F486127

General Info

Members Datasets Scaffolds Average Seq Length
934 431 1868 225

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10083949|Ga0316576_100839491
Length 273
Sequence VQGTQNTILHMGCAEPLCTGAGALPVSASRDTERKTDILAMTFPLRIAPSILSADFARLGEEVRAVDAAGADWIHVDVMDGHFVPNITIGPDVVKALRPHSPKPFDVHLMIAPCDPYLEAFAKAGADIITVHVEAGPHLHRSLQAIRALGKRAGVTLNPGTPVSTIEPVIDMVDLILVMSVNPGFGGQQFITAALDKITRLRALAAGRPIEIEIDGGINPEIAPLVARAGANVLVAGNAVFKAGGAEGGGTEAYARNITAIRDAAAMARGEVV

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
197 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
206 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
230 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
334 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
335 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
336 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
360 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
361 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
362 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
363 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
364 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
365 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
366 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
367 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
368 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
369 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
370 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
374 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
375 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
376 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
377 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
382 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
383 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
384 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
385 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
386 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
392 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
399 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
400 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
401 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
402 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
403 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
406 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
407 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
408 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
409 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
413 2508501050 Microvirga lupini Lut6 Isolate Nodule
414 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
415 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
416 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
417 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
418 2831426010 Nostoc sp. 106C Isolate Unclassified
419 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
420 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
421 2849660919 Nostoc sp. T09 Isolate Unclassified
422 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
423 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
424 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
425 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
426 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
427 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
428 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
429 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
430 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
431 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0.54
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.1
Nodule 0.32
Rhizoplane 8.99
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10083949 3300031727 Bacteria 2367
2 JGI24752J21851_1000198 3300001976 Bacteria 8365
3 JGI24740J21852_10005460 3300001979 Bacteria 5373
4 JGI24740J21852_10018622 3300001979 Bacteria 2457
5 JGI24739J22299_10006428 3300001989 Bacteria 4438
6 JGI24737J22298_10033317 3300001990 Bacteria 1601
7 JGI24735J21928_10005974 3300002067 Bacteria 4021
8 JGI24735J21928_10007291 3300002067 Bacteria 3609
9 JGI24750J21931_1002769 3300002070 Bacteria 2106
10 JGI24748J21848_1000042 3300002074 Bacteria 62376
11 JGI24749J21850_1020066 3300002076 Bacteria 944
12 JGI24034J26672_10000035 3300002239 Bacteria 85548
13 JGI24742J22300_10031650 3300002244 Bacteria 926
14 Ga0055540_1006853 3300003792 Bacteria 4430
15 Ga0058859_11244916 3300004798 Bacteria 864
16 Ga0070658_10339213 3300005327 Bacteria 1285
17 Ga0070690_100000009 3300005330 Bacteria 112447
18 Ga0070690_100040895 3300005330 Bacteria 2934
19 Ga0070670_100287174 3300005331 Bacteria 1437
20 Ga0070677_10000155 3300005333 Bacteria 23197
21 Ga0070666_10000006 3300005335 Bacteria 319173
22 Ga0070666_10001803 3300005335 Bacteria 13038
23 Ga0070680_100001660 3300005336 Bacteria 16265
24 Ga0070680_100110382 3300005336 Bacteria 2289
25 Ga0070680_100168740 3300005336 Bacteria 1841
26 Ga0070682_100094964 3300005337 Bacteria 1957
27 Ga0070660_100000064 3300005339 Bacteria 62554
28 Ga0070660_100047236 3300005339 Bacteria 3302
29 Ga0070660_100109866 3300005339 Bacteria 2193
30 Ga0070660_100276101 3300005339 Bacteria 1374
31 Ga0070660_100307567 3300005339 Bacteria 1300
32 Ga0070660_100412668 3300005339 Bacteria 1117
33 Ga0070689_100012742 3300005340 Bacteria 6069
34 Ga0070689_100179282 3300005340 Bacteria 1720
35 Ga0070691_10016128 3300005341 Bacteria 3433
36 Ga0070687_100071737 3300005343 Bacteria 1862
37 Ga0070687_100225626 3300005343 Bacteria 1150
38 Ga0070661_100004993 3300005344 Bacteria 9138
39 Ga0070668_100000539 3300005347 Bacteria 25247
40 Ga0070668_100036683 3300005347 Bacteria 3742
41 Ga0070668_100083683 3300005347 Bacteria 2505
42 Ga0070668_100397584 3300005347 Bacteria 1176
43 Ga0070669_100000095 3300005353 Bacteria 86930
44 Ga0070669_100000280 3300005353 Bacteria 40554
45 Ga0070675_100061783 3300005354 Bacteria 3094
46 Ga0070675_100310794 3300005354 Bacteria 1390
47 Ga0070671_100000005 3300005355 Bacteria 256547
48 Ga0070671_100067244 3300005355 Bacteria 2988
49 Ga0070671_100186306 3300005355 Bacteria 1758
50 Ga0070674_100016308 3300005356 Bacteria 4656
51 Ga0070673_100083073 3300005364 Bacteria 2601
52 Ga0070688_100004996 3300005365 Bacteria 6945
53 Ga0070688_100045907 3300005365 Bacteria 2703
54 Ga0070659_100017634 3300005366 Bacteria 5378
55 Ga0070659_100132082 3300005366 Bacteria 2028
56 Ga0070659_100209567 3300005366 Bacteria 1606
57 Ga0070667_100021629 3300005367 Bacteria 5338
58 Ga0070667_100207098 3300005367 Bacteria 1742
59 Ga0070714_100432594 3300005435 Bacteria 1248
60 Ga0070713_100368594 3300005436 Bacteria 1336
61 Ga0070710_10187201 3300005437 Bacteria 1300
62 Ga0070700_100025794 3300005441 Bacteria 3464
63 Ga0070694_100187145 3300005444 Bacteria 1535
64 Ga0070708_100021449 3300005445 Bacteria 5462
65 Ga0070663_100050356 3300005455 Bacteria 2962
66 Ga0070663_100645155 3300005455 Bacteria 895
67 Ga0070678_100049859 3300005456 Bacteria 3024
68 Ga0070662_100251530 3300005457 Bacteria 1421
69 Ga0070681_10013407 3300005458 Bacteria 8143
70 Ga0070681_10024397 3300005458 Bacteria 6088
71 Ga0070681_10046789 3300005458 Bacteria 4324
72 Ga0070681_10167330 3300005458 Bacteria 2121
73 Ga0070681_10194105 3300005458 Bacteria 1949
74 Ga0070681_10199336 3300005458 Bacteria 1920
75 Ga0070681_10272796 3300005458 Bacteria 1603
76 Ga0070681_10506439 3300005458 Bacteria 1120
77 Ga0070685_10000155 3300005466 Bacteria 45505
78 Ga0070707_100136600 3300005468 Bacteria 2385
79 Ga0070707_100332576 3300005468 Bacteria 1476
80 Ga0070698_100003881 3300005471 Bacteria 16433
81 Ga0070699_100082691 3300005518 Bacteria 2799
82 Ga0070679_100108824 3300005530 Bacteria 2758
83 Ga0070679_100165670 3300005530 Bacteria 2183
84 Ga0070679_100245169 3300005530 Bacteria 1749
85 Ga0070684_100153420 3300005535 Bacteria 2088
86 Ga0070697_100298596 3300005536 Bacteria 1384
87 Ga0068853_100784584 3300005539 Bacteria 912
88 Ga0070686_100000091 3300005544 Bacteria 63232
89 Ga0070665_100000019 3300005548 Bacteria 413972
90 Ga0070665_100000148 3300005548 Bacteria 128573
91 Ga0070665_100043313 3300005548 Bacteria 4523
92 Ga0070665_100189335 3300005548 Bacteria 2059
93 Ga0068855_100016827 3300005563 Bacteria 8794
94 Ga0068855_100022850 3300005563 Bacteria 7496
95 Ga0068855_100938848 3300005563 Bacteria 912
96 Ga0070664_100016307 3300005564 Bacteria 6089
97 Ga0070664_100486215 3300005564 Bacteria 1136
98 Ga0068854_100459371 3300005578 Bacteria 1065
99 Ga0068854_100504303 3300005578 Bacteria 1019
100 Ga0068856_100490559 3300005614 Bacteria 1249
101 Ga0068852_100007430 3300005616 Bacteria 7998
102 Ga0068852_100042768 3300005616 Bacteria 3838
103 Ga0068852_100092276 3300005616 Bacteria 2711
104 Ga0068852_100639984 3300005616 Bacteria 1070
105 Ga0068859_100022381 3300005617 Bacteria 6336
106 Ga0068859_100213616 3300005617 Bacteria 2016
107 Ga0068861_100012358 3300005719 Bacteria 5953
108 Ga0068851_10077419 3300005834 Bacteria 1731
109 Ga0068863_100000118 3300005841 Bacteria 82651
110 Ga0068863_100014260 3300005841 Bacteria 7657
111 Ga0068863_100316090 3300005841 Bacteria 1516
112 Ga0068863_100523847 3300005841 Bacteria 1169
113 Ga0068858_100000723 3300005842 Bacteria 34436
114 Ga0068858_100002727 3300005842 Bacteria 17774
115 Ga0068858_100005339 3300005842 Bacteria 12606
116 Ga0068860_100000014 3300005843 Bacteria 319437
117 Ga0068860_100001093 3300005843 Bacteria 29849
118 Ga0068860_100134992 3300005843 Bacteria 2369
119 Ga0068862_100000014 3300005844 Bacteria 251552
120 Ga0068862_100000503 3300005844 Bacteria 41613
121 Ga0068862_100001001 3300005844 Bacteria 27048
122 Ga0081455_10002509 3300005937 Bacteria 21784
123 Ga0081455_10064681 3300005937 Bacteria 3062
124 Ga0081538_10068599 3300005981 Bacteria 1970
125 Ga0081540_1014204 3300005983 Bacteria 5119
126 Ga0081539_10014301 3300005985 Bacteria 5883
127 Ga0070717_10854828 3300006028 Bacteria 828
128 Ga0075365_10015277 3300006038 Bacteria 4640
129 Ga0070712_100001034 3300006175 Bacteria 16789
130 Ga0070712_100511112 3300006175 Bacteria 1008
131 Ga0075367_10178454 3300006178 Bacteria 1324
132 Ga0075367_10298417 3300006178 Bacteria 1014
133 Ga0075366_10003290 3300006195 Bacteria 8495
134 Ga0075366_10019985 3300006195 Bacteria 3882
135 Ga0068871_100359928 3300006358 Bacteria 1289
136 Ga0075428_100205281 3300006844 Bacteria 2130
137 Ga0075428_100311554 3300006844 Bacteria 1692
138 Ga0075431_100020447 3300006847 Bacteria 6762
139 Ga0075431_100058054 3300006847 Bacteria 3991
140 Ga0075433_10052600 3300006852 Bacteria 3549
141 Ga0075433_10124576 3300006852 Bacteria 2289
142 Ga0075434_100000986 3300006871 Bacteria 23010
143 Ga0075434_100074790 3300006871 Bacteria 3381
144 Ga0075434_100465951 3300006871 Bacteria 1285
145 Ga0075429_100057848 3300006880 Bacteria 3376
146 Ga0075436_100065280 3300006914 Bacteria 2516
147 Ga0097620_100022380 3300006931 Bacteria 6336
148 Ga0097620_100213618 3300006931 Bacteria 2016
149 Ga0075435_100036045 3300007076 Bacteria 3929
150 Ga0075435_100345783 3300007076 Bacteria 1274
151 Ga0105240_10295843 3300009093 Bacteria 1854
152 Ga0105240_10597732 3300009093 Bacteria 1215
153 Ga0105240_10678746 3300009093 Bacteria 1127
154 Ga0111539_10335230 3300009094 Bacteria 1761
155 Ga0111539_10422510 3300009094 Bacteria 1552
156 Ga0105245_10133351 3300009098 Bacteria 2332
157 Ga0105247_10000830 3300009101 Bacteria 23517
158 Ga0105247_10039951 3300009101 Bacteria 2867
159 Ga0105247_10093791 3300009101 Bacteria 1909
160 Ga0105247_10115726 3300009101 Bacteria 1731
161 Ga0105247_10151643 3300009101 Bacteria 1528
162 Ga0114129_10054562 3300009147 Bacteria 5603
163 Ga0114129_11134092 3300009147 Bacteria 977
164 Ga0105243_10138496 3300009148 Bacteria 2073
165 Ga0105242_10096458 3300009176 Bacteria 2498
166 Ga0105248_10028861 3300009177 Bacteria 6184
167 Ga0105248_10056676 3300009177 Bacteria 4396
168 Ga0105237_10047573 3300009545 Bacteria 4312
169 Ga0105237_10078994 3300009545 Bacteria 3280
170 Ga0105238_10416014 3300009551 Bacteria 1338
171 Ga0105238_10454160 3300009551 Bacteria 1278
172 Ga0105249_10000002 3300009553 Bacteria 376207
173 Ga0105249_10000035 3300009553 Bacteria 201325
174 Ga0105249_10385060 3300009553 Bacteria 1429
175 Ga0105249_10416469 3300009553 Bacteria 1376
176 Ga0099796_10010288 3300010159 Bacteria 2567
177 Ga0105239_10034581 3300010375 Bacteria 5550
178 Ga0157373_10022779 3300013100 Bacteria 4542
179 Ga0157373_10105027 3300013100 Bacteria 1987
180 Ga0157371_10147730 3300013102 Bacteria 1676
181 Ga0157371_10269119 3300013102 Bacteria 1229
182 Ga0157370_10014955 3300013104 Bacteria 7913
183 Ga0157370_10028926 3300013104 Bacteria 5445
184 Ga0157370_10112520 3300013104 Bacteria 2544
185 Ga0157369_10000043 3300013105 Bacteria 180713
186 Ga0157369_10007581 3300013105 Bacteria 12489
187 Ga0157369_10094209 3300013105 Bacteria 3196
188 Ga0157369_10111023 3300013105 Bacteria 2914
189 Ga0157369_10847637 3300013105 Bacteria 938
190 Ga0157374_10023802 3300013296 Bacteria 5483
191 Ga0157378_10333651 3300013297 Bacteria 1477
192 Ga0157378_10382343 3300013297 Bacteria 1383
193 Ga0163162_10014044 3300013306 Bacteria 7827
194 Ga0163162_10036563 3300013306 Bacteria 4895
195 Ga0163162_10114980 3300013306 Bacteria 2790
196 Ga0163162_10154001 3300013306 Bacteria 2418
197 Ga0163162_10206538 3300013306 Bacteria 2093
198 Ga0157372_10276084 3300013307 Bacteria 1953
199 Ga0157375_11173984 3300013308 Bacteria 900
200 Ga0163163_10005537 3300014325 Bacteria 10936
201 Ga0163163_10019657 3300014325 Bacteria 6346
202 Ga0157380_10004798 3300014326 Bacteria 9423
203 Ga0157380_10062201 3300014326 Bacteria 2989
204 Ga0157379_10008890 3300014968 Bacteria 8756
205 Ga0157379_10405318 3300014968 Bacteria 1254
206 Ga0157379_10455885 3300014968 Bacteria 1181
207 Ga0157379_10581161 3300014968 Bacteria 1044
208 Ga0182005_1064129 3300015265 Bacteria 1004
209 Ga0163161_10000102 3300017792 Bacteria 81540
210 Ga0213872_10014988 3300021361 Bacteria 3606
211 Ga0213874_10062776 3300021377 Bacteria 1168
212 Ga0213875_10150129 3300021388 Bacteria 1092
213 Ga0209758_1000128 3300025297 Bacteria 186771
214 Ga0207697_10009619 3300025315 Bacteria 4166
215 Ga0207697_10013327 3300025315 Bacteria 3431
216 Ga0207697_10055657 3300025315 Bacteria 1640
217 Ga0207656_10078538 3300025321 Bacteria 1479
218 Ga0207656_10102693 3300025321 Bacteria 1312
219 Ga0207682_10000147 3300025893 Bacteria 31656
220 Ga0207710_10022092 3300025900 Bacteria 2729
221 Ga0207710_10029664 3300025900 Bacteria 2382
222 Ga0207710_10092185 3300025900 Bacteria 1419
223 Ga0207710_10122998 3300025900 Bacteria 1241
224 Ga0207688_10002303 3300025901 Bacteria 10272
225 Ga0207688_10157154 3300025901 Bacteria 1346
226 Ga0207680_10000011 3300025903 Bacteria 391225
227 Ga0207680_10024594 3300025903 Bacteria 3308
228 Ga0207680_10201301 3300025903 Bacteria 1357
229 Ga0207647_10008450 3300025904 Bacteria 7382
230 Ga0207647_10055215 3300025904 Bacteria 2441
231 Ga0207647_10207689 3300025904 Bacteria 1132
232 Ga0207645_10022266 3300025907 Bacteria 4125
233 Ga0207643_10027485 3300025908 Bacteria 3154
234 Ga0207643_10180488 3300025908 Bacteria 1277
235 Ga0207705_10000033 3300025909 Bacteria 223997
236 Ga0207705_10180163 3300025909 Bacteria 1594
237 Ga0207705_10310735 3300025909 Bacteria 1210
238 Ga0207684_10479254 3300025910 Bacteria 1067
239 Ga0207654_10000285 3300025911 Bacteria 30791
240 Ga0207707_10016805 3300025912 Bacteria 6375
241 Ga0207707_10150528 3300025912 Bacteria 2035
242 Ga0207707_10159254 3300025912 Bacteria 1974
243 Ga0207707_10605427 3300025912 Bacteria 927
244 Ga0207695_10002074 3300025913 Bacteria 30558
245 Ga0207671_10012192 3300025914 Bacteria 6934
246 Ga0207693_10009479 3300025915 Bacteria 7929
247 Ga0207693_10017330 3300025915 Bacteria 5744
248 Ga0207693_10042503 3300025915 Bacteria 3577
249 Ga0207693_10078129 3300025915 Bacteria 2591
250 Ga0207693_10205671 3300025915 Bacteria 1548
251 Ga0207660_10002059 3300025917 Bacteria 13360
252 Ga0207660_10029613 3300025917 Bacteria 3758
253 Ga0207660_10245440 3300025917 Bacteria 1412
254 Ga0207662_10221508 3300025918 Bacteria 1232
255 Ga0207657_10091569 3300025919 Bacteria 2535
256 Ga0207657_10168929 3300025919 Bacteria 1773
257 Ga0207649_10000444 3300025920 Bacteria 29932
258 Ga0207649_10074284 3300025920 Bacteria 2181
259 Ga0207649_10100090 3300025920 Bacteria 1916
260 Ga0207652_10188151 3300025921 Bacteria 1856
261 Ga0207646_10214716 3300025922 Bacteria 1737
262 Ga0207681_10000096 3300025923 Bacteria 74995
263 Ga0207681_10000112 3300025923 Bacteria 68723
264 Ga0207681_10021738 3300025923 Bacteria 4083
265 Ga0207681_10323687 3300025923 Bacteria 1227
266 Ga0207694_10004187 3300025924 Bacteria 11314
267 Ga0207694_10198752 3300025924 Bacteria 1630
268 Ga0207687_10019713 3300025927 Bacteria 4471
269 Ga0207687_10051601 3300025927 Bacteria 2868
270 Ga0207700_10023911 3300025928 Bacteria 4223
271 Ga0207664_10286062 3300025929 Bacteria 1448
272 Ga0207664_10878560 3300025929 Bacteria 805
273 Ga0207644_10000008 3300025931 Bacteria 354219
274 Ga0207644_10009210 3300025931 Bacteria 6476
275 Ga0207644_10014179 3300025931 Bacteria 5331
276 Ga0207644_10351399 3300025931 Bacteria 1197
277 Ga0207690_10011704 3300025932 Bacteria 5246
278 Ga0207706_10109808 3300025933 Bacteria 2427
279 Ga0207706_10123536 3300025933 Bacteria 2277
280 Ga0207706_10278816 3300025933 Bacteria 1458
281 Ga0207706_10298024 3300025933 Bacteria 1405
282 Ga0207686_10076118 3300025934 Bacteria 2175
283 Ga0207686_10127490 3300025934 Bacteria 1741
284 Ga0207709_10252546 3300025935 Bacteria 1289
285 Ga0207670_10006506 3300025936 Bacteria 6485
286 Ga0207670_10061467 3300025936 Bacteria 2563
287 Ga0207704_10249315 3300025938 Bacteria 1332
288 Ga0207665_10370326 3300025939 Bacteria 1085
289 Ga0207691_10042109 3300025940 Bacteria 4211
290 Ga0207691_10429741 3300025940 Bacteria 1125
291 Ga0207711_10020384 3300025941 Bacteria 5527
292 Ga0207711_10056159 3300025941 Bacteria 3382
293 Ga0207711_10165981 3300025941 Bacteria 2001
294 Ga0207689_10072495 3300025942 Bacteria 2829
295 Ga0207661_10174628 3300025944 Bacteria 1872
296 Ga0207661_10349253 3300025944 Bacteria 1334
297 Ga0207679_10029237 3300025945 Bacteria 3835
298 Ga0207679_10191126 3300025945 Bacteria 1702
299 Ga0207667_10007324 3300025949 Bacteria 13282
300 Ga0207667_10012362 3300025949 Bacteria 9844
301 Ga0207667_10022285 3300025949 Bacteria 7001
302 Ga0207667_10042471 3300025949 Bacteria 4832
303 Ga0207667_10074478 3300025949 Bacteria 3527
304 Ga0207651_10109481 3300025960 Bacteria 2070
305 Ga0207712_10000002 3300025961 Bacteria 706628
306 Ga0207712_10000013 3300025961 Bacteria 391208
307 Ga0207712_10079828 3300025961 Bacteria 2378
308 Ga0207668_10007115 3300025972 Bacteria 6639
309 Ga0207668_10066392 3300025972 Bacteria 2557
310 Ga0207668_10096978 3300025972 Bacteria 2181
311 Ga0207640_10063192 3300025981 Bacteria 2459
312 Ga0207640_10215809 3300025981 Bacteria 1465
313 Ga0207640_10591692 3300025981 Bacteria 938
314 Ga0207658_10000689 3300025986 Bacteria 29444
315 Ga0207658_10102311 3300025986 Bacteria 2247
316 Ga0207658_10163505 3300025986 Bacteria 1826
317 Ga0207703_10001006 3300026035 Bacteria 27062
318 Ga0207703_10009748 3300026035 Bacteria 7537
319 Ga0207703_10013788 3300026035 Bacteria 6300
320 Ga0207703_10136533 3300026035 Bacteria 2124
321 Ga0207639_10043651 3300026041 Bacteria 3367
322 Ga0207639_10261723 3300026041 Bacteria 1513
323 Ga0207639_10616822 3300026041 Bacteria 1001
324 Ga0207678_10320833 3300026067 Bacteria 1333
325 Ga0207708_10036299 3300026075 Bacteria 3752
326 Ga0207708_10043986 3300026075 Bacteria 3403
327 Ga0207702_10007648 3300026078 Bacteria 9194
328 Ga0207702_10307501 3300026078 Bacteria 1506
329 Ga0207641_10000101 3300026088 Bacteria 122493
330 Ga0207641_10003069 3300026088 Bacteria 15060
331 Ga0207676_10001834 3300026095 Bacteria 15561
332 Ga0207674_10030099 3300026116 Bacteria 5710
333 Ga0207674_10039328 3300026116 Bacteria 4904
334 Ga0207674_10231985 3300026116 Bacteria 1793
335 Ga0207674_10445601 3300026116 Bacteria 1251
336 Ga0207674_10581922 3300026116 Bacteria 1081
337 Ga0207675_100011489 3300026118 Bacteria 8284
338 Ga0207675_100118534 3300026118 Bacteria 2503
339 Ga0207683_10095843 3300026121 Bacteria 2645
340 Ga0207683_10148744 3300026121 Bacteria 2113
341 Ga0207698_10001849 3300026142 Bacteria 12360
342 Ga0207698_10013844 3300026142 Bacteria 5340
343 Ga0207698_10038387 3300026142 Bacteria 3538
344 Ga0268266_10000025 3300028379 Bacteria 477143
345 Ga0268266_10000626 3300028379 Bacteria 48011
346 Ga0268266_10108335 3300028379 Bacteria 2458
347 Ga0268266_10137786 3300028379 Bacteria 2187
348 Ga0268266_10942846 3300028379 Bacteria 835
349 Ga0268265_10000048 3300028380 Bacteria 178523
350 Ga0268265_10000316 3300028380 Bacteria 53175
351 Ga0268265_10000975 3300028380 Bacteria 26114
352 Ga0268264_10000037 3300028381 Bacteria 391116
353 Ga0268264_10000439 3300028381 Bacteria 57339
354 Ga0268264_10161279 3300028381 Bacteria 2020
355 Ga0265760_10026725 3300031090 Bacteria 1689
356 Ga0265328_10070937 3300031239 Bacteria 1281
357 Ga0265329_10046276 3300031242 Bacteria 1390
358 Ga0265340_10022791 3300031247 Bacteria 3198
359 Ga0265340_10029387 3300031247 Bacteria 2760
360 Ga0265339_10058674 3300031249 Bacteria 2077
361 Ga0265339_10195298 3300031249 Bacteria 1001
362 Ga0265331_10002807 3300031250 Bacteria 11548
363 Ga0265331_10019075 3300031250 Bacteria 3545
364 Ga0307513_10494841 3300031456 Bacteria 940
365 Ga0265313_10000021 3300031595 Bacteria 144949
366 Ga0316575_10106133 3300031665 Bacteria 1144
367 Ga0316579_10153587 3300031691 Bacteria 1111
368 Ga0265314_10000279 3300031711 Bacteria 74300
369 Ga0265314_10025954 3300031711 Bacteria 4411
370 Ga0265314_10058157 3300031711 Bacteria 2650
371 Ga0265342_10009824 3300031712 Bacteria 6694
372 Ga0265342_10065920 3300031712 Bacteria 2121
373 Ga0316578_10038730 3300031728 Bacteria 2751
374 Ga0307405_10555396 3300031731 Bacteria 930
375 Ga0307413_10220122 3300031824 Bacteria 1386
376 Ga0307412_10144788 3300031911 Bacteria 1745
377 Ga0307412_10225018 3300031911 Bacteria 1441
378 Ga0307412_10302574 3300031911 Bacteria 1265
379 Ga0307409_100079291 3300031995 Bacteria 2646
380 Ga0307414_10057088 3300032004 Bacteria 2742
381 Ga0307414_10071542 3300032004 Bacteria 2502
382 Ga0307414_10229974 3300032004 Bacteria 1528
383 Ga0307411_10563347 3300032005 Bacteria 974
384 Ga0307415_100252775 3300032126 Bacteria 1433
385 Ga0316583_10001287 3300032133 Bacteria 8297
386 Ga0316593_10033295 3300032168 Bacteria 1686
387 Ga0307510_10000248 3300033180 Bacteria 48764
388 Ga0316592_1012612 3300033524 Bacteria 1735
389 Ga0316592_1056016 3300033524 Bacteria 882
390 Ga0373930_0035672 3300034816 Bacteria 1040
391 Ga0373958_0024349 3300034819 Bacteria 1145
392 Ga0373959_0045163 3300034820 Bacteria 936
393 Ga0373938_0090185 3300034957 Bacteria 757
394 Ga0373926_0005063 3300035083 Bacteria 4329
395 Ga0373926_0008334 3300035083 Bacteria 3447
396 Ga0373929_0012346 3300035085 Bacteria 1623
397 Ga0373940_0080405 3300035088 Bacteria 963
398 Ga0373944_0002213 3300035089 Bacteria 4942
399 Ga0373923_0041409 3300035111 Bacteria 1899
400 Ga0373923_0050859 3300035111 Bacteria 1737
401 Ga0373923_0085332 3300035111 Bacteria 1374
402 Ga0373932_0151554 3300035112 Bacteria 796
403 Ga0373936_0067593 3300035113 Bacteria 1469
404 Ga0373941_0090086 3300035115 Bacteria 1051
405 Ga0373945_0012237 3300035116 Bacteria 2846
406 Ga0373953_0213947 3300035117 Bacteria 834
407 Ga0373954_0039018 3300035118 Bacteria 2210
408 Ga0373954_0127770 3300035118 Bacteria 1236
409 Ga0373957_0204054 3300035120 Bacteria 824
410 Ga0373943_0000038 3300035170 Bacteria 44091
411 Ga0373943_0006907 3300035170 Bacteria 5091
412 Ga0373943_0084078 3300035170 Bacteria 1637
413 Ga0373946_0003198 3300035171 Bacteria 5809
414 Ga0373955_0045922 3300035172 Bacteria 2359
415 Ga0373955_0173865 3300035172 Bacteria 1276
416 Ga0373942_0052239 3300035207 Bacteria 1149
417 Ga0373961_0028678 3300035241 Bacteria 1536
418 Ga0316574_0473080 3300035398 Bacteria 783
419 Ga0373924_0043034 3300035410 Bacteria 1854
420 Ga0373931_0197657 3300035691 Bacteria 1199
421 Ga0373931_0381779 3300035691 Bacteria 888
422 Ga0373931_0393176 3300035691 Bacteria 876
423 Ga0373935_0274025 3300035692 Bacteria 1186
424 Ga0373935_0297920 3300035692 Bacteria 1139
425 Ga0373927_0000651 3300035695 Bacteria 26320
426 Ga0373927_0025823 3300035695 Bacteria 3840
427 Ga0373927_0230645 3300035695 Bacteria 1216
428 Ga0373927_0263089 3300035695 Bacteria 1134
429 Ga0373933_0024606 3300035724 Bacteria 3447
430 Ga0373947_0000024 3300035725 Bacteria 87027
431 Ga0373947_0013366 3300035725 Bacteria 4704
432 Ga0373947_0091793 3300035725 Bacteria 1895
433 Ga0373947_0094215 3300035725 Bacteria 1872
434 Ga0373947_0131845 3300035725 Bacteria 1596
435 Ga0373937_0005793 3300036401 Bacteria 10619
436 Ga0373937_0020159 3300036401 Bacteria 5975
437 Ga0373937_0580248 3300036401 Bacteria 1065
438 Ga0316582_0018667 3300036647 Bacteria 4042
439 Ga0316584_0007550 3300036712 Bacteria 7450
440 Ga0373925_0018395 3300037068 Bacteria 5079
441 Ga0373925_0153430 3300037068 Bacteria 1810
442 Ga0373925_0491408 3300037068 Bacteria 1007
443 Ga0395899_0000137 3300037312 Bacteria 111924
444 Ga0395899_0125111 3300037312 Bacteria 1839
445 Ga0395900_0000108 3300037418 Bacteria 147706
446 Ga0395900_0018679 3300037418 Bacteria 7070
447 Ga0395900_0032943 3300037418 Bacteria 5331
448 Ga0395900_0034968 3300037418 Bacteria 5175
449 Ga0395900_0043072 3300037418 Bacteria 4651
450 Ga0395900_0045893 3300037418 Bacteria 4500
451 Ga0395900_0170835 3300037418 Bacteria 2213
452 Ga0395898_0000632 3300037466 Bacteria 64373
453 Ga0395898_0024358 3300037466 Bacteria 6104
454 Ga0395898_0044477 3300037466 Bacteria 4370
455 Ga0395898_0053895 3300037466 Bacteria 3926
456 Ga0395905_0000780 3300037471 Bacteria 41824
457 Ga0395905_0096596 3300037471 Bacteria 2774
458 Ga0436364_0013094 3300037853 Bacteria 1884
459 Ga0436364_0195157 3300037853 Bacteria 17364
460 Ga0436364_0526272 3300037853 Bacteria 3502
461 Ga0436364_1108265 3300037853 Bacteria 5139
462 Ga0395901_0000050 3300038443 Bacteria 171046
463 Ga0395901_0000086 3300038443 Bacteria 125359
464 Ga0395901_0026198 3300038443 Bacteria 5985
465 Ga0395901_0051291 3300038443 Bacteria 4289
466 Ga0395901_0244060 3300038443 Bacteria 1872
467 Ga0395901_0390029 3300038443 Bacteria 1432
468 Ga0395901_0485823 3300038443 Bacteria 1259
469 Ga0400483_136809 3300039062 Bacteria 1317
470 Ga0400483_206045 3300039062 Bacteria 1699
471 Ga0436365_1896329 3300039437 Bacteria 9698
472 Ga0436360_0048356 3300039438 Bacteria 1363
473 Ga0436360_1007073 3300039438 Bacteria 1324
474 Ga0436361_0009329 3300039447 Bacteria 997
475 Ga0436361_0194635 3300039447 Bacteria 1532
476 Ga0436361_0231853 3300039447 Bacteria 1892
477 Ga0436361_0770494 3300039447 Bacteria 1510
478 Ga0436363_0211911 3300039450 Bacteria 50385
479 Ga0436363_0576058 3300039450 Bacteria 3507
480 Ga0439448_0027222 3300042005 Bacteria 1801
481 Ga0439448_0160677 3300042005 Bacteria 782
482 Ga0439456_017035 3300042013 Bacteria 1522
483 Ga0453683_0002196 3300044673 Bacteria 15517
484 Ga0466966_0020726 3300044684 Bacteria 4320
485 Ga0466961_0012256 3300044693 Bacteria 5483
486 Ga0466963_0034953 3300044694 Bacteria 3272
487 Ga0466963_0068019 3300044694 Bacteria 2391
488 Ga0453684_0028704 3300044712 Bacteria 7925
489 Ga0453684_0105894 3300044712 Bacteria 3429
490 Ga0453684_0494753 3300044712 Bacteria 1355
491 Ga0453684_0870126 3300044712 Bacteria 967
492 Ga0466971_0017973 3300044719 Bacteria 3131
493 Ga0466970_0009668 3300044765 Bacteria 4879
494 Ga0466957_0055470 3300044842 Bacteria 2422
495 Ga0466960_0134560 3300044901 Bacteria 1308
496 Ga0466959_0008062 3300045049 Bacteria 7424
497 Ga0451576_0001224 3300045051 Bacteria 45523
498 Ga0451576_0004466 3300045051 Bacteria 18128
499 Ga0451576_0012315 3300045051 Bacteria 9617
500 Ga0451576_0156267 3300045051 Bacteria 2379
501 Ga0451576_0186575 3300045051 Bacteria 2165
502 Ga0466958_0002196 3300045836 Bacteria 9718
503 Ga0466967_0032500 3300045976 Bacteria 4407
504 Ga0466967_0438975 3300045976 Bacteria 1274
505 Ga0495592_0008885 3300046454 Bacteria 7546
506 Ga0495603_0022743 3300046455 Bacteria 3793
507 Ga0495603_0098291 3300046455 Bacteria 1709
508 Ga0495629_0001636 3300046459 Bacteria 17607
509 Ga0495629_0015778 3300046459 Bacteria 5425
510 Ga0495629_0412197 3300046459 Bacteria 917
511 Ga0495629_0431396 3300046459 Bacteria 894
512 Ga0495638_0001117 3300046460 Bacteria 26096
513 Ga0495638_0064102 3300046460 Bacteria 2264
514 Ga0495641_0037738 3300046461 Bacteria 2262
515 Ga0495651_0000860 3300046462 Bacteria 23547
516 Ga0495651_0085272 3300046462 Bacteria 2379
517 Ga0495653_0002396 3300046463 Bacteria 14921
518 Ga0495580_0082128 3300046472 Bacteria 2246
519 Ga0495582_0127994 3300046473 Bacteria 1434
520 Ga0495639_0029254 3300046475 Bacteria 2445
521 Ga0495662_0041905 3300046476 Bacteria 2210
522 Ga0495662_0215780 3300046476 Bacteria 946
523 Ga0495664_0014194 3300046477 Bacteria 4513
524 Ga0495664_0231080 3300046477 Bacteria 1119
525 Ga0495584_0054269 3300046491 Bacteria 2017
526 Ga0495584_0182285 3300046491 Bacteria 1067
527 Ga0495585_0011012 3300046492 Bacteria 5370
528 Ga0495594_0005510 3300046499 Bacteria 6499
529 Ga0495607_0004756 3300046501 Bacteria 9927
530 Ga0495608_0002790 3300046511 Bacteria 12541
531 Ga0495608_0093221 3300046511 Bacteria 1946
532 Ga0495620_0122087 3300046515 Bacteria 1026
533 Ga0495628_0016517 3300046516 Bacteria 6155
534 Ga0495628_0322965 3300046516 Bacteria 1139
535 Ga0495628_0341313 3300046516 Bacteria 1102
536 Ga0495628_0690018 3300046516 Bacteria 722
537 Ga0495630_0102927 3300046517 Bacteria 2161
538 Ga0495630_0121908 3300046517 Bacteria 1978
539 Ga0495630_0264974 3300046517 Bacteria 1313
540 Ga0495637_0016075 3300046520 Bacteria 3503
541 Ga0495637_0043659 3300046520 Bacteria 1912
542 Ga0495643_0080976 3300046522 Bacteria 1689
543 Ga0495644_0003154 3300046523 Bacteria 6519
544 Ga0495644_0097544 3300046523 Bacteria 1111
545 Ga0495648_0075932 3300046524 Bacteria 1931
546 Ga0495666_0020658 3300046526 Bacteria 3261
547 Ga0495666_0174480 3300046526 Bacteria 994
548 Ga0495652_0009824 3300046529 Bacteria 8674
549 Ga0495652_0062137 3300046529 Bacteria 3150
550 Ga0495652_0381484 3300046529 Bacteria 1002
551 Ga0495665_0013078 3300046531 Bacteria 4494
552 Ga0495665_0026036 3300046531 Bacteria 3142
553 Ga0495640_0027323 3300046533 Bacteria 4116
554 Ga0495640_0039590 3300046533 Bacteria 3306
555 Ga0495640_0085978 3300046533 Bacteria 2083
556 Ga0495587_0005187 3300046536 Bacteria 8514
557 Ga0495645_0290115 3300046543 Bacteria 1073
558 Ga0495667_0001836 3300046559 Bacteria 14089
559 Ga0495667_0263455 3300046559 Bacteria 1096
560 Ga0495667_0354623 3300046559 Bacteria 926
561 Ga0495656_0005971 3300046615 Bacteria 4236
562 Ga0495634_0016406 3300046642 Bacteria 5299
563 Ga0495625_0070430 3300046660 Bacteria 2455
564 Ga0495625_0200594 3300046660 Bacteria 1317
565 Ga0495635_0008770 3300046663 Bacteria 7060
566 Ga0495635_0241348 3300046663 Bacteria 1219
567 Ga0495635_0388504 3300046663 Bacteria 928
568 Ga0495657_0198990 3300046675 Bacteria 1222
569 Ga0495599_0004247 3300046678 Bacteria 8464
570 Ga0495623_0002702 3300046679 Bacteria 11722
571 Ga0495646_0003305 3300046680 Bacteria 10032
572 Ga0495647_0002950 3300046681 Bacteria 5395
573 Ga0495647_0018044 3300046681 Bacteria 2505
574 Ga0495658_0014556 3300046683 Bacteria 4023
575 Ga0495613_0074116 3300046689 Bacteria 2479
576 Ga0495613_0157226 3300046689 Bacteria 1619
577 Ga0495624_0004781 3300046690 Bacteria 9849
578 Ga0495624_0086224 3300046690 Bacteria 1939
579 Ga0495670_0001709 3300046691 Bacteria 10800
580 Ga0495670_0008540 3300046691 Bacteria 5043
581 Ga0495670_0084260 3300046691 Bacteria 1622
582 Ga0495600_0157468 3300046809 Bacteria 1469
583 Ga0495600_0309258 3300046809 Bacteria 996
584 Ga0495581_0013861 3300047315 Bacteria 4672
585 Ga0495581_0101832 3300047315 Bacteria 1669
586 Ga0495581_0158978 3300047315 Bacteria 1321
587 Ga0495604_0001315 3300047317 Bacteria 20297
588 Ga0495604_0093810 3300047317 Bacteria 2220
589 Ga0495674_0000145 3300047319 Bacteria 54755
590 Ga0495674_0106941 3300047319 Bacteria 2375
591 Ga0495672_0111331 3300047320 Bacteria 1469
592 Ga0495676_0015903 3300047321 Bacteria 6687
593 Ga0495676_0113249 3300047321 Bacteria 1986
594 Ga0495676_0130375 3300047321 Bacteria 1816
595 Ga0495676_0202922 3300047321 Bacteria 1377
596 Ga0495680_0003388 3300047322 Bacteria 15738
597 Ga0495680_0145384 3300047322 Bacteria 1732
598 Ga0495675_0003692 3300047444 Bacteria 9253
599 Ga0495675_0388210 3300047444 Bacteria 815
600 Ga0495677_0019390 3300047445 Bacteria 2466
601 Ga0495684_0000209 3300047471 Bacteria 45383
602 Ga0495684_0022282 3300047471 Bacteria 4877
603 Ga0495684_0114332 3300047471 Bacteria 2035
604 Ga0495684_0218547 3300047471 Bacteria 1398
605 Ga0495602_0010058 3300048088 Bacteria 9819
606 Ga0495602_0357651 3300048088 Bacteria 1052
607 Ga0496100_0039775 3300048903 Bacteria 2987
608 Ga0496100_0049795 3300048903 Bacteria 2711
609 Ga0496100_0117889 3300048903 Bacteria 1854
610 Ga0496100_0373458 3300048903 Bacteria 1082
611 Ga0496100_0451373 3300048903 Bacteria 986
612 Ga0496101_0003779 3300048904 Bacteria 9459
613 Ga0496101_0031548 3300048904 Bacteria 3726
614 Ga0496101_0371114 3300048904 Bacteria 1125
615 Ga0496102_0012833 3300048905 Bacteria 7252
616 Ga0496102_0017546 3300048905 Bacteria 6269
617 Ga0496102_0143856 3300048905 Bacteria 2237
618 Ga0496102_0169470 3300048905 Bacteria 2055
619 Ga0496102_0200919 3300048905 Bacteria 1879
620 Ga0496102_0593267 3300048905 Bacteria 1031
621 Ga0496103_0003334 3300048906 Bacteria 9820
622 Ga0496104_0002148 3300048907 Bacteria 17117
623 Ga0496104_0003136 3300048907 Bacteria 14255
624 Ga0496104_0009810 3300048907 Bacteria 8535
625 Ga0496104_0026954 3300048907 Bacteria 5313
626 Ga0496104_0042587 3300048907 Bacteria 4262
627 Ga0496104_0055314 3300048907 Bacteria 3752
628 Ga0496104_0104710 3300048907 Bacteria 2711
629 Ga0496104_0106466 3300048907 Bacteria 2687
630 Ga0496104_0232421 3300048907 Bacteria 1756
631 Ga0496105_0000882 3300048908 Bacteria 20534
632 Ga0496105_0012680 3300048908 Bacteria 6676
633 Ga0496105_0013528 3300048908 Bacteria 6482
634 Ga0496105_0017190 3300048908 Bacteria 5793
635 Ga0496105_0029423 3300048908 Bacteria 4496
636 Ga0496105_0043061 3300048908 Bacteria 3723
637 Ga0496105_0309730 3300048908 Bacteria 1268
638 Ga0496105_0421979 3300048908 Bacteria 1056
639 Ga0496106_0002149 3300048909 Bacteria 14729
640 Ga0496106_0002837 3300048909 Bacteria 12860
641 Ga0496106_0095642 3300048909 Bacteria 2298
642 Ga0496106_0193717 3300048909 Bacteria 1616
643 Ga0496107_0005939 3300048910 Bacteria 8367
644 Ga0496107_0010755 3300048910 Bacteria 6364
645 Ga0496107_0011930 3300048910 Bacteria 6068
646 Ga0496107_0033374 3300048910 Bacteria 3682
647 Ga0496108_0006835 3300048911 Bacteria 9230
648 Ga0496108_0011301 3300048911 Bacteria 7254
649 Ga0496108_0049348 3300048911 Bacteria 3520
650 Ga0496109_0005176 3300048912 Bacteria 10887
651 Ga0496109_0017543 3300048912 Bacteria 6275
652 Ga0496109_0022885 3300048912 Bacteria 5538
653 Ga0496109_0119498 3300048912 Bacteria 2454
654 Ga0496109_0128459 3300048912 Bacteria 2364
655 Ga0496109_0162856 3300048912 Bacteria 2090
656 Ga0496110_0004030 3300048913 Bacteria 11329
657 Ga0496110_0013474 3300048913 Bacteria 6761
658 Ga0496110_0034708 3300048913 Bacteria 4371
659 Ga0496110_0098102 3300048913 Bacteria 2625
660 Ga0496110_0187090 3300048913 Bacteria 1880
661 Ga0496110_0221215 3300048913 Bacteria 1722
662 Ga0496111_0010614 3300048914 Bacteria 6188
663 Ga0496111_0017179 3300048914 Bacteria 4998
664 Ga0496111_0175123 3300048914 Bacteria 1595
665 Ga0496111_0206854 3300048914 Bacteria 1458
666 Ga0496111_0273777 3300048914 Bacteria 1252
667 Ga0496111_0468431 3300048914 Bacteria 929
668 Ga0496112_0002737 3300048915 Bacteria 14280
669 Ga0496112_0008660 3300048915 Bacteria 9123
670 Ga0496112_0034196 3300048915 Bacteria 4945
671 Ga0496112_0057103 3300048915 Bacteria 3842
672 Ga0496112_0072266 3300048915 Bacteria 3410
673 Ga0496112_0093100 3300048915 Bacteria 2984
674 Ga0496112_0098327 3300048915 Bacteria 2896
675 Ga0496112_0157400 3300048915 Bacteria 2238
676 Ga0496112_0285303 3300048915 Bacteria 1597
677 Ga0496112_0327421 3300048915 Bacteria 1476
678 Ga0496113_0003871 3300048916 Bacteria 9062
679 Ga0496113_0009682 3300048916 Bacteria 6329
680 Ga0496113_0055224 3300048916 Bacteria 2976
681 Ga0496113_0406263 3300048916 Bacteria 1093
682 Ga0496113_0414392 3300048916 Bacteria 1082
683 Ga0496113_0486196 3300048916 Bacteria 991
684 Ga0496114_0245324 3300048917 Bacteria 1576
685 Ga0496114_0299955 3300048917 Bacteria 1418
686 Ga0496115_0001345 3300048918 Bacteria 17523
687 Ga0496115_0065665 3300048918 Bacteria 2931
688 Ga0496115_0198692 3300048918 Bacteria 1656
689 Ga0496115_0212947 3300048918 Bacteria 1596
690 Ga0496115_0434223 3300048918 Bacteria 1062
691 Ga0496117_0037727 3300048920 Bacteria 3595
692 Ga0496118_0078175 3300048921 Bacteria 2342
693 Ga0496125_0205690 3300048928 Bacteria 1284
694 Ga0496126_0001890 3300048929 Bacteria 30241
695 Ga0496126_0517092 3300048929 Bacteria 952
696 Ga0501290_000271 3300049513 Bacteria 8525
697 Ga0501292_000003 3300049515 Bacteria 161908
698 Ga0501294_000455 3300049517 Bacteria 4826
699 Ga0501300_000439 3300049523 Bacteria 6324
700 Ga0501032_0004263 3300049569 Bacteria 10800
701 Ga0501032_0021362 3300049569 Bacteria 4499
702 Ga0501032_0091875 3300049569 Bacteria 2013
703 Ga0501032_0099781 3300049569 Bacteria 1923
704 Ga0501032_0106862 3300049569 Bacteria 1853
705 Ga0501032_0140434 3300049569 Bacteria 1591
706 Ga0501032_0341181 3300049569 Bacteria 965
707 Ga0501032_0493815 3300049569 Bacteria 782
708 Ga0501033_0033047 3300049570 Bacteria 3884
709 Ga0501033_0043744 3300049570 Bacteria 3334
710 Ga0501033_0086125 3300049570 Bacteria 2300
711 Ga0501033_0110581 3300049570 Bacteria 2000
712 Ga0501033_0216789 3300049570 Bacteria 1363
713 Ga0501033_0258270 3300049570 Bacteria 1233
714 Ga0501034_0001899 3300049571 Bacteria 26478
715 Ga0501034_0024465 3300049571 Bacteria 6144
716 Ga0501034_0025674 3300049571 Bacteria 6000
717 Ga0501034_0045159 3300049571 Bacteria 4453
718 Ga0501034_0052705 3300049571 Bacteria 4098
719 Ga0501034_0081133 3300049571 Bacteria 3246
720 Ga0501034_0093965 3300049571 Bacteria 2995
721 Ga0501034_0143844 3300049571 Bacteria 2363
722 Ga0501034_0243790 3300049571 Bacteria 1742
723 Ga0501034_0571233 3300049571 Bacteria 1038
724 Ga0501036_0003218 3300049572 Bacteria 13028
725 Ga0501036_0020141 3300049572 Bacteria 5601
726 Ga0501036_0067993 3300049572 Bacteria 3014
727 Ga0501036_0075584 3300049572 Bacteria 2848
728 Ga0501036_0247731 3300049572 Bacteria 1493
729 Ga0501036_0648907 3300049572 Bacteria 874
730 Ga0501037_0229598 3300049573 Bacteria 1303
731 Ga0501037_0238688 3300049573 Bacteria 1274
732 Ga0501038_0050512 3300049574 Bacteria 3592
733 Ga0501038_0061324 3300049574 Bacteria 3216
734 Ga0501038_0100002 3300049574 Bacteria 2417
735 Ga0501038_0129631 3300049574 Bacteria 2072
736 Ga0501038_0153588 3300049574 Bacteria 1875
737 Ga0501038_0536318 3300049574 Bacteria 891
738 Ga0501038_0566408 3300049574 Bacteria 862
739 Ga0501039_0120913 3300049575 Bacteria 2052
740 Ga0501039_0138114 3300049575 Bacteria 1914
741 Ga0501040_0027148 3300049576 Bacteria 3853
742 Ga0501042_0018714 3300049578 Bacteria 4800
743 Ga0501042_0052098 3300049578 Bacteria 2919
744 Ga0501042_0176734 3300049578 Bacteria 1540
745 Ga0501042_0251988 3300049578 Bacteria 1274
746 Ga0501043_0000380 3300049579 Bacteria 40427
747 Ga0501043_0021924 3300049579 Bacteria 5009
748 Ga0501043_0030658 3300049579 Bacteria 4227
749 Ga0501043_0059130 3300049579 Bacteria 3007
750 Ga0501043_0085612 3300049579 Bacteria 2476
751 Ga0501043_0223860 3300049579 Bacteria 1455
752 Ga0501043_0291908 3300049579 Bacteria 1248
753 Ga0501046_0010856 3300049580 Bacteria 7807
754 Ga0501046_0011538 3300049580 Bacteria 7555
755 Ga0501046_0012127 3300049580 Bacteria 7348
756 Ga0501046_0266618 3300049580 Bacteria 1257
757 Ga0501046_0296737 3300049580 Bacteria 1181
758 Ga0501047_0007528 3300049581 Bacteria 10253
759 Ga0501047_0018522 3300049581 Bacteria 6677
760 Ga0501047_0020095 3300049581 Bacteria 6413
761 Ga0501047_0045295 3300049581 Bacteria 4253
762 Ga0501047_0091556 3300049581 Bacteria 2919
763 Ga0501047_0115158 3300049581 Bacteria 2570
764 Ga0501047_0133669 3300049581 Bacteria 2361
765 Ga0501047_0245573 3300049581 Bacteria 1639
766 Ga0501047_0304642 3300049581 Bacteria 1435
767 Ga0501047_0465015 3300049581 Bacteria 1093
768 Ga0501048_0000424 3300049582 Bacteria 29683
769 Ga0501048_0037378 3300049582 Bacteria 3486
770 Ga0501048_0241404 3300049582 Bacteria 1282
771 Ga0501067_0000224 3300049583 Bacteria 31442
772 Ga0501067_0003270 3300049583 Bacteria 8920
773 Ga0501067_0234834 3300049583 Bacteria 1020
774 Ga0501068_0006315 3300049584 Bacteria 6528
775 Ga0501069_0000251 3300049585 Bacteria 24244
776 Ga0501069_0034265 3300049585 Bacteria 2796
777 Ga0501069_0080190 3300049585 Bacteria 1838
778 Ga0501069_0336743 3300049585 Bacteria 888
779 Ga0501070_0003929 3300049586 Bacteria 12811
780 Ga0501070_0007814 3300049586 Bacteria 9066
781 Ga0501070_0009582 3300049586 Bacteria 8180
782 Ga0501070_0035482 3300049586 Bacteria 4167
783 Ga0501070_0077965 3300049586 Bacteria 2742
784 Ga0501070_0194580 3300049586 Bacteria 1666
785 Ga0501070_0574693 3300049586 Bacteria 900
786 Ga0501071_0024156 3300049587 Bacteria 4250
787 Ga0501071_0087704 3300049587 Bacteria 2283
788 Ga0501071_0281177 3300049587 Bacteria 1259
789 Ga0501072_0379588 3300049588 Bacteria 1121
790 Ga0501073_0005963 3300049589 Bacteria 9091
791 Ga0501073_0011271 3300049589 Bacteria 6540
792 Ga0501073_0035524 3300049589 Bacteria 3542
793 Ga0501073_0049686 3300049589 Bacteria 2940
794 Ga0501073_0111398 3300049589 Bacteria 1898
795 Ga0501073_0161388 3300049589 Bacteria 1553
796 Ga0501073_0194619 3300049589 Bacteria 1402
797 Ga0501073_0363937 3300049589 Bacteria 999
798 Ga0501074_0006850 3300049590 Bacteria 8232
799 Ga0501074_0015486 3300049590 Bacteria 5543
800 Ga0501074_0082702 3300049590 Bacteria 2302
801 Ga0501074_0104132 3300049590 Bacteria 2031
802 Ga0501074_0359330 3300049590 Bacteria 1033
803 Ga0501076_0347310 3300049592 Bacteria 1218
804 Ga0501077_0139924 3300049593 Bacteria 1535
805 Ga0501206_004121 3300049653 Bacteria 1845
806 Ga0501222_000807 3300049662 Bacteria 4505
807 Ga0501223_000796 3300049663 Bacteria 7476
808 Ga0501224_001001 3300049664 Bacteria 3662
809 Ga0501227_001098 3300049665 Bacteria 6021
810 Ga0501252_008839 3300049682 Bacteria 1165
811 Ga0501257_020712 3300049686 Bacteria 1546
812 Ga0501259_000913 3300049688 Bacteria 4870
813 Ga0501261_000066 3300049690 Bacteria 18533
814 Ga0501225_0016325 3300049705 Bacteria 2064
815 Ga0501079_0096855 3300049741 Bacteria 2287
816 Ga0501079_0377315 3300049741 Bacteria 1112
817 Ga0501079_0633420 3300049741 Bacteria 842
818 Ga0501080_0000112 3300049742 Bacteria 56408
819 Ga0501080_0003244 3300049742 Bacteria 14351
820 Ga0501080_0018241 3300049742 Bacteria 6494
821 Ga0501080_0056888 3300049742 Bacteria 3641
822 Ga0501080_0130513 3300049742 Bacteria 2326
823 Ga0501080_0225582 3300049742 Bacteria 1713
824 Ga0501083_0007146 3300049744 Bacteria 7928
825 Ga0501083_0010656 3300049744 Bacteria 6469
826 Ga0501083_0046768 3300049744 Bacteria 2925
827 Ga0501083_0068040 3300049744 Bacteria 2370
828 Ga0501083_0173071 3300049744 Bacteria 1411
829 Ga0501241_051067 3300049758 Bacteria 817
830 Ga0501279_000040 3300049775 Bacteria 29044
831 Ga0501280_000144 3300049776 Bacteria 18384
832 Ga0501281_00385 3300049777 Bacteria 4428
833 Ga0501282_000071 3300049778 Bacteria 12013
834 Ga0501035_0014537 3300049822 Bacteria 7267
835 Ga0501035_0025766 3300049822 Bacteria 5390
836 Ga0501035_0027254 3300049822 Bacteria 5222
837 Ga0501035_0029360 3300049822 Bacteria 5014
838 Ga0501035_0351949 3300049822 Bacteria 1232
839 Ga0501044_0000658 3300049823 Bacteria 41690
840 Ga0501044_0003453 3300049823 Bacteria 17799
841 Ga0501044_0020081 3300049823 Bacteria 7133
842 Ga0501044_0025440 3300049823 Bacteria 6273
843 Ga0501044_0057121 3300049823 Bacteria 4005
844 Ga0501044_0062271 3300049823 Bacteria 3813
845 Ga0501044_0068185 3300049823 Bacteria 3624
846 Ga0501044_0193914 3300049823 Bacteria 1992
847 Ga0501044_0217258 3300049823 Bacteria 1863
848 Ga0501044_0279089 3300049823 Bacteria 1605
849 Ga0501044_0751910 3300049823 Bacteria 857
850 Ga0501045_0056418 3300049824 Bacteria 2872
851 Ga0501045_0093089 3300049824 Bacteria 2229
852 nmdc:mga03683_27069_c1 3300050489 Bacteria 2267
853 nmdc:mga00v17_385813_c1 3300050491 Bacteria 911
854 nmdc:mga0yw44_30437_c1 3300050492 Bacteria 3128
855 nmdc:mga0k408_2287_c1 3300050493 Bacteria 10222
856 nmdc:mga0k408_95314_c1 3300050493 Bacteria 1751
857 nmdc:mga05p37_43907_c1 3300050507 Bacteria 5499
858 nmdc:mga05p37_751430_c1 3300050507 Bacteria 1075
859 nmdc:mga09592_503163_c1 3300050508 Bacteria 1043
860 nmdc:mga06r32_207952_c1 3300050510 Bacteria 1945
861 nmdc:mga06r32_213150_c1 3300050510 Bacteria 1919
862 nmdc:mga08y16_303449_c1 3300050511 Bacteria 1645
863 nmdc:mga08y16_44774_c1 3300050511 Bacteria 4638
864 nmdc:mga08y16_636227_c1 3300050511 Bacteria 1072
865 nmdc:mga0n895_125963_c1 3300050512 Bacteria 2585
866 nmdc:mga0n895_2174_c1 3300050512 Bacteria 15166
867 nmdc:mga0n895_72521_c1 3300050512 Bacteria 3416
868 nmdc:mga0rr50_19771_c1 3300050513 Bacteria 4555
869 nmdc:mga08x19_59086_c1 3300050514 Bacteria 2482
870 nmdc:mga0a205_325893_c1 3300050515 Bacteria 1406
871 nmdc:mga0a205_62019_c1 3300050515 Bacteria 3612
872 Ga0495601_0000947 3300053077 Bacteria 15805
873 Ga0495601_0015896 3300053077 Bacteria 4554
874 Ga0495601_0028555 3300053077 Bacteria 3456
875 Ga0495601_0031852 3300053077 Bacteria 3279
876 Ga0495612_0000797 3300053078 Bacteria 12820
877 Ga0495612_0004285 3300053078 Bacteria 5921
878 Ga0495612_0059162 3300053078 Bacteria 1584
879 Ga0495612_0092251 3300053078 Bacteria 1284
880 Ga0495655_0017666 3300053083 Bacteria 1557
881 Ga0495595_0001078 3300053084 Bacteria 10554
882 Ga0495595_0035101 3300053084 Bacteria 2271
883 Ga0495595_0173151 3300053084 Bacteria 1069
884 Ga0495595_0285484 3300053084 Bacteria 829
885 Ga0495619_0001656 3300053085 Bacteria 14704
886 Ga0495619_0030530 3300053085 Bacteria 3489
887 Ga0500643_019996 3300053087 Bacteria 2197
888 Ga0500647_0131142 3300053091 Bacteria 1181
889 Ga0500555_044219 3300053103 Bacteria 1233
890 Ga0500556_0017319 3300053104 Bacteria 2256
891 Ga0500556_0117629 3300053104 Bacteria 1035
892 Ga0500642_0086461 3300053130 Bacteria 1445
893 Ga0500655_000033 3300053133 Bacteria 38482
894 Ga0500658_0002175 3300053134 Bacteria 7615
895 Ga0500568_0000406 3300053139 Bacteria 32845
896 Ga0500590_013244 3300053148 Bacteria 4228
897 Ga0500604_0000583 3300053151 Bacteria 10047
898 Ga0500616_0000084 3300053153 Bacteria 195562
899 Ga0500616_0000161 3300053153 Bacteria 111424
900 Ga0500616_0000805 3300053153 Bacteria 35836
901 Ga0500616_0011661 3300053153 Bacteria 5178
902 Ga0500616_0231333 3300053153 Bacteria 800
903 Ga0500587_000809 3300053739 Bacteria 4080
904 Ga0501084_0004384 3300054114 Bacteria 11505
905 Ga0501084_0076860 3300054114 Bacteria 2799
906 Ga0501084_0090968 3300054114 Bacteria 2562
907 Ga0501084_0094190 3300054114 Bacteria 2514
908 Ga0501084_0114033 3300054114 Bacteria 2272
909 Ga0501082_0006226 3300060353 Bacteria 10361
910 Ga0501082_0011332 3300060353 Bacteria 7664
911 Ga0501082_0111262 3300060353 Bacteria 2370
912 Ga0501082_0128860 3300060353 Bacteria 2195
913 Ga0501082_0384604 3300060353 Bacteria 1224
914 Ga0501082_0503484 3300060353 Bacteria 1059
915 Ga0530510_0097350 3300061734 Bacteria 2151
916 2508735756 2508501050 Bacteria 9633614
917 2617913383 2617270889 Bacteria 9064343
918 2643755515 2643221547 Bacteria 4740017
919 2738946168 2738541317 Bacteria 5340176
920 2776259030 2775506901 Bacteria 9631051
921 2831428310 2831426010 Bacteria 8662725
922 2835313563 2835312727 Bacteria 7413381
923 2848698472 2848694841 Bacteria 9205737
924 2849666178 2849660919 Bacteria 8251853
925 2882461521 2882456835 Bacteria 6863978
926 2884299721 2884298095 Bacteria 3823049
927 2886633913 2886627955 Bacteria 7618130
928 2894240136 2894232714 Bacteria 8834183
929 2913311247 2913308742 Bacteria 5350706
930 2913845598 2913844669 Bacteria 8381711
931 2913917531 2913912277 Bacteria 9037797
932 2913941558 2913939268 Bacteria 8559644
933 2919455263 2919450847 Bacteria 5631160
934 642600782 642555144 Bacteria 9059191
935 Ga0316576_10083949
936 JGI24752J21851_1000198
937 JGI24740J21852_10005460
938 JGI24740J21852_10018622
939 JGI24739J22299_10006428
940 JGI24737J22298_10033317
941 JGI24735J21928_10005974
942 JGI24735J21928_10007291
943 JGI24750J21931_1002769
944 JGI24748J21848_1000042
945 JGI24749J21850_1020066
946 JGI24034J26672_10000035
947 JGI24742J22300_10031650
948 Ga0055540_1006853
949 Ga0058859_11244916
950 Ga0070658_10339213
951 Ga0070690_100000009
952 Ga0070690_100040895
953 Ga0070670_100287174
954 Ga0070677_10000155
955 Ga0070666_10000006
956 Ga0070666_10001803
957 Ga0070680_100001660
958 Ga0070680_100110382
959 Ga0070680_100168740
960 Ga0070682_100094964
961 Ga0070660_100000064
962 Ga0070660_100047236
963 Ga0070660_100109866
964 Ga0070660_100276101
965 Ga0070660_100307567
966 Ga0070660_100412668
967 Ga0070689_100012742
968 Ga0070689_100179282
969 Ga0070691_10016128
970 Ga0070687_100071737
971 Ga0070687_100225626
972 Ga0070661_100004993
973 Ga0070668_100000539
974 Ga0070668_100036683
975 Ga0070668_100083683
976 Ga0070668_100397584
977 Ga0070669_100000095
978 Ga0070669_100000280
979 Ga0070675_100061783
980 Ga0070675_100310794
981 Ga0070671_100000005
982 Ga0070671_100067244
983 Ga0070671_100186306
984 Ga0070674_100016308
985 Ga0070673_100083073
986 Ga0070688_100004996
987 Ga0070688_100045907
988 Ga0070659_100017634
989 Ga0070659_100132082
990 Ga0070659_100209567
991 Ga0070667_100021629
992 Ga0070667_100207098
993 Ga0070714_100432594
994 Ga0070713_100368594
995 Ga0070710_10187201
996 Ga0070700_100025794
997 Ga0070694_100187145
998 Ga0070708_100021449
999 Ga0070663_100050356
1000 Ga0070663_100645155
1001 Ga0070678_100049859
1002 Ga0070662_100251530
1003 Ga0070681_10013407
1004 Ga0070681_10024397
1005 Ga0070681_10046789
1006 Ga0070681_10167330
1007 Ga0070681_10194105
1008 Ga0070681_10199336
1009 Ga0070681_10272796
1010 Ga0070681_10506439
1011 Ga0070685_10000155
1012 Ga0070707_100136600
1013 Ga0070707_100332576
1014 Ga0070698_100003881
1015 Ga0070699_100082691
1016 Ga0070679_100108824
1017 Ga0070679_100165670
1018 Ga0070679_100245169
1019 Ga0070684_100153420
1020 Ga0070697_100298596
1021 Ga0068853_100784584
1022 Ga0070686_100000091
1023 Ga0070665_100000019
1024 Ga0070665_100000148
1025 Ga0070665_100043313
1026 Ga0070665_100189335
1027 Ga0068855_100016827
1028 Ga0068855_100022850
1029 Ga0068855_100938848
1030 Ga0070664_100016307
1031 Ga0070664_100486215
1032 Ga0068854_100459371
1033 Ga0068854_100504303
1034 Ga0068856_100490559
1035 Ga0068852_100007430
1036 Ga0068852_100042768
1037 Ga0068852_100092276
1038 Ga0068852_100639984
1039 Ga0068859_100022381
1040 Ga0068859_100213616
1041 Ga0068861_100012358
1042 Ga0068851_10077419
1043 Ga0068863_100000118
1044 Ga0068863_100014260
1045 Ga0068863_100316090
1046 Ga0068863_100523847
1047 Ga0068858_100000723
1048 Ga0068858_100002727
1049 Ga0068858_100005339
1050 Ga0068860_100000014
1051 Ga0068860_100001093
1052 Ga0068860_100134992
1053 Ga0068862_100000014
1054 Ga0068862_100000503
1055 Ga0068862_100001001
1056 Ga0081455_10002509
1057 Ga0081455_10064681
1058 Ga0081538_10068599
1059 Ga0081540_1014204
1060 Ga0081539_10014301
1061 Ga0070717_10854828
1062 Ga0075365_10015277
1063 Ga0070712_100001034
1064 Ga0070712_100511112
1065 Ga0075367_10178454
1066 Ga0075367_10298417
1067 Ga0075366_10003290
1068 Ga0075366_10019985
1069 Ga0068871_100359928
1070 Ga0075428_100205281
1071 Ga0075428_100311554
1072 Ga0075431_100020447
1073 Ga0075431_100058054
1074 Ga0075433_10052600
1075 Ga0075433_10124576
1076 Ga0075434_100000986
1077 Ga0075434_100074790
1078 Ga0075434_100465951
1079 Ga0075429_100057848
1080 Ga0075436_100065280
1081 Ga0097620_100022380
1082 Ga0097620_100213618
1083 Ga0075435_100036045
1084 Ga0075435_100345783
1085 Ga0105240_10295843
1086 Ga0105240_10597732
1087 Ga0105240_10678746
1088 Ga0111539_10335230
1089 Ga0111539_10422510
1090 Ga0105245_10133351
1091 Ga0105247_10000830
1092 Ga0105247_10039951
1093 Ga0105247_10093791
1094 Ga0105247_10115726
1095 Ga0105247_10151643
1096 Ga0114129_10054562
1097 Ga0114129_11134092
1098 Ga0105243_10138496
1099 Ga0105242_10096458
1100 Ga0105248_10028861
1101 Ga0105248_10056676
1102 Ga0105237_10047573
1103 Ga0105237_10078994
1104 Ga0105238_10416014
1105 Ga0105238_10454160
1106 Ga0105249_10000002
1107 Ga0105249_10000035
1108 Ga0105249_10385060
1109 Ga0105249_10416469
1110 Ga0099796_10010288
1111 Ga0105239_10034581
1112 Ga0157373_10022779
1113 Ga0157373_10105027
1114 Ga0157371_10147730
1115 Ga0157371_10269119
1116 Ga0157370_10014955
1117 Ga0157370_10028926
1118 Ga0157370_10112520
1119 Ga0157369_10000043
1120 Ga0157369_10007581
1121 Ga0157369_10094209
1122 Ga0157369_10111023
1123 Ga0157369_10847637
1124 Ga0157374_10023802
1125 Ga0157378_10333651
1126 Ga0157378_10382343
1127 Ga0163162_10014044
1128 Ga0163162_10036563
1129 Ga0163162_10114980
1130 Ga0163162_10154001
1131 Ga0163162_10206538
1132 Ga0157372_10276084
1133 Ga0157375_11173984
1134 Ga0163163_10005537
1135 Ga0163163_10019657
1136 Ga0157380_10004798
1137 Ga0157380_10062201
1138 Ga0157379_10008890
1139 Ga0157379_10405318
1140 Ga0157379_10455885
1141 Ga0157379_10581161
1142 Ga0182005_1064129
1143 Ga0163161_10000102
1144 Ga0213872_10014988
1145 Ga0213874_10062776
1146 Ga0213875_10150129
1147 Ga0209758_1000128
1148 Ga0207697_10009619
1149 Ga0207697_10013327
1150 Ga0207697_10055657
1151 Ga0207656_10078538
1152 Ga0207656_10102693
1153 Ga0207682_10000147
1154 Ga0207710_10022092
1155 Ga0207710_10029664
1156 Ga0207710_10092185
1157 Ga0207710_10122998
1158 Ga0207688_10002303
1159 Ga0207688_10157154
1160 Ga0207680_10000011
1161 Ga0207680_10024594
1162 Ga0207680_10201301
1163 Ga0207647_10008450
1164 Ga0207647_10055215
1165 Ga0207647_10207689
1166 Ga0207645_10022266
1167 Ga0207643_10027485
1168 Ga0207643_10180488
1169 Ga0207705_10000033
1170 Ga0207705_10180163
1171 Ga0207705_10310735
1172 Ga0207684_10479254
1173 Ga0207654_10000285
1174 Ga0207707_10016805
1175 Ga0207707_10150528
1176 Ga0207707_10159254
1177 Ga0207707_10605427
1178 Ga0207695_10002074
1179 Ga0207671_10012192
1180 Ga0207693_10009479
1181 Ga0207693_10017330
1182 Ga0207693_10042503
1183 Ga0207693_10078129
1184 Ga0207693_10205671
1185 Ga0207660_10002059
1186 Ga0207660_10029613
1187 Ga0207660_10245440
1188 Ga0207662_10221508
1189 Ga0207657_10091569
1190 Ga0207657_10168929
1191 Ga0207649_10000444
1192 Ga0207649_10074284
1193 Ga0207649_10100090
1194 Ga0207652_10188151
1195 Ga0207646_10214716
1196 Ga0207681_10000096
1197 Ga0207681_10000112
1198 Ga0207681_10021738
1199 Ga0207681_10323687
1200 Ga0207694_10004187
1201 Ga0207694_10198752
1202 Ga0207687_10019713
1203 Ga0207687_10051601
1204 Ga0207700_10023911
1205 Ga0207664_10286062
1206 Ga0207664_10878560
1207 Ga0207644_10000008
1208 Ga0207644_10009210
1209 Ga0207644_10014179
1210 Ga0207644_10351399
1211 Ga0207690_10011704
1212 Ga0207706_10109808
1213 Ga0207706_10123536
1214 Ga0207706_10278816
1215 Ga0207706_10298024
1216 Ga0207686_10076118
1217 Ga0207686_10127490
1218 Ga0207709_10252546
1219 Ga0207670_10006506
1220 Ga0207670_10061467
1221 Ga0207704_10249315
1222 Ga0207665_10370326
1223 Ga0207691_10042109
1224 Ga0207691_10429741
1225 Ga0207711_10020384
1226 Ga0207711_10056159
1227 Ga0207711_10165981
1228 Ga0207689_10072495
1229 Ga0207661_10174628
1230 Ga0207661_10349253
1231 Ga0207679_10029237
1232 Ga0207679_10191126
1233 Ga0207667_10007324
1234 Ga0207667_10012362
1235 Ga0207667_10022285
1236 Ga0207667_10042471
1237 Ga0207667_10074478
1238 Ga0207651_10109481
1239 Ga0207712_10000002
1240 Ga0207712_10000013
1241 Ga0207712_10079828
1242 Ga0207668_10007115
1243 Ga0207668_10066392
1244 Ga0207668_10096978
1245 Ga0207640_10063192
1246 Ga0207640_10215809
1247 Ga0207640_10591692
1248 Ga0207658_10000689
1249 Ga0207658_10102311
1250 Ga0207658_10163505
1251 Ga0207703_10001006
1252 Ga0207703_10009748
1253 Ga0207703_10013788
1254 Ga0207703_10136533
1255 Ga0207639_10043651
1256 Ga0207639_10261723
1257 Ga0207639_10616822
1258 Ga0207678_10320833
1259 Ga0207708_10036299
1260 Ga0207708_10043986
1261 Ga0207702_10007648
1262 Ga0207702_10307501
1263 Ga0207641_10000101
1264 Ga0207641_10003069
1265 Ga0207676_10001834
1266 Ga0207674_10030099
1267 Ga0207674_10039328
1268 Ga0207674_10231985
1269 Ga0207674_10445601
1270 Ga0207674_10581922
1271 Ga0207675_100011489
1272 Ga0207675_100118534
1273 Ga0207683_10095843
1274 Ga0207683_10148744
1275 Ga0207698_10001849
1276 Ga0207698_10013844
1277 Ga0207698_10038387
1278 Ga0268266_10000025
1279 Ga0268266_10000626
1280 Ga0268266_10108335
1281 Ga0268266_10137786
1282 Ga0268266_10942846
1283 Ga0268265_10000048
1284 Ga0268265_10000316
1285 Ga0268265_10000975
1286 Ga0268264_10000037
1287 Ga0268264_10000439
1288 Ga0268264_10161279
1289 Ga0265760_10026725
1290 Ga0265328_10070937
1291 Ga0265329_10046276
1292 Ga0265340_10022791
1293 Ga0265340_10029387
1294 Ga0265339_10058674
1295 Ga0265339_10195298
1296 Ga0265331_10002807
1297 Ga0265331_10019075
1298 Ga0307513_10494841
1299 Ga0265313_10000021
1300 Ga0316575_10106133
1301 Ga0316579_10153587
1302 Ga0265314_10000279
1303 Ga0265314_10025954
1304 Ga0265314_10058157
1305 Ga0265342_10009824
1306 Ga0265342_10065920
1307 Ga0316578_10038730
1308 Ga0307405_10555396
1309 Ga0307413_10220122
1310 Ga0307412_10144788
1311 Ga0307412_10225018
1312 Ga0307412_10302574
1313 Ga0307409_100079291
1314 Ga0307414_10057088
1315 Ga0307414_10071542
1316 Ga0307414_10229974
1317 Ga0307411_10563347
1318 Ga0307415_100252775
1319 Ga0316583_10001287
1320 Ga0316593_10033295
1321 Ga0307510_10000248
1322 Ga0316592_1012612
1323 Ga0316592_1056016
1324 Ga0373930_0035672
1325 Ga0373958_0024349
1326 Ga0373959_0045163
1327 Ga0373938_0090185
1328 Ga0373926_0005063
1329 Ga0373926_0008334
1330 Ga0373929_0012346
1331 Ga0373940_0080405
1332 Ga0373944_0002213
1333 Ga0373923_0041409
1334 Ga0373923_0050859
1335 Ga0373923_0085332
1336 Ga0373932_0151554
1337 Ga0373936_0067593
1338 Ga0373941_0090086
1339 Ga0373945_0012237
1340 Ga0373953_0213947
1341 Ga0373954_0039018
1342 Ga0373954_0127770
1343 Ga0373957_0204054
1344 Ga0373943_0000038
1345 Ga0373943_0006907
1346 Ga0373943_0084078
1347 Ga0373946_0003198
1348 Ga0373955_0045922
1349 Ga0373955_0173865
1350 Ga0373942_0052239
1351 Ga0373961_0028678
1352 Ga0316574_0473080
1353 Ga0373924_0043034
1354 Ga0373931_0197657
1355 Ga0373931_0381779
1356 Ga0373931_0393176
1357 Ga0373935_0274025
1358 Ga0373935_0297920
1359 Ga0373927_0000651
1360 Ga0373927_0025823
1361 Ga0373927_0230645
1362 Ga0373927_0263089
1363 Ga0373933_0024606
1364 Ga0373947_0000024
1365 Ga0373947_0013366
1366 Ga0373947_0091793
1367 Ga0373947_0094215
1368 Ga0373947_0131845
1369 Ga0373937_0005793
1370 Ga0373937_0020159
1371 Ga0373937_0580248
1372 Ga0316582_0018667
1373 Ga0316584_0007550
1374 Ga0373925_0018395
1375 Ga0373925_0153430
1376 Ga0373925_0491408
1377 Ga0395899_0000137
1378 Ga0395899_0125111
1379 Ga0395900_0000108
1380 Ga0395900_0018679
1381 Ga0395900_0032943
1382 Ga0395900_0034968
1383 Ga0395900_0043072
1384 Ga0395900_0045893
1385 Ga0395900_0170835
1386 Ga0395898_0000632
1387 Ga0395898_0024358
1388 Ga0395898_0044477
1389 Ga0395898_0053895
1390 Ga0395905_0000780
1391 Ga0395905_0096596
1392 Ga0436364_0013094
1393 Ga0436364_0195157
1394 Ga0436364_0526272
1395 Ga0436364_1108265
1396 Ga0395901_0000050
1397 Ga0395901_0000086
1398 Ga0395901_0026198
1399 Ga0395901_0051291
1400 Ga0395901_0244060
1401 Ga0395901_0390029
1402 Ga0395901_0485823
1403 Ga0400483_136809
1404 Ga0400483_206045
1405 Ga0436365_1896329
1406 Ga0436360_0048356
1407 Ga0436360_1007073
1408 Ga0436361_0009329
1409 Ga0436361_0194635
1410 Ga0436361_0231853
1411 Ga0436361_0770494
1412 Ga0436363_0211911
1413 Ga0436363_0576058
1414 Ga0439448_0027222
1415 Ga0439448_0160677
1416 Ga0439456_017035
1417 Ga0453683_0002196
1418 Ga0466966_0020726
1419 Ga0466961_0012256
1420 Ga0466963_0034953
1421 Ga0466963_0068019
1422 Ga0453684_0028704
1423 Ga0453684_0105894
1424 Ga0453684_0494753
1425 Ga0453684_0870126
1426 Ga0466971_0017973
1427 Ga0466970_0009668
1428 Ga0466957_0055470
1429 Ga0466960_0134560
1430 Ga0466959_0008062
1431 Ga0451576_0001224
1432 Ga0451576_0004466
1433 Ga0451576_0012315
1434 Ga0451576_0156267
1435 Ga0451576_0186575
1436 Ga0466958_0002196
1437 Ga0466967_0032500
1438 Ga0466967_0438975
1439 Ga0495592_0008885
1440 Ga0495603_0022743
1441 Ga0495603_0098291
1442 Ga0495629_0001636
1443 Ga0495629_0015778
1444 Ga0495629_0412197
1445 Ga0495629_0431396
1446 Ga0495638_0001117
1447 Ga0495638_0064102
1448 Ga0495641_0037738
1449 Ga0495651_0000860
1450 Ga0495651_0085272
1451 Ga0495653_0002396
1452 Ga0495580_0082128
1453 Ga0495582_0127994
1454 Ga0495639_0029254
1455 Ga0495662_0041905
1456 Ga0495662_0215780
1457 Ga0495664_0014194
1458 Ga0495664_0231080
1459 Ga0495584_0054269
1460 Ga0495584_0182285
1461 Ga0495585_0011012
1462 Ga0495594_0005510
1463 Ga0495607_0004756
1464 Ga0495608_0002790
1465 Ga0495608_0093221
1466 Ga0495620_0122087
1467 Ga0495628_0016517
1468 Ga0495628_0322965
1469 Ga0495628_0341313
1470 Ga0495628_0690018
1471 Ga0495630_0102927
1472 Ga0495630_0121908
1473 Ga0495630_0264974
1474 Ga0495637_0016075
1475 Ga0495637_0043659
1476 Ga0495643_0080976
1477 Ga0495644_0003154
1478 Ga0495644_0097544
1479 Ga0495648_0075932
1480 Ga0495666_0020658
1481 Ga0495666_0174480
1482 Ga0495652_0009824
1483 Ga0495652_0062137
1484 Ga0495652_0381484
1485 Ga0495665_0013078
1486 Ga0495665_0026036
1487 Ga0495640_0027323
1488 Ga0495640_0039590
1489 Ga0495640_0085978
1490 Ga0495587_0005187
1491 Ga0495645_0290115
1492 Ga0495667_0001836
1493 Ga0495667_0263455
1494 Ga0495667_0354623
1495 Ga0495656_0005971
1496 Ga0495634_0016406
1497 Ga0495625_0070430
1498 Ga0495625_0200594
1499 Ga0495635_0008770
1500 Ga0495635_0241348
1501 Ga0495635_0388504
1502 Ga0495657_0198990
1503 Ga0495599_0004247
1504 Ga0495623_0002702
1505 Ga0495646_0003305
1506 Ga0495647_0002950
1507 Ga0495647_0018044
1508 Ga0495658_0014556
1509 Ga0495613_0074116
1510 Ga0495613_0157226
1511 Ga0495624_0004781
1512 Ga0495624_0086224
1513 Ga0495670_0001709
1514 Ga0495670_0008540
1515 Ga0495670_0084260
1516 Ga0495600_0157468
1517 Ga0495600_0309258
1518 Ga0495581_0013861
1519 Ga0495581_0101832
1520 Ga0495581_0158978
1521 Ga0495604_0001315
1522 Ga0495604_0093810
1523 Ga0495674_0000145
1524 Ga0495674_0106941
1525 Ga0495672_0111331
1526 Ga0495676_0015903
1527 Ga0495676_0113249
1528 Ga0495676_0130375
1529 Ga0495676_0202922
1530 Ga0495680_0003388
1531 Ga0495680_0145384
1532 Ga0495675_0003692
1533 Ga0495675_0388210
1534 Ga0495677_0019390
1535 Ga0495684_0000209
1536 Ga0495684_0022282
1537 Ga0495684_0114332
1538 Ga0495684_0218547
1539 Ga0495602_0010058
1540 Ga0495602_0357651
1541 Ga0496100_0039775
1542 Ga0496100_0049795
1543 Ga0496100_0117889
1544 Ga0496100_0373458
1545 Ga0496100_0451373
1546 Ga0496101_0003779
1547 Ga0496101_0031548
1548 Ga0496101_0371114
1549 Ga0496102_0012833
1550 Ga0496102_0017546
1551 Ga0496102_0143856
1552 Ga0496102_0169470
1553 Ga0496102_0200919
1554 Ga0496102_0593267
1555 Ga0496103_0003334
1556 Ga0496104_0002148
1557 Ga0496104_0003136
1558 Ga0496104_0009810
1559 Ga0496104_0026954
1560 Ga0496104_0042587
1561 Ga0496104_0055314
1562 Ga0496104_0104710
1563 Ga0496104_0106466
1564 Ga0496104_0232421
1565 Ga0496105_0000882
1566 Ga0496105_0012680
1567 Ga0496105_0013528
1568 Ga0496105_0017190
1569 Ga0496105_0029423
1570 Ga0496105_0043061
1571 Ga0496105_0309730
1572 Ga0496105_0421979
1573 Ga0496106_0002149
1574 Ga0496106_0002837
1575 Ga0496106_0095642
1576 Ga0496106_0193717
1577 Ga0496107_0005939
1578 Ga0496107_0010755
1579 Ga0496107_0011930
1580 Ga0496107_0033374
1581 Ga0496108_0006835
1582 Ga0496108_0011301
1583 Ga0496108_0049348
1584 Ga0496109_0005176
1585 Ga0496109_0017543
1586 Ga0496109_0022885
1587 Ga0496109_0119498
1588 Ga0496109_0128459
1589 Ga0496109_0162856
1590 Ga0496110_0004030
1591 Ga0496110_0013474
1592 Ga0496110_0034708
1593 Ga0496110_0098102
1594 Ga0496110_0187090
1595 Ga0496110_0221215
1596 Ga0496111_0010614
1597 Ga0496111_0017179
1598 Ga0496111_0175123
1599 Ga0496111_0206854
1600 Ga0496111_0273777
1601 Ga0496111_0468431
1602 Ga0496112_0002737
1603 Ga0496112_0008660
1604 Ga0496112_0034196
1605 Ga0496112_0057103
1606 Ga0496112_0072266
1607 Ga0496112_0093100
1608 Ga0496112_0098327
1609 Ga0496112_0157400
1610 Ga0496112_0285303
1611 Ga0496112_0327421
1612 Ga0496113_0003871
1613 Ga0496113_0009682
1614 Ga0496113_0055224
1615 Ga0496113_0406263
1616 Ga0496113_0414392
1617 Ga0496113_0486196
1618 Ga0496114_0245324
1619 Ga0496114_0299955
1620 Ga0496115_0001345
1621 Ga0496115_0065665
1622 Ga0496115_0198692
1623 Ga0496115_0212947
1624 Ga0496115_0434223
1625 Ga0496117_0037727
1626 Ga0496118_0078175
1627 Ga0496125_0205690
1628 Ga0496126_0001890
1629 Ga0496126_0517092
1630 Ga0501290_000271
1631 Ga0501292_000003
1632 Ga0501294_000455
1633 Ga0501300_000439
1634 Ga0501032_0004263
1635 Ga0501032_0021362
1636 Ga0501032_0091875
1637 Ga0501032_0099781
1638 Ga0501032_0106862
1639 Ga0501032_0140434
1640 Ga0501032_0341181
1641 Ga0501032_0493815
1642 Ga0501033_0033047
1643 Ga0501033_0043744
1644 Ga0501033_0086125
1645 Ga0501033_0110581
1646 Ga0501033_0216789
1647 Ga0501033_0258270
1648 Ga0501034_0001899
1649 Ga0501034_0024465
1650 Ga0501034_0025674
1651 Ga0501034_0045159
1652 Ga0501034_0052705
1653 Ga0501034_0081133
1654 Ga0501034_0093965
1655 Ga0501034_0143844
1656 Ga0501034_0243790
1657 Ga0501034_0571233
1658 Ga0501036_0003218
1659 Ga0501036_0020141
1660 Ga0501036_0067993
1661 Ga0501036_0075584
1662 Ga0501036_0247731
1663 Ga0501036_0648907
1664 Ga0501037_0229598
1665 Ga0501037_0238688
1666 Ga0501038_0050512
1667 Ga0501038_0061324
1668 Ga0501038_0100002
1669 Ga0501038_0129631
1670 Ga0501038_0153588
1671 Ga0501038_0536318
1672 Ga0501038_0566408
1673 Ga0501039_0120913
1674 Ga0501039_0138114
1675 Ga0501040_0027148
1676 Ga0501042_0018714
1677 Ga0501042_0052098
1678 Ga0501042_0176734
1679 Ga0501042_0251988
1680 Ga0501043_0000380
1681 Ga0501043_0021924
1682 Ga0501043_0030658
1683 Ga0501043_0059130
1684 Ga0501043_0085612
1685 Ga0501043_0223860
1686 Ga0501043_0291908
1687 Ga0501046_0010856
1688 Ga0501046_0011538
1689 Ga0501046_0012127
1690 Ga0501046_0266618
1691 Ga0501046_0296737
1692 Ga0501047_0007528
1693 Ga0501047_0018522
1694 Ga0501047_0020095
1695 Ga0501047_0045295
1696 Ga0501047_0091556
1697 Ga0501047_0115158
1698 Ga0501047_0133669
1699 Ga0501047_0245573
1700 Ga0501047_0304642
1701 Ga0501047_0465015
1702 Ga0501048_0000424
1703 Ga0501048_0037378
1704 Ga0501048_0241404
1705 Ga0501067_0000224
1706 Ga0501067_0003270
1707 Ga0501067_0234834
1708 Ga0501068_0006315
1709 Ga0501069_0000251
1710 Ga0501069_0034265
1711 Ga0501069_0080190
1712 Ga0501069_0336743
1713 Ga0501070_0003929
1714 Ga0501070_0007814
1715 Ga0501070_0009582
1716 Ga0501070_0035482
1717 Ga0501070_0077965
1718 Ga0501070_0194580
1719 Ga0501070_0574693
1720 Ga0501071_0024156
1721 Ga0501071_0087704
1722 Ga0501071_0281177
1723 Ga0501072_0379588
1724 Ga0501073_0005963
1725 Ga0501073_0011271
1726 Ga0501073_0035524
1727 Ga0501073_0049686
1728 Ga0501073_0111398
1729 Ga0501073_0161388
1730 Ga0501073_0194619
1731 Ga0501073_0363937
1732 Ga0501074_0006850
1733 Ga0501074_0015486
1734 Ga0501074_0082702
1735 Ga0501074_0104132
1736 Ga0501074_0359330
1737 Ga0501076_0347310
1738 Ga0501077_0139924
1739 Ga0501206_004121
1740 Ga0501222_000807
1741 Ga0501223_000796
1742 Ga0501224_001001
1743 Ga0501227_001098
1744 Ga0501252_008839
1745 Ga0501257_020712
1746 Ga0501259_000913
1747 Ga0501261_000066
1748 Ga0501225_0016325
1749 Ga0501079_0096855
1750 Ga0501079_0377315
1751 Ga0501079_0633420
1752 Ga0501080_0000112
1753 Ga0501080_0003244
1754 Ga0501080_0018241
1755 Ga0501080_0056888
1756 Ga0501080_0130513
1757 Ga0501080_0225582
1758 Ga0501083_0007146
1759 Ga0501083_0010656
1760 Ga0501083_0046768
1761 Ga0501083_0068040
1762 Ga0501083_0173071
1763 Ga0501241_051067
1764 Ga0501279_000040
1765 Ga0501280_000144
1766 Ga0501281_00385
1767 Ga0501282_000071
1768 Ga0501035_0014537
1769 Ga0501035_0025766
1770 Ga0501035_0027254
1771 Ga0501035_0029360
1772 Ga0501035_0351949
1773 Ga0501044_0000658
1774 Ga0501044_0003453
1775 Ga0501044_0020081
1776 Ga0501044_0025440
1777 Ga0501044_0057121
1778 Ga0501044_0062271
1779 Ga0501044_0068185
1780 Ga0501044_0193914
1781 Ga0501044_0217258
1782 Ga0501044_0279089
1783 Ga0501044_0751910
1784 Ga0501045_0056418
1785 Ga0501045_0093089
1786 nmdc:mga03683_27069_c1
1787 nmdc:mga00v17_385813_c1
1788 nmdc:mga0yw44_30437_c1
1789 nmdc:mga0k408_2287_c1
1790 nmdc:mga0k408_95314_c1
1791 nmdc:mga05p37_43907_c1
1792 nmdc:mga05p37_751430_c1
1793 nmdc:mga09592_503163_c1
1794 nmdc:mga06r32_207952_c1
1795 nmdc:mga06r32_213150_c1
1796 nmdc:mga08y16_303449_c1
1797 nmdc:mga08y16_44774_c1
1798 nmdc:mga08y16_636227_c1
1799 nmdc:mga0n895_125963_c1
1800 nmdc:mga0n895_2174_c1
1801 nmdc:mga0n895_72521_c1
1802 nmdc:mga0rr50_19771_c1
1803 nmdc:mga08x19_59086_c1
1804 nmdc:mga0a205_325893_c1
1805 nmdc:mga0a205_62019_c1
1806 Ga0495601_0000947
1807 Ga0495601_0015896
1808 Ga0495601_0028555
1809 Ga0495601_0031852
1810 Ga0495612_0000797
1811 Ga0495612_0004285
1812 Ga0495612_0059162
1813 Ga0495612_0092251
1814 Ga0495655_0017666
1815 Ga0495595_0001078
1816 Ga0495595_0035101
1817 Ga0495595_0173151
1818 Ga0495595_0285484
1819 Ga0495619_0001656
1820 Ga0495619_0030530
1821 Ga0500643_019996
1822 Ga0500647_0131142
1823 Ga0500555_044219
1824 Ga0500556_0017319
1825 Ga0500556_0117629
1826 Ga0500642_0086461
1827 Ga0500655_000033
1828 Ga0500658_0002175
1829 Ga0500568_0000406
1830 Ga0500590_013244
1831 Ga0500604_0000583
1832 Ga0500616_0000084
1833 Ga0500616_0000161
1834 Ga0500616_0000805
1835 Ga0500616_0011661
1836 Ga0500616_0231333
1837 Ga0500587_000809
1838 Ga0501084_0004384
1839 Ga0501084_0076860
1840 Ga0501084_0090968
1841 Ga0501084_0094190
1842 Ga0501084_0114033
1843 Ga0501082_0006226
1844 Ga0501082_0011332
1845 Ga0501082_0111262
1846 Ga0501082_0128860
1847 Ga0501082_0384604
1848 Ga0501082_0503484
1849 Ga0530510_0097350
1850 2508735756
1851 2617913383
1852 2643755515
1853 2738946168
1854 2776259030
1855 2831428310
1856 2835313563
1857 2848698472
1858 2849666178
1859 2882461521
1860 2884299721
1861 2886633913
1862 2894240136
1863 2913311247
1864 2913845598
1865 2913917531
1866 2913941558
1867 2919455263
1868 642600782

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

46

241

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9789 5 218
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9743 4 218
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.974 4 220
1tqj-assembly1.cif.gz_F crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9711 4 218
3inp-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. 0.9707 5 218
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9791 3 218 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9725 4 218 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9698 4 220 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9695 5 218 3.20.20.70
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9569 3 218 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W6EV29-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9929 5 219 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A162JL25-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.991 1 218 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A844ZET1-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9909 5 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1I4C0L9-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9896 3 218 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A382V2T8-F1-model_v4 ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9891 3 199 GO:0004750
GO:0005975
GO:0006098

Map