteria 8008976
726 2509126584 2508501125 Bacteria 7208311
727 2511091497 2510917013 Bacteria 9951648
728 2511098376 2510917014 Bacteria 8296963
729 2511105367 2510917015 Bacteria 7950052
730 2511265037 2511231006 Bacteria 6794709
731 2511287384 2511231010 Bacteria 6373152
732 2511302704 2511231012 Bacteria 6738011
733 2511343746 2511231019 Bacteria 6520662
734 2511373515 2511231024 Bacteria 5835885
735 2511386128 2511231026 Bacteria 5225445
736 2512328910 2512047018 Bacteria 6663241
737 2513557382 2513237082 Bacteria 8640282
738 2513562991 2513237083 Bacteria 8410967
739 2513958132 2513237151 Bacteria 6309801
740 2514053760 2513237166 Bacteria 10373764
741 2515681368 2515154122 Bacteria 8609520
742 2516017576 2515154189 Bacteria 9629850
743 2519462534 2519103095 Bacteria 6629912
744 2527076087 2526164713 Bacteria 6780608
745 2554818505 2554235132 Bacteria 6772433
746 2555247143 2554235231 Bacteria 5215788
747 2555670509 2554235341 Bacteria 6867980
748 2563064949 2562617112 Bacteria 10918404
749 2583792298 2582580891 Bacteria 6800976
750 2585295530 2582581311 Bacteria 6763856
751 2597858403 2597489887 Bacteria 6666321
752 2597863524 2597489888 Bacteria 6179543
753 2599352465 2599185160 Bacteria 6844013
754 2599358814 2599185161 Bacteria 6960462
755 2599365665 2599185162 Bacteria 6957254
756 2599371457 2599185163 Bacteria 6995158
757 2599383706 2599185164 Bacteria 6841688
758 2599385050 2599185165 Bacteria 6843250
759 2599390366 2599185166 Bacteria 6959206
760 2599397531 2599185167 Bacteria 6353609
761 2599402500 2599185168 Bacteria 6997636
762 2599451976 2599185179 Bacteria 6611171
763 2599465185 2599185181 Bacteria 6844519
764 2599466412 2599185182 Bacteria 6883168
765 2599486379 2599185185 Bacteria 6652270
766 2599488319 2599185186 Bacteria 6831633
767 2599509997 2599185189 Bacteria 5862825
768 2599513642 2599185190 Bacteria 6285678
769 2599521947 2599185191 Bacteria 6297582
770 2599737614 2599185239 Bacteria 8686614
771 2599745120 2599185240 Bacteria 7968121
772 2599769086 2599185248 Bacteria 6696816
773 2599803002 2599185257 Bacteria 6492581
774 2599888330 2599185289 Bacteria 6778765
775 2599892319 2599185290 Bacteria 6289611
776 2599895942 2599185291 Bacteria 6775623
777 2599932296 2599185300 Bacteria 6062622
778 2599944269 2599185302 Bacteria 5954930
779 2599954741 2599185304 Bacteria 5951361
780 2599957826 2599185305 Bacteria 6748700
781 2599985683 2599185309 Bacteria 5969593
782 2599991531 2599185310 Bacteria 6014457
783 2600002520 2599185312 Bacteria 5912071
784 2600015550 2599185315 Bacteria 6771107
785 2600050174 2599185320 Bacteria 5963263
786 2600050758 2599185321 Bacteria 6764560
787 2600072721 2599185324 Bacteria 6590677
788 2600206699 2599185355 Bacteria 7968906
789 2600211900 2599185356 Bacteria 6843884
790 2600362750 2600254931 Bacteria 6734225
791 2600813580 2600255067 Bacteria 6795583
792 2601691525 2600255296 Bacteria 5784754
793 2601772068 2600255313 Bacteria 6842543
794 2601796943 2600255318 Bacteria 6383414
795 2606076327 2603880185 Bacteria 6379190
796 2606131237 2603880199 Bacteria 6377649
797 2608385362 2606217733 Bacteria 6360972
798 2621300302 2619619299 Bacteria 6649820
799 2624481227 2623620443 Bacteria 6427864
800 2643844835 2643221565 Bacteria 6216018
801 2643870591 2643221571 Bacteria 6228673
802 2671088634 2667528170 Bacteria 6786960
803 2671096009 2667528171 Bacteria 6900659
804 2671585446 2671180115 Bacteria 5353919
805 2671769376 2671180172 Bacteria 6495783
806 2676743152 2675903129 Bacteria 7964495
807 2677896014 2675903420 Bacteria 6247433
808 2678263695 2675903515 Bacteria 6580491
809 2713482061 2711768613 Bacteria 11048459
810 2715755730 2713897149 Bacteria 6506249
811 2722885565 2721755523 Bacteria 6430384
812 2723248341 2721755607 Bacteria 5841722
813 2738674669 2738541265 Bacteria 6594665
814 2738753062 2738541282 Bacteria 6593925
815 2738823334 2738541296 Bacteria 7285013
816 2738835564 2738541298 Bacteria 7286732
817 2738862217 2738541303 Bacteria 6591772
818 2738877255 2738541306 Bacteria 7284992
819 2739188961 2738543002 Bacteria 7284546
820 2739197807 2738543004 Bacteria 6381073
821 2739223848 2738543008 Bacteria 7282815
822 2739260815 2738543015 Bacteria 6750701
823 2739285896 2738543020 Bacteria 5718238
824 2739291209 2738543021 Bacteria 5718241
825 2743737854 2740892503 Bacteria 6855563
826 2745010026 2744054620 Bacteria 6551379
827 2746087615 2744054900 Bacteria 8399525
828 2746098889 2744054901 Bacteria 8397047
829 2765583640 2765235841 Bacteria 6137024
830 2794597165 2791355520 Bacteria 5948615
831 2807408051 2806310737 Bacteria 5751088
832 2807456354 2806310745 Bacteria 5742165
833 2808941759 2808606379 Bacteria 5022697
834 2808957985 2808606382 Bacteria 6841132
835 2808974088 2808606384 Bacteria 8474373
836 2809007600 2808606390 Bacteria 8476311
837 2809016067 2808606391 Bacteria 8308166
838 2812370437 2811994881 Bacteria 6298475
839 2817263103 2816332253 Bacteria 6764532
840 2817276521 2816332256 Bacteria 6891714
841 2817454586 2816332286 Bacteria 6853759
842 2817490624 2816332298 Bacteria 6852809
843 2819623988 2818991450 Bacteria 6962147
844 2819635675 2818991452 Bacteria 8442785
845 2819700556 2818991464 Bacteria 6907494
846 2837679713 2837678835 Bacteria 5252418
847 2842807681 2842805378 Bacteria 5385175
848 2842827303 2842826826 Bacteria 5974129
849 2842841717 2842837860 Bacteria 6066181
850 2842858266 2842854478 Bacteria 6143501
851 2844671119 2844665904 Bacteria 6817974
852 2856292474 2856287931 Bacteria 7223934
853 2860870927 2860867994 Bacteria 5645326
854 2863427909 2863421361 Bacteria 7300805
855 2870076429 2870068957 Bacteria 8925310
856 2876605039 2876601092 Bacteria 5114497
857 2878033180 2878029506 Bacteria 6418441
858 2885272680 2885270888 Bacteria 9831543
859 2900634473 2900634093 Bacteria 10263517
860 2902686185 2902682994 Bacteria 8951596
861 2904485625 2904483920 Bacteria 7545285
862 2904567105 2904564687 Bacteria 7609577
863 2904573951 2904571731 Bacteria 7608790
864 2904621810 2904615490 Bacteria 10047340
865 2908449071 2908446538 Bacteria 6829095
866 2908674176 2908669403 Bacteria 5740494
867 2913039499 2913036834 Bacteria 6704877
868 2917074337 2917070673 Bacteria 6868303
869 2919067098 2919063839 Bacteria 6302690
870 2919485484 2919481497 Bacteria 6907839
871 2919533789 2919527303 Bacteria 7718827
872 2921644371 2921643360 Bacteria 11448031
873 2923156901 2923153595 Bacteria 6870622
874 2923524528 2923519811 Bacteria 6298479
875 2928109555 2928108538 Bacteria 7360024
876 2928136991 2928135762 Bacteria 7259641
877 2928162607 2928157003 Bacteria 7522202
878 2928166847 2928163908 Bacteria 7561269
879 2928176868 2928170801 Bacteria 8785406
880 2928506519 2928503688 Bacteria 7268108
881 2928541063 2928536128 Bacteria 7657547
882 2929192166 2929189879 Bacteria 5930554
883 2931393518 2931390751 Bacteria 6273349
884 2935355599 2935353572 Unclassified 6955622
885 2939640026 2939636861 Bacteria 6297853
886 2945933035 2945928738 Bacteria 6053221
887 2945936061 2945934425 Bacteria 7444609
888 2945963081 2945961074 Bacteria 7342064
889 2946010481 2946006987 Bacteria 6705746
890 2946031252 2946027586 Bacteria 6049274
891 2947238217 2947233263 Bacteria 6439278
892 2981995304 2981990288 Bacteria 7590678
893 2984289197 2984286254 Bacteria 6702062
894 2990710034 2990703756 Bacteria 7715990
895 3000019644 3000017691 Bacteria 3772574
896 3007316967 3007315729 Bacteria 5076637
897 3007620654 3007619802 Bacteria 6411688
898 3007721650 3007718800 Bacteria 5971527
899 3007809370 3007803356 Bacteria 5931491
900 3007869063 3007866637 Bacteria 5899198
901 637320862 637000220 Bacteria 7074893
902 642422573 641736151 Bacteria 7477263
903 642417885 641736154 Bacteria 7689995
904 642597751 642555112 Bacteria 8676562
905 642621921 642555113 Bacteria 8214658
906 8003955866 8003955200 Bacteria 8601927
907 8011356091 8011350971 Bacteria 6158957
908 8015691146 8015687852 Bacteria 6613826
909 8018846121 8018845410 Bacteria 8933938
910 8019775453 8019769354 Bacteria 6924660
911 8020811539 8020807995 Bacteria 6801506
912 8020940135 8020938398 Bacteria 7472757
913 8020948171 8020945358 Bacteria 8467355
914 8020960356 8020953355 Bacteria 7439080
915 8021124653 8021120328 Bacteria 8782274
916 8039103673 8039098773 Bacteria 6602928
917 8040172896 8040167225 Bacteria 6542727
918 8040178796 8040173305 Bacteria 6827067
919 8052496841 8052494512 Bacteria 5765634
920 8054347923 8054347763 Bacteria 5901107
921 8054931536 8054929484 Bacteria 5599761
922 8055303173 8055301274 Bacteria 8587385
923 8055774284 8055770955 Bacteria 6827675
924 8055821523 8055817908 Bacteria 6609162
925 8055882693 8055878733 Bacteria 5907058
926 8056119044 8056115690 Bacteria 5527654
927 8056123849 8056120720 Bacteria 5758328
928 8056129509 8056125926 Bacteria 6228218
929 8056140722 8056137416 Bacteria 6147080
930 8056146092 8056143049 Bacteria 6307666
931 8056155006 8056148874 Bacteria 6479865
932 8056165676 8056161164 Bacteria 6106669
933 8056179192 8056177738 Bacteria 6748268
934 8057801109 8057798959 Bacteria 6713499
935 Ga0079104_1000037
936 SwRhRL2b_contig_2621290
937 SwRhRL2b_contig_3688828
938 JGI24739J22299_10007158
939 JGI24735J21928_10000299
940 JGI24735J21928_10002925
941 JGI24735J21928_10007036
942 JGI25156J39149_1000506
943 JGI25162J39368_1000164
944 JGI25163J39215_1000025
945 JGI25164J39214_1000126
946 JGI25165J46597_1000247
947 rootH2_10164091
948 rootH2_10197494
949 rootL2_10002460
950 JGI25160J50197_1000074
951 Ga0055538_1000537
952 Ga0055539_1000466
953 Ga0055533_1000551
954 Ga0055533_1000984
955 Ga0055532_1000055
956 Ga0055532_1000358
957 Ga0055532_1000652
958 Ga0055525_1000658
959 Ga0055527_1000030
960 Ga0055535_1000038
961 Ga0055542_1000063
962 Ga0055529_1000071
963 Ga0055536_1000005
964 Ga0055536_1000037
965 Ga0055530_10000001
966 Ga0055530_10000606
967 Ga0055530_10000865
968 Ga0055540_1000025
969 Ga0055540_1000302
970 Ga0055531_10000301
971 Ga0055541_1000388
972 Ga0058692_1000515
973 Ga0065165_1000203
974 Ga0065714_10064945
975 Ga0065714_10067899
976 Ga0065704_10071472
977 Ga0065704_10071534
978 Ga0070670_100000390
979 Ga0070666_10030121
980 Ga0070682_100117693
981 Ga0070660_100000188
982 Ga0070661_100076456
983 Ga0070669_100132752
984 Ga0070659_100000006
985 Ga0070667_100046498
986 Ga0070667_100187346
987 Ga0070663_100011648
988 Ga0070662_100018038
989 Ga0070679_100037174
990 Ga0068855_100104269
991 Ga0068852_100155803
992 Ga0068851_10001228
993 Ga0075364_10000318
994 Ga0075364_10193052
995 Ga0099823_1000017
996 Ga0079104_1000060
997 Ga0079104_1000142
998 Ga0105251_10001555
999 Ga0105251_10005237
1000 Ga0105251_10012466
1001 Ga0105251_10015734
1002 Ga0105251_10050949
1003 Ga0105251_10050950
1004 Ga0105251_10090437
1005 Ga0105251_10091778
1006 Ga0105244_10000533
1007 Ga0105244_10000804
1008 Ga0105244_10001274
1009 Ga0105244_10015346
1010 Ga0105244_10021413
1011 Ga0105244_10031342
1012 Ga0105244_10048150
1013 Ga0105250_10026427
1014 Ga0105250_10032517
1015 Ga0105240_10005736
1016 Ga0105240_10339894
1017 Ga0105243_10000099
1018 Ga0105243_10001355
1019 Ga0105243_10012812
1020 Ga0105237_10211339
1021 Ga0105249_10359899
1022 Ga0105239_10009639
1023 Ga0105246_10000626
1024 Ga0105246_10001438
1025 Ga0157373_10000315
1026 Ga0157373_10000596
1027 Ga0157373_10005498
1028 Ga0157371_10001604
1029 Ga0157370_10000264
1030 Ga0157370_10149938
1031 Ga0157369_10019522
1032 Ga0157369_10020661
1033 Ga0157369_10021547
1034 Ga0157369_10293892
1035 Ga0157374_10027105
1036 Ga0163162_10001693
1037 Ga0157372_10084385
1038 Ga0157375_10000602
1039 Ga0157375_10002153
1040 Ga0182008_10000425
1041 Ga0182008_10001433
1042 Ga0182008_10001892
1043 Ga0182008_10011969
1044 Ga0182007_10002722
1045 Ga0182007_10012041
1046 Ga0182005_1000533
1047 Ga0182005_1019429
1048 Ga0163161_10002303
1049 Ga0163161_10002711
1050 Ga0163161_10007270
1051 Ga0163161_10010811
1052 Ga0209760_100076
1053 Ga0209784_100065
1054 Ga0209566_100081
1055 Ga0209566_100570
1056 Ga0209674_100022
1057 Ga0209674_100093
1058 Ga0209674_100101
1059 Ga0209674_102954
1060 Ga0209672_100001
1061 Ga0209147_100001
1062 Ga0209147_100021
1063 Ga0209147_100152
1064 Ga0209563_100098
1065 Ga0207427_100022
1066 Ga0207427_101241
1067 Ga0209437_100002
1068 Ga0209258_100001
1069 Ga0209258_100969
1070 Ga0209646_1000363
1071 Ga0209677_100059
1072 Ga0209148_1000003
1073 Ga0209759_1000030
1074 Ga0209759_1000039
1075 Ga0209759_1000099
1076 Ga0209759_1003695
1077 Ga0209233_1000004
1078 Ga0209233_1000180
1079 Ga0209455_1000001
1080 Ga0209673_1000520
1081 Ga0209130_1010530
1082 Ga0209675_1001483
1083 Ga0209676_1000002
1084 Ga0209676_1000003
1085 Ga0209676_1000522
1086 Ga0209564_1020289
1087 Ga0209050_1000004
1088 Ga0209050_1000006
1089 Ga0207426_1000018
1090 Ga0207426_1001166
1091 Ga0209051_1000001
1092 Ga0209051_1000006
1093 Ga0209257_1000056
1094 Ga0207656_10000679
1095 Ga0207696_1000006
1096 Ga0207696_1000013
1097 Ga0207696_1015699
1098 Ga0207696_1023591
1099 Ga0207655_1000143
1100 Ga0207655_1000338
1101 Ga0207655_1000432
1102 Ga0207655_1005437
1103 Ga0207655_1021816
1104 Ga0207655_1039816
1105 Ga0207713_1000551
1106 Ga0207713_1000698
1107 Ga0207713_1001164
1108 Ga0207713_1002903
1109 Ga0207713_1008002
1110 Ga0207713_1014678
1111 Ga0207680_10019143
1112 Ga0207647_10011975
1113 Ga0207647_10012538
1114 Ga0207695_10001620
1115 Ga0207657_10000270
1116 Ga0207652_10054097
1117 Ga0207681_10026264
1118 Ga0207694_10125640
1119 Ga0207650_10000204
1120 Ga0207644_10347968
1121 Ga0207690_10000019
1122 Ga0207706_10003884
1123 Ga0207709_10000014
1124 Ga0207709_10006726
1125 Ga0207667_10076888
1126 Ga0207640_10279697
1127 Ga0207678_10005353
1128 Ga0207683_10196510
1129 Ga0207698_10012043
1130 Ga0209281_1000002
1131 Ga0209281_1000064
1132 Ga0209281_1000262
1133 Ga0209389_1000022
1134 Ga0209371_1000087
1135 Ga0209371_1000203
1136 Ga0209371_1000342
1137 Ga0209371_1001734
1138 Ga0207428_10056347
1139 Ga0307515_10155884
1140 Ga0268256_1000101
1141 Ga0268256_1000291
1142 Ga0268256_1001512
1143 Ga0268256_1001704
1144 Ga0307408_100000145
1145 Ga0307408_100007984
1146 Ga0307408_100241942
1147 Ga0307514_10008864
1148 Ga0307405_10000291
1149 Ga0307405_10019036
1150 Ga0307405_10020660
1151 Ga0307405_10224191
1152 Ga0307406_10004000
1153 Ga0307412_10000005
1154 Ga0307412_10007665
1155 Ga0307412_10074752
1156 Ga0307414_10012008
1157 Ga0307411_10123024
1158 Ga0395898_0019835
1159 Ga0395905_0000009
1160 Ga0395905_0001003
1161 Ga0395905_0030642
1162 Ga0395905_0036368
1163 Ga0237819_00471
1164 Ga0436365_1175663
1165 Ga0439436_0000760
1166 Ga0439438_000077
1167 Ga0439438_000205
1168 Ga0439438_000478
1169 Ga0439438_001753
1170 Ga0439438_001852
1171 Ga0439438_010096
1172 Ga0439438_010249
1173 Ga0439447_001433
1174 Ga0439447_002447
1175 Ga0439447_006498
1176 Ga0439447_015499
1177 Ga0439466_0000298
1178 Ga0439466_0003539
1179 Ga0439466_0004779
1180 Ga0439466_0018522
1181 Ga0439466_0038296
1182 Ga0439466_0040527
1183 Ga0439431_0000666
1184 Ga0439445_0008480
1185 Ga0439432_000501
1186 Ga0439432_002222
1187 Ga0439432_007170
1188 Ga0439432_009762
1189 Ga0439452_000085
1190 Ga0439452_000136
1191 Ga0439452_002958
1192 Ga0439452_003624
1193 Ga0439456_000198
1194 Ga0439456_002185
1195 Ga0450911_003465
1196 Ga0450920_006057
1197 Ga0450922_000899
1198 Ga0450902_008077
1199 Ga0450903_003563
1200 Ga0450905_003188
1201 Ga0450906_009657
1202 Ga0450907_003161
1203 Ga0450910_001413
1204 Ga0450910_001955
1205 Ga0450909_002438
1206 Ga0439434_0000582
1207 Ga0439464_0011819
1208 Ga0439440_0005583
1209 Ga0466969_0010596
1210 Ga0466977_0000224
1211 Ga0466966_0005241
1212 Ga0466970_0012731
1213 Ga0466957_0117768
1214 Ga0466958_0175341
1215 Ga0495627_000504
1216 Ga0495627_000781
1217 Ga0495627_007203
1218 Ga0495592_0062026
1219 Ga0495603_0000871
1220 Ga0495603_0055956
1221 Ga0495590_0000173
1222 Ga0495590_0002472
1223 Ga0495591_000117
1224 Ga0495591_002734
1225 Ga0495591_003659
1226 Ga0495629_0000310
1227 Ga0495629_0005414
1228 Ga0495629_0021205
1229 Ga0495629_0021382
1230 Ga0495629_0022413
1231 Ga0495629_0054792
1232 Ga0495638_0001452
1233 Ga0495638_0007494
1234 Ga0495638_0090744
1235 Ga0495638_0111512
1236 Ga0495641_0009924
1237 Ga0495651_0051887
1238 Ga0495653_0000937
1239 Ga0495653_0006194
1240 Ga0495653_0015189
1241 Ga0495653_0017779
1242 Ga0495653_0049902
1243 Ga0495650_0000628
1244 Ga0495650_0000802
1245 Ga0495650_0001184
1246 Ga0495650_0004910
1247 Ga0495650_0006982
1248 Ga0495650_0007178
1249 Ga0495650_0012173
1250 Ga0495650_0028536
1251 Ga0495650_0028682
1252 Ga0495580_0000047
1253 Ga0495580_0001969
1254 Ga0495580_0007575
1255 Ga0495580_0023965
1256 Ga0495580_0037797
1257 Ga0495582_0002684
1258 Ga0495582_0019964
1259 Ga0495582_0036563
1260 Ga0495605_0000036
1261 Ga0495605_0000631
1262 Ga0495605_0002926
1263 Ga0495605_0003631
1264 Ga0495605_0019021
1265 Ga0495605_0022213
1266 Ga0495662_0016913
1267 Ga0495664_0002835
1268 Ga0495664_0024889
1269 Ga0495584_0001618
1270 Ga0495584_0115241
1271 Ga0495585_0000284
1272 Ga0495585_0000711
1273 Ga0495585_0029587
1274 Ga0495585_0032050
1275 Ga0495594_0006259
1276 Ga0495596_0005767
1277 Ga0495596_0007942
1278 Ga0495596_0012731
1279 Ga0495607_0036051
1280 Ga0495607_0088520
1281 Ga0495583_0000028
1282 Ga0495583_0000109
1283 Ga0495583_0000511
1284 Ga0495583_0001837
1285 Ga0495583_0006414
1286 Ga0495583_0017299
1287 Ga0495606_0000204
1288 Ga0495606_0000270
1289 Ga0495606_0001623
1290 Ga0495606_0011345
1291 Ga0495606_0011356
1292 Ga0495606_0028555
1293 Ga0495606_0033517
1294 Ga0495606_0037710
1295 Ga0495606_0078706
1296 Ga0495608_0085761
1297 Ga0495610_0006250
1298 Ga0495610_0014560
1299 Ga0495610_0024169
1300 Ga0495610_0032287
1301 Ga0495610_0037818
1302 Ga0495610_0046618
1303 Ga0495610_0049498
1304 Ga0495610_0053315
1305 Ga0495610_0053707
1306 Ga0495616_0039330
1307 Ga0495616_0083207
1308 Ga0495618_0002049
1309 Ga0495618_0013398
1310 Ga0495618_0017322
1311 Ga0495620_0000049
1312 Ga0495620_0000073
1313 Ga0495620_0009807
1314 Ga0495620_0022114
1315 Ga0495628_0005251
1316 Ga0495628_0015580
1317 Ga0495628_0031441
1318 Ga0495628_0046817
1319 Ga0495628_0047821
1320 Ga0495628_0135357
1321 Ga0495630_0001476
1322 Ga0495630_0005335
1323 Ga0495630_0028040
1324 Ga0495630_0050899
1325 Ga0495630_0061356
1326 Ga0495631_0061618
1327 Ga0495632_0000051
1328 Ga0495632_0000742
1329 Ga0495632_0001635
1330 Ga0495632_0003365
1331 Ga0495637_0007116
1332 Ga0495637_0020012
1333 Ga0495637_0022414
1334 Ga0495637_0030956
1335 Ga0495637_0042350
1336 Ga0495643_0000150
1337 Ga0495643_0000152
1338 Ga0495643_0000445
1339 Ga0495643_0001282
1340 Ga0495644_0051973
1341 Ga0495648_0000512
1342 Ga0495648_0000560
1343 Ga0495648_0001151
1344 Ga0495648_0001307
1345 Ga0495648_0002230
1346 Ga0495648_0050276
1347 Ga0495648_0061099
1348 Ga0495648_0068855
1349 Ga0495666_0004585
1350 Ga0495642_0000018
1351 Ga0495642_0003020
1352 Ga0495642_0012506
1353 Ga0495652_0010089
1354 Ga0495652_0022094
1355 Ga0495652_0068711
1356 Ga0495652_0192799
1357 Ga0495654_0000246
1358 Ga0495654_0000432
1359 Ga0495654_0002687
1360 Ga0495654_0005855
1361 Ga0495654_0010556
1362 Ga0495654_0011171
1363 Ga0495654_0062578
1364 Ga0495654_0108985
1365 Ga0495665_0005136
1366 Ga0495665_0017762
1367 Ga0495665_0025622
1368 Ga0495665_0028537
1369 Ga0495640_0007879
1370 Ga0495586_0001052
1371 Ga0495586_0008468
1372 Ga0495586_0078806
1373 Ga0495587_0004029
1374 Ga0495587_0012559
1375 Ga0495609_0000014
1376 Ga0495609_0000115
1377 Ga0495597_0000635
1378 Ga0495597_0003598
1379 Ga0495597_0016635
1380 Ga0495597_0054975
1381 Ga0495645_0000185
1382 Ga0495645_0000915
1383 Ga0495645_0086631
1384 Ga0495645_0107292
1385 Ga0495633_0000028
1386 Ga0495667_0019337
1387 Ga0495668_0021608
1388 Ga0495634_0026224
1389 Ga0495634_0046998
1390 Ga0495611_0036346
1391 Ga0495611_0041270
1392 Ga0495625_0107485
1393 Ga0495635_0003126
1394 Ga0495635_0019568
1395 Ga0495635_0026970
1396 Ga0495635_0036214
1397 Ga0495635_0039275
1398 Ga0495661_0000007
1399 Ga0495661_0000100
1400 Ga0495661_0000144
1401 Ga0495661_0000211
1402 Ga0495661_0010888
1403 Ga0495661_0014156
1404 Ga0495661_0029189
1405 Ga0495661_0061942
1406 Ga0495588_0029072
1407 Ga0495588_0050748
1408 Ga0495657_0065714
1409 Ga0495599_0001328
1410 Ga0495599_0024802
1411 Ga0495599_0068519
1412 Ga0495623_0001986
1413 Ga0495623_0006279
1414 Ga0495623_0041565
1415 Ga0495623_0055802
1416 Ga0495623_0101012
1417 Ga0495646_0001386
1418 Ga0495646_0004735
1419 Ga0495646_0082040
1420 Ga0495646_0088712
1421 Ga0495669_0019138
1422 Ga0495669_0047114
1423 Ga0495613_0023372
1424 Ga0495624_0000502
1425 Ga0495624_0001403
1426 Ga0495624_0003505
1427 Ga0495624_0005612
1428 Ga0495624_0012833
1429 Ga0495624_0018840
1430 Ga0495624_0058746
1431 Ga0495670_0000942
1432 Ga0495671_0003839
1433 Ga0495671_0004675
1434 Ga0495671_0015247
1435 Ga0495671_0027953
1436 Ga0495671_0082985
1437 Ga0495671_0095866
1438 Ga0495649_0000110
1439 Ga0495649_0000764
1440 Ga0495649_0002230
1441 Ga0495649_0007336
1442 Ga0495649_0008267
1443 Ga0495649_0015493
1444 Ga0495649_0024949
1445 Ga0495649_0027847
1446 Ga0495649_0055582
1447 Ga0495649_0057493
1448 Ga0495649_0089239
1449 Ga0495589_0000297
1450 Ga0495589_0002558
1451 Ga0495589_0003366
1452 Ga0495589_0005324
1453 Ga0495589_0019622
1454 Ga0495589_0037158
1455 Ga0495600_0005652
1456 Ga0495660_0029420
1457 Ga0495581_0002420
1458 Ga0495581_0016499
1459 Ga0495604_0000506
1460 Ga0495604_0004171
1461 Ga0495604_0017237
1462 Ga0495604_0048542
1463 Ga0495604_0119157
1464 Ga0495674_0000598
1465 Ga0495674_0004116
1466 Ga0495674_0013144
1467 Ga0495674_0019972
1468 Ga0495674_0026139
1469 Ga0495672_0000995
1470 Ga0495672_0006835
1471 Ga0495672_0009422
1472 Ga0495672_0012784
1473 Ga0495672_0039353
1474 Ga0495676_0019606
1475 Ga0495676_0028059
1476 Ga0495676_0060712
1477 Ga0495676_0076369
1478 Ga0495676_0178149
1479 Ga0495680_0005885
1480 Ga0495680_0006126
1481 Ga0495680_0034155
1482 Ga0495683_0000091
1483 Ga0495683_0000578
1484 Ga0495683_0004864
1485 Ga0495683_0004934
1486 Ga0495683_0012413
1487 Ga0495683_0049206
1488 Ga0495683_0054009
1489 Ga0495687_000294
1490 Ga0495687_007776
1491 Ga0495687_009595
1492 Ga0495687_037994
1493 Ga0495675_0004036
1494 Ga0495675_0009198
1495 Ga0495675_0019815
1496 Ga0495675_0035887
1497 Ga0495675_0066610
1498 Ga0495675_0079450
1499 Ga0495679_000012
1500 Ga0495679_000083
1501 Ga0495679_000836
1502 Ga0495679_002695
1503 Ga0495679_004048
1504 Ga0495679_005142
1505 Ga0495679_012643
1506 Ga0495679_020535
1507 Ga0495673_0002326
1508 Ga0495673_0018789
1509 Ga0495673_0024236
1510 Ga0495673_0025962
1511 Ga0495681_0000221
1512 Ga0495681_0003291
1513 Ga0495681_0003640
1514 Ga0495681_0020343
1515 Ga0495681_0020972
1516 Ga0495681_0021981
1517 Ga0495681_0050074
1518 Ga0495684_0087175
1519 Ga0495684_0209711
1520 Ga0495686_0018124
1521 Ga0495686_0104286
1522 Ga0495593_0005316
1523 Ga0495593_0009716
1524 Ga0495593_0010034
1525 Ga0495593_0048562
1526 Ga0495593_0051621
1527 Ga0495593_0056666
1528 Ga0495602_0000273
1529 Ga0495602_0004558
1530 Ga0495602_0004974
1531 Ga0495614_0000622
1532 Ga0495614_0006093
1533 Ga0495614_0025392
1534 Ga0495626_0000079
1535 Ga0495626_0000780
1536 Ga0495626_0004861
1537 Ga0495626_0009255
1538 Ga0495626_0032337
1539 Ga0495626_0046741
1540 Ga0496100_0001296
1541 Ga0496100_0001665
1542 Ga0496100_0017056
1543 Ga0496101_0002522
1544 Ga0496101_0016831
1545 Ga0496101_0040422
1546 Ga0496101_0053450
1547 Ga0496102_0001350
1548 Ga0496102_0097094
1549 Ga0496103_0001506
1550 Ga0496103_0003909
1551 Ga0496103_0120776
1552 Ga0496104_0019780
1553 Ga0496104_0050742
1554 Ga0496104_0075968
1555 Ga0496104_0248049
1556 Ga0496105_0002749
1557 Ga0496105_0081522
1558 Ga0496105_0135066
1559 Ga0496106_0000009
1560 Ga0496106_0013618
1561 Ga0496107_0049469
1562 Ga0496107_0154554
1563 Ga0496110_0101590
1564 Ga0496112_0010241
1565 Ga0496112_0018946
1566 Ga0496113_0011172
1567 Ga0496113_0343028
1568 Ga0496114_0005479
1569 Ga0496114_0009118
1570 Ga0496115_0026182
1571 Ga0496116_0000010
1572 Ga0496116_0001291
1573 Ga0496116_0011474
1574 Ga0496116_0067790
1575 Ga0496116_0081671
1576 Ga0496117_0000359
1577 Ga0496117_0000756
1578 Ga0496117_0001866
1579 Ga0496117_0002606
1580 Ga0496117_0002873
1581 Ga0496117_0003110
1582 Ga0496117_0003258
1583 Ga0496117_0007888
1584 Ga0496117_0008340
1585 Ga0496117_0146439
1586 Ga0496118_0000206
1587 Ga0496118_0001374
1588 Ga0496118_0005183
1589 Ga0496118_0008980
1590 Ga0496118_0011627
1591 Ga0496118_0023844
1592 Ga0496118_0049864
1593 Ga0496118_0052999
1594 Ga0496118_0069082
1595 Ga0496118_0071991
1596 Ga0496118_0085903
1597 Ga0496119_0001027
1598 Ga0496119_0006480
1599 Ga0496119_0027482
1600 Ga0496119_0033096
1601 Ga0496120_0000898
1602 Ga0496120_0004791
1603 Ga0496120_0014526
1604 Ga0496121_0000050
1605 Ga0496121_0000907
1606 Ga0496121_0001440
1607 Ga0496121_0002508
1608 Ga0496121_0003075
1609 Ga0496121_0004007
1610 Ga0496121_0007922
1611 Ga0496121_0011830
1612 Ga0496121_0129280
1613 Ga0496122_0008015
1614 Ga0496122_0010856
1615 Ga0496122_0013046
1616 Ga0496122_0014275
1617 Ga0496122_0023743
1618 Ga0496122_0055368
1619 Ga0496122_0083665
1620 Ga0496122_0104113
1621 Ga0496122_0126330
1622 Ga0496123_0000609
1623 Ga0496123_0000899
1624 Ga0496123_0015526
1625 Ga0496123_0022723
1626 Ga0496123_0033203
1627 Ga0496123_0072822
1628 Ga0496124_0000309
1629 Ga0496124_0004118
1630 Ga0496124_0007907
1631 Ga0496124_0025222
1632 Ga0496124_0049493
1633 Ga0496124_0059878
1634 Ga0496124_0128445
1635 Ga0496124_0167340
1636 Ga0496125_0000080
1637 Ga0496125_0000459
1638 Ga0496125_0035903
1639 Ga0496125_0040213
1640 Ga0496125_0082063
1641 Ga0496126_0000065
1642 Ga0496126_0000503
1643 Ga0496126_0015672
1644 Ga0496126_0020710
1645 Ga0496126_0037650
1646 Ga0496126_0158007
1647 Ga0495678_000020
1648 Ga0495678_028928
1649 Ga0495678_035143
1650 Ga0495682_0015036
1651 Ga0495682_0032221
1652 Ga0501034_0000685
1653 Ga0501222_000762
1654 nmdc:mga08x19_194340_c1
1655 nmdc:mga0sz30_855_c1
1656 Ga0500659_0000721
1657 2501075694
1658 2501085806
1659 2501408664
1660 2509126584
1661 2511091497
1662 2511098376
1663 2511105367
1664 2511265037
1665 2511287384
1666 2511302704
1667 2511343746
1668 2511373515
1669 2511386128
1670 2512328910
1671 2513557382
1672 2513562991
1673 2513958132
1674 2514053760
1675 2515681368
1676 2516017576
1677 2519462534
1678 2527076087
1679 2554818505
1680 2555247143
1681 2555670509
1682 2563064949
1683 2583792298
1684 2585295530
1685 2597858403
1686 2597863524
1687 2599352465
1688 2599358814
1689 2599365665
1690 2599371457
1691 2599383706
1692 2599385050
1693 2599390366
1694 2599397531
1695 2599402500
1696 2599451976
1697 2599465185
1698 2599466412
1699 2599486379
1700 2599488319
1701 2599509997
1702 2599513642
1703 2599521947
1704 2599737614
1705 2599745120
1706 2599769086
1707 2599803002
1708 2599888330
1709 2599892319
1710 2599895942
1711 2599932296
1712 2599944269
1713 2599954741
1714 2599957826
1715 2599985683
1716 2599991531
1717 2600002520
1718 2600015550
1719 2600050174
1720 2600050758
1721 2600072721
1722 2600206699
1723 2600211900
1724 2600362750
1725 2600813580
1726 2601691525
1727 2601772068
1728 2601796943
1729 2606076327
1730 2606131237
1731 2608385362
1732 2621300302
1733 2624481227
1734 2643844835
1735 2643870591
1736 2671088634
1737 2671096009
1738 2671585446
1739 2671769376
1740 2676743152
1741 2677896014
1742 2678263695
1743 2713482061
1744 2715755730
1745 2722885565
1746 2723248341
1747 2738674669
1748 2738753062
1749 2738823334
1750 2738835564
1751 2738862217
1752 2738877255
1753 2739188961
1754 2739197807
1755 2739223848
1756 2739260815
1757 2739285896
1758 2739291209
1759 2743737854
1760 2745010026
1761 2746087615
1762 2746098889
1763 2765583640
1764 2794597165
1765 2807408051
1766 2807456354
1767 2808941759
1768 2808957985
1769 2808974088
1770 2809007600
1771 2809016067
1772 2812370437
1773 2817263103
1774 2817276521
1775 2817454586
1776 2817490624
1777 2819623988
1778 2819635675
1779 2819700556
1780 2837679713
1781 2842807681
1782 2842827303
1783 2842841717
1784 2842858266
1785 2844671119
1786 2856292474
1787 2860870927
1788 2863427909
1789 2870076429
1790 2876605039
1791 2878033180
1792 2885272680
1793 2900634473
1794 2902686185
1795 2904485625
1796 2904567105
1797 2904573951
1798 2904621810
1799 2908449071
1800 2908674176
1801 2913039499
1802 2917074337
1803 2919067098
1804 2919485484
1805 2919533789
1806 2921644371
1807 2923156901
1808 2923524528
1809 2928109555
1810 2928136991
1811 2928162607
1812 2928166847
1813 2928176868
1814 2928506519
1815 2928541063
1816 2929192166
1817 2931393518
1818 2935355599
1819 2939640026
1820 2945933035
1821 2945936061
1822 2945963081
1823 2946010481
1824 2946031252
1825 2947238217
1826 2981995304
1827 2984289197
1828 2990710034
1829 3000019644
1830 3007316967
1831 3007620654
1832 3007721650
1833 3007809370
1834 3007869063
1835 637320862
1836 642422573
1837 642417885
1838 642597751
1839 642621921
1840 8003955866
1841 8011356091
1842 8015691146
1843 8018846121
1844 8019775453
1845 8020811539
1846 8020940135
1847 8020948171
1848 8020960356
1849 8021124653
1850 8039103673
1851 8040172896
1852 8040178796
1853 8052496841
1854 8054347923
1855 8054931536
1856 8055303173
1857 8055774284
1858 8055821523
1859 8055882693
1860 8056119044
1861 8056123849
1862 8056129509
1863 8056140722
1864 8056146092
1865 8056155006
1866 8056165676
1867 8056179192
1868 8057801109

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

172

285

0.96

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

68

382

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uoi-assembly1.cif.gz_A-2 crystallographic structure of dape from enterococcus faecium 0.8778 1 383
7uoi-assembly1.cif.gz_A-2 crystallographic structure of dape from enterococcus faecium 0.8655 1 383
7rsf-assembly1.cif.gz_B acetylornithine deacetylase from escherichia coli 0.8456 5 384
7rsf-assembly1.cif.gz_B acetylornithine deacetylase from escherichia coli 0.8355 5 384
2f7v-assembly1.cif.gz_A structure of acetylcitrulline deacetylase complexed with one co 0.8266 5 379
ID Description Score Start End Superfamily
af_Q4DU62_176_300_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9636 177 298 3.30.70.360
af_Q4CYZ5_181_305_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9516 177 298 3.30.70.360
af_Q4CYZ5_13_177_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9507 11 169 3.40.630.10
af_Q4DU62_26_162_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9483 30 160 3.40.630.10
af_Q4CR09_181_288_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9446 177 282 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A7Y7E1B2-F1-model_v4 deleted 0.9923 5 138
AF-A0A127I5S1-F1-model_v4 Acetylornithine deacetylase 0.9838 5 384 GO:0005737
GO:0006526
GO:0008777
GO:0009014
GO:0046872
AF-A0A6M1CIQ8-F1-model_v4 deleted 0.9815 5 175
AF-A0A382WQI5-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9782 5 142 GO:0006526
GO:0008777
AF-A0A258KCC3-F1-model_v4 Acetylornithine deacetylase 0.9764 3 124 GO:0006526
GO:0008777

Map