F486121
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 934 | 488 | 1868 | 385 |
Family's Representative Sequence
| Representative Sequence | 3300006946|Ga0079104_1000037|Ga0079104_1000037165 |
| Length | 405 |
| Sequence | MNKPTSRDLLRSLVGFPTVSRDSNLALIGFIQRYLADLGVQSELLHNAEGTKANLFATIGPRDRGGIVLSGHTDVVPVDGQAWTMEPFRLTEAHGRLYGRGTADMKGFIASVLAAVPLFLRQPLSMPVHLAFSYDEEVGCLGVRSLLSELQNRPHRPRLCLIGEPTELQPVLGHKGKLAMRCRIQGAACHSAHAPRGVNAIGYAARVIRKLDEIAARLSRPEHHDPRFDPPFSTVQVGVIQGGRALNIVPAECEFDFEVRALPGFDAHEVAYELQDYAETDLQPLMQAVQPGTGIRLQPLSAYPGLATPPESEAAQLLTLLSGRRDFGTVAFGTEGGLFDQAGIPTVVCGPASMDQGHKPDEFITVEQLQACDAMLARLAAHLTQVDGATQDPARPQAEDSRHPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 46 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 47 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 122 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 130 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 131 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 132 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 133 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 134 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 135 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 136 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 137 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 138 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 139 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 140 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 141 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 142 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 143 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 144 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 145 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 146 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 147 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 148 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 149 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 150 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 151 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 152 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 153 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 154 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 155 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 156 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 266 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 267 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 274 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 277 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 278 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 279 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 280 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 281 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 282 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 283 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 284 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 285 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 286 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 287 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 288 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 289 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 290 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 291 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 292 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 293 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 294 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 295 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 296 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 297 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 298 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 299 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 300 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 301 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 302 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 303 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 304 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 305 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 306 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 307 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 308 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 309 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 310 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 311 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 312 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 313 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 314 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 315 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 316 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 317 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 318 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 319 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 320 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 321 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 322 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 323 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 324 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 325 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 326 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 327 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 328 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 329 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 330 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 331 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 332 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 333 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 334 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 335 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 336 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 337 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 338 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 339 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 340 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 341 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 342 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 343 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 344 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 345 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 346 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 347 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 348 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 349 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 350 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 351 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 352 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 353 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 354 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 355 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 356 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 357 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 358 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 359 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 360 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 361 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 362 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 363 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 364 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 365 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 366 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 367 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 368 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 369 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 370 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 371 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 372 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 373 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 374 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 375 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 376 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 377 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 378 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 379 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 380 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 381 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 382 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 383 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 384 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 385 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 386 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 387 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 388 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 389 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 390 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 391 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 392 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 393 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 394 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 395 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 396 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 397 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 398 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 399 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 400 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 401 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 402 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 403 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 404 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 405 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 406 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 407 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 408 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 409 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 410 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 411 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 412 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 413 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 414 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 415 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 416 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 417 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 418 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 419 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 420 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 421 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 422 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 423 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 424 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 425 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 426 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 427 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 428 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 429 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 430 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 431 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 432 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 433 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 434 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 435 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 436 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 437 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 438 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 439 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 440 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 441 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 442 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 443 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 444 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 445 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 446 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 447 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 448 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 449 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 450 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 451 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 452 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 453 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 454 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 455 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 456 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 457 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 458 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 459 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 460 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 461 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 462 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 463 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 464 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 465 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 466 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 467 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 468 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 469 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 470 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 471 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 472 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 473 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 474 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 475 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 476 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 477 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 478 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 479 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 480 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 481 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 482 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 483 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 484 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 485 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 486 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 487 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 488 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.3 |
| Metatranscriptomes | 0 |
| Isolates | 22.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.28 |
| Nodule | 2.68 |
| Rhizoplane | 8.78 |
| Rhizosphere | 63.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0079104_1000037 | 3300006946 | Bacteria | 189207 |
| 2 | SwRhRL2b_contig_2621290 | 2162886007 | Bacteria | 2519 |
| 3 | SwRhRL2b_contig_3688828 | 2162886007 | Bacteria | 1913 |
| 4 | JGI24739J22299_10007158 | 3300001989 | Bacteria | 4199 |
| 5 | JGI24735J21928_10000299 | 3300002067 | Bacteria | 17255 |
| 6 | JGI24735J21928_10002925 | 3300002067 | Bacteria | 5878 |
| 7 | JGI24735J21928_10007036 | 3300002067 | Bacteria | 3677 |
| 8 | JGI25156J39149_1000506 | 3300002705 | Bacteria | 22799 |
| 9 | JGI25162J39368_1000164 | 3300002737 | Bacteria | 73373 |
| 10 | JGI25163J39215_1000025 | 3300002771 | Bacteria | 69682 |
| 11 | JGI25164J39214_1000126 | 3300002772 | Bacteria | 73373 |
| 12 | JGI25165J46597_1000247 | 3300003214 | Bacteria | 73373 |
| 13 | rootH2_10164091 | 3300003320 | Bacteria | 4273 |
| 14 | rootH2_10197494 | 3300003320 | Bacteria | 1703 |
| 15 | rootL2_10002460 | 3300003322 | Bacteria | 22027 |
| 16 | JGI25160J50197_1000074 | 3300003354 | Bacteria | 103621 |
| 17 | Ga0055538_1000537 | 3300003751 | Bacteria | 13347 |
| 18 | Ga0055539_1000466 | 3300003752 | Bacteria | 13347 |
| 19 | Ga0055533_1000551 | 3300003756 | Bacteria | 13347 |
| 20 | Ga0055533_1000984 | 3300003756 | Bacteria | 8317 |
| 21 | Ga0055532_1000055 | 3300003758 | Bacteria | 160192 |
| 22 | Ga0055532_1000358 | 3300003758 | Bacteria | 24185 |
| 23 | Ga0055532_1000652 | 3300003758 | Bacteria | 13347 |
| 24 | Ga0055525_1000658 | 3300003759 | Bacteria | 13347 |
| 25 | Ga0055527_1000030 | 3300003760 | Bacteria | 160175 |
| 26 | Ga0055535_1000038 | 3300003761 | Bacteria | 160192 |
| 27 | Ga0055542_1000063 | 3300003762 | Bacteria | 160175 |
| 28 | Ga0055529_1000071 | 3300003763 | Bacteria | 160192 |
| 29 | Ga0055536_1000005 | 3300003781 | Bacteria | 383598 |
| 30 | Ga0055536_1000037 | 3300003781 | Bacteria | 138437 |
| 31 | Ga0055530_10000001 | 3300003791 | Bacteria | 383067 |
| 32 | Ga0055530_10000606 | 3300003791 | Bacteria | 31097 |
| 33 | Ga0055530_10000865 | 3300003791 | Bacteria | 24933 |
| 34 | Ga0055540_1000025 | 3300003792 | Bacteria | 197801 |
| 35 | Ga0055540_1000302 | 3300003792 | Bacteria | 43687 |
| 36 | Ga0055531_10000301 | 3300003794 | Bacteria | 49074 |
| 37 | Ga0055541_1000388 | 3300003841 | Bacteria | 13347 |
| 38 | Ga0058692_1000515 | 3300003856 | Bacteria | 17069 |
| 39 | Ga0065165_1000203 | 3300005262 | Bacteria | 103001 |
| 40 | Ga0065714_10064945 | 3300005288 | Bacteria | 15037 |
| 41 | Ga0065714_10067899 | 3300005288 | Bacteria | 5125 |
| 42 | Ga0065704_10071472 | 3300005289 | Bacteria | 11004 |
| 43 | Ga0065704_10071534 | 3300005289 | Bacteria | 10781 |
| 44 | Ga0070670_100000390 | 3300005331 | Bacteria | 36385 |
| 45 | Ga0070666_10030121 | 3300005335 | Bacteria | 3573 |
| 46 | Ga0070682_100117693 | 3300005337 | Bacteria | 1779 |
| 47 | Ga0070660_100000188 | 3300005339 | Bacteria | 41185 |
| 48 | Ga0070661_100076456 | 3300005344 | Bacteria | 2467 |
| 49 | Ga0070669_100132752 | 3300005353 | Bacteria | 1912 |
| 50 | Ga0070659_100000006 | 3300005366 | Bacteria | 229954 |
| 51 | Ga0070667_100046498 | 3300005367 | Bacteria | 3651 |
| 52 | Ga0070667_100187346 | 3300005367 | Bacteria | 1832 |
| 53 | Ga0070663_100011648 | 3300005455 | Bacteria | 5529 |
| 54 | Ga0070662_100018038 | 3300005457 | Bacteria | 4768 |
| 55 | Ga0070679_100037174 | 3300005530 | Bacteria | 4835 |
| 56 | Ga0068855_100104269 | 3300005563 | Bacteria | 3262 |
| 57 | Ga0068852_100155803 | 3300005616 | Bacteria | 2128 |
| 58 | Ga0068851_10001228 | 3300005834 | Bacteria | 11138 |
| 59 | Ga0075364_10000318 | 3300006051 | Bacteria | 23710 |
| 60 | Ga0075364_10193052 | 3300006051 | Bacteria | 1379 |
| 61 | Ga0099823_1000017 | 3300006944 | Bacteria | 86474 |
| 62 | Ga0079104_1000060 | 3300006946 | Bacteria | 161936 |
| 63 | Ga0079104_1000142 | 3300006946 | Bacteria | 101403 |
| 64 | Ga0105251_10001555 | 3300009011 | Bacteria | 19680 |
| 65 | Ga0105251_10005237 | 3300009011 | Bacteria | 8548 |
| 66 | Ga0105251_10012466 | 3300009011 | Bacteria | 4809 |
| 67 | Ga0105251_10015734 | 3300009011 | Bacteria | 4122 |
| 68 | Ga0105251_10050949 | 3300009011 | Bacteria | 1976 |
| 69 | Ga0105251_10050950 | 3300009011 | Bacteria | 1976 |
| 70 | Ga0105251_10090437 | 3300009011 | Bacteria | 1406 |
| 71 | Ga0105251_10091778 | 3300009011 | Bacteria | 1394 |
| 72 | Ga0105244_10000533 | 3300009036 | Bacteria | 33932 |
| 73 | Ga0105244_10000804 | 3300009036 | Bacteria | 26699 |
| 74 | Ga0105244_10001274 | 3300009036 | Bacteria | 20663 |
| 75 | Ga0105244_10015346 | 3300009036 | Bacteria | 4394 |
| 76 | Ga0105244_10021413 | 3300009036 | Bacteria | 3575 |
| 77 | Ga0105244_10031342 | 3300009036 | Bacteria | 2822 |
| 78 | Ga0105244_10048150 | 3300009036 | Bacteria | 2183 |
| 79 | Ga0105250_10026427 | 3300009092 | Bacteria | 2338 |
| 80 | Ga0105250_10032517 | 3300009092 | Bacteria | 2095 |
| 81 | Ga0105240_10005736 | 3300009093 | Bacteria | 18419 |
| 82 | Ga0105240_10339894 | 3300009093 | Bacteria | 1706 |
| 83 | Ga0105243_10000099 | 3300009148 | Bacteria | 99838 |
| 84 | Ga0105243_10001355 | 3300009148 | Bacteria | 21785 |
| 85 | Ga0105243_10012812 | 3300009148 | Bacteria | 6335 |
| 86 | Ga0105237_10211339 | 3300009545 | Bacteria | 1940 |
| 87 | Ga0105249_10359899 | 3300009553 | Bacteria | 1476 |
| 88 | Ga0105239_10009639 | 3300010375 | Bacteria | 10862 |
| 89 | Ga0105246_10000626 | 3300011119 | Bacteria | 19731 |
| 90 | Ga0105246_10001438 | 3300011119 | Bacteria | 14095 |
| 91 | Ga0157373_10000315 | 3300013100 | Bacteria | 38946 |
| 92 | Ga0157373_10000596 | 3300013100 | Bacteria | 28045 |
| 93 | Ga0157373_10005498 | 3300013100 | Bacteria | 9507 |
| 94 | Ga0157371_10001604 | 3300013102 | Bacteria | 23194 |
| 95 | Ga0157370_10000264 | 3300013104 | Bacteria | 66688 |
| 96 | Ga0157370_10149938 | 3300013104 | Bacteria | 2170 |
| 97 | Ga0157369_10019522 | 3300013105 | Bacteria | 7585 |
| 98 | Ga0157369_10020661 | 3300013105 | Bacteria | 7364 |
| 99 | Ga0157369_10021547 | 3300013105 | Bacteria | 7208 |
| 100 | Ga0157369_10293892 | 3300013105 | Bacteria | 1691 |
| 101 | Ga0157374_10027105 | 3300013296 | Bacteria | 5164 |
| 102 | Ga0163162_10001693 | 3300013306 | Bacteria | 20666 |
| 103 | Ga0157372_10084385 | 3300013307 | Bacteria | 3600 |
| 104 | Ga0157375_10000602 | 3300013308 | Bacteria | 31951 |
| 105 | Ga0157375_10002153 | 3300013308 | Bacteria | 17026 |
| 106 | Ga0182008_10000425 | 3300014497 | Bacteria | 32600 |
| 107 | Ga0182008_10001433 | 3300014497 | Bacteria | 15949 |
| 108 | Ga0182008_10001892 | 3300014497 | Bacteria | 13592 |
| 109 | Ga0182008_10011969 | 3300014497 | Bacteria | 4596 |
| 110 | Ga0182007_10002722 | 3300015262 | Bacteria | 8650 |
| 111 | Ga0182007_10012041 | 3300015262 | Bacteria | 3342 |
| 112 | Ga0182005_1000533 | 3300015265 | Bacteria | 19274 |
| 113 | Ga0182005_1019429 | 3300015265 | Bacteria | 1873 |
| 114 | Ga0163161_10002303 | 3300017792 | Bacteria | 13689 |
| 115 | Ga0163161_10002711 | 3300017792 | Bacteria | 12588 |
| 116 | Ga0163161_10007270 | 3300017792 | Bacteria | 7646 |
| 117 | Ga0163161_10010811 | 3300017792 | Bacteria | 6325 |
| 118 | Ga0209760_100076 | 3300025207 | Bacteria | 78740 |
| 119 | Ga0209784_100065 | 3300025224 | Bacteria | 155963 |
| 120 | Ga0209566_100081 | 3300025225 | Bacteria | 155963 |
| 121 | Ga0209566_100570 | 3300025225 | Bacteria | 23953 |
| 122 | Ga0209674_100022 | 3300025226 | Bacteria | 563656 |
| 123 | Ga0209674_100093 | 3300025226 | Bacteria | 170423 |
| 124 | Ga0209674_100101 | 3300025226 | Bacteria | 155963 |
| 125 | Ga0209674_102954 | 3300025226 | Bacteria | 3336 |
| 126 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 127 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 128 | Ga0209147_100021 | 3300025229 | Bacteria | 464719 |
| 129 | Ga0209147_100152 | 3300025229 | Bacteria | 100822 |
| 130 | Ga0209563_100098 | 3300025230 | Bacteria | 155963 |
| 131 | Ga0207427_100022 | 3300025231 | Bacteria | 469701 |
| 132 | Ga0207427_101241 | 3300025231 | Bacteria | 9781 |
| 133 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 134 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 135 | Ga0209258_100969 | 3300025242 | Bacteria | 13441 |
| 136 | Ga0209646_1000363 | 3300025246 | Bacteria | 31020 |
| 137 | Ga0209677_100059 | 3300025253 | Bacteria | 155963 |
| 138 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 139 | Ga0209759_1000030 | 3300025256 | Bacteria | 285649 |
| 140 | Ga0209759_1000039 | 3300025256 | Bacteria | 256444 |
| 141 | Ga0209759_1000099 | 3300025256 | Bacteria | 156332 |
| 142 | Ga0209759_1003695 | 3300025256 | Bacteria | 5999 |
| 143 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 144 | Ga0209233_1000180 | 3300025261 | Bacteria | 140304 |
| 145 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 146 | Ga0209673_1000520 | 3300025273 | Bacteria | 63002 |
| 147 | Ga0209130_1010530 | 3300025284 | Bacteria | 2541 |
| 148 | Ga0209675_1001483 | 3300025291 | Bacteria | 13473 |
| 149 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 150 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 151 | Ga0209676_1000522 | 3300025292 | Bacteria | 60128 |
| 152 | Ga0209564_1020289 | 3300025295 | Bacteria | 2440 |
| 153 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 154 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 155 | Ga0207426_1000018 | 3300025302 | Bacteria | 566740 |
| 156 | Ga0207426_1001166 | 3300025302 | Bacteria | 23536 |
| 157 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 158 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 159 | Ga0209257_1000056 | 3300025304 | Bacteria | 403132 |
| 160 | Ga0207656_10000679 | 3300025321 | Bacteria | 11160 |
| 161 | Ga0207696_1000006 | 3300025711 | Bacteria | 616498 |
| 162 | Ga0207696_1000013 | 3300025711 | Bacteria | 524881 |
| 163 | Ga0207696_1015699 | 3300025711 | Bacteria | 2559 |
| 164 | Ga0207696_1023591 | 3300025711 | Bacteria | 1939 |
| 165 | Ga0207655_1000143 | 3300025728 | Bacteria | 137102 |
| 166 | Ga0207655_1000338 | 3300025728 | Bacteria | 68161 |
| 167 | Ga0207655_1000432 | 3300025728 | Bacteria | 56332 |
| 168 | Ga0207655_1005437 | 3300025728 | Bacteria | 8660 |
| 169 | Ga0207655_1021816 | 3300025728 | Bacteria | 3233 |
| 170 | Ga0207655_1039816 | 3300025728 | Bacteria | 2036 |
| 171 | Ga0207713_1000551 | 3300025735 | Bacteria | 37432 |
| 172 | Ga0207713_1000698 | 3300025735 | Bacteria | 31417 |
| 173 | Ga0207713_1001164 | 3300025735 | Bacteria | 22239 |
| 174 | Ga0207713_1002903 | 3300025735 | Bacteria | 12004 |
| 175 | Ga0207713_1008002 | 3300025735 | Bacteria | 6147 |
| 176 | Ga0207713_1014678 | 3300025735 | Bacteria | 4054 |
| 177 | Ga0207680_10019143 | 3300025903 | Bacteria | 3657 |
| 178 | Ga0207647_10011975 | 3300025904 | Bacteria | 6055 |
| 179 | Ga0207647_10012538 | 3300025904 | Bacteria | 5897 |
| 180 | Ga0207695_10001620 | 3300025913 | Bacteria | 36495 |
| 181 | Ga0207657_10000270 | 3300025919 | Bacteria | 55069 |
| 182 | Ga0207652_10054097 | 3300025921 | Bacteria | 3450 |
| 183 | Ga0207681_10026264 | 3300025923 | Bacteria | 3754 |
| 184 | Ga0207694_10125640 | 3300025924 | Bacteria | 2052 |
| 185 | Ga0207650_10000204 | 3300025925 | Bacteria | 68172 |
| 186 | Ga0207644_10347968 | 3300025931 | Bacteria | 1203 |
| 187 | Ga0207690_10000019 | 3300025932 | Bacteria | 235380 |
| 188 | Ga0207706_10003884 | 3300025933 | Bacteria | 14189 |
| 189 | Ga0207709_10000014 | 3300025935 | Bacteria | 526302 |
| 190 | Ga0207709_10006726 | 3300025935 | Bacteria | 6439 |
| 191 | Ga0207667_10076888 | 3300025949 | Bacteria | 3463 |
| 192 | Ga0207640_10279697 | 3300025981 | Bacteria | 1310 |
| 193 | Ga0207678_10005353 | 3300026067 | Bacteria | 11491 |
| 194 | Ga0207683_10196510 | 3300026121 | Bacteria | 1833 |
| 195 | Ga0207698_10012043 | 3300026142 | Bacteria | 5639 |
| 196 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 197 | Ga0209281_1000064 | 3300027111 | Bacteria | 287876 |
| 198 | Ga0209281_1000262 | 3300027111 | Bacteria | 101417 |
| 199 | Ga0209389_1000022 | 3300027296 | Bacteria | 166756 |
| 200 | Ga0209371_1000087 | 3300027312 | Bacteria | 175021 |
| 201 | Ga0209371_1000203 | 3300027312 | Bacteria | 85883 |
| 202 | Ga0209371_1000342 | 3300027312 | Bacteria | 50937 |
| 203 | Ga0209371_1001734 | 3300027312 | Bacteria | 13743 |
| 204 | Ga0207428_10056347 | 3300027907 | Bacteria | 3124 |
| 205 | Ga0307515_10155884 | 3300028794 | Bacteria | 2357 |
| 206 | Ga0268256_1000101 | 3300030500 | Bacteria | 130956 |
| 207 | Ga0268256_1000291 | 3300030500 | Bacteria | 50937 |
| 208 | Ga0268256_1001512 | 3300030500 | Bacteria | 13745 |
| 209 | Ga0268256_1001704 | 3300030500 | Bacteria | 12540 |
| 210 | Ga0307408_100000145 | 3300031548 | Bacteria | 79041 |
| 211 | Ga0307408_100007984 | 3300031548 | Bacteria | 6997 |
| 212 | Ga0307408_100241942 | 3300031548 | Bacteria | 1483 |
| 213 | Ga0307514_10008864 | 3300031649 | Bacteria | 8509 |
| 214 | Ga0307405_10000291 | 3300031731 | Bacteria | 18543 |
| 215 | Ga0307405_10019036 | 3300031731 | Bacteria | 3803 |
| 216 | Ga0307405_10020660 | 3300031731 | Bacteria | 3683 |
| 217 | Ga0307405_10224191 | 3300031731 | Bacteria | 1381 |
| 218 | Ga0307406_10004000 | 3300031901 | Bacteria | 8014 |
| 219 | Ga0307412_10000005 | 3300031911 | Bacteria | 526194 |
| 220 | Ga0307412_10007665 | 3300031911 | Bacteria | 6130 |
| 221 | Ga0307412_10074752 | 3300031911 | Bacteria | 2322 |
| 222 | Ga0307414_10012008 | 3300032004 | Bacteria | 5106 |
| 223 | Ga0307411_10123024 | 3300032005 | Bacteria | 1881 |
| 224 | Ga0395898_0019835 | 3300037466 | Bacteria | 6838 |
| 225 | Ga0395905_0000009 | 3300037471 | Bacteria | 488729 |
| 226 | Ga0395905_0001003 | 3300037471 | Bacteria | 36126 |
| 227 | Ga0395905_0030642 | 3300037471 | Bacteria | 5066 |
| 228 | Ga0395905_0036368 | 3300037471 | Bacteria | 4624 |
| 229 | Ga0237819_00471 | 3300038705 | Bacteria | 13733 |
| 230 | Ga0436365_1175663 | 3300039437 | Bacteria | 3189 |
| 231 | Ga0439436_0000760 | 3300041404 | Bacteria | 8719 |
| 232 | Ga0439438_000077 | 3300041405 | Bacteria | 45928 |
| 233 | Ga0439438_000205 | 3300041405 | Bacteria | 26994 |
| 234 | Ga0439438_000478 | 3300041405 | Bacteria | 18095 |
| 235 | Ga0439438_001753 | 3300041405 | Bacteria | 9537 |
| 236 | Ga0439438_001852 | 3300041405 | Bacteria | 9254 |
| 237 | Ga0439438_010096 | 3300041405 | Bacteria | 3012 |
| 238 | Ga0439438_010249 | 3300041405 | Bacteria | 2974 |
| 239 | Ga0439447_001433 | 3300041407 | Bacteria | 8750 |
| 240 | Ga0439447_002447 | 3300041407 | Bacteria | 6766 |
| 241 | Ga0439447_006498 | 3300041407 | Bacteria | 3789 |
| 242 | Ga0439447_015499 | 3300041407 | Bacteria | 2114 |
| 243 | Ga0439466_0000298 | 3300041411 | Bacteria | 19175 |
| 244 | Ga0439466_0003539 | 3300041411 | Bacteria | 6040 |
| 245 | Ga0439466_0004779 | 3300041411 | Bacteria | 5205 |
| 246 | Ga0439466_0018522 | 3300041411 | Bacteria | 2496 |
| 247 | Ga0439466_0038296 | 3300041411 | Bacteria | 1610 |
| 248 | Ga0439466_0040527 | 3300041411 | Bacteria | 1557 |
| 249 | Ga0439431_0000666 | 3300041997 | Bacteria | 7322 |
| 250 | Ga0439445_0008480 | 3300042004 | Bacteria | 2404 |
| 251 | Ga0439432_000501 | 3300042006 | Bacteria | 14592 |
| 252 | Ga0439432_002222 | 3300042006 | Bacteria | 7324 |
| 253 | Ga0439432_007170 | 3300042006 | Bacteria | 3960 |
| 254 | Ga0439432_009762 | 3300042006 | Bacteria | 3339 |
| 255 | Ga0439452_000085 | 3300042010 | Bacteria | 79496 |
| 256 | Ga0439452_000136 | 3300042010 | Bacteria | 55807 |
| 257 | Ga0439452_002958 | 3300042010 | Bacteria | 6050 |
| 258 | Ga0439452_003624 | 3300042010 | Bacteria | 5373 |
| 259 | Ga0439456_000198 | 3300042013 | Bacteria | 17189 |
| 260 | Ga0439456_002185 | 3300042013 | Bacteria | 3940 |
| 261 | Ga0450911_003465 | 3300042115 | Bacteria | 2779 |
| 262 | Ga0450920_006057 | 3300042122 | Bacteria | 2164 |
| 263 | Ga0450922_000899 | 3300042124 | Bacteria | 3037 |
| 264 | Ga0450902_008077 | 3300042137 | Bacteria | 1638 |
| 265 | Ga0450903_003563 | 3300042138 | Bacteria | 2688 |
| 266 | Ga0450905_003188 | 3300042142 | Bacteria | 2151 |
| 267 | Ga0450906_009657 | 3300042145 | Bacteria | 1834 |
| 268 | Ga0450907_003161 | 3300042146 | Bacteria | 2981 |
| 269 | Ga0450910_001413 | 3300042147 | Bacteria | 3015 |
| 270 | Ga0450910_001955 | 3300042147 | Bacteria | 2669 |
| 271 | Ga0450909_002438 | 3300042185 | Bacteria | 2632 |
| 272 | Ga0439434_0000582 | 3300042435 | Bacteria | 10554 |
| 273 | Ga0439464_0011819 | 3300042439 | Bacteria | 2318 |
| 274 | Ga0439440_0005583 | 3300042993 | Bacteria | 2501 |
| 275 | Ga0466969_0010596 | 3300044656 | Bacteria | 4886 |
| 276 | Ga0466977_0000224 | 3300044666 | Bacteria | 15372 |
| 277 | Ga0466966_0005241 | 3300044684 | Bacteria | 8522 |
| 278 | Ga0466970_0012731 | 3300044765 | Bacteria | 4304 |
| 279 | Ga0466957_0117768 | 3300044842 | Bacteria | 1691 |
| 280 | Ga0466958_0175341 | 3300045836 | Bacteria | 1359 |
| 281 | Ga0495627_000504 | 3300046453 | Bacteria | 32717 |
| 282 | Ga0495627_000781 | 3300046453 | Bacteria | 23497 |
| 283 | Ga0495627_007203 | 3300046453 | Bacteria | 4291 |
| 284 | Ga0495592_0062026 | 3300046454 | Bacteria | 2746 |
| 285 | Ga0495603_0000871 | 3300046455 | Bacteria | 17318 |
| 286 | Ga0495603_0055956 | 3300046455 | Bacteria | 2337 |
| 287 | Ga0495590_0000173 | 3300046457 | Bacteria | 37961 |
| 288 | Ga0495590_0002472 | 3300046457 | Bacteria | 7653 |
| 289 | Ga0495591_000117 | 3300046458 | Bacteria | 89645 |
| 290 | Ga0495591_002734 | 3300046458 | Bacteria | 9553 |
| 291 | Ga0495591_003659 | 3300046458 | Bacteria | 7825 |
| 292 | Ga0495629_0000310 | 3300046459 | Bacteria | 41782 |
| 293 | Ga0495629_0005414 | 3300046459 | Bacteria | 9519 |
| 294 | Ga0495629_0021205 | 3300046459 | Bacteria | 4637 |
| 295 | Ga0495629_0021382 | 3300046459 | Bacteria | 4617 |
| 296 | Ga0495629_0022413 | 3300046459 | Bacteria | 4504 |
| 297 | Ga0495629_0054792 | 3300046459 | Bacteria | 2789 |
| 298 | Ga0495638_0001452 | 3300046460 | Bacteria | 21411 |
| 299 | Ga0495638_0007494 | 3300046460 | Bacteria | 7815 |
| 300 | Ga0495638_0090744 | 3300046460 | Bacteria | 1841 |
| 301 | Ga0495638_0111512 | 3300046460 | Bacteria | 1624 |
| 302 | Ga0495641_0009924 | 3300046461 | Bacteria | 5599 |
| 303 | Ga0495651_0051887 | 3300046462 | Bacteria | 3160 |
| 304 | Ga0495653_0000937 | 3300046463 | Bacteria | 22475 |
| 305 | Ga0495653_0006194 | 3300046463 | Bacteria | 9813 |
| 306 | Ga0495653_0015189 | 3300046463 | Bacteria | 6277 |
| 307 | Ga0495653_0017779 | 3300046463 | Bacteria | 5782 |
| 308 | Ga0495653_0049902 | 3300046463 | Bacteria | 3220 |
| 309 | Ga0495650_0000628 | 3300046471 | Bacteria | 47433 |
| 310 | Ga0495650_0000802 | 3300046471 | Bacteria | 38263 |
| 311 | Ga0495650_0001184 | 3300046471 | Bacteria | 27715 |
| 312 | Ga0495650_0004910 | 3300046471 | Bacteria | 8937 |
| 313 | Ga0495650_0006982 | 3300046471 | Bacteria | 6896 |
| 314 | Ga0495650_0007178 | 3300046471 | Bacteria | 6755 |
| 315 | Ga0495650_0012173 | 3300046471 | Bacteria | 4645 |
| 316 | Ga0495650_0028536 | 3300046471 | Bacteria | 2560 |
| 317 | Ga0495650_0028682 | 3300046471 | Bacteria | 2549 |
| 318 | Ga0495580_0000047 | 3300046472 | Bacteria | 68842 |
| 319 | Ga0495580_0001969 | 3300046472 | Bacteria | 18030 |
| 320 | Ga0495580_0007575 | 3300046472 | Bacteria | 8710 |
| 321 | Ga0495580_0023965 | 3300046472 | Bacteria | 4473 |
| 322 | Ga0495580_0037797 | 3300046472 | Bacteria | 3461 |
| 323 | Ga0495582_0002684 | 3300046473 | Bacteria | 9933 |
| 324 | Ga0495582_0019964 | 3300046473 | Bacteria | 3665 |
| 325 | Ga0495582_0036563 | 3300046473 | Bacteria | 2701 |
| 326 | Ga0495605_0000036 | 3300046474 | Bacteria | 203902 |
| 327 | Ga0495605_0000631 | 3300046474 | Bacteria | 27198 |
| 328 | Ga0495605_0002926 | 3300046474 | Bacteria | 10351 |
| 329 | Ga0495605_0003631 | 3300046474 | Bacteria | 9154 |
| 330 | Ga0495605_0019021 | 3300046474 | Bacteria | 3677 |
| 331 | Ga0495605_0022213 | 3300046474 | Bacteria | 3353 |
| 332 | Ga0495662_0016913 | 3300046476 | Bacteria | 3529 |
| 333 | Ga0495664_0002835 | 3300046477 | Bacteria | 9328 |
| 334 | Ga0495664_0024889 | 3300046477 | Bacteria | 3481 |
| 335 | Ga0495584_0001618 | 3300046491 | Bacteria | 13249 |
| 336 | Ga0495584_0115241 | 3300046491 | Bacteria | 1360 |
| 337 | Ga0495585_0000284 | 3300046492 | Bacteria | 50818 |
| 338 | Ga0495585_0000711 | 3300046492 | Bacteria | 29916 |
| 339 | Ga0495585_0029587 | 3300046492 | Bacteria | 3117 |
| 340 | Ga0495585_0032050 | 3300046492 | Bacteria | 2980 |
| 341 | Ga0495594_0006259 | 3300046499 | Bacteria | 6121 |
| 342 | Ga0495596_0005767 | 3300046500 | Bacteria | 5807 |
| 343 | Ga0495596_0007942 | 3300046500 | Bacteria | 4748 |
| 344 | Ga0495596_0012731 | 3300046500 | Bacteria | 3590 |
| 345 | Ga0495607_0036051 | 3300046501 | Bacteria | 2985 |
| 346 | Ga0495607_0088520 | 3300046501 | Bacteria | 1683 |
| 347 | Ga0495583_0000028 | 3300046506 | Bacteria | 255787 |
| 348 | Ga0495583_0000109 | 3300046506 | Bacteria | 138768 |
| 349 | Ga0495583_0000511 | 3300046506 | Bacteria | 55564 |
| 350 | Ga0495583_0001837 | 3300046506 | Bacteria | 19806 |
| 351 | Ga0495583_0006414 | 3300046506 | Bacteria | 7696 |
| 352 | Ga0495583_0017299 | 3300046506 | Bacteria | 3832 |
| 353 | Ga0495606_0000204 | 3300046507 | Bacteria | 103880 |
| 354 | Ga0495606_0000270 | 3300046507 | Bacteria | 91423 |
| 355 | Ga0495606_0001623 | 3300046507 | Bacteria | 29338 |
| 356 | Ga0495606_0011345 | 3300046507 | Bacteria | 7278 |
| 357 | Ga0495606_0011356 | 3300046507 | Bacteria | 7273 |
| 358 | Ga0495606_0028555 | 3300046507 | Bacteria | 3932 |
| 359 | Ga0495606_0033517 | 3300046507 | Bacteria | 3541 |
| 360 | Ga0495606_0037710 | 3300046507 | Bacteria | 3279 |
| 361 | Ga0495606_0078706 | 3300046507 | Bacteria | 2055 |
| 362 | Ga0495608_0085761 | 3300046511 | Bacteria | 2041 |
| 363 | Ga0495610_0006250 | 3300046512 | Bacteria | 8255 |
| 364 | Ga0495610_0014560 | 3300046512 | Bacteria | 4615 |
| 365 | Ga0495610_0024169 | 3300046512 | Bacteria | 3284 |
| 366 | Ga0495610_0032287 | 3300046512 | Bacteria | 2721 |
| 367 | Ga0495610_0037818 | 3300046512 | Bacteria | 2452 |
| 368 | Ga0495610_0046618 | 3300046512 | Bacteria | 2137 |
| 369 | Ga0495610_0049498 | 3300046512 | Bacteria | 2057 |
| 370 | Ga0495610_0053315 | 3300046512 | Bacteria | 1959 |
| 371 | Ga0495610_0053707 | 3300046512 | Bacteria | 1949 |
| 372 | Ga0495616_0039330 | 3300046513 | Bacteria | 2423 |
| 373 | Ga0495616_0083207 | 3300046513 | Bacteria | 1527 |
| 374 | Ga0495618_0002049 | 3300046514 | Bacteria | 13240 |
| 375 | Ga0495618_0013398 | 3300046514 | Bacteria | 4989 |
| 376 | Ga0495618_0017322 | 3300046514 | Bacteria | 4415 |
| 377 | Ga0495620_0000049 | 3300046515 | Bacteria | 106184 |
| 378 | Ga0495620_0000073 | 3300046515 | Bacteria | 83446 |
| 379 | Ga0495620_0009807 | 3300046515 | Bacteria | 5080 |
| 380 | Ga0495620_0022114 | 3300046515 | Bacteria | 3071 |
| 381 | Ga0495628_0005251 | 3300046516 | Bacteria | 11357 |
| 382 | Ga0495628_0015580 | 3300046516 | Bacteria | 6348 |
| 383 | Ga0495628_0031441 | 3300046516 | Bacteria | 4293 |
| 384 | Ga0495628_0046817 | 3300046516 | Bacteria | 3434 |
| 385 | Ga0495628_0047821 | 3300046516 | Bacteria | 3392 |
| 386 | Ga0495628_0135357 | 3300046516 | Bacteria | 1883 |
| 387 | Ga0495630_0001476 | 3300046517 | Bacteria | 16264 |
| 388 | Ga0495630_0005335 | 3300046517 | Bacteria | 9069 |
| 389 | Ga0495630_0028040 | 3300046517 | Bacteria | 4183 |
| 390 | Ga0495630_0050899 | 3300046517 | Bacteria | 3099 |
| 391 | Ga0495630_0061356 | 3300046517 | Bacteria | 2823 |
| 392 | Ga0495631_0061618 | 3300046518 | Bacteria | 1627 |
| 393 | Ga0495632_0000051 | 3300046519 | Bacteria | 133522 |
| 394 | Ga0495632_0000742 | 3300046519 | Bacteria | 29442 |
| 395 | Ga0495632_0001635 | 3300046519 | Bacteria | 18359 |
| 396 | Ga0495632_0003365 | 3300046519 | Bacteria | 11396 |
| 397 | Ga0495637_0007116 | 3300046520 | Bacteria | 5570 |
| 398 | Ga0495637_0020012 | 3300046520 | Bacteria | 3083 |
| 399 | Ga0495637_0022414 | 3300046520 | Bacteria | 2880 |
| 400 | Ga0495637_0030956 | 3300046520 | Bacteria | 2370 |
| 401 | Ga0495637_0042350 | 3300046520 | Bacteria | 1948 |
| 402 | Ga0495643_0000150 | 3300046522 | Bacteria | 113560 |
| 403 | Ga0495643_0000152 | 3300046522 | Bacteria | 112556 |
| 404 | Ga0495643_0000445 | 3300046522 | Bacteria | 53349 |
| 405 | Ga0495643_0001282 | 3300046522 | Bacteria | 24031 |
| 406 | Ga0495644_0051973 | 3300046523 | Bacteria | 1538 |
| 407 | Ga0495648_0000512 | 3300046524 | Bacteria | 41742 |
| 408 | Ga0495648_0000560 | 3300046524 | Bacteria | 39735 |
| 409 | Ga0495648_0001151 | 3300046524 | Bacteria | 26757 |
| 410 | Ga0495648_0001307 | 3300046524 | Bacteria | 24712 |
| 411 | Ga0495648_0002230 | 3300046524 | Bacteria | 18114 |
| 412 | Ga0495648_0050276 | 3300046524 | Bacteria | 2548 |
| 413 | Ga0495648_0061099 | 3300046524 | Bacteria | 2239 |
| 414 | Ga0495648_0068855 | 3300046524 | Bacteria | 2062 |
| 415 | Ga0495666_0004585 | 3300046526 | Bacteria | 6987 |
| 416 | Ga0495642_0000018 | 3300046528 | Bacteria | 108992 |
| 417 | Ga0495642_0003020 | 3300046528 | Bacteria | 6701 |
| 418 | Ga0495642_0012506 | 3300046528 | Bacteria | 3272 |
| 419 | Ga0495652_0010089 | 3300046529 | Bacteria | 8562 |
| 420 | Ga0495652_0022094 | 3300046529 | Bacteria | 5650 |
| 421 | Ga0495652_0068711 | 3300046529 | Bacteria | 2967 |
| 422 | Ga0495652_0192799 | 3300046529 | Bacteria | 1553 |
| 423 | Ga0495654_0000246 | 3300046530 | Bacteria | 50620 |
| 424 | Ga0495654_0000432 | 3300046530 | Bacteria | 35485 |
| 425 | Ga0495654_0002687 | 3300046530 | Bacteria | 11255 |
| 426 | Ga0495654_0005855 | 3300046530 | Bacteria | 7073 |
| 427 | Ga0495654_0010556 | 3300046530 | Bacteria | 5024 |
| 428 | Ga0495654_0011171 | 3300046530 | Bacteria | 4874 |
| 429 | Ga0495654_0062578 | 3300046530 | Bacteria | 1783 |
| 430 | Ga0495654_0108985 | 3300046530 | Bacteria | 1265 |
| 431 | Ga0495665_0005136 | 3300046531 | Bacteria | 7059 |
| 432 | Ga0495665_0017762 | 3300046531 | Bacteria | 3823 |
| 433 | Ga0495665_0025622 | 3300046531 | Bacteria | 3168 |
| 434 | Ga0495665_0028537 | 3300046531 | Bacteria | 2991 |
| 435 | Ga0495640_0007879 | 3300046533 | Bacteria | 8376 |
| 436 | Ga0495586_0001052 | 3300046535 | Bacteria | 15580 |
| 437 | Ga0495586_0008468 | 3300046535 | Bacteria | 5471 |
| 438 | Ga0495586_0078806 | 3300046535 | Bacteria | 1808 |
| 439 | Ga0495587_0004029 | 3300046536 | Bacteria | 9733 |
| 440 | Ga0495587_0012559 | 3300046536 | Bacteria | 5326 |
| 441 | Ga0495609_0000014 | 3300046538 | Bacteria | 326023 |
| 442 | Ga0495609_0000115 | 3300046538 | Bacteria | 93419 |
| 443 | Ga0495597_0000635 | 3300046542 | Bacteria | 28659 |
| 444 | Ga0495597_0003598 | 3300046542 | Bacteria | 8922 |
| 445 | Ga0495597_0016635 | 3300046542 | Bacteria | 3471 |
| 446 | Ga0495597_0054975 | 3300046542 | Bacteria | 1747 |
| 447 | Ga0495645_0000185 | 3300046543 | Bacteria | 44326 |
| 448 | Ga0495645_0000915 | 3300046543 | Bacteria | 20101 |
| 449 | Ga0495645_0086631 | 3300046543 | Bacteria | 2241 |
| 450 | Ga0495645_0107292 | 3300046543 | Bacteria | 1980 |
| 451 | Ga0495633_0000028 | 3300046558 | Bacteria | 203214 |
| 452 | Ga0495667_0019337 | 3300046559 | Bacteria | 4596 |
| 453 | Ga0495668_0021608 | 3300046616 | Bacteria | 3687 |
| 454 | Ga0495634_0026224 | 3300046642 | Bacteria | 4068 |
| 455 | Ga0495634_0046998 | 3300046642 | Bacteria | 2910 |
| 456 | Ga0495611_0036346 | 3300046648 | Bacteria | 2185 |
| 457 | Ga0495611_0041270 | 3300046648 | Bacteria | 2058 |
| 458 | Ga0495625_0107485 | 3300046660 | Bacteria | 1909 |
| 459 | Ga0495635_0003126 | 3300046663 | Bacteria | 11393 |
| 460 | Ga0495635_0019568 | 3300046663 | Bacteria | 4717 |
| 461 | Ga0495635_0026970 | 3300046663 | Bacteria | 3996 |
| 462 | Ga0495635_0036214 | 3300046663 | Bacteria | 3421 |
| 463 | Ga0495635_0039275 | 3300046663 | Bacteria | 3274 |
| 464 | Ga0495661_0000007 | 3300046665 | Bacteria | 411832 |
| 465 | Ga0495661_0000100 | 3300046665 | Bacteria | 104957 |
| 466 | Ga0495661_0000144 | 3300046665 | Bacteria | 82961 |
| 467 | Ga0495661_0000211 | 3300046665 | Bacteria | 67481 |
| 468 | Ga0495661_0010888 | 3300046665 | Bacteria | 6184 |
| 469 | Ga0495661_0014156 | 3300046665 | Bacteria | 5343 |
| 470 | Ga0495661_0029189 | 3300046665 | Bacteria | 3523 |
| 471 | Ga0495661_0061942 | 3300046665 | Bacteria | 2219 |
| 472 | Ga0495588_0029072 | 3300046674 | Bacteria | 2770 |
| 473 | Ga0495588_0050748 | 3300046674 | Bacteria | 2135 |
| 474 | Ga0495657_0065714 | 3300046675 | Bacteria | 2385 |
| 475 | Ga0495599_0001328 | 3300046678 | Bacteria | 14099 |
| 476 | Ga0495599_0024802 | 3300046678 | Bacteria | 3750 |
| 477 | Ga0495599_0068519 | 3300046678 | Bacteria | 2215 |
| 478 | Ga0495623_0001986 | 3300046679 | Bacteria | 13723 |
| 479 | Ga0495623_0006279 | 3300046679 | Bacteria | 7725 |
| 480 | Ga0495623_0041565 | 3300046679 | Bacteria | 2931 |
| 481 | Ga0495623_0055802 | 3300046679 | Bacteria | 2488 |
| 482 | Ga0495623_0101012 | 3300046679 | Bacteria | 1757 |
| 483 | Ga0495646_0001386 | 3300046680 | Bacteria | 14391 |
| 484 | Ga0495646_0004735 | 3300046680 | Bacteria | 8585 |
| 485 | Ga0495646_0082040 | 3300046680 | Bacteria | 1877 |
| 486 | Ga0495646_0088712 | 3300046680 | Bacteria | 1790 |
| 487 | Ga0495669_0019138 | 3300046684 | Bacteria | 2953 |
| 488 | Ga0495669_0047114 | 3300046684 | Bacteria | 1925 |
| 489 | Ga0495613_0023372 | 3300046689 | Bacteria | 4605 |
| 490 | Ga0495624_0000502 | 3300046690 | Bacteria | 30600 |
| 491 | Ga0495624_0001403 | 3300046690 | Bacteria | 18799 |
| 492 | Ga0495624_0003505 | 3300046690 | Bacteria | 11628 |
| 493 | Ga0495624_0005612 | 3300046690 | Bacteria | 9005 |
| 494 | Ga0495624_0012833 | 3300046690 | Bacteria | 5718 |
| 495 | Ga0495624_0018840 | 3300046690 | Bacteria | 4613 |
| 496 | Ga0495624_0058746 | 3300046690 | Bacteria | 2415 |
| 497 | Ga0495670_0000942 | 3300046691 | Bacteria | 14081 |
| 498 | Ga0495671_0003839 | 3300046692 | Bacteria | 9132 |
| 499 | Ga0495671_0004675 | 3300046692 | Bacteria | 8108 |
| 500 | Ga0495671_0015247 | 3300046692 | Bacteria | 4124 |
| 501 | Ga0495671_0027953 | 3300046692 | Bacteria | 2908 |
| 502 | Ga0495671_0082985 | 3300046692 | Bacteria | 1570 |
| 503 | Ga0495671_0095866 | 3300046692 | Bacteria | 1451 |
| 504 | Ga0495649_0000110 | 3300046694 | Bacteria | 72175 |
| 505 | Ga0495649_0000764 | 3300046694 | Bacteria | 25871 |
| 506 | Ga0495649_0002230 | 3300046694 | Bacteria | 13787 |
| 507 | Ga0495649_0007336 | 3300046694 | Bacteria | 6735 |
| 508 | Ga0495649_0008267 | 3300046694 | Bacteria | 6270 |
| 509 | Ga0495649_0015493 | 3300046694 | Bacteria | 4338 |
| 510 | Ga0495649_0024949 | 3300046694 | Bacteria | 3331 |
| 511 | Ga0495649_0027847 | 3300046694 | Bacteria | 3133 |
| 512 | Ga0495649_0055582 | 3300046694 | Bacteria | 2138 |
| 513 | Ga0495649_0057493 | 3300046694 | Bacteria | 2097 |
| 514 | Ga0495649_0089239 | 3300046694 | Bacteria | 1644 |
| 515 | Ga0495589_0000297 | 3300046794 | Bacteria | 39517 |
| 516 | Ga0495589_0002558 | 3300046794 | Bacteria | 10112 |
| 517 | Ga0495589_0003366 | 3300046794 | Bacteria | 8669 |
| 518 | Ga0495589_0005324 | 3300046794 | Bacteria | 6795 |
| 519 | Ga0495589_0019622 | 3300046794 | Bacteria | 3461 |
| 520 | Ga0495589_0037158 | 3300046794 | Bacteria | 2440 |
| 521 | Ga0495600_0005652 | 3300046809 | Bacteria | 7554 |
| 522 | Ga0495660_0029420 | 3300046810 | Bacteria | 3099 |
| 523 | Ga0495581_0002420 | 3300047315 | Bacteria | 10543 |
| 524 | Ga0495581_0016499 | 3300047315 | Bacteria | 4292 |
| 525 | Ga0495604_0000506 | 3300047317 | Bacteria | 34325 |
| 526 | Ga0495604_0004171 | 3300047317 | Bacteria | 11459 |
| 527 | Ga0495604_0017237 | 3300047317 | Bacteria | 5779 |
| 528 | Ga0495604_0048542 | 3300047317 | Bacteria | 3302 |
| 529 | Ga0495604_0119157 | 3300047317 | Bacteria | 1912 |
| 530 | Ga0495674_0000598 | 3300047319 | Bacteria | 33806 |
| 531 | Ga0495674_0004116 | 3300047319 | Bacteria | 14040 |
| 532 | Ga0495674_0013144 | 3300047319 | Bacteria | 7784 |
| 533 | Ga0495674_0019972 | 3300047319 | Bacteria | 6209 |
| 534 | Ga0495674_0026139 | 3300047319 | Bacteria | 5343 |
| 535 | Ga0495672_0000995 | 3300047320 | Bacteria | 29252 |
| 536 | Ga0495672_0006835 | 3300047320 | Bacteria | 8712 |
| 537 | Ga0495672_0009422 | 3300047320 | Bacteria | 7078 |
| 538 | Ga0495672_0012784 | 3300047320 | Bacteria | 5832 |
| 539 | Ga0495672_0039353 | 3300047320 | Bacteria | 2874 |
| 540 | Ga0495676_0019606 | 3300047321 | Bacteria | 5948 |
| 541 | Ga0495676_0028059 | 3300047321 | Bacteria | 4816 |
| 542 | Ga0495676_0060712 | 3300047321 | Bacteria | 2961 |
| 543 | Ga0495676_0076369 | 3300047321 | Bacteria | 2558 |
| 544 | Ga0495676_0178149 | 3300047321 | Bacteria | 1491 |
| 545 | Ga0495680_0005885 | 3300047322 | Bacteria | 11474 |
| 546 | Ga0495680_0006126 | 3300047322 | Bacteria | 11223 |
| 547 | Ga0495680_0034155 | 3300047322 | Bacteria | 4112 |
| 548 | Ga0495683_0000091 | 3300047323 | Bacteria | 91313 |
| 549 | Ga0495683_0000578 | 3300047323 | Bacteria | 27719 |
| 550 | Ga0495683_0004864 | 3300047323 | Bacteria | 7522 |
| 551 | Ga0495683_0004934 | 3300047323 | Bacteria | 7462 |
| 552 | Ga0495683_0012413 | 3300047323 | Bacteria | 4471 |
| 553 | Ga0495683_0049206 | 3300047323 | Bacteria | 2112 |
| 554 | Ga0495683_0054009 | 3300047323 | Bacteria | 2003 |
| 555 | Ga0495687_000294 | 3300047443 | Bacteria | 65644 |
| 556 | Ga0495687_007776 | 3300047443 | Bacteria | 6242 |
| 557 | Ga0495687_009595 | 3300047443 | Bacteria | 5394 |
| 558 | Ga0495687_037994 | 3300047443 | Bacteria | 2140 |
| 559 | Ga0495675_0004036 | 3300047444 | Bacteria | 8900 |
| 560 | Ga0495675_0009198 | 3300047444 | Bacteria | 6144 |
| 561 | Ga0495675_0019815 | 3300047444 | Bacteria | 4273 |
| 562 | Ga0495675_0035887 | 3300047444 | Bacteria | 3165 |
| 563 | Ga0495675_0066610 | 3300047444 | Bacteria | 2276 |
| 564 | Ga0495675_0079450 | 3300047444 | Bacteria | 2066 |
| 565 | Ga0495679_000012 | 3300047446 | Bacteria | 319098 |
| 566 | Ga0495679_000083 | 3300047446 | Bacteria | 87051 |
| 567 | Ga0495679_000836 | 3300047446 | Bacteria | 19590 |
| 568 | Ga0495679_002695 | 3300047446 | Bacteria | 8870 |
| 569 | Ga0495679_004048 | 3300047446 | Bacteria | 6882 |
| 570 | Ga0495679_005142 | 3300047446 | Bacteria | 5860 |
| 571 | Ga0495679_012643 | 3300047446 | Bacteria | 3201 |
| 572 | Ga0495679_020535 | 3300047446 | Bacteria | 2298 |
| 573 | Ga0495673_0002326 | 3300047469 | Bacteria | 13542 |
| 574 | Ga0495673_0018789 | 3300047469 | Bacteria | 3478 |
| 575 | Ga0495673_0024236 | 3300047469 | Bacteria | 2937 |
| 576 | Ga0495673_0025962 | 3300047469 | Bacteria | 2808 |
| 577 | Ga0495681_0000221 | 3300047470 | Bacteria | 47433 |
| 578 | Ga0495681_0003291 | 3300047470 | Bacteria | 11263 |
| 579 | Ga0495681_0003640 | 3300047470 | Bacteria | 10704 |
| 580 | Ga0495681_0020343 | 3300047470 | Bacteria | 3603 |
| 581 | Ga0495681_0020972 | 3300047470 | Bacteria | 3531 |
| 582 | Ga0495681_0021981 | 3300047470 | Bacteria | 3423 |
| 583 | Ga0495681_0050074 | 3300047470 | Bacteria | 1971 |
| 584 | Ga0495684_0087175 | 3300047471 | Bacteria | 2366 |
| 585 | Ga0495684_0209711 | 3300047471 | Bacteria | 1433 |
| 586 | Ga0495686_0018124 | 3300047472 | Bacteria | 4730 |
| 587 | Ga0495686_0104286 | 3300047472 | Bacteria | 1707 |
| 588 | Ga0495593_0005316 | 3300047673 | Bacteria | 7611 |
| 589 | Ga0495593_0009716 | 3300047673 | Bacteria | 5582 |
| 590 | Ga0495593_0010034 | 3300047673 | Bacteria | 5487 |
| 591 | Ga0495593_0048562 | 3300047673 | Bacteria | 2255 |
| 592 | Ga0495593_0051621 | 3300047673 | Bacteria | 2175 |
| 593 | Ga0495593_0056666 | 3300047673 | Bacteria | 2059 |
| 594 | Ga0495602_0000273 | 3300048088 | Bacteria | 47682 |
| 595 | Ga0495602_0004558 | 3300048088 | Bacteria | 14460 |
| 596 | Ga0495602_0004974 | 3300048088 | Bacteria | 13929 |
| 597 | Ga0495614_0000622 | 3300048089 | Bacteria | 14840 |
| 598 | Ga0495614_0006093 | 3300048089 | Bacteria | 5423 |
| 599 | Ga0495614_0025392 | 3300048089 | Bacteria | 2555 |
| 600 | Ga0495626_0000079 | 3300048091 | Bacteria | 129922 |
| 601 | Ga0495626_0000780 | 3300048091 | Bacteria | 28969 |
| 602 | Ga0495626_0004861 | 3300048091 | Bacteria | 8085 |
| 603 | Ga0495626_0009255 | 3300048091 | Bacteria | 5331 |
| 604 | Ga0495626_0032337 | 3300048091 | Bacteria | 2513 |
| 605 | Ga0495626_0046741 | 3300048091 | Bacteria | 2015 |
| 606 | Ga0496100_0001296 | 3300048903 | Bacteria | 12196 |
| 607 | Ga0496100_0001665 | 3300048903 | Bacteria | 11024 |
| 608 | Ga0496100_0017056 | 3300048903 | Bacteria | 4279 |
| 609 | Ga0496101_0002522 | 3300048904 | Bacteria | 11245 |
| 610 | Ga0496101_0016831 | 3300048904 | Bacteria | 4949 |
| 611 | Ga0496101_0040422 | 3300048904 | Bacteria | 3321 |
| 612 | Ga0496101_0053450 | 3300048904 | Bacteria | 2914 |
| 613 | Ga0496102_0001350 | 3300048905 | Bacteria | 21980 |
| 614 | Ga0496102_0097094 | 3300048905 | Bacteria | 2732 |
| 615 | Ga0496103_0001506 | 3300048906 | Bacteria | 15592 |
| 616 | Ga0496103_0003909 | 3300048906 | Bacteria | 9064 |
| 617 | Ga0496103_0120776 | 3300048906 | Bacteria | 1669 |
| 618 | Ga0496104_0019780 | 3300048907 | Bacteria | 6164 |
| 619 | Ga0496104_0050742 | 3300048907 | Bacteria | 3914 |
| 620 | Ga0496104_0075968 | 3300048907 | Bacteria | 3199 |
| 621 | Ga0496104_0248049 | 3300048907 | Bacteria | 1693 |
| 622 | Ga0496105_0002749 | 3300048908 | Bacteria | 12838 |
| 623 | Ga0496105_0081522 | 3300048908 | Bacteria | 2672 |
| 624 | Ga0496105_0135066 | 3300048908 | Bacteria | 2032 |
| 625 | Ga0496106_0000009 | 3300048909 | Bacteria | 238601 |
| 626 | Ga0496106_0013618 | 3300048909 | Bacteria | 6004 |
| 627 | Ga0496107_0049469 | 3300048910 | Bacteria | 3029 |
| 628 | Ga0496107_0154554 | 3300048910 | Bacteria | 1698 |
| 629 | Ga0496110_0101590 | 3300048913 | Bacteria | 2578 |
| 630 | Ga0496112_0010241 | 3300048915 | Bacteria | 8500 |
| 631 | Ga0496112_0018946 | 3300048915 | Bacteria | 6487 |
| 632 | Ga0496113_0011172 | 3300048916 | Bacteria | 5976 |
| 633 | Ga0496113_0343028 | 3300048916 | Bacteria | 1198 |
| 634 | Ga0496114_0005479 | 3300048917 | Bacteria | 9932 |
| 635 | Ga0496114_0009118 | 3300048917 | Bacteria | 7865 |
| 636 | Ga0496115_0026182 | 3300048918 | Bacteria | 4550 |
| 637 | Ga0496116_0000010 | 3300048919 | Bacteria | 665608 |
| 638 | Ga0496116_0001291 | 3300048919 | Bacteria | 28769 |
| 639 | Ga0496116_0011474 | 3300048919 | Bacteria | 7326 |
| 640 | Ga0496116_0067790 | 3300048919 | Bacteria | 2277 |
| 641 | Ga0496116_0081671 | 3300048919 | Bacteria | 2003 |
| 642 | Ga0496117_0000359 | 3300048920 | Bacteria | 79857 |
| 643 | Ga0496117_0000756 | 3300048920 | Bacteria | 50927 |
| 644 | Ga0496117_0001866 | 3300048920 | Bacteria | 28433 |
| 645 | Ga0496117_0002606 | 3300048920 | Bacteria | 22420 |
| 646 | Ga0496117_0002873 | 3300048920 | Bacteria | 20920 |
| 647 | Ga0496117_0003110 | 3300048920 | Bacteria | 19816 |
| 648 | Ga0496117_0003258 | 3300048920 | Bacteria | 19091 |
| 649 | Ga0496117_0007888 | 3300048920 | Bacteria | 10237 |
| 650 | Ga0496117_0008340 | 3300048920 | Bacteria | 9855 |
| 651 | Ga0496117_0146439 | 3300048920 | Bacteria | 1405 |
| 652 | Ga0496118_0000206 | 3300048921 | Bacteria | 104093 |
| 653 | Ga0496118_0001374 | 3300048921 | Bacteria | 36687 |
| 654 | Ga0496118_0005183 | 3300048921 | Bacteria | 14915 |
| 655 | Ga0496118_0008980 | 3300048921 | Bacteria | 10196 |
| 656 | Ga0496118_0011627 | 3300048921 | Bacteria | 8561 |
| 657 | Ga0496118_0023844 | 3300048921 | Bacteria | 5302 |
| 658 | Ga0496118_0049864 | 3300048921 | Bacteria | 3219 |
| 659 | Ga0496118_0052999 | 3300048921 | Bacteria | 3088 |
| 660 | Ga0496118_0069082 | 3300048921 | Bacteria | 2561 |
| 661 | Ga0496118_0071991 | 3300048921 | Bacteria | 2485 |
| 662 | Ga0496118_0085903 | 3300048921 | Bacteria | 2188 |
| 663 | Ga0496119_0001027 | 3300048922 | Bacteria | 35766 |
| 664 | Ga0496119_0006480 | 3300048922 | Bacteria | 10815 |
| 665 | Ga0496119_0027482 | 3300048922 | Bacteria | 3908 |
| 666 | Ga0496119_0033096 | 3300048922 | Bacteria | 3435 |
| 667 | Ga0496120_0000898 | 3300048923 | Bacteria | 41805 |
| 668 | Ga0496120_0004791 | 3300048923 | Bacteria | 11095 |
| 669 | Ga0496120_0014526 | 3300048923 | Bacteria | 5244 |
| 670 | Ga0496121_0000050 | 3300048924 | Bacteria | 318295 |
| 671 | Ga0496121_0000907 | 3300048924 | Bacteria | 53390 |
| 672 | Ga0496121_0001440 | 3300048924 | Bacteria | 40172 |
| 673 | Ga0496121_0002508 | 3300048924 | Bacteria | 27906 |
| 674 | Ga0496121_0003075 | 3300048924 | Bacteria | 24164 |
| 675 | Ga0496121_0004007 | 3300048924 | Bacteria | 20293 |
| 676 | Ga0496121_0007922 | 3300048924 | Bacteria | 12702 |
| 677 | Ga0496121_0011830 | 3300048924 | Bacteria | 9610 |
| 678 | Ga0496121_0129280 | 3300048924 | Bacteria | 1894 |
| 679 | Ga0496122_0008015 | 3300048925 | Bacteria | 11538 |
| 680 | Ga0496122_0010856 | 3300048925 | Bacteria | 9324 |
| 681 | Ga0496122_0013046 | 3300048925 | Bacteria | 8185 |
| 682 | Ga0496122_0014275 | 3300048925 | Bacteria | 7694 |
| 683 | Ga0496122_0023743 | 3300048925 | Bacteria | 5390 |
| 684 | Ga0496122_0055368 | 3300048925 | Bacteria | 2968 |
| 685 | Ga0496122_0083665 | 3300048925 | Bacteria | 2211 |
| 686 | Ga0496122_0104113 | 3300048925 | Bacteria | 1886 |
| 687 | Ga0496122_0126330 | 3300048925 | Bacteria | 1636 |
| 688 | Ga0496123_0000609 | 3300048926 | Bacteria | 60290 |
| 689 | Ga0496123_0000899 | 3300048926 | Bacteria | 47084 |
| 690 | Ga0496123_0015526 | 3300048926 | Bacteria | 6240 |
| 691 | Ga0496123_0022723 | 3300048926 | Bacteria | 4823 |
| 692 | Ga0496123_0033203 | 3300048926 | Bacteria | 3718 |
| 693 | Ga0496123_0072822 | 3300048926 | Bacteria | 2135 |
| 694 | Ga0496124_0000309 | 3300048927 | Bacteria | 90452 |
| 695 | Ga0496124_0004118 | 3300048927 | Bacteria | 17182 |
| 696 | Ga0496124_0007907 | 3300048927 | Bacteria | 11201 |
| 697 | Ga0496124_0025222 | 3300048927 | Bacteria | 5388 |
| 698 | Ga0496124_0049493 | 3300048927 | Bacteria | 3585 |
| 699 | Ga0496124_0059878 | 3300048927 | Bacteria | 3197 |
| 700 | Ga0496124_0128445 | 3300048927 | Bacteria | 2017 |
| 701 | Ga0496124_0167340 | 3300048927 | Bacteria | 1707 |
| 702 | Ga0496125_0000080 | 3300048928 | Bacteria | 228514 |
| 703 | Ga0496125_0000459 | 3300048928 | Bacteria | 73809 |
| 704 | Ga0496125_0035903 | 3300048928 | Bacteria | 4338 |
| 705 | Ga0496125_0040213 | 3300048928 | Bacteria | 4013 |
| 706 | Ga0496125_0082063 | 3300048928 | Bacteria | 2459 |
| 707 | Ga0496126_0000065 | 3300048929 | Bacteria | 252549 |
| 708 | Ga0496126_0000503 | 3300048929 | Bacteria | 76786 |
| 709 | Ga0496126_0015672 | 3300048929 | Bacteria | 7616 |
| 710 | Ga0496126_0020710 | 3300048929 | Bacteria | 6440 |
| 711 | Ga0496126_0037650 | 3300048929 | Bacteria | 4511 |
| 712 | Ga0496126_0158007 | 3300048929 | Bacteria | 1939 |
| 713 | Ga0495678_000020 | 3300049459 | Bacteria | 253654 |
| 714 | Ga0495678_028928 | 3300049459 | Bacteria | 2332 |
| 715 | Ga0495678_035143 | 3300049459 | Bacteria | 2057 |
| 716 | Ga0495682_0015036 | 3300049460 | Bacteria | 2933 |
| 717 | Ga0495682_0032221 | 3300049460 | Bacteria | 1936 |
| 718 | Ga0501034_0000685 | 3300049571 | Bacteria | 51551 |
| 719 | Ga0501222_000762 | 3300049662 | Bacteria | 4653 |
| 720 | nmdc:mga08x19_194340_c1 | 3300050514 | Bacteria | 1389 |
| 721 | nmdc:mga0sz30_855_c1 | 3300050516 | Bacteria | 6127 |
| 722 | Ga0500659_0000721 | 3300053135 | Bacteria | 21335 |
| 723 | 2501075694 | 2501025501 | Bacteria | 7768574 |
| 724 | 2501085806 | 2501025502 | Bacteria | 9641094 |
| 725 | 2501408664 | 2501025504 | Bacteria | 8008976 |
| 726 | 2509126584 | 2508501125 | Bacteria | 7208311 |
| 727 | 2511091497 | 2510917013 | Bacteria | 9951648 |
| 728 | 2511098376 | 2510917014 | Bacteria | 8296963 |
| 729 | 2511105367 | 2510917015 | Bacteria | 7950052 |
| 730 | 2511265037 | 2511231006 | Bacteria | 6794709 |
| 731 | 2511287384 | 2511231010 | Bacteria | 6373152 |
| 732 | 2511302704 | 2511231012 | Bacteria | 6738011 |
| 733 | 2511343746 | 2511231019 | Bacteria | 6520662 |
| 734 | 2511373515 | 2511231024 | Bacteria | 5835885 |
| 735 | 2511386128 | 2511231026 | Bacteria | 5225445 |
| 736 | 2512328910 | 2512047018 | Bacteria | 6663241 |
| 737 | 2513557382 | 2513237082 | Bacteria | 8640282 |
| 738 | 2513562991 | 2513237083 | Bacteria | 8410967 |
| 739 | 2513958132 | 2513237151 | Bacteria | 6309801 |
| 740 | 2514053760 | 2513237166 | Bacteria | 10373764 |
| 741 | 2515681368 | 2515154122 | Bacteria | 8609520 |
| 742 | 2516017576 | 2515154189 | Bacteria | 9629850 |
| 743 | 2519462534 | 2519103095 | Bacteria | 6629912 |
| 744 | 2527076087 | 2526164713 | Bacteria | 6780608 |
| 745 | 2554818505 | 2554235132 | Bacteria | 6772433 |
| 746 | 2555247143 | 2554235231 | Bacteria | 5215788 |
| 747 | 2555670509 | 2554235341 | Bacteria | 6867980 |
| 748 | 2563064949 | 2562617112 | Bacteria | 10918404 |
| 749 | 2583792298 | 2582580891 | Bacteria | 6800976 |
| 750 | 2585295530 | 2582581311 | Bacteria | 6763856 |
| 751 | 2597858403 | 2597489887 | Bacteria | 6666321 |
| 752 | 2597863524 | 2597489888 | Bacteria | 6179543 |
| 753 | 2599352465 | 2599185160 | Bacteria | 6844013 |
| 754 | 2599358814 | 2599185161 | Bacteria | 6960462 |
| 755 | 2599365665 | 2599185162 | Bacteria | 6957254 |
| 756 | 2599371457 | 2599185163 | Bacteria | 6995158 |
| 757 | 2599383706 | 2599185164 | Bacteria | 6841688 |
| 758 | 2599385050 | 2599185165 | Bacteria | 6843250 |
| 759 | 2599390366 | 2599185166 | Bacteria | 6959206 |
| 760 | 2599397531 | 2599185167 | Bacteria | 6353609 |
| 761 | 2599402500 | 2599185168 | Bacteria | 6997636 |
| 762 | 2599451976 | 2599185179 | Bacteria | 6611171 |
| 763 | 2599465185 | 2599185181 | Bacteria | 6844519 |
| 764 | 2599466412 | 2599185182 | Bacteria | 6883168 |
| 765 | 2599486379 | 2599185185 | Bacteria | 6652270 |
| 766 | 2599488319 | 2599185186 | Bacteria | 6831633 |
| 767 | 2599509997 | 2599185189 | Bacteria | 5862825 |
| 768 | 2599513642 | 2599185190 | Bacteria | 6285678 |
| 769 | 2599521947 | 2599185191 | Bacteria | 6297582 |
| 770 | 2599737614 | 2599185239 | Bacteria | 8686614 |
| 771 | 2599745120 | 2599185240 | Bacteria | 7968121 |
| 772 | 2599769086 | 2599185248 | Bacteria | 6696816 |
| 773 | 2599803002 | 2599185257 | Bacteria | 6492581 |
| 774 | 2599888330 | 2599185289 | Bacteria | 6778765 |
| 775 | 2599892319 | 2599185290 | Bacteria | 6289611 |
| 776 | 2599895942 | 2599185291 | Bacteria | 6775623 |
| 777 | 2599932296 | 2599185300 | Bacteria | 6062622 |
| 778 | 2599944269 | 2599185302 | Bacteria | 5954930 |
| 779 | 2599954741 | 2599185304 | Bacteria | 5951361 |
| 780 | 2599957826 | 2599185305 | Bacteria | 6748700 |
| 781 | 2599985683 | 2599185309 | Bacteria | 5969593 |
| 782 | 2599991531 | 2599185310 | Bacteria | 6014457 |
| 783 | 2600002520 | 2599185312 | Bacteria | 5912071 |
| 784 | 2600015550 | 2599185315 | Bacteria | 6771107 |
| 785 | 2600050174 | 2599185320 | Bacteria | 5963263 |
| 786 | 2600050758 | 2599185321 | Bacteria | 6764560 |
| 787 | 2600072721 | 2599185324 | Bacteria | 6590677 |
| 788 | 2600206699 | 2599185355 | Bacteria | 7968906 |
| 789 | 2600211900 | 2599185356 | Bacteria | 6843884 |
| 790 | 2600362750 | 2600254931 | Bacteria | 6734225 |
| 791 | 2600813580 | 2600255067 | Bacteria | 6795583 |
| 792 | 2601691525 | 2600255296 | Bacteria | 5784754 |
| 793 | 2601772068 | 2600255313 | Bacteria | 6842543 |
| 794 | 2601796943 | 2600255318 | Bacteria | 6383414 |
| 795 | 2606076327 | 2603880185 | Bacteria | 6379190 |
| 796 | 2606131237 | 2603880199 | Bacteria | 6377649 |
| 797 | 2608385362 | 2606217733 | Bacteria | 6360972 |
| 798 | 2621300302 | 2619619299 | Bacteria | 6649820 |
| 799 | 2624481227 | 2623620443 | Bacteria | 6427864 |
| 800 | 2643844835 | 2643221565 | Bacteria | 6216018 |
| 801 | 2643870591 | 2643221571 | Bacteria | 6228673 |
| 802 | 2671088634 | 2667528170 | Bacteria | 6786960 |
| 803 | 2671096009 | 2667528171 | Bacteria | 6900659 |
| 804 | 2671585446 | 2671180115 | Bacteria | 5353919 |
| 805 | 2671769376 | 2671180172 | Bacteria | 6495783 |
| 806 | 2676743152 | 2675903129 | Bacteria | 7964495 |
| 807 | 2677896014 | 2675903420 | Bacteria | 6247433 |
| 808 | 2678263695 | 2675903515 | Bacteria | 6580491 |
| 809 | 2713482061 | 2711768613 | Bacteria | 11048459 |
| 810 | 2715755730 | 2713897149 | Bacteria | 6506249 |
| 811 | 2722885565 | 2721755523 | Bacteria | 6430384 |
| 812 | 2723248341 | 2721755607 | Bacteria | 5841722 |
| 813 | 2738674669 | 2738541265 | Bacteria | 6594665 |
| 814 | 2738753062 | 2738541282 | Bacteria | 6593925 |
| 815 | 2738823334 | 2738541296 | Bacteria | 7285013 |
| 816 | 2738835564 | 2738541298 | Bacteria | 7286732 |
| 817 | 2738862217 | 2738541303 | Bacteria | 6591772 |
| 818 | 2738877255 | 2738541306 | Bacteria | 7284992 |
| 819 | 2739188961 | 2738543002 | Bacteria | 7284546 |
| 820 | 2739197807 | 2738543004 | Bacteria | 6381073 |
| 821 | 2739223848 | 2738543008 | Bacteria | 7282815 |
| 822 | 2739260815 | 2738543015 | Bacteria | 6750701 |
| 823 | 2739285896 | 2738543020 | Bacteria | 5718238 |
| 824 | 2739291209 | 2738543021 | Bacteria | 5718241 |
| 825 | 2743737854 | 2740892503 | Bacteria | 6855563 |
| 826 | 2745010026 | 2744054620 | Bacteria | 6551379 |
| 827 | 2746087615 | 2744054900 | Bacteria | 8399525 |
| 828 | 2746098889 | 2744054901 | Bacteria | 8397047 |
| 829 | 2765583640 | 2765235841 | Bacteria | 6137024 |
| 830 | 2794597165 | 2791355520 | Bacteria | 5948615 |
| 831 | 2807408051 | 2806310737 | Bacteria | 5751088 |
| 832 | 2807456354 | 2806310745 | Bacteria | 5742165 |
| 833 | 2808941759 | 2808606379 | Bacteria | 5022697 |
| 834 | 2808957985 | 2808606382 | Bacteria | 6841132 |
| 835 | 2808974088 | 2808606384 | Bacteria | 8474373 |
| 836 | 2809007600 | 2808606390 | Bacteria | 8476311 |
| 837 | 2809016067 | 2808606391 | Bacteria | 8308166 |
| 838 | 2812370437 | 2811994881 | Bacteria | 6298475 |
| 839 | 2817263103 | 2816332253 | Bacteria | 6764532 |
| 840 | 2817276521 | 2816332256 | Bacteria | 6891714 |
| 841 | 2817454586 | 2816332286 | Bacteria | 6853759 |
| 842 | 2817490624 | 2816332298 | Bacteria | 6852809 |
| 843 | 2819623988 | 2818991450 | Bacteria | 6962147 |
| 844 | 2819635675 | 2818991452 | Bacteria | 8442785 |
| 845 | 2819700556 | 2818991464 | Bacteria | 6907494 |
| 846 | 2837679713 | 2837678835 | Bacteria | 5252418 |
| 847 | 2842807681 | 2842805378 | Bacteria | 5385175 |
| 848 | 2842827303 | 2842826826 | Bacteria | 5974129 |
| 849 | 2842841717 | 2842837860 | Bacteria | 6066181 |
| 850 | 2842858266 | 2842854478 | Bacteria | 6143501 |
| 851 | 2844671119 | 2844665904 | Bacteria | 6817974 |
| 852 | 2856292474 | 2856287931 | Bacteria | 7223934 |
| 853 | 2860870927 | 2860867994 | Bacteria | 5645326 |
| 854 | 2863427909 | 2863421361 | Bacteria | 7300805 |
| 855 | 2870076429 | 2870068957 | Bacteria | 8925310 |
| 856 | 2876605039 | 2876601092 | Bacteria | 5114497 |
| 857 | 2878033180 | 2878029506 | Bacteria | 6418441 |
| 858 | 2885272680 | 2885270888 | Bacteria | 9831543 |
| 859 | 2900634473 | 2900634093 | Bacteria | 10263517 |
| 860 | 2902686185 | 2902682994 | Bacteria | 8951596 |
| 861 | 2904485625 | 2904483920 | Bacteria | 7545285 |
| 862 | 2904567105 | 2904564687 | Bacteria | 7609577 |
| 863 | 2904573951 | 2904571731 | Bacteria | 7608790 |
| 864 | 2904621810 | 2904615490 | Bacteria | 10047340 |
| 865 | 2908449071 | 2908446538 | Bacteria | 6829095 |
| 866 | 2908674176 | 2908669403 | Bacteria | 5740494 |
| 867 | 2913039499 | 2913036834 | Bacteria | 6704877 |
| 868 | 2917074337 | 2917070673 | Bacteria | 6868303 |
| 869 | 2919067098 | 2919063839 | Bacteria | 6302690 |
| 870 | 2919485484 | 2919481497 | Bacteria | 6907839 |
| 871 | 2919533789 | 2919527303 | Bacteria | 7718827 |
| 872 | 2921644371 | 2921643360 | Bacteria | 11448031 |
| 873 | 2923156901 | 2923153595 | Bacteria | 6870622 |
| 874 | 2923524528 | 2923519811 | Bacteria | 6298479 |
| 875 | 2928109555 | 2928108538 | Bacteria | 7360024 |
| 876 | 2928136991 | 2928135762 | Bacteria | 7259641 |
| 877 | 2928162607 | 2928157003 | Bacteria | 7522202 |
| 878 | 2928166847 | 2928163908 | Bacteria | 7561269 |
| 879 | 2928176868 | 2928170801 | Bacteria | 8785406 |
| 880 | 2928506519 | 2928503688 | Bacteria | 7268108 |
| 881 | 2928541063 | 2928536128 | Bacteria | 7657547 |
| 882 | 2929192166 | 2929189879 | Bacteria | 5930554 |
| 883 | 2931393518 | 2931390751 | Bacteria | 6273349 |
| 884 | 2935355599 | 2935353572 | Unclassified | 6955622 |
| 885 | 2939640026 | 2939636861 | Bacteria | 6297853 |
| 886 | 2945933035 | 2945928738 | Bacteria | 6053221 |
| 887 | 2945936061 | 2945934425 | Bacteria | 7444609 |
| 888 | 2945963081 | 2945961074 | Bacteria | 7342064 |
| 889 | 2946010481 | 2946006987 | Bacteria | 6705746 |
| 890 | 2946031252 | 2946027586 | Bacteria | 6049274 |
| 891 | 2947238217 | 2947233263 | Bacteria | 6439278 |
| 892 | 2981995304 | 2981990288 | Bacteria | 7590678 |
| 893 | 2984289197 | 2984286254 | Bacteria | 6702062 |
| 894 | 2990710034 | 2990703756 | Bacteria | 7715990 |
| 895 | 3000019644 | 3000017691 | Bacteria | 3772574 |
| 896 | 3007316967 | 3007315729 | Bacteria | 5076637 |
| 897 | 3007620654 | 3007619802 | Bacteria | 6411688 |
| 898 | 3007721650 | 3007718800 | Bacteria | 5971527 |
| 899 | 3007809370 | 3007803356 | Bacteria | 5931491 |
| 900 | 3007869063 | 3007866637 | Bacteria | 5899198 |
| 901 | 637320862 | 637000220 | Bacteria | 7074893 |
| 902 | 642422573 | 641736151 | Bacteria | 7477263 |
| 903 | 642417885 | 641736154 | Bacteria | 7689995 |
| 904 | 642597751 | 642555112 | Bacteria | 8676562 |
| 905 | 642621921 | 642555113 | Bacteria | 8214658 |
| 906 | 8003955866 | 8003955200 | Bacteria | 8601927 |
| 907 | 8011356091 | 8011350971 | Bacteria | 6158957 |
| 908 | 8015691146 | 8015687852 | Bacteria | 6613826 |
| 909 | 8018846121 | 8018845410 | Bacteria | 8933938 |
| 910 | 8019775453 | 8019769354 | Bacteria | 6924660 |
| 911 | 8020811539 | 8020807995 | Bacteria | 6801506 |
| 912 | 8020940135 | 8020938398 | Bacteria | 7472757 |
| 913 | 8020948171 | 8020945358 | Bacteria | 8467355 |
| 914 | 8020960356 | 8020953355 | Bacteria | 7439080 |
| 915 | 8021124653 | 8021120328 | Bacteria | 8782274 |
| 916 | 8039103673 | 8039098773 | Bacteria | 6602928 |
| 917 | 8040172896 | 8040167225 | Bacteria | 6542727 |
| 918 | 8040178796 | 8040173305 | Bacteria | 6827067 |
| 919 | 8052496841 | 8052494512 | Bacteria | 5765634 |
| 920 | 8054347923 | 8054347763 | Bacteria | 5901107 |
| 921 | 8054931536 | 8054929484 | Bacteria | 5599761 |
| 922 | 8055303173 | 8055301274 | Bacteria | 8587385 |
| 923 | 8055774284 | 8055770955 | Bacteria | 6827675 |
| 924 | 8055821523 | 8055817908 | Bacteria | 6609162 |
| 925 | 8055882693 | 8055878733 | Bacteria | 5907058 |
| 926 | 8056119044 | 8056115690 | Bacteria | 5527654 |
| 927 | 8056123849 | 8056120720 | Bacteria | 5758328 |
| 928 | 8056129509 | 8056125926 | Bacteria | 6228218 |
| 929 | 8056140722 | 8056137416 | Bacteria | 6147080 |
| 930 | 8056146092 | 8056143049 | Bacteria | 6307666 |
| 931 | 8056155006 | 8056148874 | Bacteria | 6479865 |
| 932 | 8056165676 | 8056161164 | Bacteria | 6106669 |
| 933 | 8056179192 | 8056177738 | Bacteria | 6748268 |
| 934 | 8057801109 | 8057798959 | Bacteria | 6713499 |
| 935 | Ga0079104_1000037 | |||
| 936 | SwRhRL2b_contig_2621290 | |||
| 937 | SwRhRL2b_contig_3688828 | |||
| 938 | JGI24739J22299_10007158 | |||
| 939 | JGI24735J21928_10000299 | |||
| 940 | JGI24735J21928_10002925 | |||
| 941 | JGI24735J21928_10007036 | |||
| 942 | JGI25156J39149_1000506 | |||
| 943 | JGI25162J39368_1000164 | |||
| 944 | JGI25163J39215_1000025 | |||
| 945 | JGI25164J39214_1000126 | |||
| 946 | JGI25165J46597_1000247 | |||
| 947 | rootH2_10164091 | |||
| 948 | rootH2_10197494 | |||
| 949 | rootL2_10002460 | |||
| 950 | JGI25160J50197_1000074 | |||
| 951 | Ga0055538_1000537 | |||
| 952 | Ga0055539_1000466 | |||
| 953 | Ga0055533_1000551 | |||
| 954 | Ga0055533_1000984 | |||
| 955 | Ga0055532_1000055 | |||
| 956 | Ga0055532_1000358 | |||
| 957 | Ga0055532_1000652 | |||
| 958 | Ga0055525_1000658 | |||
| 959 | Ga0055527_1000030 | |||
| 960 | Ga0055535_1000038 | |||
| 961 | Ga0055542_1000063 | |||
| 962 | Ga0055529_1000071 | |||
| 963 | Ga0055536_1000005 | |||
| 964 | Ga0055536_1000037 | |||
| 965 | Ga0055530_10000001 | |||
| 966 | Ga0055530_10000606 | |||
| 967 | Ga0055530_10000865 | |||
| 968 | Ga0055540_1000025 | |||
| 969 | Ga0055540_1000302 | |||
| 970 | Ga0055531_10000301 | |||
| 971 | Ga0055541_1000388 | |||
| 972 | Ga0058692_1000515 | |||
| 973 | Ga0065165_1000203 | |||
| 974 | Ga0065714_10064945 | |||
| 975 | Ga0065714_10067899 | |||
| 976 | Ga0065704_10071472 | |||
| 977 | Ga0065704_10071534 | |||
| 978 | Ga0070670_100000390 | |||
| 979 | Ga0070666_10030121 | |||
| 980 | Ga0070682_100117693 | |||
| 981 | Ga0070660_100000188 | |||
| 982 | Ga0070661_100076456 | |||
| 983 | Ga0070669_100132752 | |||
| 984 | Ga0070659_100000006 | |||
| 985 | Ga0070667_100046498 | |||
| 986 | Ga0070667_100187346 | |||
| 987 | Ga0070663_100011648 | |||
| 988 | Ga0070662_100018038 | |||
| 989 | Ga0070679_100037174 | |||
| 990 | Ga0068855_100104269 | |||
| 991 | Ga0068852_100155803 | |||
| 992 | Ga0068851_10001228 | |||
| 993 | Ga0075364_10000318 | |||
| 994 | Ga0075364_10193052 | |||
| 995 | Ga0099823_1000017 | |||
| 996 | Ga0079104_1000060 | |||
| 997 | Ga0079104_1000142 | |||
| 998 | Ga0105251_10001555 | |||
| 999 | Ga0105251_10005237 | |||
| 1000 | Ga0105251_10012466 | |||
| 1001 | Ga0105251_10015734 | |||
| 1002 | Ga0105251_10050949 | |||
| 1003 | Ga0105251_10050950 | |||
| 1004 | Ga0105251_10090437 | |||
| 1005 | Ga0105251_10091778 | |||
| 1006 | Ga0105244_10000533 | |||
| 1007 | Ga0105244_10000804 | |||
| 1008 | Ga0105244_10001274 | |||
| 1009 | Ga0105244_10015346 | |||
| 1010 | Ga0105244_10021413 | |||
| 1011 | Ga0105244_10031342 | |||
| 1012 | Ga0105244_10048150 | |||
| 1013 | Ga0105250_10026427 | |||
| 1014 | Ga0105250_10032517 | |||
| 1015 | Ga0105240_10005736 | |||
| 1016 | Ga0105240_10339894 | |||
| 1017 | Ga0105243_10000099 | |||
| 1018 | Ga0105243_10001355 | |||
| 1019 | Ga0105243_10012812 | |||
| 1020 | Ga0105237_10211339 | |||
| 1021 | Ga0105249_10359899 | |||
| 1022 | Ga0105239_10009639 | |||
| 1023 | Ga0105246_10000626 | |||
| 1024 | Ga0105246_10001438 | |||
| 1025 | Ga0157373_10000315 | |||
| 1026 | Ga0157373_10000596 | |||
| 1027 | Ga0157373_10005498 | |||
| 1028 | Ga0157371_10001604 | |||
| 1029 | Ga0157370_10000264 | |||
| 1030 | Ga0157370_10149938 | |||
| 1031 | Ga0157369_10019522 | |||
| 1032 | Ga0157369_10020661 | |||
| 1033 | Ga0157369_10021547 | |||
| 1034 | Ga0157369_10293892 | |||
| 1035 | Ga0157374_10027105 | |||
| 1036 | Ga0163162_10001693 | |||
| 1037 | Ga0157372_10084385 | |||
| 1038 | Ga0157375_10000602 | |||
| 1039 | Ga0157375_10002153 | |||
| 1040 | Ga0182008_10000425 | |||
| 1041 | Ga0182008_10001433 | |||
| 1042 | Ga0182008_10001892 | |||
| 1043 | Ga0182008_10011969 | |||
| 1044 | Ga0182007_10002722 | |||
| 1045 | Ga0182007_10012041 | |||
| 1046 | Ga0182005_1000533 | |||
| 1047 | Ga0182005_1019429 | |||
| 1048 | Ga0163161_10002303 | |||
| 1049 | Ga0163161_10002711 | |||
| 1050 | Ga0163161_10007270 | |||
| 1051 | Ga0163161_10010811 | |||
| 1052 | Ga0209760_100076 | |||
| 1053 | Ga0209784_100065 | |||
| 1054 | Ga0209566_100081 | |||
| 1055 | Ga0209566_100570 | |||
| 1056 | Ga0209674_100022 | |||
| 1057 | Ga0209674_100093 | |||
| 1058 | Ga0209674_100101 | |||
| 1059 | Ga0209674_102954 | |||
| 1060 | Ga0209672_100001 | |||
| 1061 | Ga0209147_100001 | |||
| 1062 | Ga0209147_100021 | |||
| 1063 | Ga0209147_100152 | |||
| 1064 | Ga0209563_100098 | |||
| 1065 | Ga0207427_100022 | |||
| 1066 | Ga0207427_101241 | |||
| 1067 | Ga0209437_100002 | |||
| 1068 | Ga0209258_100001 | |||
| 1069 | Ga0209258_100969 | |||
| 1070 | Ga0209646_1000363 | |||
| 1071 | Ga0209677_100059 | |||
| 1072 | Ga0209148_1000003 | |||
| 1073 | Ga0209759_1000030 | |||
| 1074 | Ga0209759_1000039 | |||
| 1075 | Ga0209759_1000099 | |||
| 1076 | Ga0209759_1003695 | |||
| 1077 | Ga0209233_1000004 | |||
| 1078 | Ga0209233_1000180 | |||
| 1079 | Ga0209455_1000001 | |||
| 1080 | Ga0209673_1000520 | |||
| 1081 | Ga0209130_1010530 | |||
| 1082 | Ga0209675_1001483 | |||
| 1083 | Ga0209676_1000002 | |||
| 1084 | Ga0209676_1000003 | |||
| 1085 | Ga0209676_1000522 | |||
| 1086 | Ga0209564_1020289 | |||
| 1087 | Ga0209050_1000004 | |||
| 1088 | Ga0209050_1000006 | |||
| 1089 | Ga0207426_1000018 | |||
| 1090 | Ga0207426_1001166 | |||
| 1091 | Ga0209051_1000001 | |||
| 1092 | Ga0209051_1000006 | |||
| 1093 | Ga0209257_1000056 | |||
| 1094 | Ga0207656_10000679 | |||
| 1095 | Ga0207696_1000006 | |||
| 1096 | Ga0207696_1000013 | |||
| 1097 | Ga0207696_1015699 | |||
| 1098 | Ga0207696_1023591 | |||
| 1099 | Ga0207655_1000143 | |||
| 1100 | Ga0207655_1000338 | |||
| 1101 | Ga0207655_1000432 | |||
| 1102 | Ga0207655_1005437 | |||
| 1103 | Ga0207655_1021816 | |||
| 1104 | Ga0207655_1039816 | |||
| 1105 | Ga0207713_1000551 | |||
| 1106 | Ga0207713_1000698 | |||
| 1107 | Ga0207713_1001164 | |||
| 1108 | Ga0207713_1002903 | |||
| 1109 | Ga0207713_1008002 | |||
| 1110 | Ga0207713_1014678 | |||
| 1111 | Ga0207680_10019143 | |||
| 1112 | Ga0207647_10011975 | |||
| 1113 | Ga0207647_10012538 | |||
| 1114 | Ga0207695_10001620 | |||
| 1115 | Ga0207657_10000270 | |||
| 1116 | Ga0207652_10054097 | |||
| 1117 | Ga0207681_10026264 | |||
| 1118 | Ga0207694_10125640 | |||
| 1119 | Ga0207650_10000204 | |||
| 1120 | Ga0207644_10347968 | |||
| 1121 | Ga0207690_10000019 | |||
| 1122 | Ga0207706_10003884 | |||
| 1123 | Ga0207709_10000014 | |||
| 1124 | Ga0207709_10006726 | |||
| 1125 | Ga0207667_10076888 | |||
| 1126 | Ga0207640_10279697 | |||
| 1127 | Ga0207678_10005353 | |||
| 1128 | Ga0207683_10196510 | |||
| 1129 | Ga0207698_10012043 | |||
| 1130 | Ga0209281_1000002 | |||
| 1131 | Ga0209281_1000064 | |||
| 1132 | Ga0209281_1000262 | |||
| 1133 | Ga0209389_1000022 | |||
| 1134 | Ga0209371_1000087 | |||
| 1135 | Ga0209371_1000203 | |||
| 1136 | Ga0209371_1000342 | |||
| 1137 | Ga0209371_1001734 | |||
| 1138 | Ga0207428_10056347 | |||
| 1139 | Ga0307515_10155884 | |||
| 1140 | Ga0268256_1000101 | |||
| 1141 | Ga0268256_1000291 | |||
| 1142 | Ga0268256_1001512 | |||
| 1143 | Ga0268256_1001704 | |||
| 1144 | Ga0307408_100000145 | |||
| 1145 | Ga0307408_100007984 | |||
| 1146 | Ga0307408_100241942 | |||
| 1147 | Ga0307514_10008864 | |||
| 1148 | Ga0307405_10000291 | |||
| 1149 | Ga0307405_10019036 | |||
| 1150 | Ga0307405_10020660 | |||
| 1151 | Ga0307405_10224191 | |||
| 1152 | Ga0307406_10004000 | |||
| 1153 | Ga0307412_10000005 | |||
| 1154 | Ga0307412_10007665 | |||
| 1155 | Ga0307412_10074752 | |||
| 1156 | Ga0307414_10012008 | |||
| 1157 | Ga0307411_10123024 | |||
| 1158 | Ga0395898_0019835 | |||
| 1159 | Ga0395905_0000009 | |||
| 1160 | Ga0395905_0001003 | |||
| 1161 | Ga0395905_0030642 | |||
| 1162 | Ga0395905_0036368 | |||
| 1163 | Ga0237819_00471 | |||
| 1164 | Ga0436365_1175663 | |||
| 1165 | Ga0439436_0000760 | |||
| 1166 | Ga0439438_000077 | |||
| 1167 | Ga0439438_000205 | |||
| 1168 | Ga0439438_000478 | |||
| 1169 | Ga0439438_001753 | |||
| 1170 | Ga0439438_001852 | |||
| 1171 | Ga0439438_010096 | |||
| 1172 | Ga0439438_010249 | |||
| 1173 | Ga0439447_001433 | |||
| 1174 | Ga0439447_002447 | |||
| 1175 | Ga0439447_006498 | |||
| 1176 | Ga0439447_015499 | |||
| 1177 | Ga0439466_0000298 | |||
| 1178 | Ga0439466_0003539 | |||
| 1179 | Ga0439466_0004779 | |||
| 1180 | Ga0439466_0018522 | |||
| 1181 | Ga0439466_0038296 | |||
| 1182 | Ga0439466_0040527 | |||
| 1183 | Ga0439431_0000666 | |||
| 1184 | Ga0439445_0008480 | |||
| 1185 | Ga0439432_000501 | |||
| 1186 | Ga0439432_002222 | |||
| 1187 | Ga0439432_007170 | |||
| 1188 | Ga0439432_009762 | |||
| 1189 | Ga0439452_000085 | |||
| 1190 | Ga0439452_000136 | |||
| 1191 | Ga0439452_002958 | |||
| 1192 | Ga0439452_003624 | |||
| 1193 | Ga0439456_000198 | |||
| 1194 | Ga0439456_002185 | |||
| 1195 | Ga0450911_003465 | |||
| 1196 | Ga0450920_006057 | |||
| 1197 | Ga0450922_000899 | |||
| 1198 | Ga0450902_008077 | |||
| 1199 | Ga0450903_003563 | |||
| 1200 | Ga0450905_003188 | |||
| 1201 | Ga0450906_009657 | |||
| 1202 | Ga0450907_003161 | |||
| 1203 | Ga0450910_001413 | |||
| 1204 | Ga0450910_001955 | |||
| 1205 | Ga0450909_002438 | |||
| 1206 | Ga0439434_0000582 | |||
| 1207 | Ga0439464_0011819 | |||
| 1208 | Ga0439440_0005583 | |||
| 1209 | Ga0466969_0010596 | |||
| 1210 | Ga0466977_0000224 | |||
| 1211 | Ga0466966_0005241 | |||
| 1212 | Ga0466970_0012731 | |||
| 1213 | Ga0466957_0117768 | |||
| 1214 | Ga0466958_0175341 | |||
| 1215 | Ga0495627_000504 | |||
| 1216 | Ga0495627_000781 | |||
| 1217 | Ga0495627_007203 | |||
| 1218 | Ga0495592_0062026 | |||
| 1219 | Ga0495603_0000871 | |||
| 1220 | Ga0495603_0055956 | |||
| 1221 | Ga0495590_0000173 | |||
| 1222 | Ga0495590_0002472 | |||
| 1223 | Ga0495591_000117 | |||
| 1224 | Ga0495591_002734 | |||
| 1225 | Ga0495591_003659 | |||
| 1226 | Ga0495629_0000310 | |||
| 1227 | Ga0495629_0005414 | |||
| 1228 | Ga0495629_0021205 | |||
| 1229 | Ga0495629_0021382 | |||
| 1230 | Ga0495629_0022413 | |||
| 1231 | Ga0495629_0054792 | |||
| 1232 | Ga0495638_0001452 | |||
| 1233 | Ga0495638_0007494 | |||
| 1234 | Ga0495638_0090744 | |||
| 1235 | Ga0495638_0111512 | |||
| 1236 | Ga0495641_0009924 | |||
| 1237 | Ga0495651_0051887 | |||
| 1238 | Ga0495653_0000937 | |||
| 1239 | Ga0495653_0006194 | |||
| 1240 | Ga0495653_0015189 | |||
| 1241 | Ga0495653_0017779 | |||
| 1242 | Ga0495653_0049902 | |||
| 1243 | Ga0495650_0000628 | |||
| 1244 | Ga0495650_0000802 | |||
| 1245 | Ga0495650_0001184 | |||
| 1246 | Ga0495650_0004910 | |||
| 1247 | Ga0495650_0006982 | |||
| 1248 | Ga0495650_0007178 | |||
| 1249 | Ga0495650_0012173 | |||
| 1250 | Ga0495650_0028536 | |||
| 1251 | Ga0495650_0028682 | |||
| 1252 | Ga0495580_0000047 | |||
| 1253 | Ga0495580_0001969 | |||
| 1254 | Ga0495580_0007575 | |||
| 1255 | Ga0495580_0023965 | |||
| 1256 | Ga0495580_0037797 | |||
| 1257 | Ga0495582_0002684 | |||
| 1258 | Ga0495582_0019964 | |||
| 1259 | Ga0495582_0036563 | |||
| 1260 | Ga0495605_0000036 | |||
| 1261 | Ga0495605_0000631 | |||
| 1262 | Ga0495605_0002926 | |||
| 1263 | Ga0495605_0003631 | |||
| 1264 | Ga0495605_0019021 | |||
| 1265 | Ga0495605_0022213 | |||
| 1266 | Ga0495662_0016913 | |||
| 1267 | Ga0495664_0002835 | |||
| 1268 | Ga0495664_0024889 | |||
| 1269 | Ga0495584_0001618 | |||
| 1270 | Ga0495584_0115241 | |||
| 1271 | Ga0495585_0000284 | |||
| 1272 | Ga0495585_0000711 | |||
| 1273 | Ga0495585_0029587 | |||
| 1274 | Ga0495585_0032050 | |||
| 1275 | Ga0495594_0006259 | |||
| 1276 | Ga0495596_0005767 | |||
| 1277 | Ga0495596_0007942 | |||
| 1278 | Ga0495596_0012731 | |||
| 1279 | Ga0495607_0036051 | |||
| 1280 | Ga0495607_0088520 | |||
| 1281 | Ga0495583_0000028 | |||
| 1282 | Ga0495583_0000109 | |||
| 1283 | Ga0495583_0000511 | |||
| 1284 | Ga0495583_0001837 | |||
| 1285 | Ga0495583_0006414 | |||
| 1286 | Ga0495583_0017299 | |||
| 1287 | Ga0495606_0000204 | |||
| 1288 | Ga0495606_0000270 | |||
| 1289 | Ga0495606_0001623 | |||
| 1290 | Ga0495606_0011345 | |||
| 1291 | Ga0495606_0011356 | |||
| 1292 | Ga0495606_0028555 | |||
| 1293 | Ga0495606_0033517 | |||
| 1294 | Ga0495606_0037710 | |||
| 1295 | Ga0495606_0078706 | |||
| 1296 | Ga0495608_0085761 | |||
| 1297 | Ga0495610_0006250 | |||
| 1298 | Ga0495610_0014560 | |||
| 1299 | Ga0495610_0024169 | |||
| 1300 | Ga0495610_0032287 | |||
| 1301 | Ga0495610_0037818 | |||
| 1302 | Ga0495610_0046618 | |||
| 1303 | Ga0495610_0049498 | |||
| 1304 | Ga0495610_0053315 | |||
| 1305 | Ga0495610_0053707 | |||
| 1306 | Ga0495616_0039330 | |||
| 1307 | Ga0495616_0083207 | |||
| 1308 | Ga0495618_0002049 | |||
| 1309 | Ga0495618_0013398 | |||
| 1310 | Ga0495618_0017322 | |||
| 1311 | Ga0495620_0000049 | |||
| 1312 | Ga0495620_0000073 | |||
| 1313 | Ga0495620_0009807 | |||
| 1314 | Ga0495620_0022114 | |||
| 1315 | Ga0495628_0005251 | |||
| 1316 | Ga0495628_0015580 | |||
| 1317 | Ga0495628_0031441 | |||
| 1318 | Ga0495628_0046817 | |||
| 1319 | Ga0495628_0047821 | |||
| 1320 | Ga0495628_0135357 | |||
| 1321 | Ga0495630_0001476 | |||
| 1322 | Ga0495630_0005335 | |||
| 1323 | Ga0495630_0028040 | |||
| 1324 | Ga0495630_0050899 | |||
| 1325 | Ga0495630_0061356 | |||
| 1326 | Ga0495631_0061618 | |||
| 1327 | Ga0495632_0000051 | |||
| 1328 | Ga0495632_0000742 | |||
| 1329 | Ga0495632_0001635 | |||
| 1330 | Ga0495632_0003365 | |||
| 1331 | Ga0495637_0007116 | |||
| 1332 | Ga0495637_0020012 | |||
| 1333 | Ga0495637_0022414 | |||
| 1334 | Ga0495637_0030956 | |||
| 1335 | Ga0495637_0042350 | |||
| 1336 | Ga0495643_0000150 | |||
| 1337 | Ga0495643_0000152 | |||
| 1338 | Ga0495643_0000445 | |||
| 1339 | Ga0495643_0001282 | |||
| 1340 | Ga0495644_0051973 | |||
| 1341 | Ga0495648_0000512 | |||
| 1342 | Ga0495648_0000560 | |||
| 1343 | Ga0495648_0001151 | |||
| 1344 | Ga0495648_0001307 | |||
| 1345 | Ga0495648_0002230 | |||
| 1346 | Ga0495648_0050276 | |||
| 1347 | Ga0495648_0061099 | |||
| 1348 | Ga0495648_0068855 | |||
| 1349 | Ga0495666_0004585 | |||
| 1350 | Ga0495642_0000018 | |||
| 1351 | Ga0495642_0003020 | |||
| 1352 | Ga0495642_0012506 | |||
| 1353 | Ga0495652_0010089 | |||
| 1354 | Ga0495652_0022094 | |||
| 1355 | Ga0495652_0068711 | |||
| 1356 | Ga0495652_0192799 | |||
| 1357 | Ga0495654_0000246 | |||
| 1358 | Ga0495654_0000432 | |||
| 1359 | Ga0495654_0002687 | |||
| 1360 | Ga0495654_0005855 | |||
| 1361 | Ga0495654_0010556 | |||
| 1362 | Ga0495654_0011171 | |||
| 1363 | Ga0495654_0062578 | |||
| 1364 | Ga0495654_0108985 | |||
| 1365 | Ga0495665_0005136 | |||
| 1366 | Ga0495665_0017762 | |||
| 1367 | Ga0495665_0025622 | |||
| 1368 | Ga0495665_0028537 | |||
| 1369 | Ga0495640_0007879 | |||
| 1370 | Ga0495586_0001052 | |||
| 1371 | Ga0495586_0008468 | |||
| 1372 | Ga0495586_0078806 | |||
| 1373 | Ga0495587_0004029 | |||
| 1374 | Ga0495587_0012559 | |||
| 1375 | Ga0495609_0000014 | |||
| 1376 | Ga0495609_0000115 | |||
| 1377 | Ga0495597_0000635 | |||
| 1378 | Ga0495597_0003598 | |||
| 1379 | Ga0495597_0016635 | |||
| 1380 | Ga0495597_0054975 | |||
| 1381 | Ga0495645_0000185 | |||
| 1382 | Ga0495645_0000915 | |||
| 1383 | Ga0495645_0086631 | |||
| 1384 | Ga0495645_0107292 | |||
| 1385 | Ga0495633_0000028 | |||
| 1386 | Ga0495667_0019337 | |||
| 1387 | Ga0495668_0021608 | |||
| 1388 | Ga0495634_0026224 | |||
| 1389 | Ga0495634_0046998 | |||
| 1390 | Ga0495611_0036346 | |||
| 1391 | Ga0495611_0041270 | |||
| 1392 | Ga0495625_0107485 | |||
| 1393 | Ga0495635_0003126 | |||
| 1394 | Ga0495635_0019568 | |||
| 1395 | Ga0495635_0026970 | |||
| 1396 | Ga0495635_0036214 | |||
| 1397 | Ga0495635_0039275 | |||
| 1398 | Ga0495661_0000007 | |||
| 1399 | Ga0495661_0000100 | |||
| 1400 | Ga0495661_0000144 | |||
| 1401 | Ga0495661_0000211 | |||
| 1402 | Ga0495661_0010888 | |||
| 1403 | Ga0495661_0014156 | |||
| 1404 | Ga0495661_0029189 | |||
| 1405 | Ga0495661_0061942 | |||
| 1406 | Ga0495588_0029072 | |||
| 1407 | Ga0495588_0050748 | |||
| 1408 | Ga0495657_0065714 | |||
| 1409 | Ga0495599_0001328 | |||
| 1410 | Ga0495599_0024802 | |||
| 1411 | Ga0495599_0068519 | |||
| 1412 | Ga0495623_0001986 | |||
| 1413 | Ga0495623_0006279 | |||
| 1414 | Ga0495623_0041565 | |||
| 1415 | Ga0495623_0055802 | |||
| 1416 | Ga0495623_0101012 | |||
| 1417 | Ga0495646_0001386 | |||
| 1418 | Ga0495646_0004735 | |||
| 1419 | Ga0495646_0082040 | |||
| 1420 | Ga0495646_0088712 | |||
| 1421 | Ga0495669_0019138 | |||
| 1422 | Ga0495669_0047114 | |||
| 1423 | Ga0495613_0023372 | |||
| 1424 | Ga0495624_0000502 | |||
| 1425 | Ga0495624_0001403 | |||
| 1426 | Ga0495624_0003505 | |||
| 1427 | Ga0495624_0005612 | |||
| 1428 | Ga0495624_0012833 | |||
| 1429 | Ga0495624_0018840 | |||
| 1430 | Ga0495624_0058746 | |||
| 1431 | Ga0495670_0000942 | |||
| 1432 | Ga0495671_0003839 | |||
| 1433 | Ga0495671_0004675 | |||
| 1434 | Ga0495671_0015247 | |||
| 1435 | Ga0495671_0027953 | |||
| 1436 | Ga0495671_0082985 | |||
| 1437 | Ga0495671_0095866 | |||
| 1438 | Ga0495649_0000110 | |||
| 1439 | Ga0495649_0000764 | |||
| 1440 | Ga0495649_0002230 | |||
| 1441 | Ga0495649_0007336 | |||
| 1442 | Ga0495649_0008267 | |||
| 1443 | Ga0495649_0015493 | |||
| 1444 | Ga0495649_0024949 | |||
| 1445 | Ga0495649_0027847 | |||
| 1446 | Ga0495649_0055582 | |||
| 1447 | Ga0495649_0057493 | |||
| 1448 | Ga0495649_0089239 | |||
| 1449 | Ga0495589_0000297 | |||
| 1450 | Ga0495589_0002558 | |||
| 1451 | Ga0495589_0003366 | |||
| 1452 | Ga0495589_0005324 | |||
| 1453 | Ga0495589_0019622 | |||
| 1454 | Ga0495589_0037158 | |||
| 1455 | Ga0495600_0005652 | |||
| 1456 | Ga0495660_0029420 | |||
| 1457 | Ga0495581_0002420 | |||
| 1458 | Ga0495581_0016499 | |||
| 1459 | Ga0495604_0000506 | |||
| 1460 | Ga0495604_0004171 | |||
| 1461 | Ga0495604_0017237 | |||
| 1462 | Ga0495604_0048542 | |||
| 1463 | Ga0495604_0119157 | |||
| 1464 | Ga0495674_0000598 | |||
| 1465 | Ga0495674_0004116 | |||
| 1466 | Ga0495674_0013144 | |||
| 1467 | Ga0495674_0019972 | |||
| 1468 | Ga0495674_0026139 | |||
| 1469 | Ga0495672_0000995 | |||
| 1470 | Ga0495672_0006835 | |||
| 1471 | Ga0495672_0009422 | |||
| 1472 | Ga0495672_0012784 | |||
| 1473 | Ga0495672_0039353 | |||
| 1474 | Ga0495676_0019606 | |||
| 1475 | Ga0495676_0028059 | |||
| 1476 | Ga0495676_0060712 | |||
| 1477 | Ga0495676_0076369 | |||
| 1478 | Ga0495676_0178149 | |||
| 1479 | Ga0495680_0005885 | |||
| 1480 | Ga0495680_0006126 | |||
| 1481 | Ga0495680_0034155 | |||
| 1482 | Ga0495683_0000091 | |||
| 1483 | Ga0495683_0000578 | |||
| 1484 | Ga0495683_0004864 | |||
| 1485 | Ga0495683_0004934 | |||
| 1486 | Ga0495683_0012413 | |||
| 1487 | Ga0495683_0049206 | |||
| 1488 | Ga0495683_0054009 | |||
| 1489 | Ga0495687_000294 | |||
| 1490 | Ga0495687_007776 | |||
| 1491 | Ga0495687_009595 | |||
| 1492 | Ga0495687_037994 | |||
| 1493 | Ga0495675_0004036 | |||
| 1494 | Ga0495675_0009198 | |||
| 1495 | Ga0495675_0019815 | |||
| 1496 | Ga0495675_0035887 | |||
| 1497 | Ga0495675_0066610 | |||
| 1498 | Ga0495675_0079450 | |||
| 1499 | Ga0495679_000012 | |||
| 1500 | Ga0495679_000083 | |||
| 1501 | Ga0495679_000836 | |||
| 1502 | Ga0495679_002695 | |||
| 1503 | Ga0495679_004048 | |||
| 1504 | Ga0495679_005142 | |||
| 1505 | Ga0495679_012643 | |||
| 1506 | Ga0495679_020535 | |||
| 1507 | Ga0495673_0002326 | |||
| 1508 | Ga0495673_0018789 | |||
| 1509 | Ga0495673_0024236 | |||
| 1510 | Ga0495673_0025962 | |||
| 1511 | Ga0495681_0000221 | |||
| 1512 | Ga0495681_0003291 | |||
| 1513 | Ga0495681_0003640 | |||
| 1514 | Ga0495681_0020343 | |||
| 1515 | Ga0495681_0020972 | |||
| 1516 | Ga0495681_0021981 | |||
| 1517 | Ga0495681_0050074 | |||
| 1518 | Ga0495684_0087175 | |||
| 1519 | Ga0495684_0209711 | |||
| 1520 | Ga0495686_0018124 | |||
| 1521 | Ga0495686_0104286 | |||
| 1522 | Ga0495593_0005316 | |||
| 1523 | Ga0495593_0009716 | |||
| 1524 | Ga0495593_0010034 | |||
| 1525 | Ga0495593_0048562 | |||
| 1526 | Ga0495593_0051621 | |||
| 1527 | Ga0495593_0056666 | |||
| 1528 | Ga0495602_0000273 | |||
| 1529 | Ga0495602_0004558 | |||
| 1530 | Ga0495602_0004974 | |||
| 1531 | Ga0495614_0000622 | |||
| 1532 | Ga0495614_0006093 | |||
| 1533 | Ga0495614_0025392 | |||
| 1534 | Ga0495626_0000079 | |||
| 1535 | Ga0495626_0000780 | |||
| 1536 | Ga0495626_0004861 | |||
| 1537 | Ga0495626_0009255 | |||
| 1538 | Ga0495626_0032337 | |||
| 1539 | Ga0495626_0046741 | |||
| 1540 | Ga0496100_0001296 | |||
| 1541 | Ga0496100_0001665 | |||
| 1542 | Ga0496100_0017056 | |||
| 1543 | Ga0496101_0002522 | |||
| 1544 | Ga0496101_0016831 | |||
| 1545 | Ga0496101_0040422 | |||
| 1546 | Ga0496101_0053450 | |||
| 1547 | Ga0496102_0001350 | |||
| 1548 | Ga0496102_0097094 | |||
| 1549 | Ga0496103_0001506 | |||
| 1550 | Ga0496103_0003909 | |||
| 1551 | Ga0496103_0120776 | |||
| 1552 | Ga0496104_0019780 | |||
| 1553 | Ga0496104_0050742 | |||
| 1554 | Ga0496104_0075968 | |||
| 1555 | Ga0496104_0248049 | |||
| 1556 | Ga0496105_0002749 | |||
| 1557 | Ga0496105_0081522 | |||
| 1558 | Ga0496105_0135066 | |||
| 1559 | Ga0496106_0000009 | |||
| 1560 | Ga0496106_0013618 | |||
| 1561 | Ga0496107_0049469 | |||
| 1562 | Ga0496107_0154554 | |||
| 1563 | Ga0496110_0101590 | |||
| 1564 | Ga0496112_0010241 | |||
| 1565 | Ga0496112_0018946 | |||
| 1566 | Ga0496113_0011172 | |||
| 1567 | Ga0496113_0343028 | |||
| 1568 | Ga0496114_0005479 | |||
| 1569 | Ga0496114_0009118 | |||
| 1570 | Ga0496115_0026182 | |||
| 1571 | Ga0496116_0000010 | |||
| 1572 | Ga0496116_0001291 | |||
| 1573 | Ga0496116_0011474 | |||
| 1574 | Ga0496116_0067790 | |||
| 1575 | Ga0496116_0081671 | |||
| 1576 | Ga0496117_0000359 | |||
| 1577 | Ga0496117_0000756 | |||
| 1578 | Ga0496117_0001866 | |||
| 1579 | Ga0496117_0002606 | |||
| 1580 | Ga0496117_0002873 | |||
| 1581 | Ga0496117_0003110 | |||
| 1582 | Ga0496117_0003258 | |||
| 1583 | Ga0496117_0007888 | |||
| 1584 | Ga0496117_0008340 | |||
| 1585 | Ga0496117_0146439 | |||
| 1586 | Ga0496118_0000206 | |||
| 1587 | Ga0496118_0001374 | |||
| 1588 | Ga0496118_0005183 | |||
| 1589 | Ga0496118_0008980 | |||
| 1590 | Ga0496118_0011627 | |||
| 1591 | Ga0496118_0023844 | |||
| 1592 | Ga0496118_0049864 | |||
| 1593 | Ga0496118_0052999 | |||
| 1594 | Ga0496118_0069082 | |||
| 1595 | Ga0496118_0071991 | |||
| 1596 | Ga0496118_0085903 | |||
| 1597 | Ga0496119_0001027 | |||
| 1598 | Ga0496119_0006480 | |||
| 1599 | Ga0496119_0027482 | |||
| 1600 | Ga0496119_0033096 | |||
| 1601 | Ga0496120_0000898 | |||
| 1602 | Ga0496120_0004791 | |||
| 1603 | Ga0496120_0014526 | |||
| 1604 | Ga0496121_0000050 | |||
| 1605 | Ga0496121_0000907 | |||
| 1606 | Ga0496121_0001440 | |||
| 1607 | Ga0496121_0002508 | |||
| 1608 | Ga0496121_0003075 | |||
| 1609 | Ga0496121_0004007 | |||
| 1610 | Ga0496121_0007922 | |||
| 1611 | Ga0496121_0011830 | |||
| 1612 | Ga0496121_0129280 | |||
| 1613 | Ga0496122_0008015 | |||
| 1614 | Ga0496122_0010856 | |||
| 1615 | Ga0496122_0013046 | |||
| 1616 | Ga0496122_0014275 | |||
| 1617 | Ga0496122_0023743 | |||
| 1618 | Ga0496122_0055368 | |||
| 1619 | Ga0496122_0083665 | |||
| 1620 | Ga0496122_0104113 | |||
| 1621 | Ga0496122_0126330 | |||
| 1622 | Ga0496123_0000609 | |||
| 1623 | Ga0496123_0000899 | |||
| 1624 | Ga0496123_0015526 | |||
| 1625 | Ga0496123_0022723 | |||
| 1626 | Ga0496123_0033203 | |||
| 1627 | Ga0496123_0072822 | |||
| 1628 | Ga0496124_0000309 | |||
| 1629 | Ga0496124_0004118 | |||
| 1630 | Ga0496124_0007907 | |||
| 1631 | Ga0496124_0025222 | |||
| 1632 | Ga0496124_0049493 | |||
| 1633 | Ga0496124_0059878 | |||
| 1634 | Ga0496124_0128445 | |||
| 1635 | Ga0496124_0167340 | |||
| 1636 | Ga0496125_0000080 | |||
| 1637 | Ga0496125_0000459 | |||
| 1638 | Ga0496125_0035903 | |||
| 1639 | Ga0496125_0040213 | |||
| 1640 | Ga0496125_0082063 | |||
| 1641 | Ga0496126_0000065 | |||
| 1642 | Ga0496126_0000503 | |||
| 1643 | Ga0496126_0015672 | |||
| 1644 | Ga0496126_0020710 | |||
| 1645 | Ga0496126_0037650 | |||
| 1646 | Ga0496126_0158007 | |||
| 1647 | Ga0495678_000020 | |||
| 1648 | Ga0495678_028928 | |||
| 1649 | Ga0495678_035143 | |||
| 1650 | Ga0495682_0015036 | |||
| 1651 | Ga0495682_0032221 | |||
| 1652 | Ga0501034_0000685 | |||
| 1653 | Ga0501222_000762 | |||
| 1654 | nmdc:mga08x19_194340_c1 | |||
| 1655 | nmdc:mga0sz30_855_c1 | |||
| 1656 | Ga0500659_0000721 | |||
| 1657 | 2501075694 | |||
| 1658 | 2501085806 | |||
| 1659 | 2501408664 | |||
| 1660 | 2509126584 | |||
| 1661 | 2511091497 | |||
| 1662 | 2511098376 | |||
| 1663 | 2511105367 | |||
| 1664 | 2511265037 | |||
| 1665 | 2511287384 | |||
| 1666 | 2511302704 | |||
| 1667 | 2511343746 | |||
| 1668 | 2511373515 | |||
| 1669 | 2511386128 | |||
| 1670 | 2512328910 | |||
| 1671 | 2513557382 | |||
| 1672 | 2513562991 | |||
| 1673 | 2513958132 | |||
| 1674 | 2514053760 | |||
| 1675 | 2515681368 | |||
| 1676 | 2516017576 | |||
| 1677 | 2519462534 | |||
| 1678 | 2527076087 | |||
| 1679 | 2554818505 | |||
| 1680 | 2555247143 | |||
| 1681 | 2555670509 | |||
| 1682 | 2563064949 | |||
| 1683 | 2583792298 | |||
| 1684 | 2585295530 | |||
| 1685 | 2597858403 | |||
| 1686 | 2597863524 | |||
| 1687 | 2599352465 | |||
| 1688 | 2599358814 | |||
| 1689 | 2599365665 | |||
| 1690 | 2599371457 | |||
| 1691 | 2599383706 | |||
| 1692 | 2599385050 | |||
| 1693 | 2599390366 | |||
| 1694 | 2599397531 | |||
| 1695 | 2599402500 | |||
| 1696 | 2599451976 | |||
| 1697 | 2599465185 | |||
| 1698 | 2599466412 | |||
| 1699 | 2599486379 | |||
| 1700 | 2599488319 | |||
| 1701 | 2599509997 | |||
| 1702 | 2599513642 | |||
| 1703 | 2599521947 | |||
| 1704 | 2599737614 | |||
| 1705 | 2599745120 | |||
| 1706 | 2599769086 | |||
| 1707 | 2599803002 | |||
| 1708 | 2599888330 | |||
| 1709 | 2599892319 | |||
| 1710 | 2599895942 | |||
| 1711 | 2599932296 | |||
| 1712 | 2599944269 | |||
| 1713 | 2599954741 | |||
| 1714 | 2599957826 | |||
| 1715 | 2599985683 | |||
| 1716 | 2599991531 | |||
| 1717 | 2600002520 | |||
| 1718 | 2600015550 | |||
| 1719 | 2600050174 | |||
| 1720 | 2600050758 | |||
| 1721 | 2600072721 | |||
| 1722 | 2600206699 | |||
| 1723 | 2600211900 | |||
| 1724 | 2600362750 | |||
| 1725 | 2600813580 | |||
| 1726 | 2601691525 | |||
| 1727 | 2601772068 | |||
| 1728 | 2601796943 | |||
| 1729 | 2606076327 | |||
| 1730 | 2606131237 | |||
| 1731 | 2608385362 | |||
| 1732 | 2621300302 | |||
| 1733 | 2624481227 | |||
| 1734 | 2643844835 | |||
| 1735 | 2643870591 | |||
| 1736 | 2671088634 | |||
| 1737 | 2671096009 | |||
| 1738 | 2671585446 | |||
| 1739 | 2671769376 | |||
| 1740 | 2676743152 | |||
| 1741 | 2677896014 | |||
| 1742 | 2678263695 | |||
| 1743 | 2713482061 | |||
| 1744 | 2715755730 | |||
| 1745 | 2722885565 | |||
| 1746 | 2723248341 | |||
| 1747 | 2738674669 | |||
| 1748 | 2738753062 | |||
| 1749 | 2738823334 | |||
| 1750 | 2738835564 | |||
| 1751 | 2738862217 | |||
| 1752 | 2738877255 | |||
| 1753 | 2739188961 | |||
| 1754 | 2739197807 | |||
| 1755 | 2739223848 | |||
| 1756 | 2739260815 | |||
| 1757 | 2739285896 | |||
| 1758 | 2739291209 | |||
| 1759 | 2743737854 | |||
| 1760 | 2745010026 | |||
| 1761 | 2746087615 | |||
| 1762 | 2746098889 | |||
| 1763 | 2765583640 | |||
| 1764 | 2794597165 | |||
| 1765 | 2807408051 | |||
| 1766 | 2807456354 | |||
| 1767 | 2808941759 | |||
| 1768 | 2808957985 | |||
| 1769 | 2808974088 | |||
| 1770 | 2809007600 | |||
| 1771 | 2809016067 | |||
| 1772 | 2812370437 | |||
| 1773 | 2817263103 | |||
| 1774 | 2817276521 | |||
| 1775 | 2817454586 | |||
| 1776 | 2817490624 | |||
| 1777 | 2819623988 | |||
| 1778 | 2819635675 | |||
| 1779 | 2819700556 | |||
| 1780 | 2837679713 | |||
| 1781 | 2842807681 | |||
| 1782 | 2842827303 | |||
| 1783 | 2842841717 | |||
| 1784 | 2842858266 | |||
| 1785 | 2844671119 | |||
| 1786 | 2856292474 | |||
| 1787 | 2860870927 | |||
| 1788 | 2863427909 | |||
| 1789 | 2870076429 | |||
| 1790 | 2876605039 | |||
| 1791 | 2878033180 | |||
| 1792 | 2885272680 | |||
| 1793 | 2900634473 | |||
| 1794 | 2902686185 | |||
| 1795 | 2904485625 | |||
| 1796 | 2904567105 | |||
| 1797 | 2904573951 | |||
| 1798 | 2904621810 | |||
| 1799 | 2908449071 | |||
| 1800 | 2908674176 | |||
| 1801 | 2913039499 | |||
| 1802 | 2917074337 | |||
| 1803 | 2919067098 | |||
| 1804 | 2919485484 | |||
| 1805 | 2919533789 | |||
| 1806 | 2921644371 | |||
| 1807 | 2923156901 | |||
| 1808 | 2923524528 | |||
| 1809 | 2928109555 | |||
| 1810 | 2928136991 | |||
| 1811 | 2928162607 | |||
| 1812 | 2928166847 | |||
| 1813 | 2928176868 | |||
| 1814 | 2928506519 | |||
| 1815 | 2928541063 | |||
| 1816 | 2929192166 | |||
| 1817 | 2931393518 | |||
| 1818 | 2935355599 | |||
| 1819 | 2939640026 | |||
| 1820 | 2945933035 | |||
| 1821 | 2945936061 | |||
| 1822 | 2945963081 | |||
| 1823 | 2946010481 | |||
| 1824 | 2946031252 | |||
| 1825 | 2947238217 | |||
| 1826 | 2981995304 | |||
| 1827 | 2984289197 | |||
| 1828 | 2990710034 | |||
| 1829 | 3000019644 | |||
| 1830 | 3007316967 | |||
| 1831 | 3007620654 | |||
| 1832 | 3007721650 | |||
| 1833 | 3007809370 | |||
| 1834 | 3007869063 | |||
| 1835 | 637320862 | |||
| 1836 | 642422573 | |||
| 1837 | 642417885 | |||
| 1838 | 642597751 | |||
| 1839 | 642621921 | |||
| 1840 | 8003955866 | |||
| 1841 | 8011356091 | |||
| 1842 | 8015691146 | |||
| 1843 | 8018846121 | |||
| 1844 | 8019775453 | |||
| 1845 | 8020811539 | |||
| 1846 | 8020940135 | |||
| 1847 | 8020948171 | |||
| 1848 | 8020960356 | |||
| 1849 | 8021124653 | |||
| 1850 | 8039103673 | |||
| 1851 | 8040172896 | |||
| 1852 | 8040178796 | |||
| 1853 | 8052496841 | |||
| 1854 | 8054347923 | |||
| 1855 | 8054931536 | |||
| 1856 | 8055303173 | |||
| 1857 | 8055774284 | |||
| 1858 | 8055821523 | |||
| 1859 | 8055882693 | |||
| 1860 | 8056119044 | |||
| 1861 | 8056123849 | |||
| 1862 | 8056129509 | |||
| 1863 | 8056140722 | |||
| 1864 | 8056146092 | |||
| 1865 | 8056155006 | |||
| 1866 | 8056165676 | |||
| 1867 | 8056179192 | |||
| 1868 | 8057801109 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7uoi-assembly1.cif.gz_A-2 | crystallographic structure of dape from enterococcus faecium | 0.8778 | 1 | 383 |
| 7uoi-assembly1.cif.gz_A-2 | crystallographic structure of dape from enterococcus faecium | 0.8655 | 1 | 383 |
| 7rsf-assembly1.cif.gz_B | acetylornithine deacetylase from escherichia coli | 0.8456 | 5 | 384 |
| 7rsf-assembly1.cif.gz_B | acetylornithine deacetylase from escherichia coli | 0.8355 | 5 | 384 |
| 2f7v-assembly1.cif.gz_A | structure of acetylcitrulline deacetylase complexed with one co | 0.8266 | 5 | 379 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DU62_176_300_3.30.70.360 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9636 | 177 | 298 | 3.30.70.360 |
| af_Q4CYZ5_181_305_3.30.70.360 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9516 | 177 | 298 | 3.30.70.360 |
| af_Q4CYZ5_13_177_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9507 | 11 | 169 | 3.40.630.10 |
| af_Q4DU62_26_162_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9483 | 30 | 160 | 3.40.630.10 |
| af_Q4CR09_181_288_3.30.70.360 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9446 | 177 | 282 | 3.30.70.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y7E1B2-F1-model_v4 | deleted | 0.9923 | 5 | 138 |
|
| AF-A0A127I5S1-F1-model_v4 | Acetylornithine deacetylase | 0.9838 | 5 | 384 |
GO:0005737
GO:0006526 GO:0008777 GO:0009014 GO:0046872 |
| AF-A0A6M1CIQ8-F1-model_v4 | deleted | 0.9815 | 5 | 175 |
|
| AF-A0A382WQI5-F1-model_v4 | Peptidase M20 dimerisation domain-containing protein | 0.9782 | 5 | 142 |
GO:0006526
GO:0008777 |
| AF-A0A258KCC3-F1-model_v4 | Acetylornithine deacetylase | 0.9764 | 3 | 124 |
GO:0006526
GO:0008777 |