F486124

General Info

Members Datasets Scaffolds Average Seq Length
934 520 1868 400

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10049705|Ga0207699_100497053
Length 409
Sequence MNSRSETSGEAFICEALRTPIGRYGGALAAVRADDLAAIPIAALLKRQPALDPAAIEEVILGCANQAGEDNRNVARMAALLAGLPTSVPGATVNRLCGSGLDAVAIAARAIRTGELQLAIAGGVESMSRAPFVIPKSDSAFSRNAEIFDTTIGWRFVNPRLKERYGIDSMPETGENVAAQFNIARADQDRFALRSQQRAAAAAARGLFASELTPVEIPQRKGKPPLVVARDEHPRPETTLEQLASLPTPFRANGTVTAGNASGVNDGACALLLASAEAARRWNLTPRARIVAAATAGVEPRIMGMGPVPATRKVLALAHLSLAQLDTIELNEAFASQALAVLRELGLPDDAAHVNPNGGAIALGHPLGMSGARLATTAIWQLQASGGRYALCTMCIGVGQGIAMVLERV

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
222 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
223 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
230 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
231 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
337 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
340 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
341 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
342 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
343 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
344 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
345 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
367 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
368 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
369 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
370 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
371 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
372 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
373 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
374 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
375 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
378 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
379 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
380 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
386 2508501050 Microvirga lupini Lut6 Isolate Nodule
387 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
388 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
389 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
390 2511231006 Pseudomonas sp. GM17 Isolate Nodule
391 2511231024 Pseudomonas sp. GM84 Isolate Nodule
392 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
393 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
394 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
395 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
396 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
397 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
398 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
399 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
400 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
401 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
402 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
403 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
404 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
405 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
406 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
407 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
408 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
409 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
410 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
411 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
412 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
413 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
414 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
415 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
416 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
417 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
418 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
419 2643221557 Ensifer sp. Root558 Isolate Unclassified
420 2643221558 Rhizobium sp. Root149 Isolate Unclassified
421 2643221599 Rhizobium sp. Root708 Isolate Unclassified
422 2643221610 Ensifer sp. Root74 Isolate Unclassified
423 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
424 2643221668 Ensifer sp. Root423 Isolate Unclassified
425 2643221675 Ensifer sp. Root1298 Isolate Unclassified
426 2643221680 Ensifer sp. Root1312 Isolate Unclassified
427 2643221723 Ensifer sp. Root278 Isolate Unclassified
428 2643221726 Ensifer sp. Root954 Isolate Unclassified
429 2643221736 Bosea sp. Root483D1 Isolate Unclassified
430 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
431 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
432 2738541297 Duganella sp. GV083 Isolate Unclassified
433 2738541357 Duganella sp. GV053 Isolate Unclassified
434 2738543003 Duganella sp. GV066 Isolate Unclassified
435 2738543026 Duganella sp. GV089 Isolate Unclassified
436 2738543029 Duganella sp. GV039 Isolate Unclassified
437 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
438 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
439 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
440 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
441 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
442 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
443 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
444 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
445 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
446 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
447 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
448 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
449 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
450 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
451 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
452 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
453 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
454 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
455 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
456 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
457 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
458 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
459 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
460 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
461 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
462 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
463 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
464 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
465 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
466 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
467 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
468 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
469 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
470 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
471 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
472 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
473 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
474 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
475 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
476 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
477 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
478 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
479 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
480 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
481 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
482 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
483 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
484 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
485 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
486 2919476304 Duganella sp. 3397 Isolate Unclassified
487 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
488 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
489 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
490 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
491 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
492 2937539931 Pantoea sp. LS15 Isolate Unclassified
493 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
494 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
495 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
496 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
497 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
498 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
499 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
500 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
501 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
502 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
503 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
504 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
505 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
506 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
507 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
508 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
509 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
510 639633007 Azoarcus olearius BH72 Isolate Unclassified
511 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
512 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
513 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
514 8005258706 Rhizobium sp. R693 Isolate Nodule
515 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
516 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
517 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
518 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
519 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
520 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.58
Metatranscriptomes 0.21
Isolates 15.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 8.46
Nodule 5.57
Rhizoplane 3.21
Rhizosphere 69.16
Stem 0
Stem Tuber 0.11
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10049705 3300025906 Bacteria 2469
2 MRS2a_Contig_1767 2124908027 Bacteria 19337
3 MRS2a_Contig_1768 2124908027 Bacteria 8639
4 MRS2a_Contig_70 2124908027 Bacteria 29249
5 SwRhRL2b_contig_1954747 2162886007 Bacteria 6272
6 JGI25155J39150_1000048 3300002704 Bacteria 78968
7 JGI25155J39150_1000162 3300002704 Bacteria 29967
8 JGI25156J39149_1000068 3300002705 Bacteria 81397
9 JGI25156J39149_1005786 3300002705 Bacteria 3500
10 JGI25162J39368_1006021 3300002737 Bacteria 2193
11 JGI25154J39366_1000066 3300002738 Bacteria 103361
12 JGI25154J39366_1000084 3300002738 Bacteria 88167
13 JGI25157J39369_1000097 3300002741 Bacteria 74420
14 JGI25159J45721_1000454 3300002987 Bacteria 18937
15 JGI25151J46595_10016628 3300003187 Bacteria 3212
16 rootH1_10037457 3300003316 Bacteria 3996
17 JGI25160J50197_1000005 3300003354 Bacteria 417280
18 JGI25160J50197_1000014 3300003354 Bacteria 259862
19 JGI25161J50226_1000022 3300003374 Bacteria 158544
20 JGI25161J50226_1000349 3300003374 Bacteria 24501
21 Ga0055532_1000015 3300003758 Bacteria 340197
22 Ga0055526_1007416 3300003771 Bacteria 5701
23 Ga0055537_1001060 3300003773 Bacteria 12288
24 Ga0055524_1002559 3300003775 Bacteria 9280
25 Ga0055524_1012855 3300003775 Bacteria 3191
26 Ga0055524_1030908 3300003775 Bacteria 1551
27 Ga0055536_1000014 3300003781 Bacteria 240624
28 Ga0055534_1000072 3300003784 Bacteria 78212
29 Ga0055528_1000043 3300003790 Bacteria 103664
30 Ga0055528_1006829 3300003790 Bacteria 5128
31 Ga0055530_10000009 3300003791 Bacteria 174044
32 Ga0055540_1000342 3300003792 Bacteria 39754
33 Ga0055543_1000005 3300004625 Bacteria 223621
34 Ga0055543_1000082 3300004625 Bacteria 83659
35 Ga0055543_1002336 3300004625 Bacteria 6359
36 Ga0058861_11837734 3300004800 Bacteria 1344
37 Ga0065165_1000002 3300005262 Bacteria 444192
38 Ga0065165_1000187 3300005262 Bacteria 108694
39 Ga0065165_1000463 3300005262 Bacteria 63644
40 Ga0065714_10000917 3300005288 Bacteria 19048
41 Ga0070683_100000407 3300005329 Bacteria 29702
42 Ga0070683_100012192 3300005329 Bacteria 7461
43 Ga0070683_100111389 3300005329 Bacteria 2582
44 Ga0070683_100140509 3300005329 Bacteria 2288
45 Ga0070690_100012887 3300005330 Bacteria 4928
46 Ga0070670_100001173 3300005331 Bacteria 20806
47 Ga0070670_100024696 3300005331 Bacteria 5169
48 Ga0070666_10004887 3300005335 Bacteria 8193
49 Ga0070666_10015348 3300005335 Bacteria 4884
50 Ga0070666_10029975 3300005335 Bacteria 3581
51 Ga0070680_100003368 3300005336 Bacteria 11929
52 Ga0070680_100013212 3300005336 Bacteria 6427
53 Ga0070680_100056113 3300005336 Bacteria 3219
54 Ga0070680_100088865 3300005336 Bacteria 2556
55 Ga0068868_100002348 3300005338 Bacteria 13095
56 Ga0068868_100004425 3300005338 Bacteria 9854
57 Ga0068868_100005551 3300005338 Bacteria 8872
58 Ga0070691_10000505 3300005341 Bacteria 14641
59 Ga0070669_100041490 3300005353 Bacteria 3346
60 Ga0070671_100016932 3300005355 Bacteria 5895
61 Ga0070671_100028433 3300005355 Bacteria 4604
62 Ga0070671_100031183 3300005355 Bacteria 4403
63 Ga0070667_100000046 3300005367 Bacteria 162942
64 Ga0070667_100022349 3300005367 Bacteria 5246
65 Ga0070667_100061990 3300005367 Bacteria 3167
66 Ga0070667_100226934 3300005367 Bacteria 1664
67 Ga0070714_100000679 3300005435 Bacteria 24018
68 Ga0070714_100086560 3300005435 Bacteria 2738
69 Ga0070714_100130594 3300005435 Bacteria 2245
70 Ga0070714_100341774 3300005435 Bacteria 1404
71 Ga0070713_100008248 3300005436 Bacteria 7384
72 Ga0070713_100022654 3300005436 Bacteria 4857
73 Ga0070713_100088383 3300005436 Bacteria 2659
74 Ga0070662_100118561 3300005457 Bacteria 2026
75 Ga0070681_10000278 3300005458 Bacteria 40975
76 Ga0070681_10005588 3300005458 Bacteria 12144
77 Ga0070681_10008207 3300005458 Bacteria 10218
78 Ga0070681_10030852 3300005458 Bacteria 5380
79 Ga0070681_10076711 3300005458 Bacteria 3300
80 Ga0070681_10084359 3300005458 Bacteria 3129
81 Ga0068867_100014256 3300005459 Bacteria 5630
82 Ga0068867_100166422 3300005459 Bacteria 1743
83 Ga0070706_100040154 3300005467 Bacteria 4319
84 Ga0070699_100039576 3300005518 Bacteria 4081
85 Ga0070679_100010630 3300005530 Bacteria 8735
86 Ga0070679_100011761 3300005530 Bacteria 8343
87 Ga0070679_100039079 3300005530 Bacteria 4716
88 Ga0070679_100059190 3300005530 Bacteria 3818
89 Ga0070679_100078890 3300005530 Bacteria 3282
90 Ga0070679_100113034 3300005530 Bacteria 2701
91 Ga0070684_100000856 3300005535 Bacteria 21482
92 Ga0070684_100057257 3300005535 Bacteria 3403
93 Ga0070697_100032440 3300005536 Bacteria 4203
94 Ga0068853_100128029 3300005539 Bacteria 2270
95 Ga0070695_100059472 3300005545 Bacteria 2474
96 Ga0070665_100001514 3300005548 Bacteria 26960
97 Ga0070665_100010456 3300005548 Bacteria 9390
98 Ga0070665_100038832 3300005548 Bacteria 4786
99 Ga0070665_100039405 3300005548 Bacteria 4751
100 Ga0070665_100139058 3300005548 Bacteria 2432
101 Ga0068855_100000946 3300005563 Bacteria 36185
102 Ga0068855_100004315 3300005563 Bacteria 17384
103 Ga0068855_100010388 3300005563 Bacteria 11229
104 Ga0068855_100332226 3300005563 Bacteria 1678
105 Ga0068855_100409240 3300005563 Bacteria 1485
106 Ga0070664_100225222 3300005564 Bacteria 1679
107 Ga0068857_100000139 3300005577 Bacteria 44602
108 Ga0068857_100015494 3300005577 Bacteria 6660
109 Ga0068854_100085487 3300005578 Bacteria 2336
110 Ga0068856_100001980 3300005614 Bacteria 21357
111 Ga0068856_100003335 3300005614 Bacteria 16308
112 Ga0068856_100011282 3300005614 Bacteria 8672
113 Ga0068856_100066173 3300005614 Bacteria 3571
114 Ga0068856_100079057 3300005614 Bacteria 3261
115 Ga0068852_100009656 3300005616 Bacteria 7169
116 Ga0068852_100026807 3300005616 Bacteria 4690
117 Ga0068852_100062674 3300005616 Bacteria 3235
118 Ga0068859_100007848 3300005617 Bacteria 10832
119 Ga0068859_100057855 3300005617 Bacteria 3905
120 Ga0068859_100178947 3300005617 Bacteria 2203
121 Ga0068863_100001619 3300005841 Bacteria 22229
122 Ga0068863_100015117 3300005841 Bacteria 7414
123 Ga0068863_100042715 3300005841 Bacteria 4308
124 Ga0068863_100100625 3300005841 Bacteria 2747
125 Ga0068858_100000996 3300005842 Bacteria 29246
126 Ga0068858_100003356 3300005842 Bacteria 15940
127 Ga0068858_100166497 3300005842 Bacteria 2077
128 Ga0068860_100002939 3300005843 Bacteria 17616
129 Ga0068860_100003553 3300005843 Bacteria 16033
130 Ga0068860_100022586 3300005843 Bacteria 6082
131 Ga0068860_100034234 3300005843 Bacteria 4871
132 Ga0068860_100186876 3300005843 Bacteria 2004
133 Ga0068860_100357648 3300005843 Bacteria 1438
134 Ga0068862_100098962 3300005844 Bacteria 2548
135 Ga0068862_100106478 3300005844 Bacteria 2458
136 Ga0081455_10000002 3300005937 Bacteria 460472
137 Ga0081455_10000075 3300005937 Bacteria 106313
138 Ga0081539_10000123 3300005985 Bacteria 181245
139 Ga0070717_10022763 3300006028 Bacteria 4956
140 Ga0075364_10000122 3300006051 Bacteria 32120
141 Ga0075364_10009211 3300006051 Bacteria 5917
142 Ga0070715_10025500 3300006163 Bacteria 2343
143 Ga0070716_100005359 3300006173 Bacteria 6204
144 Ga0070712_100001354 3300006175 Bacteria 14871
145 Ga0070712_100018344 3300006175 Bacteria 4544
146 Ga0075367_10000065 3300006178 Bacteria 26310
147 Ga0075367_10106018 3300006178 Bacteria 1722
148 Ga0097621_100003036 3300006237 Bacteria 11528
149 Ga0097621_100023168 3300006237 Bacteria 4831
150 Ga0097621_100041334 3300006237 Bacteria 3711
151 Ga0097621_100139274 3300006237 Bacteria 2072
152 Ga0075370_10045293 3300006353 Bacteria 2488
153 Ga0068871_100003128 3300006358 Bacteria 11356
154 Ga0068871_100006989 3300006358 Bacteria 8043
155 Ga0068871_100007934 3300006358 Bacteria 7611
156 Ga0075433_10140160 3300006852 Bacteria 2149
157 Ga0068865_100000854 3300006881 Bacteria 17259
158 Ga0068865_100003193 3300006881 Bacteria 9812
159 Ga0075436_100048012 3300006914 Bacteria 2946
160 Ga0075436_100067416 3300006914 Bacteria 2473
161 Ga0097620_100007848 3300006931 Bacteria 10832
162 Ga0097620_100057855 3300006931 Bacteria 3905
163 Ga0097620_100178950 3300006931 Bacteria 2203
164 Ga0079104_1000243 3300006946 Bacteria 72656
165 Ga0079104_1011586 3300006946 Bacteria 2825
166 Ga0099794_10021173 3300007265 Bacteria 2952
167 Ga0099794_10027462 3300007265 Bacteria 2638
168 Ga0105251_10001382 3300009011 Bacteria 20993
169 Ga0105251_10008811 3300009011 Bacteria 6046
170 Ga0105251_10073173 3300009011 Bacteria 1593
171 Ga0105244_10003953 3300009036 Bacteria 10397
172 Ga0105244_10031082 3300009036 Bacteria 2835
173 Ga0105250_10000059 3300009092 Bacteria 109549
174 Ga0105250_10001065 3300009092 Bacteria 15652
175 Ga0105250_10046057 3300009092 Bacteria 1748
176 Ga0105240_10000721 3300009093 Bacteria 60541
177 Ga0105240_10002166 3300009093 Bacteria 32053
178 Ga0105240_10005036 3300009093 Bacteria 19826
179 Ga0105240_10006325 3300009093 Bacteria 17434
180 Ga0105240_10012887 3300009093 Bacteria 11513
181 Ga0105240_10058545 3300009093 Bacteria 4810
182 Ga0105240_10095545 3300009093 Bacteria 3624
183 Ga0105240_10215450 3300009093 Bacteria 2241
184 Ga0105240_10409042 3300009093 Bacteria 1526
185 Ga0111539_10000107 3300009094 Bacteria 89993
186 Ga0105245_10002527 3300009098 Bacteria 16491
187 Ga0105245_10003212 3300009098 Bacteria 14632
188 Ga0105245_10018741 3300009098 Bacteria 6055
189 Ga0105245_10019040 3300009098 Bacteria 6008
190 Ga0105245_10102026 3300009098 Bacteria 2656
191 Ga0105247_10010886 3300009101 Bacteria 5495
192 Ga0105247_10016238 3300009101 Bacteria 4460
193 Ga0105247_10026517 3300009101 Bacteria 3500
194 Ga0105243_10079262 3300009148 Bacteria 2676
195 Ga0105241_10000274 3300009174 Bacteria 38434
196 Ga0105241_10000595 3300009174 Bacteria 27201
197 Ga0105241_10032378 3300009174 Bacteria 3919
198 Ga0105241_10047004 3300009174 Bacteria 3280
199 Ga0105241_10115502 3300009174 Bacteria 2155
200 Ga0105242_10001176 3300009176 Bacteria 20604
201 Ga0105242_10017229 3300009176 Bacteria 5625
202 Ga0105242_10022525 3300009176 Bacteria 4957
203 Ga0105248_10002359 3300009177 Bacteria 20966
204 Ga0105248_10003426 3300009177 Bacteria 17619
205 Ga0105248_10051703 3300009177 Bacteria 4610
206 Ga0105248_10286623 3300009177 Bacteria 1854
207 Ga0105248_10351867 3300009177 Bacteria 1658
208 Ga0105237_10004017 3300009545 Bacteria 17192
209 Ga0105237_10193993 3300009545 Bacteria 2031
210 Ga0105238_10001117 3300009551 Bacteria 27102
211 Ga0105238_10003110 3300009551 Bacteria 16554
212 Ga0105238_10006903 3300009551 Bacteria 11339
213 Ga0105238_10009735 3300009551 Bacteria 9624
214 Ga0105238_10046694 3300009551 Bacteria 4368
215 Ga0105238_10193557 3300009551 Bacteria 2009
216 Ga0105249_10026594 3300009553 Bacteria 5217
217 Ga0105239_10002184 3300010375 Bacteria 25162
218 Ga0105239_10005500 3300010375 Bacteria 14848
219 Ga0105239_10011109 3300010375 Bacteria 10050
220 Ga0105239_10029023 3300010375 Bacteria 6081
221 Ga0105239_10033015 3300010375 Bacteria 5685
222 Ga0105239_10045243 3300010375 Bacteria 4824
223 Ga0105239_10190021 3300010375 Bacteria 2299
224 Ga0105239_10207182 3300010375 Bacteria 2197
225 Ga0105246_10008333 3300011119 Bacteria 6369
226 Ga0105246_10072511 3300011119 Bacteria 2428
227 Ga0157371_10015446 3300013102 Bacteria 5726
228 Ga0157370_10002686 3300013104 Bacteria 21320
229 Ga0157370_10015891 3300013104 Bacteria 7638
230 Ga0157370_10177484 3300013104 Bacteria 1980
231 Ga0157369_10005407 3300013105 Bacteria 14866
232 Ga0157369_10024762 3300013105 Bacteria 6668
233 Ga0157369_10045001 3300013105 Bacteria 4802
234 Ga0157369_10090441 3300013105 Bacteria 3268
235 Ga0157369_10259330 3300013105 Bacteria 1813
236 Ga0157374_10005928 3300013296 Bacteria 10326
237 Ga0157374_10032993 3300013296 Bacteria 4721
238 Ga0157374_10064220 3300013296 Bacteria 3444
239 Ga0157378_10000037 3300013297 Bacteria 117305
240 Ga0157378_10006931 3300013297 Bacteria 9894
241 Ga0157378_10052411 3300013297 Bacteria 3630
242 Ga0163162_10054706 3300013306 Bacteria 4015
243 Ga0157372_10164098 3300013307 Bacteria 2568
244 Ga0157372_10171737 3300013307 Bacteria 2508
245 Ga0163163_10117984 3300014325 Bacteria 2686
246 Ga0157380_10242171 3300014326 Bacteria 1627
247 Ga0182008_10050005 3300014497 Bacteria 2074
248 Ga0157379_10039188 3300014968 Bacteria 4227
249 Ga0157379_10114627 3300014968 Bacteria 2422
250 Ga0157376_10000094 3300014969 Bacteria 67036
251 Ga0157376_10032475 3300014969 Bacteria 4192
252 Ga0157376_10053068 3300014969 Bacteria 3374
253 Ga0182006_1000010 3300015261 Bacteria 413414
254 Ga0182006_1000055 3300015261 Bacteria 173139
255 Ga0182007_10000030 3300015262 Bacteria 156866
256 Ga0182005_1000003 3300015265 Bacteria 683269
257 Ga0182005_1000009 3300015265 Bacteria 455334
258 Ga0213872_10000523 3300021361 Bacteria 30011
259 Ga0213872_10011662 3300021361 Bacteria 4155
260 Ga0213872_10013790 3300021361 Bacteria 3780
261 Ga0213872_10039873 3300021361 Bacteria 2143
262 Ga0213876_10107298 3300021384 Bacteria 1482
263 Ga0209435_100021 3300025206 Bacteria 223961
264 Ga0209435_100074 3300025206 Bacteria 55837
265 Ga0209436_100869 3300025208 Bacteria 12075
266 Ga0209147_100004 3300025229 Bacteria 1371850
267 Ga0209437_100045 3300025233 Bacteria 429809
268 Ga0209258_100083 3300025242 Bacteria 246008
269 Ga0209646_1000057 3300025246 Bacteria 266384
270 Ga0209646_1000074 3300025246 Bacteria 223961
271 Ga0209026_1000058 3300025250 Bacteria 228656
272 Ga0209759_1000046 3300025256 Bacteria 230149
273 Ga0209759_1000112 3300025256 Bacteria 143361
274 Ga0209129_1003788 3300025258 Bacteria 6348
275 Ga0209565_1000006 3300025263 Bacteria 897294
276 Ga0209455_1008156 3300025272 Bacteria 2875
277 Ga0209673_1000004 3300025273 Bacteria 896155
278 Ga0209673_1016330 3300025273 Bacteria 2781
279 Ga0209673_1018668 3300025273 Bacteria 2513
280 Ga0209130_1000010 3300025284 Bacteria 444920
281 Ga0209130_1000013 3300025284 Bacteria 412810
282 Ga0209130_1000191 3300025284 Bacteria 85239
283 Ga0209675_1000006 3300025291 Bacteria 732267
284 Ga0209676_1000003 3300025292 Bacteria 1454178
285 Ga0209676_1006358 3300025292 Bacteria 5854
286 Ga0209025_1000687 3300025294 Bacteria 58005
287 Ga0209025_1010541 3300025294 Bacteria 6252
288 Ga0209564_1000025 3300025295 Bacteria 520535
289 Ga0209564_1000085 3300025295 Bacteria 251509
290 Ga0209564_1001631 3300025295 Bacteria 21730
291 Ga0209564_1020303 3300025295 Bacteria 2438
292 Ga0209050_1000004 3300025298 Bacteria 1600040
293 Ga0209256_1000037 3300025299 Bacteria 377661
294 Ga0209256_1000320 3300025299 Bacteria 82751
295 Ga0209256_1002250 3300025299 Bacteria 16402
296 Ga0209256_1009820 3300025299 Bacteria 4119
297 Ga0209256_1030930 3300025299 Bacteria 1471
298 Ga0207426_1000022 3300025302 Bacteria 547377
299 Ga0207426_1000036 3300025302 Bacteria 444920
300 Ga0207426_1001794 3300025302 Bacteria 16028
301 Ga0207426_1002644 3300025302 Bacteria 11044
302 Ga0209051_1000006 3300025303 Bacteria 1015785
303 Ga0209051_1039420 3300025303 Bacteria 1706
304 Ga0207696_1000005 3300025711 Bacteria 642078
305 Ga0207696_1002284 3300025711 Bacteria 9522
306 Ga0207696_1014942 3300025711 Bacteria 2645
307 Ga0207713_1000002 3300025735 Bacteria 1061749
308 Ga0207713_1000501 3300025735 Bacteria 40333
309 Ga0207713_1018816 3300025735 Bacteria 3403
310 Ga0207642_10030714 3300025899 Bacteria 2242
311 Ga0207710_10014096 3300025900 Bacteria 3367
312 Ga0207710_10015856 3300025900 Bacteria 3187
313 Ga0207688_10033070 3300025901 Bacteria 2859
314 Ga0207688_10095460 3300025901 Bacteria 1711
315 Ga0207680_10001892 3300025903 Bacteria 9820
316 Ga0207684_10268390 3300025910 Bacteria 1472
317 Ga0207654_10002301 3300025911 Bacteria 9797
318 Ga0207654_10004032 3300025911 Bacteria 7393
319 Ga0207654_10080279 3300025911 Bacteria 1961
320 Ga0207707_10000094 3300025912 Bacteria 89818
321 Ga0207707_10002920 3300025912 Bacteria 15246
322 Ga0207707_10003000 3300025912 Bacteria 15007
323 Ga0207707_10017442 3300025912 Bacteria 6259
324 Ga0207707_10018558 3300025912 Bacteria 6062
325 Ga0207707_10025363 3300025912 Bacteria 5186
326 Ga0207707_10085423 3300025912 Bacteria 2757
327 Ga0207707_10133024 3300025912 Bacteria 2175
328 Ga0207695_10000471 3300025913 Bacteria 87529
329 Ga0207695_10000776 3300025913 Bacteria 60540
330 Ga0207695_10010991 3300025913 Bacteria 10997
331 Ga0207695_10020093 3300025913 Bacteria 7662
332 Ga0207695_10028070 3300025913 Bacteria 6251
333 Ga0207695_10034697 3300025913 Bacteria 5482
334 Ga0207695_10042276 3300025913 Bacteria 4869
335 Ga0207695_10049827 3300025913 Bacteria 4410
336 Ga0207695_10058899 3300025913 Bacteria 3985
337 Ga0207695_10059123 3300025913 Bacteria 3977
338 Ga0207695_10140611 3300025913 Bacteria 2363
339 Ga0207671_10067008 3300025914 Bacteria 2673
340 Ga0207671_10125706 3300025914 Bacteria 1964
341 Ga0207693_10000245 3300025915 Bacteria 50171
342 Ga0207693_10015257 3300025915 Bacteria 6165
343 Ga0207693_10023591 3300025915 Bacteria 4884
344 Ga0207693_10046941 3300025915 Bacteria 3394
345 Ga0207693_10071257 3300025915 Bacteria 2720
346 Ga0207663_10058484 3300025916 Bacteria 2433
347 Ga0207663_10077898 3300025916 Bacteria 2159
348 Ga0207660_10185308 3300025917 Bacteria 1618
349 Ga0207660_10222041 3300025917 Bacteria 1483
350 Ga0207657_10003974 3300025919 Bacteria 15707
351 Ga0207649_10148192 3300025920 Bacteria 1613
352 Ga0207652_10014668 3300025921 Bacteria 6350
353 Ga0207652_10017165 3300025921 Bacteria 5921
354 Ga0207652_10090331 3300025921 Bacteria 2691
355 Ga0207694_10001821 3300025924 Bacteria 17755
356 Ga0207694_10006998 3300025924 Bacteria 8562
357 Ga0207694_10047733 3300025924 Bacteria 3312
358 Ga0207694_10077597 3300025924 Bacteria 2603
359 Ga0207694_10147527 3300025924 Bacteria 1894
360 Ga0207650_10000745 3300025925 Bacteria 25118
361 Ga0207687_10021803 3300025927 Bacteria 4258
362 Ga0207687_10126370 3300025927 Bacteria 1920
363 Ga0207700_10076405 3300025928 Bacteria 2599
364 Ga0207700_10111680 3300025928 Bacteria 2200
365 Ga0207664_10052053 3300025929 Bacteria 3236
366 Ga0207664_10186473 3300025929 Bacteria 1784
367 Ga0207664_10209203 3300025929 Bacteria 1687
368 Ga0207644_10005836 3300025931 Bacteria 8020
369 Ga0207644_10054521 3300025931 Bacteria 2880
370 Ga0207706_10114151 3300025933 Bacteria 2376
371 Ga0207686_10126294 3300025934 Bacteria 1748
372 Ga0207709_10057705 3300025935 Bacteria 2408
373 Ga0207670_10074848 3300025936 Bacteria 2352
374 Ga0207665_10001531 3300025939 Bacteria 15559
375 Ga0207665_10009385 3300025939 Bacteria 6420
376 Ga0207665_10022989 3300025939 Bacteria 4105
377 Ga0207691_10206589 3300025940 Bacteria 1708
378 Ga0207711_10020187 3300025941 Bacteria 5552
379 Ga0207711_10042882 3300025941 Bacteria 3857
380 Ga0207689_10003574 3300025942 Bacteria 14204
381 Ga0207661_10056496 3300025944 Bacteria 3151
382 Ga0207661_10066357 3300025944 Bacteria 2932
383 Ga0207661_10194725 3300025944 Bacteria 1779
384 Ga0207661_10242893 3300025944 Bacteria 1598
385 Ga0207667_10000399 3300025949 Bacteria 58694
386 Ga0207667_10001596 3300025949 Bacteria 28502
387 Ga0207667_10018532 3300025949 Bacteria 7804
388 Ga0207667_10061184 3300025949 Bacteria 3940
389 Ga0207712_10010235 3300025961 Bacteria 5947
390 Ga0207658_10000058 3300025986 Bacteria 122331
391 Ga0207658_10000493 3300025986 Bacteria 36279
392 Ga0207703_10000259 3300026035 Bacteria 59607
393 Ga0207703_10019229 3300026035 Bacteria 5335
394 Ga0207703_10356729 3300026035 Bacteria 1347
395 Ga0207639_10053821 3300026041 Bacteria 3073
396 Ga0207639_10389788 3300026041 Bacteria 1253
397 Ga0207678_10038195 3300026067 Bacteria 4173
398 Ga0207678_10046814 3300026067 Bacteria 3741
399 Ga0207678_10106260 3300026067 Bacteria 2395
400 Ga0207702_10011423 3300026078 Bacteria 7402
401 Ga0207702_10021345 3300026078 Bacteria 5360
402 Ga0207702_10032008 3300026078 Bacteria 4387
403 Ga0207641_10000196 3300026088 Bacteria 81985
404 Ga0207641_10002905 3300026088 Bacteria 15500
405 Ga0207641_10010473 3300026088 Bacteria 7614
406 Ga0207641_10035754 3300026088 Bacteria 4142
407 Ga0207648_10005986 3300026089 Bacteria 12160
408 Ga0207674_10000042 3300026116 Bacteria 126790
409 Ga0207674_10017528 3300026116 Bacteria 7813
410 Ga0207674_10050909 3300026116 Bacteria 4228
411 Ga0207683_10156324 3300026121 Bacteria 2060
412 Ga0209281_1000179 3300027111 Bacteria 148102
413 Ga0209281_1011946 3300027111 Bacteria 1926
414 Ga0209588_1007148 3300027671 Bacteria 3273
415 Ga0209588_1009766 3300027671 Bacteria 2872
416 Ga0207428_10000040 3300027907 Bacteria 210887
417 Ga0268266_10000512 3300028379 Bacteria 54629
418 Ga0268266_10003024 3300028379 Bacteria 17278
419 Ga0268266_10017708 3300028379 Bacteria 6071
420 Ga0268266_10024513 3300028379 Bacteria 5130
421 Ga0268266_10097277 3300028379 Bacteria 2589
422 Ga0268266_10180864 3300028379 Bacteria 1920
423 Ga0268265_10140521 3300028380 Bacteria 2021
424 Ga0268264_10000182 3300028381 Bacteria 134007
425 Ga0268264_10006165 3300028381 Bacteria 10125
426 Ga0268264_10036379 3300028381 Bacteria 4056
427 Ga0268264_10179163 3300028381 Bacteria 1923
428 Ga0265319_1001093 3300028563 Bacteria 16859
429 Ga0265318_10000259 3300028577 Bacteria 45975
430 Ga0307515_10015010 3300028794 Bacteria 14308
431 Ga0265338_10064956 3300028800 Bacteria 3170
432 Ga0307511_10000008 3300030521 Bacteria 159928
433 Ga0265332_10005055 3300031238 Bacteria 6122
434 Ga0265320_10000057 3300031240 Bacteria 104186
435 Ga0265325_10022067 3300031241 Bacteria 3490
436 Ga0265325_10036749 3300031241 Bacteria 2594
437 Ga0265329_10000235 3300031242 Bacteria 29416
438 Ga0265340_10010715 3300031247 Bacteria 4898
439 Ga0265340_10019722 3300031247 Bacteria 3470
440 Ga0265339_10045581 3300031249 Bacteria 2413
441 Ga0265331_10000041 3300031250 Bacteria 191831
442 Ga0265331_10007068 3300031250 Bacteria 6546
443 Ga0265316_10003938 3300031344 Bacteria 14877
444 Ga0307509_10000099 3300031507 Bacteria 121307
445 Ga0265313_10001609 3300031595 Bacteria 20973
446 Ga0265313_10015924 3300031595 Bacteria 4349
447 Ga0265314_10009866 3300031711 Bacteria 8013
448 Ga0265342_10000124 3300031712 Bacteria 85296
449 Ga0265342_10083331 3300031712 Bacteria 1843
450 Ga0307410_10232781 3300031852 Bacteria 1423
451 Ga0307416_100090149 3300032002 Bacteria 2628
452 Ga0307414_10142053 3300032004 Bacteria 1881
453 Ga0307411_10025255 3300032005 Bacteria 3557
454 Ga0307510_10000003 3300033180 Bacteria 756654
455 Ga0373926_0016824 3300035083 Bacteria 2506
456 Ga0373934_0002106 3300035086 Bacteria 7296
457 Ga0373923_0010433 3300035111 Bacteria 3378
458 Ga0373936_0000768 3300035113 Bacteria 11285
459 Ga0373939_0028085 3300035114 Bacteria 1599
460 Ga0373945_0037383 3300035116 Bacteria 1742
461 Ga0373954_0001458 3300035118 Bacteria 9602
462 Ga0373954_0003051 3300035118 Bacteria 7070
463 Ga0373954_0029875 3300035118 Bacteria 2512
464 Ga0373956_0000242 3300035119 Bacteria 21615
465 Ga0373946_0021451 3300035171 Bacteria 2505
466 Ga0373955_0016254 3300035172 Bacteria 3659
467 Ga0373955_0026367 3300035172 Bacteria 2993
468 Ga0373955_0112459 3300035172 Bacteria 1575
469 Ga0373924_0002488 3300035410 Bacteria 6192
470 Ga0373935_0182616 3300035692 Bacteria 1441
471 Ga0373935_0295051 3300035692 Bacteria 1144
472 Ga0373927_0032769 3300035695 Bacteria 3384
473 Ga0373927_0047483 3300035695 Bacteria 2777
474 Ga0373927_0058624 3300035695 Bacteria 2490
475 Ga0373933_0007183 3300035724 Bacteria 6069
476 Ga0373933_0084299 3300035724 Bacteria 1952
477 Ga0373933_0129967 3300035724 Bacteria 1583
478 Ga0373947_0033007 3300035725 Bacteria 3054
479 Ga0373947_0127092 3300035725 Bacteria 1624
480 Ga0373937_0023699 3300036401 Bacteria 5532
481 Ga0373937_0038961 3300036401 Bacteria 4330
482 Ga0373937_0097241 3300036401 Bacteria 2730
483 Ga0373925_0000300 3300037068 Bacteria 51846
484 Ga0373925_0012304 3300037068 Bacteria 6193
485 Ga0373925_0122088 3300037068 Bacteria 2023
486 Ga0373925_0129063 3300037068 Bacteria 1969
487 Ga0373925_0173869 3300037068 Bacteria 1701
488 Ga0395899_0000093 3300037312 Bacteria 153541
489 Ga0400490_25320 3300038726 Bacteria 33187
490 Ga0400491_04543 3300038727 Bacteria 2469
491 Ga0400487_32217 3300039110 Bacteria 35879
492 Ga0400487_61000 3300039110 Bacteria 27948
493 Ga0436365_0255902 3300039437 Bacteria 3958
494 Ga0436365_0268609 3300039437 Bacteria 3710
495 Ga0436365_1801098 3300039437 Bacteria 12302
496 Ga0436360_0201373 3300039438 Bacteria 6723
497 Ga0436360_0661826 3300039438 Bacteria 1505
498 Ga0436360_0721843 3300039438 Bacteria 2565
499 Ga0436361_0411839 3300039447 Bacteria 4454
500 Ga0436361_0590398 3300039447 Bacteria 11821
501 Ga0436361_0787586 3300039447 Bacteria 8153
502 Ga0436361_1186001 3300039447 Bacteria 4044
503 Ga0436363_1307392 3300039450 Bacteria 4051
504 Ga0436362_0935796 3300039453 Bacteria 2779
505 Ga0439452_000014 3300042010 Bacteria 344969
506 Ga0439463_000483 3300042016 Bacteria 11084
507 Ga0450920_015654 3300042122 Bacteria 1443
508 Ga0439464_0008277 3300042439 Bacteria 2726
509 Ga0451577_0001799 3300042876 Bacteria 27435
510 Ga0451577_0008240 3300042876 Bacteria 10156
511 Ga0466969_0004853 3300044656 Bacteria 7161
512 Ga0453683_0004409 3300044673 Bacteria 9994
513 Ga0466966_0001376 3300044684 Bacteria 15650
514 Ga0466961_0000376 3300044693 Bacteria 28754
515 Ga0466964_0002233 3300044706 Bacteria 6863
516 Ga0453684_0013054 3300044712 Bacteria 13565
517 Ga0466971_0000405 3300044719 Bacteria 16776
518 Ga0466970_0002295 3300044765 Bacteria 9250
519 Ga0466957_0024969 3300044842 Bacteria 3540
520 Ga0466959_0000875 3300045049 Bacteria 17741
521 Ga0466959_0003679 3300045049 Bacteria 10110
522 Ga0466959_0040113 3300045049 Bacteria 3459
523 Ga0466958_0045289 3300045836 Bacteria 2653
524 Ga0495617_000102 3300046452 Bacteria 61763
525 Ga0495592_0022246 3300046454 Bacteria 4822
526 Ga0495603_0087967 3300046455 Bacteria 1818
527 Ga0495638_0055259 3300046460 Bacteria 2466
528 Ga0495638_0067627 3300046460 Bacteria 2193
529 Ga0495651_0000348 3300046462 Bacteria 35669
530 Ga0495651_0013606 3300046462 Bacteria 6289
531 Ga0495651_0028066 3300046462 Bacteria 4387
532 Ga0495653_0004156 3300046463 Bacteria 11715
533 Ga0495653_0006412 3300046463 Bacteria 9646
534 Ga0495653_0135064 3300046463 Bacteria 1741
535 Ga0495650_0000005 3300046471 Bacteria 766553
536 Ga0495650_0005139 3300046471 Bacteria 8635
537 Ga0495650_0006809 3300046471 Bacteria 7049
538 Ga0495580_0002011 3300046472 Bacteria 17897
539 Ga0495580_0002088 3300046472 Bacteria 17538
540 Ga0495580_0019041 3300046472 Bacteria 5104
541 Ga0495580_0020188 3300046472 Bacteria 4936
542 Ga0495580_0050048 3300046472 Bacteria 2954
543 Ga0495580_0146630 3300046472 Bacteria 1636
544 Ga0495582_0056196 3300046473 Bacteria 2169
545 Ga0495605_0003384 3300046474 Bacteria 9515
546 Ga0495605_0006358 3300046474 Bacteria 6809
547 Ga0495605_0037577 3300046474 Bacteria 2434
548 Ga0495639_0049491 3300046475 Bacteria 1907
549 Ga0495662_0050420 3300046476 Bacteria 2009
550 Ga0495662_0083488 3300046476 Bacteria 1555
551 Ga0495584_0002192 3300046491 Bacteria 11134
552 Ga0495584_0012645 3300046491 Bacteria 4308
553 Ga0495585_0003916 3300046492 Bacteria 9858
554 Ga0495585_0021789 3300046492 Bacteria 3679
555 Ga0495585_0046010 3300046492 Bacteria 2434
556 Ga0495594_0000446 3300046499 Bacteria 20938
557 Ga0495594_0008871 3300046499 Bacteria 5186
558 Ga0495594_0009958 3300046499 Bacteria 4921
559 Ga0495596_0000101 3300046500 Bacteria 60820
560 Ga0495596_0004579 3300046500 Bacteria 6709
561 Ga0495607_0000130 3300046501 Bacteria 80479
562 Ga0495607_0004562 3300046501 Bacteria 10158
563 Ga0495607_0067818 3300046501 Bacteria 2003
564 Ga0495583_0000193 3300046506 Bacteria 101909
565 Ga0495583_0008294 3300046506 Bacteria 6369
566 Ga0495583_0016708 3300046506 Bacteria 3932
567 Ga0495606_0001674 3300046507 Bacteria 28659
568 Ga0495606_0002849 3300046507 Bacteria 19153
569 Ga0495606_0003983 3300046507 Bacteria 15105
570 Ga0495606_0055672 3300046507 Bacteria 2557
571 Ga0495608_0019974 3300046511 Bacteria 4607
572 Ga0495610_0001540 3300046512 Bacteria 20312
573 Ga0495616_0000103 3300046513 Bacteria 73155
574 Ga0495616_0027556 3300046513 Bacteria 3014
575 Ga0495616_0071247 3300046513 Bacteria 1681
576 Ga0495618_0013834 3300046514 Bacteria 4910
577 Ga0495618_0020574 3300046514 Bacteria 4062
578 Ga0495628_0001861 3300046516 Bacteria 19163
579 Ga0495628_0065434 3300046516 Bacteria 2843
580 Ga0495630_0011337 3300046517 Bacteria 6451
581 Ga0495630_0032771 3300046517 Bacteria 3873
582 Ga0495630_0148687 3300046517 Bacteria 1782
583 Ga0495631_0003800 3300046518 Bacteria 8210
584 Ga0495631_0008257 3300046518 Bacteria 5248
585 Ga0495637_0000926 3300046520 Bacteria 18783
586 Ga0495637_0075608 3300046520 Bacteria 1351
587 Ga0495643_0000192 3300046522 Bacteria 96511
588 Ga0495643_0006207 3300046522 Bacteria 7927
589 Ga0495648_0001877 3300046524 Bacteria 20080
590 Ga0495648_0008158 3300046524 Bacteria 8265
591 Ga0495648_0042718 3300046524 Bacteria 2849
592 Ga0495666_0019718 3300046526 Bacteria 3344
593 Ga0495666_0032636 3300046526 Bacteria 2547
594 Ga0495652_0011879 3300046529 Bacteria 7871
595 Ga0495654_0000005 3300046530 Bacteria 491381
596 Ga0495654_0006665 3300046530 Bacteria 6537
597 Ga0495654_0007231 3300046530 Bacteria 6224
598 Ga0495665_0050933 3300046531 Bacteria 2194
599 Ga0495640_0125800 3300046533 Bacteria 1662
600 Ga0495586_0004892 3300046535 Bacteria 7164
601 Ga0495586_0044988 3300046535 Bacteria 2378
602 Ga0495586_0146199 3300046535 Bacteria 1328
603 Ga0495587_0044903 3300046536 Bacteria 2627
604 Ga0495597_0000135 3300046542 Bacteria 67103
605 Ga0495597_0001100 3300046542 Bacteria 20478
606 Ga0495633_0064456 3300046558 Bacteria 1713
607 Ga0495667_0003887 3300046559 Bacteria 10024
608 Ga0495667_0043170 3300046559 Bacteria 2988
609 Ga0495667_0053754 3300046559 Bacteria 2651
610 Ga0495667_0081970 3300046559 Bacteria 2096
611 Ga0495667_0157278 3300046559 Bacteria 1462
612 Ga0495656_0014247 3300046615 Bacteria 2978
613 Ga0495668_0000008 3300046616 Bacteria 498364
614 Ga0495668_0004107 3300046616 Bacteria 10549
615 Ga0495634_0037638 3300046642 Bacteria 3304
616 Ga0495611_0001932 3300046648 Bacteria 9849
617 Ga0495611_0008093 3300046648 Bacteria 4462
618 Ga0495625_0001718 3300046660 Bacteria 25444
619 Ga0495625_0022308 3300046660 Bacteria 4857
620 Ga0495625_0026038 3300046660 Bacteria 4424
621 Ga0495635_0062625 3300046663 Bacteria 2554
622 Ga0495635_0154072 3300046663 Bacteria 1564
623 Ga0495588_0009267 3300046674 Bacteria 4546
624 Ga0495588_0016076 3300046674 Bacteria 3612
625 Ga0495588_0045257 3300046674 Bacteria 2255
626 Ga0495657_0007580 3300046675 Bacteria 8377
627 Ga0495599_0012765 3300046678 Bacteria 5183
628 Ga0495647_0022142 3300046681 Bacteria 2294
629 Ga0495658_0068550 3300046683 Bacteria 2054
630 Ga0495613_0028378 3300046689 Bacteria 4161
631 Ga0495624_0162647 3300046690 Bacteria 1363
632 Ga0495670_0015449 3300046691 Bacteria 3751
633 Ga0495670_0128351 3300046691 Bacteria 1320
634 Ga0495671_0000074 3300046692 Bacteria 96288
635 Ga0495600_0001912 3300046809 Bacteria 11695
636 Ga0495600_0003135 3300046809 Bacteria 9677
637 Ga0495660_0039808 3300046810 Bacteria 2608
638 Ga0495660_0081744 3300046810 Bacteria 1693
639 Ga0495660_0112321 3300046810 Bacteria 1389
640 Ga0495581_0111988 3300047315 Bacteria 1587
641 Ga0495604_0002736 3300047317 Bacteria 14142
642 Ga0495604_0005234 3300047317 Bacteria 10276
643 Ga0495604_0041001 3300047317 Bacteria 3632
644 Ga0495604_0090131 3300047317 Bacteria 2278
645 Ga0495636_0001344 3300047318 Bacteria 9341
646 Ga0495674_0002913 3300047319 Bacteria 16653
647 Ga0495674_0022167 3300047319 Bacteria 5860
648 Ga0495674_0078327 3300047319 Bacteria 2840
649 Ga0495672_0000155 3300047320 Bacteria 100026
650 Ga0495672_0000576 3300047320 Bacteria 41488
651 Ga0495672_0013299 3300047320 Bacteria 5685
652 Ga0495676_0073898 3300047321 Bacteria 2612
653 Ga0495680_0001336 3300047322 Bacteria 26857
654 Ga0495680_0024344 3300047322 Bacteria 5022
655 Ga0495680_0205521 3300047322 Bacteria 1411
656 Ga0495683_0009085 3300047323 Bacteria 5294
657 Ga0495683_0009490 3300047323 Bacteria 5182
658 Ga0495675_0000061 3300047444 Bacteria 76035
659 Ga0495675_0012333 3300047444 Bacteria 5379
660 Ga0495679_004406 3300047446 Bacteria 6515
661 Ga0495673_0000252 3300047469 Bacteria 74793
662 Ga0495681_0017359 3300047470 Bacteria 3998
663 Ga0495686_0005019 3300047472 Bacteria 10625
664 Ga0495686_0113106 3300047472 Bacteria 1626
665 Ga0495593_0091906 3300047673 Bacteria 1562
666 Ga0495602_0005525 3300048088 Bacteria 13263
667 Ga0495615_0002903 3300048090 Bacteria 2810
668 Ga0496100_0003279 3300048903 Bacteria 8412
669 Ga0496101_0002542 3300048904 Bacteria 11190
670 Ga0496102_0000253 3300048905 Bacteria 69634
671 Ga0496102_0004416 3300048905 Bacteria 11878
672 Ga0496102_0006100 3300048905 Bacteria 10273
673 Ga0496103_0027532 3300048906 Bacteria 3445
674 Ga0496103_0099321 3300048906 Bacteria 1841
675 Ga0496104_0000537 3300048907 Bacteria 32588
676 Ga0496104_0280899 3300048907 Bacteria 1578
677 Ga0496104_0352862 3300048907 Bacteria 1383
678 Ga0496105_0022794 3300048908 Bacteria 5073
679 Ga0496105_0069144 3300048908 Bacteria 2918
680 Ga0496106_0003355 3300048909 Bacteria 11939
681 Ga0496107_0002233 3300048910 Bacteria 12472
682 Ga0496108_0160256 3300048911 Bacteria 1944
683 Ga0496109_0149914 3300048912 Bacteria 2183
684 Ga0496110_0000704 3300048913 Bacteria 23091
685 Ga0496111_0027318 3300048914 Bacteria 4036
686 Ga0496112_0094432 3300048915 Bacteria 2961
687 Ga0496112_0153370 3300048915 Bacteria 2271
688 Ga0496113_0118527 3300048916 Bacteria 2067
689 Ga0496114_0004267 3300048917 Bacteria 11063
690 Ga0496114_0208558 3300048917 Bacteria 1713
691 Ga0496115_0007045 3300048918 Bacteria 8260
692 Ga0496115_0067942 3300048918 Bacteria 2884
693 Ga0496115_0203522 3300048918 Bacteria 1635
694 Ga0496116_0003291 3300048919 Bacteria 16067
695 Ga0496116_0040404 3300048919 Bacteria 3212
696 Ga0496116_0077769 3300048919 Bacteria 2071
697 Ga0496117_0000010 3300048920 Bacteria 611954
698 Ga0496117_0000020 3300048920 Bacteria 458405
699 Ga0496117_0000095 3300048920 Bacteria 198731
700 Ga0496117_0001093 3300048920 Bacteria 40952
701 Ga0496118_0000003 3300048921 Bacteria 773148
702 Ga0496118_0000009 3300048921 Bacteria 611954
703 Ga0496118_0000015 3300048921 Bacteria 551359
704 Ga0496118_0105408 3300048921 Bacteria 1890
705 Ga0496119_0006799 3300048922 Bacteria 10487
706 Ga0496119_0020291 3300048922 Bacteria 4853
707 Ga0496119_0074648 3300048922 Bacteria 1974
708 Ga0496119_0084377 3300048922 Bacteria 1821
709 Ga0496119_0100611 3300048922 Bacteria 1623
710 Ga0496120_0000693 3300048923 Bacteria 49436
711 Ga0496120_0002649 3300048923 Bacteria 17666
712 Ga0496120_0054557 3300048923 Bacteria 2264
713 Ga0496120_0060868 3300048923 Bacteria 2110
714 Ga0496120_0065802 3300048923 Bacteria 2006
715 Ga0496121_0000760 3300048924 Bacteria 59241
716 Ga0496121_0002573 3300048924 Bacteria 27446
717 Ga0496121_0003236 3300048924 Bacteria 23416
718 Ga0496121_0005330 3300048924 Bacteria 16532
719 Ga0496121_0005691 3300048924 Bacteria 15840
720 Ga0496121_0013141 3300048924 Bacteria 8931
721 Ga0496122_0000491 3300048925 Bacteria 82131
722 Ga0496122_0001880 3300048925 Bacteria 31877
723 Ga0496122_0005531 3300048925 Bacteria 15007
724 Ga0496122_0064238 3300048925 Bacteria 2672
725 Ga0496123_0000488 3300048926 Bacteria 69002
726 Ga0496123_0008787 3300048926 Bacteria 9210
727 Ga0496123_0017366 3300048926 Bacteria 5791
728 Ga0496123_0112970 3300048926 Bacteria 1548
729 Ga0496124_0005346 3300048927 Bacteria 14493
730 Ga0496124_0077686 3300048927 Bacteria 2737
731 Ga0496124_0220544 3300048927 Bacteria 1426
732 Ga0496125_0000757 3300048928 Bacteria 52952
733 Ga0496125_0014409 3300048928 Bacteria 7700
734 Ga0496125_0021615 3300048928 Bacteria 5997
735 Ga0496125_0022315 3300048928 Bacteria 5881
736 Ga0496125_0110181 3300048928 Bacteria 1997
737 Ga0496126_0003855 3300048929 Bacteria 18532
738 Ga0496126_0017291 3300048929 Bacteria 7185
739 Ga0496126_0066928 3300048929 Bacteria 3211
740 Ga0496126_0087972 3300048929 Bacteria 2738
741 Ga0496126_0306455 3300048929 Bacteria 1308
742 Ga0495678_036141 3300049459 Bacteria 2018
743 Ga0501032_0002698 3300049569 Bacteria 13838
744 Ga0501033_0000753 3300049570 Bacteria 29818
745 Ga0501033_0001575 3300049570 Bacteria 20086
746 Ga0501033_0023597 3300049570 Bacteria 4639
747 Ga0501034_0011345 3300049571 Bacteria 9239
748 Ga0501037_0004419 3300049573 Bacteria 10213
749 Ga0501037_0024004 3300049573 Bacteria 4508
750 Ga0501038_0006279 3300049574 Bacteria 10986
751 Ga0501043_0000559 3300049579 Bacteria 33347
752 Ga0501046_0001485 3300049580 Bacteria 22466
753 Ga0501047_0054565 3300049581 Bacteria 3865
754 Ga0501067_0008950 3300049583 Bacteria 5548
755 Ga0501068_0000229 3300049584 Bacteria 27255
756 Ga0501070_0028668 3300049586 Bacteria 4668
757 Ga0501070_0107625 3300049586 Bacteria 2304
758 Ga0501072_0000003 3300049588 Bacteria 298632
759 Ga0501074_0002384 3300049590 Bacteria 13098
760 Ga0501076_0157196 3300049592 Bacteria 1851
761 Ga0501079_0007057 3300049741 Bacteria 8476
762 Ga0501035_0002193 3300049822 Bacteria 19383
763 Ga0501035_0006107 3300049822 Bacteria 11338
764 Ga0501044_0000563 3300049823 Bacteria 45153
765 Ga0501044_0002141 3300049823 Bacteria 22624
766 Ga0501044_0179097 3300049823 Bacteria 2087
767 nmdc:mga00v17_21_c1 3300050491 Bacteria 55853
768 nmdc:mga00v17_31_c1 3300050491 Bacteria 87312
769 nmdc:mga08y16_233_c1 3300050511 Bacteria 49640
770 nmdc:mga08x19_23707_c1 3300050514 Bacteria 3808
771 nmdc:mga08x19_511_c1 3300050514 Bacteria 25777
772 nmdc:mga0a205_131476_c1 3300050515 Bacteria 2403
773 Ga0495601_0123143 3300053077 Bacteria 1685
774 Ga0495595_0025762 3300053084 Bacteria 2608
775 Ga0500646_0044336 3300053090 Bacteria 1262
776 Ga0500556_0001489 3300053104 Bacteria 9718
777 Ga0500557_009266 3300053105 Bacteria 2404
778 Ga0500591_022251 3300053115 Bacteria 3077
779 Ga0500618_000946 3300053125 Bacteria 14873
780 Ga0500658_0017191 3300053134 Bacteria 2699
781 Ga0500588_0000099 3300053146 Bacteria 11307
782 Ga0500590_119386 3300053148 Bacteria 1238
783 Ga0500622_0031117 3300053156 Bacteria 2799
784 Ga0500624_008964 3300053157 Bacteria 1412
785 Ga0500627_0022083 3300053158 Bacteria 2576
786 Ga0500639_057883 3300053163 Bacteria 2004
787 Ga0500636_0000038 3300053177 Bacteria 70653
788 Ga0501084_0000794 3300054114 Bacteria 24153
789 Ga0587077_004819 3300059493 Bacteria 1802
790 Ga0501082_0000045 3300060353 Bacteria 86365
791 Ga0466962_0000283 3300061719 Bacteria 21482
792 Ga0530510_0050043 3300061734 Bacteria 3018
793 2508732928 2508501050 Bacteria 9633614
794 2509075607 2508501114 Bacteria 7082538
795 2511132878 2510917022 Bacteria 6504556
796 2511249084 2511231003 Bacteria 5606035
797 2511265900 2511231006 Bacteria 6794709
798 2511376222 2511231024 Bacteria 5835885
799 2512323789 2512047018 Bacteria 6663241
800 2513595733 2513237088 Bacteria 6927906
801 2513595798 2513237088 Bacteria 6927906
802 2513611401 2513237090 Bacteria 7096802
803 2513870468 2513237138 Bacteria 7368160
804 2514001174 2513237159 Bacteria 6810126
805 2535519906 2534681796 Bacteria 7146037
806 2535519980 2534681796 Bacteria 7146037
807 2583791954 2582580891 Bacteria 6800976
808 2585204738 2582581294 Bacteria 6626667
809 2585232891 2582581299 Bacteria 6518058
810 2585268396 2582581306 Bacteria 6450535
811 2585272407 2582581307 Bacteria 6597605
812 2585324687 2582581315 Bacteria 7318924
813 2585332112 2582581316 Bacteria 7774528
814 2585390395 2582581865 Bacteria 6644329
815 2585397588 2582581866 Bacteria 6859583
816 2585399511 2582581867 Bacteria 7184437
817 2585401342 2582581867 Bacteria 7184437
818 2585542897 2585427528 Bacteria 6842387
819 2585561530 2585427531 Bacteria 6992870
820 2585821513 2585427590 Bacteria 6824633
821 2585841161 2585427593 Bacteria 7141551
822 2585899378 2585427608 Bacteria 6544331
823 2585906758 2585427609 Bacteria 6667127
824 2587982179 2585428125 Bacteria 6662905
825 2597858015 2597489887 Bacteria 6666321
826 2599485046 2599185185 Bacteria 6652270
827 2600197345 2599185352 Bacteria 7228948
828 2601670442 2600255292 Bacteria 6300551
829 2643809424 2643221557 Bacteria 7184309
830 2643814796 2643221558 Bacteria 5460675
831 2644003549 2643221599 Bacteria 6292121
832 2644069412 2643221610 Bacteria 7480339
833 2644241166 2643221643 Bacteria 5749658
834 2644379989 2643221668 Bacteria 7306521
835 2644420565 2643221675 Bacteria 7473456
836 2644454091 2643221680 Bacteria 7473610
837 2644674746 2643221723 Bacteria 7095460
838 2644686136 2643221726 Bacteria 7455827
839 2644744100 2643221736 Bacteria 6608466
840 2671103031 2667528172 Bacteria 5170840
841 2694630968 2693429783 Bacteria 7019804
842 2738825602 2738541297 Bacteria 6549566
843 2739149399 2738541357 Bacteria 6549408
844 2739191318 2738543003 Bacteria 6549560
845 2739317795 2738543026 Bacteria 6549408
846 2739336036 2738543029 Bacteria 6549249
847 2743737481 2740892503 Bacteria 6855563
848 2765588897 2765235842 Bacteria 4799256
849 2776260535 2775506901 Bacteria 9631051
850 2778174740 2775507266 Bacteria 7392367
851 2778178181 2775507266 Bacteria 7392367
852 2792641789 2791355094 Bacteria 7011481
853 2819244036 2818991272 Bacteria 4622173
854 2819592316 2818991445 Bacteria 4955017
855 2821126460 2821123053 Bacteria 7836056
856 2823374689 2823373977 Bacteria 4779415
857 2835319036 2835312727 Bacteria 7413381
858 2838737064 2838736955 Bacteria 5760694
859 2841842567 2841840854 Bacteria 5761912
860 2842142347 2842140634 Bacteria 5759631
861 2842512192 2842509118 Bacteria 6850950
862 2842526849 2842521101 Bacteria 6569494
863 2844427456 2844425489 Bacteria 4854065
864 2852617670 2852612431 Bacteria 6885235
865 2852672966 2852667396 Bacteria 6885555
866 2854899819 2854896431 Bacteria 5869725
867 2854920961 2854916844 Bacteria 5725939
868 2855022605 2855020534 Bacteria 3204685
869 2856314238 2856314179 Bacteria 6477897
870 2856344653 2856342000 Bacteria 7176905
871 2856369365 2856364286 Bacteria 6939991
872 2857533022 2857531043 Bacteria 6754041
873 2857548217 2857547612 Bacteria 6179999
874 2857576187 2857576091 Bacteria 5465855
875 2869286562 2869285874 Bacteria 6901219
876 2871434715 2871429161 Bacteria 6547891
877 2874149920 2874146452 Bacteria 7533118
878 2874158178 2874155637 Bacteria 6724144
879 2876416382 2876413966 Bacteria 6831344
880 2878751848 2878745973 Bacteria 6867388
881 2884816254 2884811622 Bacteria 5552861
882 2884840267 2884836552 Bacteria 5219991
883 2884856967 2884852848 Bacteria 5221161
884 2885085213 2885080285 Bacteria 6355622
885 2885349856 2885342637 Bacteria 7011821
886 2888337097 2888337043 Bacteria 6629336
887 2888345844 2888343758 Bacteria 6611049
888 2891049811 2891048133 Bacteria 4447501
889 2894233290 2894232714 Bacteria 8834183
890 2896157552 2896154374 Bacteria 5221518
891 2903504794 2903492973 Bacteria 13473544
892 2906314246 2906308376 Bacteria 6841989
893 2906327412 2906321335 Bacteria 6579571
894 2906414660 2906414383 Bacteria 6580790
895 2919109321 2919108558 Bacteria 5897419
896 2919169070 2919166419 Bacteria 4952238
897 2919479116 2919476304 Bacteria 5888696
898 2923156522 2923153595 Bacteria 6870622
899 2923560393 2923556063 Bacteria 6793593
900 2923634773 2923634449 Bacteria 4753480
901 2932412812 2932410948 Bacteria 6312192
902 2932420327 2932416698 Bacteria 6315112
903 2937541734 2937539931 Bacteria 4639830
904 2937815644 2937813078 Bacteria 7783518
905 2939639374 2939636861 Bacteria 6297853
906 2958130965 2958130278 Bacteria 6897202
907 2958184886 2958179912 Bacteria 6874908
908 2961083053 2961077736 Bacteria 7079850
909 2965063113 2965062239 Bacteria 7412989
910 2968129802 2968128360 Bacteria 6270294
911 2968130256 2968128360 Bacteria 6270294
912 2974312179 2974310843 Bacteria 4947816
913 2977845880 2977843712 Bacteria 6753583
914 2978970549 2978969890 Bacteria 5400756
915 2984587556 2984587000 Bacteria 5263363
916 2989780572 2989776772 Bacteria 4843317
917 2995397143 2995392953 Bacteria 4539380
918 3000137811 3000135777 Bacteria 6891109
919 3004217668 3004211236 Bacteria 7417683
920 3004220015 3004218560 Bacteria 7421728
921 3007395906 3007395558 Bacteria 6755444
922 639785420 639633007 Bacteria 4376040
923 8004393736 8004387939 Bacteria 7049250
924 8004720504 8004714634 Bacteria 6776161
925 8005250276 8005246636 Bacteria 4933972
926 8005263813 8005258706 Bacteria 6184835
927 8005263978 8005258706 Bacteria 6184835
928 8005547630 8005542996 Bacteria 7077758
929 8005547706 8005542996 Bacteria 7077758
930 8018152405 8018150411 Bacteria 5549903
931 8018407852 8018405270 Bacteria 4978981
932 8054561616 8054558443 Bacteria 5204801
933 8054853176 8054849141 Bacteria 5232694
934 8055773851 8055770955 Bacteria 6827675
935 Ga0207699_10049705
936 MRS2a_Contig_1767
937 MRS2a_Contig_1768
938 MRS2a_Contig_70
939 SwRhRL2b_contig_1954747
940 JGI25155J39150_1000048
941 JGI25155J39150_1000162
942 JGI25156J39149_1000068
943 JGI25156J39149_1005786
944 JGI25162J39368_1006021
945 JGI25154J39366_1000066
946 JGI25154J39366_1000084
947 JGI25157J39369_1000097
948 JGI25159J45721_1000454
949 JGI25151J46595_10016628
950 rootH1_10037457
951 JGI25160J50197_1000005
952 JGI25160J50197_1000014
953 JGI25161J50226_1000022
954 JGI25161J50226_1000349
955 Ga0055532_1000015
956 Ga0055526_1007416
957 Ga0055537_1001060
958 Ga0055524_1002559
959 Ga0055524_1012855
960 Ga0055524_1030908
961 Ga0055536_1000014
962 Ga0055534_1000072
963 Ga0055528_1000043
964 Ga0055528_1006829
965 Ga0055530_10000009
966 Ga0055540_1000342
967 Ga0055543_1000005
968 Ga0055543_1000082
969 Ga0055543_1002336
970 Ga0058861_11837734
971 Ga0065165_1000002
972 Ga0065165_1000187
973 Ga0065165_1000463
974 Ga0065714_10000917
975 Ga0070683_100000407
976 Ga0070683_100012192
977 Ga0070683_100111389
978 Ga0070683_100140509
979 Ga0070690_100012887
980 Ga0070670_100001173
981 Ga0070670_100024696
982 Ga0070666_10004887
983 Ga0070666_10015348
984 Ga0070666_10029975
985 Ga0070680_100003368
986 Ga0070680_100013212
987 Ga0070680_100056113
988 Ga0070680_100088865
989 Ga0068868_100002348
990 Ga0068868_100004425
991 Ga0068868_100005551
992 Ga0070691_10000505
993 Ga0070669_100041490
994 Ga0070671_100016932
995 Ga0070671_100028433
996 Ga0070671_100031183
997 Ga0070667_100000046
998 Ga0070667_100022349
999 Ga0070667_100061990
1000 Ga0070667_100226934
1001 Ga0070714_100000679
1002 Ga0070714_100086560
1003 Ga0070714_100130594
1004 Ga0070714_100341774
1005 Ga0070713_100008248
1006 Ga0070713_100022654
1007 Ga0070713_100088383
1008 Ga0070662_100118561
1009 Ga0070681_10000278
1010 Ga0070681_10005588
1011 Ga0070681_10008207
1012 Ga0070681_10030852
1013 Ga0070681_10076711
1014 Ga0070681_10084359
1015 Ga0068867_100014256
1016 Ga0068867_100166422
1017 Ga0070706_100040154
1018 Ga0070699_100039576
1019 Ga0070679_100010630
1020 Ga0070679_100011761
1021 Ga0070679_100039079
1022 Ga0070679_100059190
1023 Ga0070679_100078890
1024 Ga0070679_100113034
1025 Ga0070684_100000856
1026 Ga0070684_100057257
1027 Ga0070697_100032440
1028 Ga0068853_100128029
1029 Ga0070695_100059472
1030 Ga0070665_100001514
1031 Ga0070665_100010456
1032 Ga0070665_100038832
1033 Ga0070665_100039405
1034 Ga0070665_100139058
1035 Ga0068855_100000946
1036 Ga0068855_100004315
1037 Ga0068855_100010388
1038 Ga0068855_100332226
1039 Ga0068855_100409240
1040 Ga0070664_100225222
1041 Ga0068857_100000139
1042 Ga0068857_100015494
1043 Ga0068854_100085487
1044 Ga0068856_100001980
1045 Ga0068856_100003335
1046 Ga0068856_100011282
1047 Ga0068856_100066173
1048 Ga0068856_100079057
1049 Ga0068852_100009656
1050 Ga0068852_100026807
1051 Ga0068852_100062674
1052 Ga0068859_100007848
1053 Ga0068859_100057855
1054 Ga0068859_100178947
1055 Ga0068863_100001619
1056 Ga0068863_100015117
1057 Ga0068863_100042715
1058 Ga0068863_100100625
1059 Ga0068858_100000996
1060 Ga0068858_100003356
1061 Ga0068858_100166497
1062 Ga0068860_100002939
1063 Ga0068860_100003553
1064 Ga0068860_100022586
1065 Ga0068860_100034234
1066 Ga0068860_100186876
1067 Ga0068860_100357648
1068 Ga0068862_100098962
1069 Ga0068862_100106478
1070 Ga0081455_10000002
1071 Ga0081455_10000075
1072 Ga0081539_10000123
1073 Ga0070717_10022763
1074 Ga0075364_10000122
1075 Ga0075364_10009211
1076 Ga0070715_10025500
1077 Ga0070716_100005359
1078 Ga0070712_100001354
1079 Ga0070712_100018344
1080 Ga0075367_10000065
1081 Ga0075367_10106018
1082 Ga0097621_100003036
1083 Ga0097621_100023168
1084 Ga0097621_100041334
1085 Ga0097621_100139274
1086 Ga0075370_10045293
1087 Ga0068871_100003128
1088 Ga0068871_100006989
1089 Ga0068871_100007934
1090 Ga0075433_10140160
1091 Ga0068865_100000854
1092 Ga0068865_100003193
1093 Ga0075436_100048012
1094 Ga0075436_100067416
1095 Ga0097620_100007848
1096 Ga0097620_100057855
1097 Ga0097620_100178950
1098 Ga0079104_1000243
1099 Ga0079104_1011586
1100 Ga0099794_10021173
1101 Ga0099794_10027462
1102 Ga0105251_10001382
1103 Ga0105251_10008811
1104 Ga0105251_10073173
1105 Ga0105244_10003953
1106 Ga0105244_10031082
1107 Ga0105250_10000059
1108 Ga0105250_10001065
1109 Ga0105250_10046057
1110 Ga0105240_10000721
1111 Ga0105240_10002166
1112 Ga0105240_10005036
1113 Ga0105240_10006325
1114 Ga0105240_10012887
1115 Ga0105240_10058545
1116 Ga0105240_10095545
1117 Ga0105240_10215450
1118 Ga0105240_10409042
1119 Ga0111539_10000107
1120 Ga0105245_10002527
1121 Ga0105245_10003212
1122 Ga0105245_10018741
1123 Ga0105245_10019040
1124 Ga0105245_10102026
1125 Ga0105247_10010886
1126 Ga0105247_10016238
1127 Ga0105247_10026517
1128 Ga0105243_10079262
1129 Ga0105241_10000274
1130 Ga0105241_10000595
1131 Ga0105241_10032378
1132 Ga0105241_10047004
1133 Ga0105241_10115502
1134 Ga0105242_10001176
1135 Ga0105242_10017229
1136 Ga0105242_10022525
1137 Ga0105248_10002359
1138 Ga0105248_10003426
1139 Ga0105248_10051703
1140 Ga0105248_10286623
1141 Ga0105248_10351867
1142 Ga0105237_10004017
1143 Ga0105237_10193993
1144 Ga0105238_10001117
1145 Ga0105238_10003110
1146 Ga0105238_10006903
1147 Ga0105238_10009735
1148 Ga0105238_10046694
1149 Ga0105238_10193557
1150 Ga0105249_10026594
1151 Ga0105239_10002184
1152 Ga0105239_10005500
1153 Ga0105239_10011109
1154 Ga0105239_10029023
1155 Ga0105239_10033015
1156 Ga0105239_10045243
1157 Ga0105239_10190021
1158 Ga0105239_10207182
1159 Ga0105246_10008333
1160 Ga0105246_10072511
1161 Ga0157371_10015446
1162 Ga0157370_10002686
1163 Ga0157370_10015891
1164 Ga0157370_10177484
1165 Ga0157369_10005407
1166 Ga0157369_10024762
1167 Ga0157369_10045001
1168 Ga0157369_10090441
1169 Ga0157369_10259330
1170 Ga0157374_10005928
1171 Ga0157374_10032993
1172 Ga0157374_10064220
1173 Ga0157378_10000037
1174 Ga0157378_10006931
1175 Ga0157378_10052411
1176 Ga0163162_10054706
1177 Ga0157372_10164098
1178 Ga0157372_10171737
1179 Ga0163163_10117984
1180 Ga0157380_10242171
1181 Ga0182008_10050005
1182 Ga0157379_10039188
1183 Ga0157379_10114627
1184 Ga0157376_10000094
1185 Ga0157376_10032475
1186 Ga0157376_10053068
1187 Ga0182006_1000010
1188 Ga0182006_1000055
1189 Ga0182007_10000030
1190 Ga0182005_1000003
1191 Ga0182005_1000009
1192 Ga0213872_10000523
1193 Ga0213872_10011662
1194 Ga0213872_10013790
1195 Ga0213872_10039873
1196 Ga0213876_10107298
1197 Ga0209435_100021
1198 Ga0209435_100074
1199 Ga0209436_100869
1200 Ga0209147_100004
1201 Ga0209437_100045
1202 Ga0209258_100083
1203 Ga0209646_1000057
1204 Ga0209646_1000074
1205 Ga0209026_1000058
1206 Ga0209759_1000046
1207 Ga0209759_1000112
1208 Ga0209129_1003788
1209 Ga0209565_1000006
1210 Ga0209455_1008156
1211 Ga0209673_1000004
1212 Ga0209673_1016330
1213 Ga0209673_1018668
1214 Ga0209130_1000010
1215 Ga0209130_1000013
1216 Ga0209130_1000191
1217 Ga0209675_1000006
1218 Ga0209676_1000003
1219 Ga0209676_1006358
1220 Ga0209025_1000687
1221 Ga0209025_1010541
1222 Ga0209564_1000025
1223 Ga0209564_1000085
1224 Ga0209564_1001631
1225 Ga0209564_1020303
1226 Ga0209050_1000004
1227 Ga0209256_1000037
1228 Ga0209256_1000320
1229 Ga0209256_1002250
1230 Ga0209256_1009820
1231 Ga0209256_1030930
1232 Ga0207426_1000022
1233 Ga0207426_1000036
1234 Ga0207426_1001794
1235 Ga0207426_1002644
1236 Ga0209051_1000006
1237 Ga0209051_1039420
1238 Ga0207696_1000005
1239 Ga0207696_1002284
1240 Ga0207696_1014942
1241 Ga0207713_1000002
1242 Ga0207713_1000501
1243 Ga0207713_1018816
1244 Ga0207642_10030714
1245 Ga0207710_10014096
1246 Ga0207710_10015856
1247 Ga0207688_10033070
1248 Ga0207688_10095460
1249 Ga0207680_10001892
1250 Ga0207684_10268390
1251 Ga0207654_10002301
1252 Ga0207654_10004032
1253 Ga0207654_10080279
1254 Ga0207707_10000094
1255 Ga0207707_10002920
1256 Ga0207707_10003000
1257 Ga0207707_10017442
1258 Ga0207707_10018558
1259 Ga0207707_10025363
1260 Ga0207707_10085423
1261 Ga0207707_10133024
1262 Ga0207695_10000471
1263 Ga0207695_10000776
1264 Ga0207695_10010991
1265 Ga0207695_10020093
1266 Ga0207695_10028070
1267 Ga0207695_10034697
1268 Ga0207695_10042276
1269 Ga0207695_10049827
1270 Ga0207695_10058899
1271 Ga0207695_10059123
1272 Ga0207695_10140611
1273 Ga0207671_10067008
1274 Ga0207671_10125706
1275 Ga0207693_10000245
1276 Ga0207693_10015257
1277 Ga0207693_10023591
1278 Ga0207693_10046941
1279 Ga0207693_10071257
1280 Ga0207663_10058484
1281 Ga0207663_10077898
1282 Ga0207660_10185308
1283 Ga0207660_10222041
1284 Ga0207657_10003974
1285 Ga0207649_10148192
1286 Ga0207652_10014668
1287 Ga0207652_10017165
1288 Ga0207652_10090331
1289 Ga0207694_10001821
1290 Ga0207694_10006998
1291 Ga0207694_10047733
1292 Ga0207694_10077597
1293 Ga0207694_10147527
1294 Ga0207650_10000745
1295 Ga0207687_10021803
1296 Ga0207687_10126370
1297 Ga0207700_10076405
1298 Ga0207700_10111680
1299 Ga0207664_10052053
1300 Ga0207664_10186473
1301 Ga0207664_10209203
1302 Ga0207644_10005836
1303 Ga0207644_10054521
1304 Ga0207706_10114151
1305 Ga0207686_10126294
1306 Ga0207709_10057705
1307 Ga0207670_10074848
1308 Ga0207665_10001531
1309 Ga0207665_10009385
1310 Ga0207665_10022989
1311 Ga0207691_10206589
1312 Ga0207711_10020187
1313 Ga0207711_10042882
1314 Ga0207689_10003574
1315 Ga0207661_10056496
1316 Ga0207661_10066357
1317 Ga0207661_10194725
1318 Ga0207661_10242893
1319 Ga0207667_10000399
1320 Ga0207667_10001596
1321 Ga0207667_10018532
1322 Ga0207667_10061184
1323 Ga0207712_10010235
1324 Ga0207658_10000058
1325 Ga0207658_10000493
1326 Ga0207703_10000259
1327 Ga0207703_10019229
1328 Ga0207703_10356729
1329 Ga0207639_10053821
1330 Ga0207639_10389788
1331 Ga0207678_10038195
1332 Ga0207678_10046814
1333 Ga0207678_10106260
1334 Ga0207702_10011423
1335 Ga0207702_10021345
1336 Ga0207702_10032008
1337 Ga0207641_10000196
1338 Ga0207641_10002905
1339 Ga0207641_10010473
1340 Ga0207641_10035754
1341 Ga0207648_10005986
1342 Ga0207674_10000042
1343 Ga0207674_10017528
1344 Ga0207674_10050909
1345 Ga0207683_10156324
1346 Ga0209281_1000179
1347 Ga0209281_1011946
1348 Ga0209588_1007148
1349 Ga0209588_1009766
1350 Ga0207428_10000040
1351 Ga0268266_10000512
1352 Ga0268266_10003024
1353 Ga0268266_10017708
1354 Ga0268266_10024513
1355 Ga0268266_10097277
1356 Ga0268266_10180864
1357 Ga0268265_10140521
1358 Ga0268264_10000182
1359 Ga0268264_10006165
1360 Ga0268264_10036379
1361 Ga0268264_10179163
1362 Ga0265319_1001093
1363 Ga0265318_10000259
1364 Ga0307515_10015010
1365 Ga0265338_10064956
1366 Ga0307511_10000008
1367 Ga0265332_10005055
1368 Ga0265320_10000057
1369 Ga0265325_10022067
1370 Ga0265325_10036749
1371 Ga0265329_10000235
1372 Ga0265340_10010715
1373 Ga0265340_10019722
1374 Ga0265339_10045581
1375 Ga0265331_10000041
1376 Ga0265331_10007068
1377 Ga0265316_10003938
1378 Ga0307509_10000099
1379 Ga0265313_10001609
1380 Ga0265313_10015924
1381 Ga0265314_10009866
1382 Ga0265342_10000124
1383 Ga0265342_10083331
1384 Ga0307410_10232781
1385 Ga0307416_100090149
1386 Ga0307414_10142053
1387 Ga0307411_10025255
1388 Ga0307510_10000003
1389 Ga0373926_0016824
1390 Ga0373934_0002106
1391 Ga0373923_0010433
1392 Ga0373936_0000768
1393 Ga0373939_0028085
1394 Ga0373945_0037383
1395 Ga0373954_0001458
1396 Ga0373954_0003051
1397 Ga0373954_0029875
1398 Ga0373956_0000242
1399 Ga0373946_0021451
1400 Ga0373955_0016254
1401 Ga0373955_0026367
1402 Ga0373955_0112459
1403 Ga0373924_0002488
1404 Ga0373935_0182616
1405 Ga0373935_0295051
1406 Ga0373927_0032769
1407 Ga0373927_0047483
1408 Ga0373927_0058624
1409 Ga0373933_0007183
1410 Ga0373933_0084299
1411 Ga0373933_0129967
1412 Ga0373947_0033007
1413 Ga0373947_0127092
1414 Ga0373937_0023699
1415 Ga0373937_0038961
1416 Ga0373937_0097241
1417 Ga0373925_0000300
1418 Ga0373925_0012304
1419 Ga0373925_0122088
1420 Ga0373925_0129063
1421 Ga0373925_0173869
1422 Ga0395899_0000093
1423 Ga0400490_25320
1424 Ga0400491_04543
1425 Ga0400487_32217
1426 Ga0400487_61000
1427 Ga0436365_0255902
1428 Ga0436365_0268609
1429 Ga0436365_1801098
1430 Ga0436360_0201373
1431 Ga0436360_0661826
1432 Ga0436360_0721843
1433 Ga0436361_0411839
1434 Ga0436361_0590398
1435 Ga0436361_0787586
1436 Ga0436361_1186001
1437 Ga0436363_1307392
1438 Ga0436362_0935796
1439 Ga0439452_000014
1440 Ga0439463_000483
1441 Ga0450920_015654
1442 Ga0439464_0008277
1443 Ga0451577_0001799
1444 Ga0451577_0008240
1445 Ga0466969_0004853
1446 Ga0453683_0004409
1447 Ga0466966_0001376
1448 Ga0466961_0000376
1449 Ga0466964_0002233
1450 Ga0453684_0013054
1451 Ga0466971_0000405
1452 Ga0466970_0002295
1453 Ga0466957_0024969
1454 Ga0466959_0000875
1455 Ga0466959_0003679
1456 Ga0466959_0040113
1457 Ga0466958_0045289
1458 Ga0495617_000102
1459 Ga0495592_0022246
1460 Ga0495603_0087967
1461 Ga0495638_0055259
1462 Ga0495638_0067627
1463 Ga0495651_0000348
1464 Ga0495651_0013606
1465 Ga0495651_0028066
1466 Ga0495653_0004156
1467 Ga0495653_0006412
1468 Ga0495653_0135064
1469 Ga0495650_0000005
1470 Ga0495650_0005139
1471 Ga0495650_0006809
1472 Ga0495580_0002011
1473 Ga0495580_0002088
1474 Ga0495580_0019041
1475 Ga0495580_0020188
1476 Ga0495580_0050048
1477 Ga0495580_0146630
1478 Ga0495582_0056196
1479 Ga0495605_0003384
1480 Ga0495605_0006358
1481 Ga0495605_0037577
1482 Ga0495639_0049491
1483 Ga0495662_0050420
1484 Ga0495662_0083488
1485 Ga0495584_0002192
1486 Ga0495584_0012645
1487 Ga0495585_0003916
1488 Ga0495585_0021789
1489 Ga0495585_0046010
1490 Ga0495594_0000446
1491 Ga0495594_0008871
1492 Ga0495594_0009958
1493 Ga0495596_0000101
1494 Ga0495596_0004579
1495 Ga0495607_0000130
1496 Ga0495607_0004562
1497 Ga0495607_0067818
1498 Ga0495583_0000193
1499 Ga0495583_0008294
1500 Ga0495583_0016708
1501 Ga0495606_0001674
1502 Ga0495606_0002849
1503 Ga0495606_0003983
1504 Ga0495606_0055672
1505 Ga0495608_0019974
1506 Ga0495610_0001540
1507 Ga0495616_0000103
1508 Ga0495616_0027556
1509 Ga0495616_0071247
1510 Ga0495618_0013834
1511 Ga0495618_0020574
1512 Ga0495628_0001861
1513 Ga0495628_0065434
1514 Ga0495630_0011337
1515 Ga0495630_0032771
1516 Ga0495630_0148687
1517 Ga0495631_0003800
1518 Ga0495631_0008257
1519 Ga0495637_0000926
1520 Ga0495637_0075608
1521 Ga0495643_0000192
1522 Ga0495643_0006207
1523 Ga0495648_0001877
1524 Ga0495648_0008158
1525 Ga0495648_0042718
1526 Ga0495666_0019718
1527 Ga0495666_0032636
1528 Ga0495652_0011879
1529 Ga0495654_0000005
1530 Ga0495654_0006665
1531 Ga0495654_0007231
1532 Ga0495665_0050933
1533 Ga0495640_0125800
1534 Ga0495586_0004892
1535 Ga0495586_0044988
1536 Ga0495586_0146199
1537 Ga0495587_0044903
1538 Ga0495597_0000135
1539 Ga0495597_0001100
1540 Ga0495633_0064456
1541 Ga0495667_0003887
1542 Ga0495667_0043170
1543 Ga0495667_0053754
1544 Ga0495667_0081970
1545 Ga0495667_0157278
1546 Ga0495656_0014247
1547 Ga0495668_0000008
1548 Ga0495668_0004107
1549 Ga0495634_0037638
1550 Ga0495611_0001932
1551 Ga0495611_0008093
1552 Ga0495625_0001718
1553 Ga0495625_0022308
1554 Ga0495625_0026038
1555 Ga0495635_0062625
1556 Ga0495635_0154072
1557 Ga0495588_0009267
1558 Ga0495588_0016076
1559 Ga0495588_0045257
1560 Ga0495657_0007580
1561 Ga0495599_0012765
1562 Ga0495647_0022142
1563 Ga0495658_0068550
1564 Ga0495613_0028378
1565 Ga0495624_0162647
1566 Ga0495670_0015449
1567 Ga0495670_0128351
1568 Ga0495671_0000074
1569 Ga0495600_0001912
1570 Ga0495600_0003135
1571 Ga0495660_0039808
1572 Ga0495660_0081744
1573 Ga0495660_0112321
1574 Ga0495581_0111988
1575 Ga0495604_0002736
1576 Ga0495604_0005234
1577 Ga0495604_0041001
1578 Ga0495604_0090131
1579 Ga0495636_0001344
1580 Ga0495674_0002913
1581 Ga0495674_0022167
1582 Ga0495674_0078327
1583 Ga0495672_0000155
1584 Ga0495672_0000576
1585 Ga0495672_0013299
1586 Ga0495676_0073898
1587 Ga0495680_0001336
1588 Ga0495680_0024344
1589 Ga0495680_0205521
1590 Ga0495683_0009085
1591 Ga0495683_0009490
1592 Ga0495675_0000061
1593 Ga0495675_0012333
1594 Ga0495679_004406
1595 Ga0495673_0000252
1596 Ga0495681_0017359
1597 Ga0495686_0005019
1598 Ga0495686_0113106
1599 Ga0495593_0091906
1600 Ga0495602_0005525
1601 Ga0495615_0002903
1602 Ga0496100_0003279
1603 Ga0496101_0002542
1604 Ga0496102_0000253
1605 Ga0496102_0004416
1606 Ga0496102_0006100
1607 Ga0496103_0027532
1608 Ga0496103_0099321
1609 Ga0496104_0000537
1610 Ga0496104_0280899
1611 Ga0496104_0352862
1612 Ga0496105_0022794
1613 Ga0496105_0069144
1614 Ga0496106_0003355
1615 Ga0496107_0002233
1616 Ga0496108_0160256
1617 Ga0496109_0149914
1618 Ga0496110_0000704
1619 Ga0496111_0027318
1620 Ga0496112_0094432
1621 Ga0496112_0153370
1622 Ga0496113_0118527
1623 Ga0496114_0004267
1624 Ga0496114_0208558
1625 Ga0496115_0007045
1626 Ga0496115_0067942
1627 Ga0496115_0203522
1628 Ga0496116_0003291
1629 Ga0496116_0040404
1630 Ga0496116_0077769
1631 Ga0496117_0000010
1632 Ga0496117_0000020
1633 Ga0496117_0000095
1634 Ga0496117_0001093
1635 Ga0496118_0000003
1636 Ga0496118_0000009
1637 Ga0496118_0000015
1638 Ga0496118_0105408
1639 Ga0496119_0006799
1640 Ga0496119_0020291
1641 Ga0496119_0074648
1642 Ga0496119_0084377
1643 Ga0496119_0100611
1644 Ga0496120_0000693
1645 Ga0496120_0002649
1646 Ga0496120_0054557
1647 Ga0496120_0060868
1648 Ga0496120_0065802
1649 Ga0496121_0000760
1650 Ga0496121_0002573
1651 Ga0496121_0003236
1652 Ga0496121_0005330
1653 Ga0496121_0005691
1654 Ga0496121_0013141
1655 Ga0496122_0000491
1656 Ga0496122_0001880
1657 Ga0496122_0005531
1658 Ga0496122_0064238
1659 Ga0496123_0000488
1660 Ga0496123_0008787
1661 Ga0496123_0017366
1662 Ga0496123_0112970
1663 Ga0496124_0005346
1664 Ga0496124_0077686
1665 Ga0496124_0220544
1666 Ga0496125_0000757
1667 Ga0496125_0014409
1668 Ga0496125_0021615
1669 Ga0496125_0022315
1670 Ga0496125_0110181
1671 Ga0496126_0003855
1672 Ga0496126_0017291
1673 Ga0496126_0066928
1674 Ga0496126_0087972
1675 Ga0496126_0306455
1676 Ga0495678_036141
1677 Ga0501032_0002698
1678 Ga0501033_0000753
1679 Ga0501033_0001575
1680 Ga0501033_0023597
1681 Ga0501034_0011345
1682 Ga0501037_0004419
1683 Ga0501037_0024004
1684 Ga0501038_0006279
1685 Ga0501043_0000559
1686 Ga0501046_0001485
1687 Ga0501047_0054565
1688 Ga0501067_0008950
1689 Ga0501068_0000229
1690 Ga0501070_0028668
1691 Ga0501070_0107625
1692 Ga0501072_0000003
1693 Ga0501074_0002384
1694 Ga0501076_0157196
1695 Ga0501079_0007057
1696 Ga0501035_0002193
1697 Ga0501035_0006107
1698 Ga0501044_0000563
1699 Ga0501044_0002141
1700 Ga0501044_0179097
1701 nmdc:mga00v17_21_c1
1702 nmdc:mga00v17_31_c1
1703 nmdc:mga08y16_233_c1
1704 nmdc:mga08x19_23707_c1
1705 nmdc:mga08x19_511_c1
1706 nmdc:mga0a205_131476_c1
1707 Ga0495601_0123143
1708 Ga0495595_0025762
1709 Ga0500646_0044336
1710 Ga0500556_0001489
1711 Ga0500557_009266
1712 Ga0500591_022251
1713 Ga0500618_000946
1714 Ga0500658_0017191
1715 Ga0500588_0000099
1716 Ga0500590_119386
1717 Ga0500622_0031117
1718 Ga0500624_008964
1719 Ga0500627_0022083
1720 Ga0500639_057883
1721 Ga0500636_0000038
1722 Ga0501084_0000794
1723 Ga0587077_004819
1724 Ga0501082_0000045
1725 Ga0466962_0000283
1726 Ga0530510_0050043
1727 2508732928
1728 2509075607
1729 2511132878
1730 2511249084
1731 2511265900
1732 2511376222
1733 2512323789
1734 2513595733
1735 2513595798
1736 2513611401
1737 2513870468
1738 2514001174
1739 2535519906
1740 2535519980
1741 2583791954
1742 2585204738
1743 2585232891
1744 2585268396
1745 2585272407
1746 2585324687
1747 2585332112
1748 2585390395
1749 2585397588
1750 2585399511
1751 2585401342
1752 2585542897
1753 2585561530
1754 2585821513
1755 2585841161
1756 2585899378
1757 2585906758
1758 2587982179
1759 2597858015
1760 2599485046
1761 2600197345
1762 2601670442
1763 2643809424
1764 2643814796
1765 2644003549
1766 2644069412
1767 2644241166
1768 2644379989
1769 2644420565
1770 2644454091
1771 2644674746
1772 2644686136
1773 2644744100
1774 2671103031
1775 2694630968
1776 2738825602
1777 2739149399
1778 2739191318
1779 2739317795
1780 2739336036
1781 2743737481
1782 2765588897
1783 2776260535
1784 2778174740
1785 2778178181
1786 2792641789
1787 2819244036
1788 2819592316
1789 2821126460
1790 2823374689
1791 2835319036
1792 2838737064
1793 2841842567
1794 2842142347
1795 2842512192
1796 2842526849
1797 2844427456
1798 2852617670
1799 2852672966
1800 2854899819
1801 2854920961
1802 2855022605
1803 2856314238
1804 2856344653
1805 2856369365
1806 2857533022
1807 2857548217
1808 2857576187
1809 2869286562
1810 2871434715
1811 2874149920
1812 2874158178
1813 2876416382
1814 2878751848
1815 2884816254
1816 2884840267
1817 2884856967
1818 2885085213
1819 2885349856
1820 2888337097
1821 2888345844
1822 2891049811
1823 2894233290
1824 2896157552
1825 2903504794
1826 2906314246
1827 2906327412
1828 2906414660
1829 2919109321
1830 2919169070
1831 2919479116
1832 2923156522
1833 2923560393
1834 2923634773
1835 2932412812
1836 2932420327
1837 2937541734
1838 2937815644
1839 2939639374
1840 2958130965
1841 2958184886
1842 2961083053
1843 2965063113
1844 2968129802
1845 2968130256
1846 2974312179
1847 2977845880
1848 2978970549
1849 2984587556
1850 2989780572
1851 2995397143
1852 3000137811
1853 3004217668
1854 3004220015
1855 3007395906
1856 639785420
1857 8004393736
1858 8004720504
1859 8005250276
1860 8005263813
1861 8005263978
1862 8005547630
1863 8005547706
1864 8018152405
1865 8018407852
1866 8054561616
1867 8054853176
1868 8055773851

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

284

408

0.96

PF00108

Thiolase_N

Thiolase, N-terminal domain

11

277

0.92

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

82

146

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pcc-assembly1.cif.gz_B crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a 0.9742 2 400
6pca-assembly1.cif.gz_D crystal structure of beta-ketoadipyl-coa thiolase 0.9734 2 400
6pcd-assembly1.cif.gz_B crystal structure of beta-ketoadipyl-coa thiolase mutant (c90s-h356a) in complex octanoyl coenzyme a 0.9731 2 400
6pca-assembly1.cif.gz_C crystal structure of beta-ketoadipyl-coa thiolase 0.9726 2 400
6pcc-assembly1.cif.gz_A crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a 0.9725 2 400
ID Description Score Start End Superfamily
1ulqE02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9806 140 400 3.40.47.10
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9759 282 394 3.40.47.10
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9754 282 394 3.40.47.10
1ulqE02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9752 140 400 3.40.47.10
af_P0C7L2_1_401_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9736 2 400 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A0C1E3A8-F1-model_v4 Beta-ketoadipyl CoA thiolase 0.9944 265 400 GO:0016747
AF-A0A257Y4U2-F1-model_v4 Beta-ketoadipyl CoA thiolase 0.9929 265 400 GO:0003988
GO:0006635
GO:0010124
AF-A0A2E4A3X8-F1-model_v4 deleted 0.992 279 400
AF-A0A2H6HFU3-F1-model_v4 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase (EC 2.3.1.174) 0.9904 285 400 GO:0006635
GO:0010124
GO:0033812
AF-A0A4Q6EKK0-F1-model_v4 deleted 0.9862 260 400

Map