F486127
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 934 | 431 | 1868 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10083949|Ga0316576_100839491 |
| Length | 273 |
| Sequence | VQGTQNTILHMGCAEPLCTGAGALPVSASRDTERKTDILAMTFPLRIAPSILSADFARLGEEVRAVDAAGADWIHVDVMDGHFVPNITIGPDVVKALRPHSPKPFDVHLMIAPCDPYLEAFAKAGADIITVHVEAGPHLHRSLQAIRALGKRAGVTLNPGTPVSTIEPVIDMVDLILVMSVNPGFGGQQFITAALDKITRLRALAAGRPIEIEIDGGINPEIAPLVARAGANVLVAGNAVFKAGGAEGGGTEAYARNITAIRDAAAMARGEVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 185 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 197 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 199 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 202 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 203 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 230 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 244 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 245 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 334 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 335 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 336 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 361 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 362 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 366 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 367 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 368 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 369 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 374 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 375 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 376 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 377 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 382 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 385 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 399 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 400 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 401 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 403 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 406 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 407 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 408 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 410 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 413 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 414 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 415 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 416 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 417 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 418 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 419 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 420 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 421 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 422 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 423 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 424 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 425 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 426 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 427 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 428 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 429 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 430 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 431 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.43 |
| Metatranscriptomes | 0.54 |
| Isolates | 2.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.1 |
| Nodule | 0.32 |
| Rhizoplane | 8.99 |
| Rhizosphere | 84.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316576_10083949 | 3300031727 | Bacteria | 2367 |
| 2 | JGI24752J21851_1000198 | 3300001976 | Bacteria | 8365 |
| 3 | JGI24740J21852_10005460 | 3300001979 | Bacteria | 5373 |
| 4 | JGI24740J21852_10018622 | 3300001979 | Bacteria | 2457 |
| 5 | JGI24739J22299_10006428 | 3300001989 | Bacteria | 4438 |
| 6 | JGI24737J22298_10033317 | 3300001990 | Bacteria | 1601 |
| 7 | JGI24735J21928_10005974 | 3300002067 | Bacteria | 4021 |
| 8 | JGI24735J21928_10007291 | 3300002067 | Bacteria | 3609 |
| 9 | JGI24750J21931_1002769 | 3300002070 | Bacteria | 2106 |
| 10 | JGI24748J21848_1000042 | 3300002074 | Bacteria | 62376 |
| 11 | JGI24749J21850_1020066 | 3300002076 | Bacteria | 944 |
| 12 | JGI24034J26672_10000035 | 3300002239 | Bacteria | 85548 |
| 13 | JGI24742J22300_10031650 | 3300002244 | Bacteria | 926 |
| 14 | Ga0055540_1006853 | 3300003792 | Bacteria | 4430 |
| 15 | Ga0058859_11244916 | 3300004798 | Bacteria | 864 |
| 16 | Ga0070658_10339213 | 3300005327 | Bacteria | 1285 |
| 17 | Ga0070690_100000009 | 3300005330 | Bacteria | 112447 |
| 18 | Ga0070690_100040895 | 3300005330 | Bacteria | 2934 |
| 19 | Ga0070670_100287174 | 3300005331 | Bacteria | 1437 |
| 20 | Ga0070677_10000155 | 3300005333 | Bacteria | 23197 |
| 21 | Ga0070666_10000006 | 3300005335 | Bacteria | 319173 |
| 22 | Ga0070666_10001803 | 3300005335 | Bacteria | 13038 |
| 23 | Ga0070680_100001660 | 3300005336 | Bacteria | 16265 |
| 24 | Ga0070680_100110382 | 3300005336 | Bacteria | 2289 |
| 25 | Ga0070680_100168740 | 3300005336 | Bacteria | 1841 |
| 26 | Ga0070682_100094964 | 3300005337 | Bacteria | 1957 |
| 27 | Ga0070660_100000064 | 3300005339 | Bacteria | 62554 |
| 28 | Ga0070660_100047236 | 3300005339 | Bacteria | 3302 |
| 29 | Ga0070660_100109866 | 3300005339 | Bacteria | 2193 |
| 30 | Ga0070660_100276101 | 3300005339 | Bacteria | 1374 |
| 31 | Ga0070660_100307567 | 3300005339 | Bacteria | 1300 |
| 32 | Ga0070660_100412668 | 3300005339 | Bacteria | 1117 |
| 33 | Ga0070689_100012742 | 3300005340 | Bacteria | 6069 |
| 34 | Ga0070689_100179282 | 3300005340 | Bacteria | 1720 |
| 35 | Ga0070691_10016128 | 3300005341 | Bacteria | 3433 |
| 36 | Ga0070687_100071737 | 3300005343 | Bacteria | 1862 |
| 37 | Ga0070687_100225626 | 3300005343 | Bacteria | 1150 |
| 38 | Ga0070661_100004993 | 3300005344 | Bacteria | 9138 |
| 39 | Ga0070668_100000539 | 3300005347 | Bacteria | 25247 |
| 40 | Ga0070668_100036683 | 3300005347 | Bacteria | 3742 |
| 41 | Ga0070668_100083683 | 3300005347 | Bacteria | 2505 |
| 42 | Ga0070668_100397584 | 3300005347 | Bacteria | 1176 |
| 43 | Ga0070669_100000095 | 3300005353 | Bacteria | 86930 |
| 44 | Ga0070669_100000280 | 3300005353 | Bacteria | 40554 |
| 45 | Ga0070675_100061783 | 3300005354 | Bacteria | 3094 |
| 46 | Ga0070675_100310794 | 3300005354 | Bacteria | 1390 |
| 47 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 48 | Ga0070671_100067244 | 3300005355 | Bacteria | 2988 |
| 49 | Ga0070671_100186306 | 3300005355 | Bacteria | 1758 |
| 50 | Ga0070674_100016308 | 3300005356 | Bacteria | 4656 |
| 51 | Ga0070673_100083073 | 3300005364 | Bacteria | 2601 |
| 52 | Ga0070688_100004996 | 3300005365 | Bacteria | 6945 |
| 53 | Ga0070688_100045907 | 3300005365 | Bacteria | 2703 |
| 54 | Ga0070659_100017634 | 3300005366 | Bacteria | 5378 |
| 55 | Ga0070659_100132082 | 3300005366 | Bacteria | 2028 |
| 56 | Ga0070659_100209567 | 3300005366 | Bacteria | 1606 |
| 57 | Ga0070667_100021629 | 3300005367 | Bacteria | 5338 |
| 58 | Ga0070667_100207098 | 3300005367 | Bacteria | 1742 |
| 59 | Ga0070714_100432594 | 3300005435 | Bacteria | 1248 |
| 60 | Ga0070713_100368594 | 3300005436 | Bacteria | 1336 |
| 61 | Ga0070710_10187201 | 3300005437 | Bacteria | 1300 |
| 62 | Ga0070700_100025794 | 3300005441 | Bacteria | 3464 |
| 63 | Ga0070694_100187145 | 3300005444 | Bacteria | 1535 |
| 64 | Ga0070708_100021449 | 3300005445 | Bacteria | 5462 |
| 65 | Ga0070663_100050356 | 3300005455 | Bacteria | 2962 |
| 66 | Ga0070663_100645155 | 3300005455 | Bacteria | 895 |
| 67 | Ga0070678_100049859 | 3300005456 | Bacteria | 3024 |
| 68 | Ga0070662_100251530 | 3300005457 | Bacteria | 1421 |
| 69 | Ga0070681_10013407 | 3300005458 | Bacteria | 8143 |
| 70 | Ga0070681_10024397 | 3300005458 | Bacteria | 6088 |
| 71 | Ga0070681_10046789 | 3300005458 | Bacteria | 4324 |
| 72 | Ga0070681_10167330 | 3300005458 | Bacteria | 2121 |
| 73 | Ga0070681_10194105 | 3300005458 | Bacteria | 1949 |
| 74 | Ga0070681_10199336 | 3300005458 | Bacteria | 1920 |
| 75 | Ga0070681_10272796 | 3300005458 | Bacteria | 1603 |
| 76 | Ga0070681_10506439 | 3300005458 | Bacteria | 1120 |
| 77 | Ga0070685_10000155 | 3300005466 | Bacteria | 45505 |
| 78 | Ga0070707_100136600 | 3300005468 | Bacteria | 2385 |
| 79 | Ga0070707_100332576 | 3300005468 | Bacteria | 1476 |
| 80 | Ga0070698_100003881 | 3300005471 | Bacteria | 16433 |
| 81 | Ga0070699_100082691 | 3300005518 | Bacteria | 2799 |
| 82 | Ga0070679_100108824 | 3300005530 | Bacteria | 2758 |
| 83 | Ga0070679_100165670 | 3300005530 | Bacteria | 2183 |
| 84 | Ga0070679_100245169 | 3300005530 | Bacteria | 1749 |
| 85 | Ga0070684_100153420 | 3300005535 | Bacteria | 2088 |
| 86 | Ga0070697_100298596 | 3300005536 | Bacteria | 1384 |
| 87 | Ga0068853_100784584 | 3300005539 | Bacteria | 912 |
| 88 | Ga0070686_100000091 | 3300005544 | Bacteria | 63232 |
| 89 | Ga0070665_100000019 | 3300005548 | Bacteria | 413972 |
| 90 | Ga0070665_100000148 | 3300005548 | Bacteria | 128573 |
| 91 | Ga0070665_100043313 | 3300005548 | Bacteria | 4523 |
| 92 | Ga0070665_100189335 | 3300005548 | Bacteria | 2059 |
| 93 | Ga0068855_100016827 | 3300005563 | Bacteria | 8794 |
| 94 | Ga0068855_100022850 | 3300005563 | Bacteria | 7496 |
| 95 | Ga0068855_100938848 | 3300005563 | Bacteria | 912 |
| 96 | Ga0070664_100016307 | 3300005564 | Bacteria | 6089 |
| 97 | Ga0070664_100486215 | 3300005564 | Bacteria | 1136 |
| 98 | Ga0068854_100459371 | 3300005578 | Bacteria | 1065 |
| 99 | Ga0068854_100504303 | 3300005578 | Bacteria | 1019 |
| 100 | Ga0068856_100490559 | 3300005614 | Bacteria | 1249 |
| 101 | Ga0068852_100007430 | 3300005616 | Bacteria | 7998 |
| 102 | Ga0068852_100042768 | 3300005616 | Bacteria | 3838 |
| 103 | Ga0068852_100092276 | 3300005616 | Bacteria | 2711 |
| 104 | Ga0068852_100639984 | 3300005616 | Bacteria | 1070 |
| 105 | Ga0068859_100022381 | 3300005617 | Bacteria | 6336 |
| 106 | Ga0068859_100213616 | 3300005617 | Bacteria | 2016 |
| 107 | Ga0068861_100012358 | 3300005719 | Bacteria | 5953 |
| 108 | Ga0068851_10077419 | 3300005834 | Bacteria | 1731 |
| 109 | Ga0068863_100000118 | 3300005841 | Bacteria | 82651 |
| 110 | Ga0068863_100014260 | 3300005841 | Bacteria | 7657 |
| 111 | Ga0068863_100316090 | 3300005841 | Bacteria | 1516 |
| 112 | Ga0068863_100523847 | 3300005841 | Bacteria | 1169 |
| 113 | Ga0068858_100000723 | 3300005842 | Bacteria | 34436 |
| 114 | Ga0068858_100002727 | 3300005842 | Bacteria | 17774 |
| 115 | Ga0068858_100005339 | 3300005842 | Bacteria | 12606 |
| 116 | Ga0068860_100000014 | 3300005843 | Bacteria | 319437 |
| 117 | Ga0068860_100001093 | 3300005843 | Bacteria | 29849 |
| 118 | Ga0068860_100134992 | 3300005843 | Bacteria | 2369 |
| 119 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 120 | Ga0068862_100000503 | 3300005844 | Bacteria | 41613 |
| 121 | Ga0068862_100001001 | 3300005844 | Bacteria | 27048 |
| 122 | Ga0081455_10002509 | 3300005937 | Bacteria | 21784 |
| 123 | Ga0081455_10064681 | 3300005937 | Bacteria | 3062 |
| 124 | Ga0081538_10068599 | 3300005981 | Bacteria | 1970 |
| 125 | Ga0081540_1014204 | 3300005983 | Bacteria | 5119 |
| 126 | Ga0081539_10014301 | 3300005985 | Bacteria | 5883 |
| 127 | Ga0070717_10854828 | 3300006028 | Bacteria | 828 |
| 128 | Ga0075365_10015277 | 3300006038 | Bacteria | 4640 |
| 129 | Ga0070712_100001034 | 3300006175 | Bacteria | 16789 |
| 130 | Ga0070712_100511112 | 3300006175 | Bacteria | 1008 |
| 131 | Ga0075367_10178454 | 3300006178 | Bacteria | 1324 |
| 132 | Ga0075367_10298417 | 3300006178 | Bacteria | 1014 |
| 133 | Ga0075366_10003290 | 3300006195 | Bacteria | 8495 |
| 134 | Ga0075366_10019985 | 3300006195 | Bacteria | 3882 |
| 135 | Ga0068871_100359928 | 3300006358 | Bacteria | 1289 |
| 136 | Ga0075428_100205281 | 3300006844 | Bacteria | 2130 |
| 137 | Ga0075428_100311554 | 3300006844 | Bacteria | 1692 |
| 138 | Ga0075431_100020447 | 3300006847 | Bacteria | 6762 |
| 139 | Ga0075431_100058054 | 3300006847 | Bacteria | 3991 |
| 140 | Ga0075433_10052600 | 3300006852 | Bacteria | 3549 |
| 141 | Ga0075433_10124576 | 3300006852 | Bacteria | 2289 |
| 142 | Ga0075434_100000986 | 3300006871 | Bacteria | 23010 |
| 143 | Ga0075434_100074790 | 3300006871 | Bacteria | 3381 |
| 144 | Ga0075434_100465951 | 3300006871 | Bacteria | 1285 |
| 145 | Ga0075429_100057848 | 3300006880 | Bacteria | 3376 |
| 146 | Ga0075436_100065280 | 3300006914 | Bacteria | 2516 |
| 147 | Ga0097620_100022380 | 3300006931 | Bacteria | 6336 |
| 148 | Ga0097620_100213618 | 3300006931 | Bacteria | 2016 |
| 149 | Ga0075435_100036045 | 3300007076 | Bacteria | 3929 |
| 150 | Ga0075435_100345783 | 3300007076 | Bacteria | 1274 |
| 151 | Ga0105240_10295843 | 3300009093 | Bacteria | 1854 |
| 152 | Ga0105240_10597732 | 3300009093 | Bacteria | 1215 |
| 153 | Ga0105240_10678746 | 3300009093 | Bacteria | 1127 |
| 154 | Ga0111539_10335230 | 3300009094 | Bacteria | 1761 |
| 155 | Ga0111539_10422510 | 3300009094 | Bacteria | 1552 |
| 156 | Ga0105245_10133351 | 3300009098 | Bacteria | 2332 |
| 157 | Ga0105247_10000830 | 3300009101 | Bacteria | 23517 |
| 158 | Ga0105247_10039951 | 3300009101 | Bacteria | 2867 |
| 159 | Ga0105247_10093791 | 3300009101 | Bacteria | 1909 |
| 160 | Ga0105247_10115726 | 3300009101 | Bacteria | 1731 |
| 161 | Ga0105247_10151643 | 3300009101 | Bacteria | 1528 |
| 162 | Ga0114129_10054562 | 3300009147 | Bacteria | 5603 |
| 163 | Ga0114129_11134092 | 3300009147 | Bacteria | 977 |
| 164 | Ga0105243_10138496 | 3300009148 | Bacteria | 2073 |
| 165 | Ga0105242_10096458 | 3300009176 | Bacteria | 2498 |
| 166 | Ga0105248_10028861 | 3300009177 | Bacteria | 6184 |
| 167 | Ga0105248_10056676 | 3300009177 | Bacteria | 4396 |
| 168 | Ga0105237_10047573 | 3300009545 | Bacteria | 4312 |
| 169 | Ga0105237_10078994 | 3300009545 | Bacteria | 3280 |
| 170 | Ga0105238_10416014 | 3300009551 | Bacteria | 1338 |
| 171 | Ga0105238_10454160 | 3300009551 | Bacteria | 1278 |
| 172 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 173 | Ga0105249_10000035 | 3300009553 | Bacteria | 201325 |
| 174 | Ga0105249_10385060 | 3300009553 | Bacteria | 1429 |
| 175 | Ga0105249_10416469 | 3300009553 | Bacteria | 1376 |
| 176 | Ga0099796_10010288 | 3300010159 | Bacteria | 2567 |
| 177 | Ga0105239_10034581 | 3300010375 | Bacteria | 5550 |
| 178 | Ga0157373_10022779 | 3300013100 | Bacteria | 4542 |
| 179 | Ga0157373_10105027 | 3300013100 | Bacteria | 1987 |
| 180 | Ga0157371_10147730 | 3300013102 | Bacteria | 1676 |
| 181 | Ga0157371_10269119 | 3300013102 | Bacteria | 1229 |
| 182 | Ga0157370_10014955 | 3300013104 | Bacteria | 7913 |
| 183 | Ga0157370_10028926 | 3300013104 | Bacteria | 5445 |
| 184 | Ga0157370_10112520 | 3300013104 | Bacteria | 2544 |
| 185 | Ga0157369_10000043 | 3300013105 | Bacteria | 180713 |
| 186 | Ga0157369_10007581 | 3300013105 | Bacteria | 12489 |
| 187 | Ga0157369_10094209 | 3300013105 | Bacteria | 3196 |
| 188 | Ga0157369_10111023 | 3300013105 | Bacteria | 2914 |
| 189 | Ga0157369_10847637 | 3300013105 | Bacteria | 938 |
| 190 | Ga0157374_10023802 | 3300013296 | Bacteria | 5483 |
| 191 | Ga0157378_10333651 | 3300013297 | Bacteria | 1477 |
| 192 | Ga0157378_10382343 | 3300013297 | Bacteria | 1383 |
| 193 | Ga0163162_10014044 | 3300013306 | Bacteria | 7827 |
| 194 | Ga0163162_10036563 | 3300013306 | Bacteria | 4895 |
| 195 | Ga0163162_10114980 | 3300013306 | Bacteria | 2790 |
| 196 | Ga0163162_10154001 | 3300013306 | Bacteria | 2418 |
| 197 | Ga0163162_10206538 | 3300013306 | Bacteria | 2093 |
| 198 | Ga0157372_10276084 | 3300013307 | Bacteria | 1953 |
| 199 | Ga0157375_11173984 | 3300013308 | Bacteria | 900 |
| 200 | Ga0163163_10005537 | 3300014325 | Bacteria | 10936 |
| 201 | Ga0163163_10019657 | 3300014325 | Bacteria | 6346 |
| 202 | Ga0157380_10004798 | 3300014326 | Bacteria | 9423 |
| 203 | Ga0157380_10062201 | 3300014326 | Bacteria | 2989 |
| 204 | Ga0157379_10008890 | 3300014968 | Bacteria | 8756 |
| 205 | Ga0157379_10405318 | 3300014968 | Bacteria | 1254 |
| 206 | Ga0157379_10455885 | 3300014968 | Bacteria | 1181 |
| 207 | Ga0157379_10581161 | 3300014968 | Bacteria | 1044 |
| 208 | Ga0182005_1064129 | 3300015265 | Bacteria | 1004 |
| 209 | Ga0163161_10000102 | 3300017792 | Bacteria | 81540 |
| 210 | Ga0213872_10014988 | 3300021361 | Bacteria | 3606 |
| 211 | Ga0213874_10062776 | 3300021377 | Bacteria | 1168 |
| 212 | Ga0213875_10150129 | 3300021388 | Bacteria | 1092 |
| 213 | Ga0209758_1000128 | 3300025297 | Bacteria | 186771 |
| 214 | Ga0207697_10009619 | 3300025315 | Bacteria | 4166 |
| 215 | Ga0207697_10013327 | 3300025315 | Bacteria | 3431 |
| 216 | Ga0207697_10055657 | 3300025315 | Bacteria | 1640 |
| 217 | Ga0207656_10078538 | 3300025321 | Bacteria | 1479 |
| 218 | Ga0207656_10102693 | 3300025321 | Bacteria | 1312 |
| 219 | Ga0207682_10000147 | 3300025893 | Bacteria | 31656 |
| 220 | Ga0207710_10022092 | 3300025900 | Bacteria | 2729 |
| 221 | Ga0207710_10029664 | 3300025900 | Bacteria | 2382 |
| 222 | Ga0207710_10092185 | 3300025900 | Bacteria | 1419 |
| 223 | Ga0207710_10122998 | 3300025900 | Bacteria | 1241 |
| 224 | Ga0207688_10002303 | 3300025901 | Bacteria | 10272 |
| 225 | Ga0207688_10157154 | 3300025901 | Bacteria | 1346 |
| 226 | Ga0207680_10000011 | 3300025903 | Bacteria | 391225 |
| 227 | Ga0207680_10024594 | 3300025903 | Bacteria | 3308 |
| 228 | Ga0207680_10201301 | 3300025903 | Bacteria | 1357 |
| 229 | Ga0207647_10008450 | 3300025904 | Bacteria | 7382 |
| 230 | Ga0207647_10055215 | 3300025904 | Bacteria | 2441 |
| 231 | Ga0207647_10207689 | 3300025904 | Bacteria | 1132 |
| 232 | Ga0207645_10022266 | 3300025907 | Bacteria | 4125 |
| 233 | Ga0207643_10027485 | 3300025908 | Bacteria | 3154 |
| 234 | Ga0207643_10180488 | 3300025908 | Bacteria | 1277 |
| 235 | Ga0207705_10000033 | 3300025909 | Bacteria | 223997 |
| 236 | Ga0207705_10180163 | 3300025909 | Bacteria | 1594 |
| 237 | Ga0207705_10310735 | 3300025909 | Bacteria | 1210 |
| 238 | Ga0207684_10479254 | 3300025910 | Bacteria | 1067 |
| 239 | Ga0207654_10000285 | 3300025911 | Bacteria | 30791 |
| 240 | Ga0207707_10016805 | 3300025912 | Bacteria | 6375 |
| 241 | Ga0207707_10150528 | 3300025912 | Bacteria | 2035 |
| 242 | Ga0207707_10159254 | 3300025912 | Bacteria | 1974 |
| 243 | Ga0207707_10605427 | 3300025912 | Bacteria | 927 |
| 244 | Ga0207695_10002074 | 3300025913 | Bacteria | 30558 |
| 245 | Ga0207671_10012192 | 3300025914 | Bacteria | 6934 |
| 246 | Ga0207693_10009479 | 3300025915 | Bacteria | 7929 |
| 247 | Ga0207693_10017330 | 3300025915 | Bacteria | 5744 |
| 248 | Ga0207693_10042503 | 3300025915 | Bacteria | 3577 |
| 249 | Ga0207693_10078129 | 3300025915 | Bacteria | 2591 |
| 250 | Ga0207693_10205671 | 3300025915 | Bacteria | 1548 |
| 251 | Ga0207660_10002059 | 3300025917 | Bacteria | 13360 |
| 252 | Ga0207660_10029613 | 3300025917 | Bacteria | 3758 |
| 253 | Ga0207660_10245440 | 3300025917 | Bacteria | 1412 |
| 254 | Ga0207662_10221508 | 3300025918 | Bacteria | 1232 |
| 255 | Ga0207657_10091569 | 3300025919 | Bacteria | 2535 |
| 256 | Ga0207657_10168929 | 3300025919 | Bacteria | 1773 |
| 257 | Ga0207649_10000444 | 3300025920 | Bacteria | 29932 |
| 258 | Ga0207649_10074284 | 3300025920 | Bacteria | 2181 |
| 259 | Ga0207649_10100090 | 3300025920 | Bacteria | 1916 |
| 260 | Ga0207652_10188151 | 3300025921 | Bacteria | 1856 |
| 261 | Ga0207646_10214716 | 3300025922 | Bacteria | 1737 |
| 262 | Ga0207681_10000096 | 3300025923 | Bacteria | 74995 |
| 263 | Ga0207681_10000112 | 3300025923 | Bacteria | 68723 |
| 264 | Ga0207681_10021738 | 3300025923 | Bacteria | 4083 |
| 265 | Ga0207681_10323687 | 3300025923 | Bacteria | 1227 |
| 266 | Ga0207694_10004187 | 3300025924 | Bacteria | 11314 |
| 267 | Ga0207694_10198752 | 3300025924 | Bacteria | 1630 |
| 268 | Ga0207687_10019713 | 3300025927 | Bacteria | 4471 |
| 269 | Ga0207687_10051601 | 3300025927 | Bacteria | 2868 |
| 270 | Ga0207700_10023911 | 3300025928 | Bacteria | 4223 |
| 271 | Ga0207664_10286062 | 3300025929 | Bacteria | 1448 |
| 272 | Ga0207664_10878560 | 3300025929 | Bacteria | 805 |
| 273 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 274 | Ga0207644_10009210 | 3300025931 | Bacteria | 6476 |
| 275 | Ga0207644_10014179 | 3300025931 | Bacteria | 5331 |
| 276 | Ga0207644_10351399 | 3300025931 | Bacteria | 1197 |
| 277 | Ga0207690_10011704 | 3300025932 | Bacteria | 5246 |
| 278 | Ga0207706_10109808 | 3300025933 | Bacteria | 2427 |
| 279 | Ga0207706_10123536 | 3300025933 | Bacteria | 2277 |
| 280 | Ga0207706_10278816 | 3300025933 | Bacteria | 1458 |
| 281 | Ga0207706_10298024 | 3300025933 | Bacteria | 1405 |
| 282 | Ga0207686_10076118 | 3300025934 | Bacteria | 2175 |
| 283 | Ga0207686_10127490 | 3300025934 | Bacteria | 1741 |
| 284 | Ga0207709_10252546 | 3300025935 | Bacteria | 1289 |
| 285 | Ga0207670_10006506 | 3300025936 | Bacteria | 6485 |
| 286 | Ga0207670_10061467 | 3300025936 | Bacteria | 2563 |
| 287 | Ga0207704_10249315 | 3300025938 | Bacteria | 1332 |
| 288 | Ga0207665_10370326 | 3300025939 | Bacteria | 1085 |
| 289 | Ga0207691_10042109 | 3300025940 | Bacteria | 4211 |
| 290 | Ga0207691_10429741 | 3300025940 | Bacteria | 1125 |
| 291 | Ga0207711_10020384 | 3300025941 | Bacteria | 5527 |
| 292 | Ga0207711_10056159 | 3300025941 | Bacteria | 3382 |
| 293 | Ga0207711_10165981 | 3300025941 | Bacteria | 2001 |
| 294 | Ga0207689_10072495 | 3300025942 | Bacteria | 2829 |
| 295 | Ga0207661_10174628 | 3300025944 | Bacteria | 1872 |
| 296 | Ga0207661_10349253 | 3300025944 | Bacteria | 1334 |
| 297 | Ga0207679_10029237 | 3300025945 | Bacteria | 3835 |
| 298 | Ga0207679_10191126 | 3300025945 | Bacteria | 1702 |
| 299 | Ga0207667_10007324 | 3300025949 | Bacteria | 13282 |
| 300 | Ga0207667_10012362 | 3300025949 | Bacteria | 9844 |
| 301 | Ga0207667_10022285 | 3300025949 | Bacteria | 7001 |
| 302 | Ga0207667_10042471 | 3300025949 | Bacteria | 4832 |
| 303 | Ga0207667_10074478 | 3300025949 | Bacteria | 3527 |
| 304 | Ga0207651_10109481 | 3300025960 | Bacteria | 2070 |
| 305 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 306 | Ga0207712_10000013 | 3300025961 | Bacteria | 391208 |
| 307 | Ga0207712_10079828 | 3300025961 | Bacteria | 2378 |
| 308 | Ga0207668_10007115 | 3300025972 | Bacteria | 6639 |
| 309 | Ga0207668_10066392 | 3300025972 | Bacteria | 2557 |
| 310 | Ga0207668_10096978 | 3300025972 | Bacteria | 2181 |
| 311 | Ga0207640_10063192 | 3300025981 | Bacteria | 2459 |
| 312 | Ga0207640_10215809 | 3300025981 | Bacteria | 1465 |
| 313 | Ga0207640_10591692 | 3300025981 | Bacteria | 938 |
| 314 | Ga0207658_10000689 | 3300025986 | Bacteria | 29444 |
| 315 | Ga0207658_10102311 | 3300025986 | Bacteria | 2247 |
| 316 | Ga0207658_10163505 | 3300025986 | Bacteria | 1826 |
| 317 | Ga0207703_10001006 | 3300026035 | Bacteria | 27062 |
| 318 | Ga0207703_10009748 | 3300026035 | Bacteria | 7537 |
| 319 | Ga0207703_10013788 | 3300026035 | Bacteria | 6300 |
| 320 | Ga0207703_10136533 | 3300026035 | Bacteria | 2124 |
| 321 | Ga0207639_10043651 | 3300026041 | Bacteria | 3367 |
| 322 | Ga0207639_10261723 | 3300026041 | Bacteria | 1513 |
| 323 | Ga0207639_10616822 | 3300026041 | Bacteria | 1001 |
| 324 | Ga0207678_10320833 | 3300026067 | Bacteria | 1333 |
| 325 | Ga0207708_10036299 | 3300026075 | Bacteria | 3752 |
| 326 | Ga0207708_10043986 | 3300026075 | Bacteria | 3403 |
| 327 | Ga0207702_10007648 | 3300026078 | Bacteria | 9194 |
| 328 | Ga0207702_10307501 | 3300026078 | Bacteria | 1506 |
| 329 | Ga0207641_10000101 | 3300026088 | Bacteria | 122493 |
| 330 | Ga0207641_10003069 | 3300026088 | Bacteria | 15060 |
| 331 | Ga0207676_10001834 | 3300026095 | Bacteria | 15561 |
| 332 | Ga0207674_10030099 | 3300026116 | Bacteria | 5710 |
| 333 | Ga0207674_10039328 | 3300026116 | Bacteria | 4904 |
| 334 | Ga0207674_10231985 | 3300026116 | Bacteria | 1793 |
| 335 | Ga0207674_10445601 | 3300026116 | Bacteria | 1251 |
| 336 | Ga0207674_10581922 | 3300026116 | Bacteria | 1081 |
| 337 | Ga0207675_100011489 | 3300026118 | Bacteria | 8284 |
| 338 | Ga0207675_100118534 | 3300026118 | Bacteria | 2503 |
| 339 | Ga0207683_10095843 | 3300026121 | Bacteria | 2645 |
| 340 | Ga0207683_10148744 | 3300026121 | Bacteria | 2113 |
| 341 | Ga0207698_10001849 | 3300026142 | Bacteria | 12360 |
| 342 | Ga0207698_10013844 | 3300026142 | Bacteria | 5340 |
| 343 | Ga0207698_10038387 | 3300026142 | Bacteria | 3538 |
| 344 | Ga0268266_10000025 | 3300028379 | Bacteria | 477143 |
| 345 | Ga0268266_10000626 | 3300028379 | Bacteria | 48011 |
| 346 | Ga0268266_10108335 | 3300028379 | Bacteria | 2458 |
| 347 | Ga0268266_10137786 | 3300028379 | Bacteria | 2187 |
| 348 | Ga0268266_10942846 | 3300028379 | Bacteria | 835 |
| 349 | Ga0268265_10000048 | 3300028380 | Bacteria | 178523 |
| 350 | Ga0268265_10000316 | 3300028380 | Bacteria | 53175 |
| 351 | Ga0268265_10000975 | 3300028380 | Bacteria | 26114 |
| 352 | Ga0268264_10000037 | 3300028381 | Bacteria | 391116 |
| 353 | Ga0268264_10000439 | 3300028381 | Bacteria | 57339 |
| 354 | Ga0268264_10161279 | 3300028381 | Bacteria | 2020 |
| 355 | Ga0265760_10026725 | 3300031090 | Bacteria | 1689 |
| 356 | Ga0265328_10070937 | 3300031239 | Bacteria | 1281 |
| 357 | Ga0265329_10046276 | 3300031242 | Bacteria | 1390 |
| 358 | Ga0265340_10022791 | 3300031247 | Bacteria | 3198 |
| 359 | Ga0265340_10029387 | 3300031247 | Bacteria | 2760 |
| 360 | Ga0265339_10058674 | 3300031249 | Bacteria | 2077 |
| 361 | Ga0265339_10195298 | 3300031249 | Bacteria | 1001 |
| 362 | Ga0265331_10002807 | 3300031250 | Bacteria | 11548 |
| 363 | Ga0265331_10019075 | 3300031250 | Bacteria | 3545 |
| 364 | Ga0307513_10494841 | 3300031456 | Bacteria | 940 |
| 365 | Ga0265313_10000021 | 3300031595 | Bacteria | 144949 |
| 366 | Ga0316575_10106133 | 3300031665 | Bacteria | 1144 |
| 367 | Ga0316579_10153587 | 3300031691 | Bacteria | 1111 |
| 368 | Ga0265314_10000279 | 3300031711 | Bacteria | 74300 |
| 369 | Ga0265314_10025954 | 3300031711 | Bacteria | 4411 |
| 370 | Ga0265314_10058157 | 3300031711 | Bacteria | 2650 |
| 371 | Ga0265342_10009824 | 3300031712 | Bacteria | 6694 |
| 372 | Ga0265342_10065920 | 3300031712 | Bacteria | 2121 |
| 373 | Ga0316578_10038730 | 3300031728 | Bacteria | 2751 |
| 374 | Ga0307405_10555396 | 3300031731 | Bacteria | 930 |
| 375 | Ga0307413_10220122 | 3300031824 | Bacteria | 1386 |
| 376 | Ga0307412_10144788 | 3300031911 | Bacteria | 1745 |
| 377 | Ga0307412_10225018 | 3300031911 | Bacteria | 1441 |
| 378 | Ga0307412_10302574 | 3300031911 | Bacteria | 1265 |
| 379 | Ga0307409_100079291 | 3300031995 | Bacteria | 2646 |
| 380 | Ga0307414_10057088 | 3300032004 | Bacteria | 2742 |
| 381 | Ga0307414_10071542 | 3300032004 | Bacteria | 2502 |
| 382 | Ga0307414_10229974 | 3300032004 | Bacteria | 1528 |
| 383 | Ga0307411_10563347 | 3300032005 | Bacteria | 974 |
| 384 | Ga0307415_100252775 | 3300032126 | Bacteria | 1433 |
| 385 | Ga0316583_10001287 | 3300032133 | Bacteria | 8297 |
| 386 | Ga0316593_10033295 | 3300032168 | Bacteria | 1686 |
| 387 | Ga0307510_10000248 | 3300033180 | Bacteria | 48764 |
| 388 | Ga0316592_1012612 | 3300033524 | Bacteria | 1735 |
| 389 | Ga0316592_1056016 | 3300033524 | Bacteria | 882 |
| 390 | Ga0373930_0035672 | 3300034816 | Bacteria | 1040 |
| 391 | Ga0373958_0024349 | 3300034819 | Bacteria | 1145 |
| 392 | Ga0373959_0045163 | 3300034820 | Bacteria | 936 |
| 393 | Ga0373938_0090185 | 3300034957 | Bacteria | 757 |
| 394 | Ga0373926_0005063 | 3300035083 | Bacteria | 4329 |
| 395 | Ga0373926_0008334 | 3300035083 | Bacteria | 3447 |
| 396 | Ga0373929_0012346 | 3300035085 | Bacteria | 1623 |
| 397 | Ga0373940_0080405 | 3300035088 | Bacteria | 963 |
| 398 | Ga0373944_0002213 | 3300035089 | Bacteria | 4942 |
| 399 | Ga0373923_0041409 | 3300035111 | Bacteria | 1899 |
| 400 | Ga0373923_0050859 | 3300035111 | Bacteria | 1737 |
| 401 | Ga0373923_0085332 | 3300035111 | Bacteria | 1374 |
| 402 | Ga0373932_0151554 | 3300035112 | Bacteria | 796 |
| 403 | Ga0373936_0067593 | 3300035113 | Bacteria | 1469 |
| 404 | Ga0373941_0090086 | 3300035115 | Bacteria | 1051 |
| 405 | Ga0373945_0012237 | 3300035116 | Bacteria | 2846 |
| 406 | Ga0373953_0213947 | 3300035117 | Bacteria | 834 |
| 407 | Ga0373954_0039018 | 3300035118 | Bacteria | 2210 |
| 408 | Ga0373954_0127770 | 3300035118 | Bacteria | 1236 |
| 409 | Ga0373957_0204054 | 3300035120 | Bacteria | 824 |
| 410 | Ga0373943_0000038 | 3300035170 | Bacteria | 44091 |
| 411 | Ga0373943_0006907 | 3300035170 | Bacteria | 5091 |
| 412 | Ga0373943_0084078 | 3300035170 | Bacteria | 1637 |
| 413 | Ga0373946_0003198 | 3300035171 | Bacteria | 5809 |
| 414 | Ga0373955_0045922 | 3300035172 | Bacteria | 2359 |
| 415 | Ga0373955_0173865 | 3300035172 | Bacteria | 1276 |
| 416 | Ga0373942_0052239 | 3300035207 | Bacteria | 1149 |
| 417 | Ga0373961_0028678 | 3300035241 | Bacteria | 1536 |
| 418 | Ga0316574_0473080 | 3300035398 | Bacteria | 783 |
| 419 | Ga0373924_0043034 | 3300035410 | Bacteria | 1854 |
| 420 | Ga0373931_0197657 | 3300035691 | Bacteria | 1199 |
| 421 | Ga0373931_0381779 | 3300035691 | Bacteria | 888 |
| 422 | Ga0373931_0393176 | 3300035691 | Bacteria | 876 |
| 423 | Ga0373935_0274025 | 3300035692 | Bacteria | 1186 |
| 424 | Ga0373935_0297920 | 3300035692 | Bacteria | 1139 |
| 425 | Ga0373927_0000651 | 3300035695 | Bacteria | 26320 |
| 426 | Ga0373927_0025823 | 3300035695 | Bacteria | 3840 |
| 427 | Ga0373927_0230645 | 3300035695 | Bacteria | 1216 |
| 428 | Ga0373927_0263089 | 3300035695 | Bacteria | 1134 |
| 429 | Ga0373933_0024606 | 3300035724 | Bacteria | 3447 |
| 430 | Ga0373947_0000024 | 3300035725 | Bacteria | 87027 |
| 431 | Ga0373947_0013366 | 3300035725 | Bacteria | 4704 |
| 432 | Ga0373947_0091793 | 3300035725 | Bacteria | 1895 |
| 433 | Ga0373947_0094215 | 3300035725 | Bacteria | 1872 |
| 434 | Ga0373947_0131845 | 3300035725 | Bacteria | 1596 |
| 435 | Ga0373937_0005793 | 3300036401 | Bacteria | 10619 |
| 436 | Ga0373937_0020159 | 3300036401 | Bacteria | 5975 |
| 437 | Ga0373937_0580248 | 3300036401 | Bacteria | 1065 |
| 438 | Ga0316582_0018667 | 3300036647 | Bacteria | 4042 |
| 439 | Ga0316584_0007550 | 3300036712 | Bacteria | 7450 |
| 440 | Ga0373925_0018395 | 3300037068 | Bacteria | 5079 |
| 441 | Ga0373925_0153430 | 3300037068 | Bacteria | 1810 |
| 442 | Ga0373925_0491408 | 3300037068 | Bacteria | 1007 |
| 443 | Ga0395899_0000137 | 3300037312 | Bacteria | 111924 |
| 444 | Ga0395899_0125111 | 3300037312 | Bacteria | 1839 |
| 445 | Ga0395900_0000108 | 3300037418 | Bacteria | 147706 |
| 446 | Ga0395900_0018679 | 3300037418 | Bacteria | 7070 |
| 447 | Ga0395900_0032943 | 3300037418 | Bacteria | 5331 |
| 448 | Ga0395900_0034968 | 3300037418 | Bacteria | 5175 |
| 449 | Ga0395900_0043072 | 3300037418 | Bacteria | 4651 |
| 450 | Ga0395900_0045893 | 3300037418 | Bacteria | 4500 |
| 451 | Ga0395900_0170835 | 3300037418 | Bacteria | 2213 |
| 452 | Ga0395898_0000632 | 3300037466 | Bacteria | 64373 |
| 453 | Ga0395898_0024358 | 3300037466 | Bacteria | 6104 |
| 454 | Ga0395898_0044477 | 3300037466 | Bacteria | 4370 |
| 455 | Ga0395898_0053895 | 3300037466 | Bacteria | 3926 |
| 456 | Ga0395905_0000780 | 3300037471 | Bacteria | 41824 |
| 457 | Ga0395905_0096596 | 3300037471 | Bacteria | 2774 |
| 458 | Ga0436364_0013094 | 3300037853 | Bacteria | 1884 |
| 459 | Ga0436364_0195157 | 3300037853 | Bacteria | 17364 |
| 460 | Ga0436364_0526272 | 3300037853 | Bacteria | 3502 |
| 461 | Ga0436364_1108265 | 3300037853 | Bacteria | 5139 |
| 462 | Ga0395901_0000050 | 3300038443 | Bacteria | 171046 |
| 463 | Ga0395901_0000086 | 3300038443 | Bacteria | 125359 |
| 464 | Ga0395901_0026198 | 3300038443 | Bacteria | 5985 |
| 465 | Ga0395901_0051291 | 3300038443 | Bacteria | 4289 |
| 466 | Ga0395901_0244060 | 3300038443 | Bacteria | 1872 |
| 467 | Ga0395901_0390029 | 3300038443 | Bacteria | 1432 |
| 468 | Ga0395901_0485823 | 3300038443 | Bacteria | 1259 |
| 469 | Ga0400483_136809 | 3300039062 | Bacteria | 1317 |
| 470 | Ga0400483_206045 | 3300039062 | Bacteria | 1699 |
| 471 | Ga0436365_1896329 | 3300039437 | Bacteria | 9698 |
| 472 | Ga0436360_0048356 | 3300039438 | Bacteria | 1363 |
| 473 | Ga0436360_1007073 | 3300039438 | Bacteria | 1324 |
| 474 | Ga0436361_0009329 | 3300039447 | Bacteria | 997 |
| 475 | Ga0436361_0194635 | 3300039447 | Bacteria | 1532 |
| 476 | Ga0436361_0231853 | 3300039447 | Bacteria | 1892 |
| 477 | Ga0436361_0770494 | 3300039447 | Bacteria | 1510 |
| 478 | Ga0436363_0211911 | 3300039450 | Bacteria | 50385 |
| 479 | Ga0436363_0576058 | 3300039450 | Bacteria | 3507 |
| 480 | Ga0439448_0027222 | 3300042005 | Bacteria | 1801 |
| 481 | Ga0439448_0160677 | 3300042005 | Bacteria | 782 |
| 482 | Ga0439456_017035 | 3300042013 | Bacteria | 1522 |
| 483 | Ga0453683_0002196 | 3300044673 | Bacteria | 15517 |
| 484 | Ga0466966_0020726 | 3300044684 | Bacteria | 4320 |
| 485 | Ga0466961_0012256 | 3300044693 | Bacteria | 5483 |
| 486 | Ga0466963_0034953 | 3300044694 | Bacteria | 3272 |
| 487 | Ga0466963_0068019 | 3300044694 | Bacteria | 2391 |
| 488 | Ga0453684_0028704 | 3300044712 | Bacteria | 7925 |
| 489 | Ga0453684_0105894 | 3300044712 | Bacteria | 3429 |
| 490 | Ga0453684_0494753 | 3300044712 | Bacteria | 1355 |
| 491 | Ga0453684_0870126 | 3300044712 | Bacteria | 967 |
| 492 | Ga0466971_0017973 | 3300044719 | Bacteria | 3131 |
| 493 | Ga0466970_0009668 | 3300044765 | Bacteria | 4879 |
| 494 | Ga0466957_0055470 | 3300044842 | Bacteria | 2422 |
| 495 | Ga0466960_0134560 | 3300044901 | Bacteria | 1308 |
| 496 | Ga0466959_0008062 | 3300045049 | Bacteria | 7424 |
| 497 | Ga0451576_0001224 | 3300045051 | Bacteria | 45523 |
| 498 | Ga0451576_0004466 | 3300045051 | Bacteria | 18128 |
| 499 | Ga0451576_0012315 | 3300045051 | Bacteria | 9617 |
| 500 | Ga0451576_0156267 | 3300045051 | Bacteria | 2379 |
| 501 | Ga0451576_0186575 | 3300045051 | Bacteria | 2165 |
| 502 | Ga0466958_0002196 | 3300045836 | Bacteria | 9718 |
| 503 | Ga0466967_0032500 | 3300045976 | Bacteria | 4407 |
| 504 | Ga0466967_0438975 | 3300045976 | Bacteria | 1274 |
| 505 | Ga0495592_0008885 | 3300046454 | Bacteria | 7546 |
| 506 | Ga0495603_0022743 | 3300046455 | Bacteria | 3793 |
| 507 | Ga0495603_0098291 | 3300046455 | Bacteria | 1709 |
| 508 | Ga0495629_0001636 | 3300046459 | Bacteria | 17607 |
| 509 | Ga0495629_0015778 | 3300046459 | Bacteria | 5425 |
| 510 | Ga0495629_0412197 | 3300046459 | Bacteria | 917 |
| 511 | Ga0495629_0431396 | 3300046459 | Bacteria | 894 |
| 512 | Ga0495638_0001117 | 3300046460 | Bacteria | 26096 |
| 513 | Ga0495638_0064102 | 3300046460 | Bacteria | 2264 |
| 514 | Ga0495641_0037738 | 3300046461 | Bacteria | 2262 |
| 515 | Ga0495651_0000860 | 3300046462 | Bacteria | 23547 |
| 516 | Ga0495651_0085272 | 3300046462 | Bacteria | 2379 |
| 517 | Ga0495653_0002396 | 3300046463 | Bacteria | 14921 |
| 518 | Ga0495580_0082128 | 3300046472 | Bacteria | 2246 |
| 519 | Ga0495582_0127994 | 3300046473 | Bacteria | 1434 |
| 520 | Ga0495639_0029254 | 3300046475 | Bacteria | 2445 |
| 521 | Ga0495662_0041905 | 3300046476 | Bacteria | 2210 |
| 522 | Ga0495662_0215780 | 3300046476 | Bacteria | 946 |
| 523 | Ga0495664_0014194 | 3300046477 | Bacteria | 4513 |
| 524 | Ga0495664_0231080 | 3300046477 | Bacteria | 1119 |
| 525 | Ga0495584_0054269 | 3300046491 | Bacteria | 2017 |
| 526 | Ga0495584_0182285 | 3300046491 | Bacteria | 1067 |
| 527 | Ga0495585_0011012 | 3300046492 | Bacteria | 5370 |
| 528 | Ga0495594_0005510 | 3300046499 | Bacteria | 6499 |
| 529 | Ga0495607_0004756 | 3300046501 | Bacteria | 9927 |
| 530 | Ga0495608_0002790 | 3300046511 | Bacteria | 12541 |
| 531 | Ga0495608_0093221 | 3300046511 | Bacteria | 1946 |
| 532 | Ga0495620_0122087 | 3300046515 | Bacteria | 1026 |
| 533 | Ga0495628_0016517 | 3300046516 | Bacteria | 6155 |
| 534 | Ga0495628_0322965 | 3300046516 | Bacteria | 1139 |
| 535 | Ga0495628_0341313 | 3300046516 | Bacteria | 1102 |
| 536 | Ga0495628_0690018 | 3300046516 | Bacteria | 722 |
| 537 | Ga0495630_0102927 | 3300046517 | Bacteria | 2161 |
| 538 | Ga0495630_0121908 | 3300046517 | Bacteria | 1978 |
| 539 | Ga0495630_0264974 | 3300046517 | Bacteria | 1313 |
| 540 | Ga0495637_0016075 | 3300046520 | Bacteria | 3503 |
| 541 | Ga0495637_0043659 | 3300046520 | Bacteria | 1912 |
| 542 | Ga0495643_0080976 | 3300046522 | Bacteria | 1689 |
| 543 | Ga0495644_0003154 | 3300046523 | Bacteria | 6519 |
| 544 | Ga0495644_0097544 | 3300046523 | Bacteria | 1111 |
| 545 | Ga0495648_0075932 | 3300046524 | Bacteria | 1931 |
| 546 | Ga0495666_0020658 | 3300046526 | Bacteria | 3261 |
| 547 | Ga0495666_0174480 | 3300046526 | Bacteria | 994 |
| 548 | Ga0495652_0009824 | 3300046529 | Bacteria | 8674 |
| 549 | Ga0495652_0062137 | 3300046529 | Bacteria | 3150 |
| 550 | Ga0495652_0381484 | 3300046529 | Bacteria | 1002 |
| 551 | Ga0495665_0013078 | 3300046531 | Bacteria | 4494 |
| 552 | Ga0495665_0026036 | 3300046531 | Bacteria | 3142 |
| 553 | Ga0495640_0027323 | 3300046533 | Bacteria | 4116 |
| 554 | Ga0495640_0039590 | 3300046533 | Bacteria | 3306 |
| 555 | Ga0495640_0085978 | 3300046533 | Bacteria | 2083 |
| 556 | Ga0495587_0005187 | 3300046536 | Bacteria | 8514 |
| 557 | Ga0495645_0290115 | 3300046543 | Bacteria | 1073 |
| 558 | Ga0495667_0001836 | 3300046559 | Bacteria | 14089 |
| 559 | Ga0495667_0263455 | 3300046559 | Bacteria | 1096 |
| 560 | Ga0495667_0354623 | 3300046559 | Bacteria | 926 |
| 561 | Ga0495656_0005971 | 3300046615 | Bacteria | 4236 |
| 562 | Ga0495634_0016406 | 3300046642 | Bacteria | 5299 |
| 563 | Ga0495625_0070430 | 3300046660 | Bacteria | 2455 |
| 564 | Ga0495625_0200594 | 3300046660 | Bacteria | 1317 |
| 565 | Ga0495635_0008770 | 3300046663 | Bacteria | 7060 |
| 566 | Ga0495635_0241348 | 3300046663 | Bacteria | 1219 |
| 567 | Ga0495635_0388504 | 3300046663 | Bacteria | 928 |
| 568 | Ga0495657_0198990 | 3300046675 | Bacteria | 1222 |
| 569 | Ga0495599_0004247 | 3300046678 | Bacteria | 8464 |
| 570 | Ga0495623_0002702 | 3300046679 | Bacteria | 11722 |
| 571 | Ga0495646_0003305 | 3300046680 | Bacteria | 10032 |
| 572 | Ga0495647_0002950 | 3300046681 | Bacteria | 5395 |
| 573 | Ga0495647_0018044 | 3300046681 | Bacteria | 2505 |
| 574 | Ga0495658_0014556 | 3300046683 | Bacteria | 4023 |
| 575 | Ga0495613_0074116 | 3300046689 | Bacteria | 2479 |
| 576 | Ga0495613_0157226 | 3300046689 | Bacteria | 1619 |
| 577 | Ga0495624_0004781 | 3300046690 | Bacteria | 9849 |
| 578 | Ga0495624_0086224 | 3300046690 | Bacteria | 1939 |
| 579 | Ga0495670_0001709 | 3300046691 | Bacteria | 10800 |
| 580 | Ga0495670_0008540 | 3300046691 | Bacteria | 5043 |
| 581 | Ga0495670_0084260 | 3300046691 | Bacteria | 1622 |
| 582 | Ga0495600_0157468 | 3300046809 | Bacteria | 1469 |
| 583 | Ga0495600_0309258 | 3300046809 | Bacteria | 996 |
| 584 | Ga0495581_0013861 | 3300047315 | Bacteria | 4672 |
| 585 | Ga0495581_0101832 | 3300047315 | Bacteria | 1669 |
| 586 | Ga0495581_0158978 | 3300047315 | Bacteria | 1321 |
| 587 | Ga0495604_0001315 | 3300047317 | Bacteria | 20297 |
| 588 | Ga0495604_0093810 | 3300047317 | Bacteria | 2220 |
| 589 | Ga0495674_0000145 | 3300047319 | Bacteria | 54755 |
| 590 | Ga0495674_0106941 | 3300047319 | Bacteria | 2375 |
| 591 | Ga0495672_0111331 | 3300047320 | Bacteria | 1469 |
| 592 | Ga0495676_0015903 | 3300047321 | Bacteria | 6687 |
| 593 | Ga0495676_0113249 | 3300047321 | Bacteria | 1986 |
| 594 | Ga0495676_0130375 | 3300047321 | Bacteria | 1816 |
| 595 | Ga0495676_0202922 | 3300047321 | Bacteria | 1377 |
| 596 | Ga0495680_0003388 | 3300047322 | Bacteria | 15738 |
| 597 | Ga0495680_0145384 | 3300047322 | Bacteria | 1732 |
| 598 | Ga0495675_0003692 | 3300047444 | Bacteria | 9253 |
| 599 | Ga0495675_0388210 | 3300047444 | Bacteria | 815 |
| 600 | Ga0495677_0019390 | 3300047445 | Bacteria | 2466 |
| 601 | Ga0495684_0000209 | 3300047471 | Bacteria | 45383 |
| 602 | Ga0495684_0022282 | 3300047471 | Bacteria | 4877 |
| 603 | Ga0495684_0114332 | 3300047471 | Bacteria | 2035 |
| 604 | Ga0495684_0218547 | 3300047471 | Bacteria | 1398 |
| 605 | Ga0495602_0010058 | 3300048088 | Bacteria | 9819 |
| 606 | Ga0495602_0357651 | 3300048088 | Bacteria | 1052 |
| 607 | Ga0496100_0039775 | 3300048903 | Bacteria | 2987 |
| 608 | Ga0496100_0049795 | 3300048903 | Bacteria | 2711 |
| 609 | Ga0496100_0117889 | 3300048903 | Bacteria | 1854 |
| 610 | Ga0496100_0373458 | 3300048903 | Bacteria | 1082 |
| 611 | Ga0496100_0451373 | 3300048903 | Bacteria | 986 |
| 612 | Ga0496101_0003779 | 3300048904 | Bacteria | 9459 |
| 613 | Ga0496101_0031548 | 3300048904 | Bacteria | 3726 |
| 614 | Ga0496101_0371114 | 3300048904 | Bacteria | 1125 |
| 615 | Ga0496102_0012833 | 3300048905 | Bacteria | 7252 |
| 616 | Ga0496102_0017546 | 3300048905 | Bacteria | 6269 |
| 617 | Ga0496102_0143856 | 3300048905 | Bacteria | 2237 |
| 618 | Ga0496102_0169470 | 3300048905 | Bacteria | 2055 |
| 619 | Ga0496102_0200919 | 3300048905 | Bacteria | 1879 |
| 620 | Ga0496102_0593267 | 3300048905 | Bacteria | 1031 |
| 621 | Ga0496103_0003334 | 3300048906 | Bacteria | 9820 |
| 622 | Ga0496104_0002148 | 3300048907 | Bacteria | 17117 |
| 623 | Ga0496104_0003136 | 3300048907 | Bacteria | 14255 |
| 624 | Ga0496104_0009810 | 3300048907 | Bacteria | 8535 |
| 625 | Ga0496104_0026954 | 3300048907 | Bacteria | 5313 |
| 626 | Ga0496104_0042587 | 3300048907 | Bacteria | 4262 |
| 627 | Ga0496104_0055314 | 3300048907 | Bacteria | 3752 |
| 628 | Ga0496104_0104710 | 3300048907 | Bacteria | 2711 |
| 629 | Ga0496104_0106466 | 3300048907 | Bacteria | 2687 |
| 630 | Ga0496104_0232421 | 3300048907 | Bacteria | 1756 |
| 631 | Ga0496105_0000882 | 3300048908 | Bacteria | 20534 |
| 632 | Ga0496105_0012680 | 3300048908 | Bacteria | 6676 |
| 633 | Ga0496105_0013528 | 3300048908 | Bacteria | 6482 |
| 634 | Ga0496105_0017190 | 3300048908 | Bacteria | 5793 |
| 635 | Ga0496105_0029423 | 3300048908 | Bacteria | 4496 |
| 636 | Ga0496105_0043061 | 3300048908 | Bacteria | 3723 |
| 637 | Ga0496105_0309730 | 3300048908 | Bacteria | 1268 |
| 638 | Ga0496105_0421979 | 3300048908 | Bacteria | 1056 |
| 639 | Ga0496106_0002149 | 3300048909 | Bacteria | 14729 |
| 640 | Ga0496106_0002837 | 3300048909 | Bacteria | 12860 |
| 641 | Ga0496106_0095642 | 3300048909 | Bacteria | 2298 |
| 642 | Ga0496106_0193717 | 3300048909 | Bacteria | 1616 |
| 643 | Ga0496107_0005939 | 3300048910 | Bacteria | 8367 |
| 644 | Ga0496107_0010755 | 3300048910 | Bacteria | 6364 |
| 645 | Ga0496107_0011930 | 3300048910 | Bacteria | 6068 |
| 646 | Ga0496107_0033374 | 3300048910 | Bacteria | 3682 |
| 647 | Ga0496108_0006835 | 3300048911 | Bacteria | 9230 |
| 648 | Ga0496108_0011301 | 3300048911 | Bacteria | 7254 |
| 649 | Ga0496108_0049348 | 3300048911 | Bacteria | 3520 |
| 650 | Ga0496109_0005176 | 3300048912 | Bacteria | 10887 |
| 651 | Ga0496109_0017543 | 3300048912 | Bacteria | 6275 |
| 652 | Ga0496109_0022885 | 3300048912 | Bacteria | 5538 |
| 653 | Ga0496109_0119498 | 3300048912 | Bacteria | 2454 |
| 654 | Ga0496109_0128459 | 3300048912 | Bacteria | 2364 |
| 655 | Ga0496109_0162856 | 3300048912 | Bacteria | 2090 |
| 656 | Ga0496110_0004030 | 3300048913 | Bacteria | 11329 |
| 657 | Ga0496110_0013474 | 3300048913 | Bacteria | 6761 |
| 658 | Ga0496110_0034708 | 3300048913 | Bacteria | 4371 |
| 659 | Ga0496110_0098102 | 3300048913 | Bacteria | 2625 |
| 660 | Ga0496110_0187090 | 3300048913 | Bacteria | 1880 |
| 661 | Ga0496110_0221215 | 3300048913 | Bacteria | 1722 |
| 662 | Ga0496111_0010614 | 3300048914 | Bacteria | 6188 |
| 663 | Ga0496111_0017179 | 3300048914 | Bacteria | 4998 |
| 664 | Ga0496111_0175123 | 3300048914 | Bacteria | 1595 |
| 665 | Ga0496111_0206854 | 3300048914 | Bacteria | 1458 |
| 666 | Ga0496111_0273777 | 3300048914 | Bacteria | 1252 |
| 667 | Ga0496111_0468431 | 3300048914 | Bacteria | 929 |
| 668 | Ga0496112_0002737 | 3300048915 | Bacteria | 14280 |
| 669 | Ga0496112_0008660 | 3300048915 | Bacteria | 9123 |
| 670 | Ga0496112_0034196 | 3300048915 | Bacteria | 4945 |
| 671 | Ga0496112_0057103 | 3300048915 | Bacteria | 3842 |
| 672 | Ga0496112_0072266 | 3300048915 | Bacteria | 3410 |
| 673 | Ga0496112_0093100 | 3300048915 | Bacteria | 2984 |
| 674 | Ga0496112_0098327 | 3300048915 | Bacteria | 2896 |
| 675 | Ga0496112_0157400 | 3300048915 | Bacteria | 2238 |
| 676 | Ga0496112_0285303 | 3300048915 | Bacteria | 1597 |
| 677 | Ga0496112_0327421 | 3300048915 | Bacteria | 1476 |
| 678 | Ga0496113_0003871 | 3300048916 | Bacteria | 9062 |
| 679 | Ga0496113_0009682 | 3300048916 | Bacteria | 6329 |
| 680 | Ga0496113_0055224 | 3300048916 | Bacteria | 2976 |
| 681 | Ga0496113_0406263 | 3300048916 | Bacteria | 1093 |
| 682 | Ga0496113_0414392 | 3300048916 | Bacteria | 1082 |
| 683 | Ga0496113_0486196 | 3300048916 | Bacteria | 991 |
| 684 | Ga0496114_0245324 | 3300048917 | Bacteria | 1576 |
| 685 | Ga0496114_0299955 | 3300048917 | Bacteria | 1418 |
| 686 | Ga0496115_0001345 | 3300048918 | Bacteria | 17523 |
| 687 | Ga0496115_0065665 | 3300048918 | Bacteria | 2931 |
| 688 | Ga0496115_0198692 | 3300048918 | Bacteria | 1656 |
| 689 | Ga0496115_0212947 | 3300048918 | Bacteria | 1596 |
| 690 | Ga0496115_0434223 | 3300048918 | Bacteria | 1062 |
| 691 | Ga0496117_0037727 | 3300048920 | Bacteria | 3595 |
| 692 | Ga0496118_0078175 | 3300048921 | Bacteria | 2342 |
| 693 | Ga0496125_0205690 | 3300048928 | Bacteria | 1284 |
| 694 | Ga0496126_0001890 | 3300048929 | Bacteria | 30241 |
| 695 | Ga0496126_0517092 | 3300048929 | Bacteria | 952 |
| 696 | Ga0501290_000271 | 3300049513 | Bacteria | 8525 |
| 697 | Ga0501292_000003 | 3300049515 | Bacteria | 161908 |
| 698 | Ga0501294_000455 | 3300049517 | Bacteria | 4826 |
| 699 | Ga0501300_000439 | 3300049523 | Bacteria | 6324 |
| 700 | Ga0501032_0004263 | 3300049569 | Bacteria | 10800 |
| 701 | Ga0501032_0021362 | 3300049569 | Bacteria | 4499 |
| 702 | Ga0501032_0091875 | 3300049569 | Bacteria | 2013 |
| 703 | Ga0501032_0099781 | 3300049569 | Bacteria | 1923 |
| 704 | Ga0501032_0106862 | 3300049569 | Bacteria | 1853 |
| 705 | Ga0501032_0140434 | 3300049569 | Bacteria | 1591 |
| 706 | Ga0501032_0341181 | 3300049569 | Bacteria | 965 |
| 707 | Ga0501032_0493815 | 3300049569 | Bacteria | 782 |
| 708 | Ga0501033_0033047 | 3300049570 | Bacteria | 3884 |
| 709 | Ga0501033_0043744 | 3300049570 | Bacteria | 3334 |
| 710 | Ga0501033_0086125 | 3300049570 | Bacteria | 2300 |
| 711 | Ga0501033_0110581 | 3300049570 | Bacteria | 2000 |
| 712 | Ga0501033_0216789 | 3300049570 | Bacteria | 1363 |
| 713 | Ga0501033_0258270 | 3300049570 | Bacteria | 1233 |
| 714 | Ga0501034_0001899 | 3300049571 | Bacteria | 26478 |
| 715 | Ga0501034_0024465 | 3300049571 | Bacteria | 6144 |
| 716 | Ga0501034_0025674 | 3300049571 | Bacteria | 6000 |
| 717 | Ga0501034_0045159 | 3300049571 | Bacteria | 4453 |
| 718 | Ga0501034_0052705 | 3300049571 | Bacteria | 4098 |
| 719 | Ga0501034_0081133 | 3300049571 | Bacteria | 3246 |
| 720 | Ga0501034_0093965 | 3300049571 | Bacteria | 2995 |
| 721 | Ga0501034_0143844 | 3300049571 | Bacteria | 2363 |
| 722 | Ga0501034_0243790 | 3300049571 | Bacteria | 1742 |
| 723 | Ga0501034_0571233 | 3300049571 | Bacteria | 1038 |
| 724 | Ga0501036_0003218 | 3300049572 | Bacteria | 13028 |
| 725 | Ga0501036_0020141 | 3300049572 | Bacteria | 5601 |
| 726 | Ga0501036_0067993 | 3300049572 | Bacteria | 3014 |
| 727 | Ga0501036_0075584 | 3300049572 | Bacteria | 2848 |
| 728 | Ga0501036_0247731 | 3300049572 | Bacteria | 1493 |
| 729 | Ga0501036_0648907 | 3300049572 | Bacteria | 874 |
| 730 | Ga0501037_0229598 | 3300049573 | Bacteria | 1303 |
| 731 | Ga0501037_0238688 | 3300049573 | Bacteria | 1274 |
| 732 | Ga0501038_0050512 | 3300049574 | Bacteria | 3592 |
| 733 | Ga0501038_0061324 | 3300049574 | Bacteria | 3216 |
| 734 | Ga0501038_0100002 | 3300049574 | Bacteria | 2417 |
| 735 | Ga0501038_0129631 | 3300049574 | Bacteria | 2072 |
| 736 | Ga0501038_0153588 | 3300049574 | Bacteria | 1875 |
| 737 | Ga0501038_0536318 | 3300049574 | Bacteria | 891 |
| 738 | Ga0501038_0566408 | 3300049574 | Bacteria | 862 |
| 739 | Ga0501039_0120913 | 3300049575 | Bacteria | 2052 |
| 740 | Ga0501039_0138114 | 3300049575 | Bacteria | 1914 |
| 741 | Ga0501040_0027148 | 3300049576 | Bacteria | 3853 |
| 742 | Ga0501042_0018714 | 3300049578 | Bacteria | 4800 |
| 743 | Ga0501042_0052098 | 3300049578 | Bacteria | 2919 |
| 744 | Ga0501042_0176734 | 3300049578 | Bacteria | 1540 |
| 745 | Ga0501042_0251988 | 3300049578 | Bacteria | 1274 |
| 746 | Ga0501043_0000380 | 3300049579 | Bacteria | 40427 |
| 747 | Ga0501043_0021924 | 3300049579 | Bacteria | 5009 |
| 748 | Ga0501043_0030658 | 3300049579 | Bacteria | 4227 |
| 749 | Ga0501043_0059130 | 3300049579 | Bacteria | 3007 |
| 750 | Ga0501043_0085612 | 3300049579 | Bacteria | 2476 |
| 751 | Ga0501043_0223860 | 3300049579 | Bacteria | 1455 |
| 752 | Ga0501043_0291908 | 3300049579 | Bacteria | 1248 |
| 753 | Ga0501046_0010856 | 3300049580 | Bacteria | 7807 |
| 754 | Ga0501046_0011538 | 3300049580 | Bacteria | 7555 |
| 755 | Ga0501046_0012127 | 3300049580 | Bacteria | 7348 |
| 756 | Ga0501046_0266618 | 3300049580 | Bacteria | 1257 |
| 757 | Ga0501046_0296737 | 3300049580 | Bacteria | 1181 |
| 758 | Ga0501047_0007528 | 3300049581 | Bacteria | 10253 |
| 759 | Ga0501047_0018522 | 3300049581 | Bacteria | 6677 |
| 760 | Ga0501047_0020095 | 3300049581 | Bacteria | 6413 |
| 761 | Ga0501047_0045295 | 3300049581 | Bacteria | 4253 |
| 762 | Ga0501047_0091556 | 3300049581 | Bacteria | 2919 |
| 763 | Ga0501047_0115158 | 3300049581 | Bacteria | 2570 |
| 764 | Ga0501047_0133669 | 3300049581 | Bacteria | 2361 |
| 765 | Ga0501047_0245573 | 3300049581 | Bacteria | 1639 |
| 766 | Ga0501047_0304642 | 3300049581 | Bacteria | 1435 |
| 767 | Ga0501047_0465015 | 3300049581 | Bacteria | 1093 |
| 768 | Ga0501048_0000424 | 3300049582 | Bacteria | 29683 |
| 769 | Ga0501048_0037378 | 3300049582 | Bacteria | 3486 |
| 770 | Ga0501048_0241404 | 3300049582 | Bacteria | 1282 |
| 771 | Ga0501067_0000224 | 3300049583 | Bacteria | 31442 |
| 772 | Ga0501067_0003270 | 3300049583 | Bacteria | 8920 |
| 773 | Ga0501067_0234834 | 3300049583 | Bacteria | 1020 |
| 774 | Ga0501068_0006315 | 3300049584 | Bacteria | 6528 |
| 775 | Ga0501069_0000251 | 3300049585 | Bacteria | 24244 |
| 776 | Ga0501069_0034265 | 3300049585 | Bacteria | 2796 |
| 777 | Ga0501069_0080190 | 3300049585 | Bacteria | 1838 |
| 778 | Ga0501069_0336743 | 3300049585 | Bacteria | 888 |
| 779 | Ga0501070_0003929 | 3300049586 | Bacteria | 12811 |
| 780 | Ga0501070_0007814 | 3300049586 | Bacteria | 9066 |
| 781 | Ga0501070_0009582 | 3300049586 | Bacteria | 8180 |
| 782 | Ga0501070_0035482 | 3300049586 | Bacteria | 4167 |
| 783 | Ga0501070_0077965 | 3300049586 | Bacteria | 2742 |
| 784 | Ga0501070_0194580 | 3300049586 | Bacteria | 1666 |
| 785 | Ga0501070_0574693 | 3300049586 | Bacteria | 900 |
| 786 | Ga0501071_0024156 | 3300049587 | Bacteria | 4250 |
| 787 | Ga0501071_0087704 | 3300049587 | Bacteria | 2283 |
| 788 | Ga0501071_0281177 | 3300049587 | Bacteria | 1259 |
| 789 | Ga0501072_0379588 | 3300049588 | Bacteria | 1121 |
| 790 | Ga0501073_0005963 | 3300049589 | Bacteria | 9091 |
| 791 | Ga0501073_0011271 | 3300049589 | Bacteria | 6540 |
| 792 | Ga0501073_0035524 | 3300049589 | Bacteria | 3542 |
| 793 | Ga0501073_0049686 | 3300049589 | Bacteria | 2940 |
| 794 | Ga0501073_0111398 | 3300049589 | Bacteria | 1898 |
| 795 | Ga0501073_0161388 | 3300049589 | Bacteria | 1553 |
| 796 | Ga0501073_0194619 | 3300049589 | Bacteria | 1402 |
| 797 | Ga0501073_0363937 | 3300049589 | Bacteria | 999 |
| 798 | Ga0501074_0006850 | 3300049590 | Bacteria | 8232 |
| 799 | Ga0501074_0015486 | 3300049590 | Bacteria | 5543 |
| 800 | Ga0501074_0082702 | 3300049590 | Bacteria | 2302 |
| 801 | Ga0501074_0104132 | 3300049590 | Bacteria | 2031 |
| 802 | Ga0501074_0359330 | 3300049590 | Bacteria | 1033 |
| 803 | Ga0501076_0347310 | 3300049592 | Bacteria | 1218 |
| 804 | Ga0501077_0139924 | 3300049593 | Bacteria | 1535 |
| 805 | Ga0501206_004121 | 3300049653 | Bacteria | 1845 |
| 806 | Ga0501222_000807 | 3300049662 | Bacteria | 4505 |
| 807 | Ga0501223_000796 | 3300049663 | Bacteria | 7476 |
| 808 | Ga0501224_001001 | 3300049664 | Bacteria | 3662 |
| 809 | Ga0501227_001098 | 3300049665 | Bacteria | 6021 |
| 810 | Ga0501252_008839 | 3300049682 | Bacteria | 1165 |
| 811 | Ga0501257_020712 | 3300049686 | Bacteria | 1546 |
| 812 | Ga0501259_000913 | 3300049688 | Bacteria | 4870 |
| 813 | Ga0501261_000066 | 3300049690 | Bacteria | 18533 |
| 814 | Ga0501225_0016325 | 3300049705 | Bacteria | 2064 |
| 815 | Ga0501079_0096855 | 3300049741 | Bacteria | 2287 |
| 816 | Ga0501079_0377315 | 3300049741 | Bacteria | 1112 |
| 817 | Ga0501079_0633420 | 3300049741 | Bacteria | 842 |
| 818 | Ga0501080_0000112 | 3300049742 | Bacteria | 56408 |
| 819 | Ga0501080_0003244 | 3300049742 | Bacteria | 14351 |
| 820 | Ga0501080_0018241 | 3300049742 | Bacteria | 6494 |
| 821 | Ga0501080_0056888 | 3300049742 | Bacteria | 3641 |
| 822 | Ga0501080_0130513 | 3300049742 | Bacteria | 2326 |
| 823 | Ga0501080_0225582 | 3300049742 | Bacteria | 1713 |
| 824 | Ga0501083_0007146 | 3300049744 | Bacteria | 7928 |
| 825 | Ga0501083_0010656 | 3300049744 | Bacteria | 6469 |
| 826 | Ga0501083_0046768 | 3300049744 | Bacteria | 2925 |
| 827 | Ga0501083_0068040 | 3300049744 | Bacteria | 2370 |
| 828 | Ga0501083_0173071 | 3300049744 | Bacteria | 1411 |
| 829 | Ga0501241_051067 | 3300049758 | Bacteria | 817 |
| 830 | Ga0501279_000040 | 3300049775 | Bacteria | 29044 |
| 831 | Ga0501280_000144 | 3300049776 | Bacteria | 18384 |
| 832 | Ga0501281_00385 | 3300049777 | Bacteria | 4428 |
| 833 | Ga0501282_000071 | 3300049778 | Bacteria | 12013 |
| 834 | Ga0501035_0014537 | 3300049822 | Bacteria | 7267 |
| 835 | Ga0501035_0025766 | 3300049822 | Bacteria | 5390 |
| 836 | Ga0501035_0027254 | 3300049822 | Bacteria | 5222 |
| 837 | Ga0501035_0029360 | 3300049822 | Bacteria | 5014 |
| 838 | Ga0501035_0351949 | 3300049822 | Bacteria | 1232 |
| 839 | Ga0501044_0000658 | 3300049823 | Bacteria | 41690 |
| 840 | Ga0501044_0003453 | 3300049823 | Bacteria | 17799 |
| 841 | Ga0501044_0020081 | 3300049823 | Bacteria | 7133 |
| 842 | Ga0501044_0025440 | 3300049823 | Bacteria | 6273 |
| 843 | Ga0501044_0057121 | 3300049823 | Bacteria | 4005 |
| 844 | Ga0501044_0062271 | 3300049823 | Bacteria | 3813 |
| 845 | Ga0501044_0068185 | 3300049823 | Bacteria | 3624 |
| 846 | Ga0501044_0193914 | 3300049823 | Bacteria | 1992 |
| 847 | Ga0501044_0217258 | 3300049823 | Bacteria | 1863 |
| 848 | Ga0501044_0279089 | 3300049823 | Bacteria | 1605 |
| 849 | Ga0501044_0751910 | 3300049823 | Bacteria | 857 |
| 850 | Ga0501045_0056418 | 3300049824 | Bacteria | 2872 |
| 851 | Ga0501045_0093089 | 3300049824 | Bacteria | 2229 |
| 852 | nmdc:mga03683_27069_c1 | 3300050489 | Bacteria | 2267 |
| 853 | nmdc:mga00v17_385813_c1 | 3300050491 | Bacteria | 911 |
| 854 | nmdc:mga0yw44_30437_c1 | 3300050492 | Bacteria | 3128 |
| 855 | nmdc:mga0k408_2287_c1 | 3300050493 | Bacteria | 10222 |
| 856 | nmdc:mga0k408_95314_c1 | 3300050493 | Bacteria | 1751 |
| 857 | nmdc:mga05p37_43907_c1 | 3300050507 | Bacteria | 5499 |
| 858 | nmdc:mga05p37_751430_c1 | 3300050507 | Bacteria | 1075 |
| 859 | nmdc:mga09592_503163_c1 | 3300050508 | Bacteria | 1043 |
| 860 | nmdc:mga06r32_207952_c1 | 3300050510 | Bacteria | 1945 |
| 861 | nmdc:mga06r32_213150_c1 | 3300050510 | Bacteria | 1919 |
| 862 | nmdc:mga08y16_303449_c1 | 3300050511 | Bacteria | 1645 |
| 863 | nmdc:mga08y16_44774_c1 | 3300050511 | Bacteria | 4638 |
| 864 | nmdc:mga08y16_636227_c1 | 3300050511 | Bacteria | 1072 |
| 865 | nmdc:mga0n895_125963_c1 | 3300050512 | Bacteria | 2585 |
| 866 | nmdc:mga0n895_2174_c1 | 3300050512 | Bacteria | 15166 |
| 867 | nmdc:mga0n895_72521_c1 | 3300050512 | Bacteria | 3416 |
| 868 | nmdc:mga0rr50_19771_c1 | 3300050513 | Bacteria | 4555 |
| 869 | nmdc:mga08x19_59086_c1 | 3300050514 | Bacteria | 2482 |
| 870 | nmdc:mga0a205_325893_c1 | 3300050515 | Bacteria | 1406 |
| 871 | nmdc:mga0a205_62019_c1 | 3300050515 | Bacteria | 3612 |
| 872 | Ga0495601_0000947 | 3300053077 | Bacteria | 15805 |
| 873 | Ga0495601_0015896 | 3300053077 | Bacteria | 4554 |
| 874 | Ga0495601_0028555 | 3300053077 | Bacteria | 3456 |
| 875 | Ga0495601_0031852 | 3300053077 | Bacteria | 3279 |
| 876 | Ga0495612_0000797 | 3300053078 | Bacteria | 12820 |
| 877 | Ga0495612_0004285 | 3300053078 | Bacteria | 5921 |
| 878 | Ga0495612_0059162 | 3300053078 | Bacteria | 1584 |
| 879 | Ga0495612_0092251 | 3300053078 | Bacteria | 1284 |
| 880 | Ga0495655_0017666 | 3300053083 | Bacteria | 1557 |
| 881 | Ga0495595_0001078 | 3300053084 | Bacteria | 10554 |
| 882 | Ga0495595_0035101 | 3300053084 | Bacteria | 2271 |
| 883 | Ga0495595_0173151 | 3300053084 | Bacteria | 1069 |
| 884 | Ga0495595_0285484 | 3300053084 | Bacteria | 829 |
| 885 | Ga0495619_0001656 | 3300053085 | Bacteria | 14704 |
| 886 | Ga0495619_0030530 | 3300053085 | Bacteria | 3489 |
| 887 | Ga0500643_019996 | 3300053087 | Bacteria | 2197 |
| 888 | Ga0500647_0131142 | 3300053091 | Bacteria | 1181 |
| 889 | Ga0500555_044219 | 3300053103 | Bacteria | 1233 |
| 890 | Ga0500556_0017319 | 3300053104 | Bacteria | 2256 |
| 891 | Ga0500556_0117629 | 3300053104 | Bacteria | 1035 |
| 892 | Ga0500642_0086461 | 3300053130 | Bacteria | 1445 |
| 893 | Ga0500655_000033 | 3300053133 | Bacteria | 38482 |
| 894 | Ga0500658_0002175 | 3300053134 | Bacteria | 7615 |
| 895 | Ga0500568_0000406 | 3300053139 | Bacteria | 32845 |
| 896 | Ga0500590_013244 | 3300053148 | Bacteria | 4228 |
| 897 | Ga0500604_0000583 | 3300053151 | Bacteria | 10047 |
| 898 | Ga0500616_0000084 | 3300053153 | Bacteria | 195562 |
| 899 | Ga0500616_0000161 | 3300053153 | Bacteria | 111424 |
| 900 | Ga0500616_0000805 | 3300053153 | Bacteria | 35836 |
| 901 | Ga0500616_0011661 | 3300053153 | Bacteria | 5178 |
| 902 | Ga0500616_0231333 | 3300053153 | Bacteria | 800 |
| 903 | Ga0500587_000809 | 3300053739 | Bacteria | 4080 |
| 904 | Ga0501084_0004384 | 3300054114 | Bacteria | 11505 |
| 905 | Ga0501084_0076860 | 3300054114 | Bacteria | 2799 |
| 906 | Ga0501084_0090968 | 3300054114 | Bacteria | 2562 |
| 907 | Ga0501084_0094190 | 3300054114 | Bacteria | 2514 |
| 908 | Ga0501084_0114033 | 3300054114 | Bacteria | 2272 |
| 909 | Ga0501082_0006226 | 3300060353 | Bacteria | 10361 |
| 910 | Ga0501082_0011332 | 3300060353 | Bacteria | 7664 |
| 911 | Ga0501082_0111262 | 3300060353 | Bacteria | 2370 |
| 912 | Ga0501082_0128860 | 3300060353 | Bacteria | 2195 |
| 913 | Ga0501082_0384604 | 3300060353 | Bacteria | 1224 |
| 914 | Ga0501082_0503484 | 3300060353 | Bacteria | 1059 |
| 915 | Ga0530510_0097350 | 3300061734 | Bacteria | 2151 |
| 916 | 2508735756 | 2508501050 | Bacteria | 9633614 |
| 917 | 2617913383 | 2617270889 | Bacteria | 9064343 |
| 918 | 2643755515 | 2643221547 | Bacteria | 4740017 |
| 919 | 2738946168 | 2738541317 | Bacteria | 5340176 |
| 920 | 2776259030 | 2775506901 | Bacteria | 9631051 |
| 921 | 2831428310 | 2831426010 | Bacteria | 8662725 |
| 922 | 2835313563 | 2835312727 | Bacteria | 7413381 |
| 923 | 2848698472 | 2848694841 | Bacteria | 9205737 |
| 924 | 2849666178 | 2849660919 | Bacteria | 8251853 |
| 925 | 2882461521 | 2882456835 | Bacteria | 6863978 |
| 926 | 2884299721 | 2884298095 | Bacteria | 3823049 |
| 927 | 2886633913 | 2886627955 | Bacteria | 7618130 |
| 928 | 2894240136 | 2894232714 | Bacteria | 8834183 |
| 929 | 2913311247 | 2913308742 | Bacteria | 5350706 |
| 930 | 2913845598 | 2913844669 | Bacteria | 8381711 |
| 931 | 2913917531 | 2913912277 | Bacteria | 9037797 |
| 932 | 2913941558 | 2913939268 | Bacteria | 8559644 |
| 933 | 2919455263 | 2919450847 | Bacteria | 5631160 |
| 934 | 642600782 | 642555144 | Bacteria | 9059191 |
| 935 | Ga0316576_10083949 | |||
| 936 | JGI24752J21851_1000198 | |||
| 937 | JGI24740J21852_10005460 | |||
| 938 | JGI24740J21852_10018622 | |||
| 939 | JGI24739J22299_10006428 | |||
| 940 | JGI24737J22298_10033317 | |||
| 941 | JGI24735J21928_10005974 | |||
| 942 | JGI24735J21928_10007291 | |||
| 943 | JGI24750J21931_1002769 | |||
| 944 | JGI24748J21848_1000042 | |||
| 945 | JGI24749J21850_1020066 | |||
| 946 | JGI24034J26672_10000035 | |||
| 947 | JGI24742J22300_10031650 | |||
| 948 | Ga0055540_1006853 | |||
| 949 | Ga0058859_11244916 | |||
| 950 | Ga0070658_10339213 | |||
| 951 | Ga0070690_100000009 | |||
| 952 | Ga0070690_100040895 | |||
| 953 | Ga0070670_100287174 | |||
| 954 | Ga0070677_10000155 | |||
| 955 | Ga0070666_10000006 | |||
| 956 | Ga0070666_10001803 | |||
| 957 | Ga0070680_100001660 | |||
| 958 | Ga0070680_100110382 | |||
| 959 | Ga0070680_100168740 | |||
| 960 | Ga0070682_100094964 | |||
| 961 | Ga0070660_100000064 | |||
| 962 | Ga0070660_100047236 | |||
| 963 | Ga0070660_100109866 | |||
| 964 | Ga0070660_100276101 | |||
| 965 | Ga0070660_100307567 | |||
| 966 | Ga0070660_100412668 | |||
| 967 | Ga0070689_100012742 | |||
| 968 | Ga0070689_100179282 | |||
| 969 | Ga0070691_10016128 | |||
| 970 | Ga0070687_100071737 | |||
| 971 | Ga0070687_100225626 | |||
| 972 | Ga0070661_100004993 | |||
| 973 | Ga0070668_100000539 | |||
| 974 | Ga0070668_100036683 | |||
| 975 | Ga0070668_100083683 | |||
| 976 | Ga0070668_100397584 | |||
| 977 | Ga0070669_100000095 | |||
| 978 | Ga0070669_100000280 | |||
| 979 | Ga0070675_100061783 | |||
| 980 | Ga0070675_100310794 | |||
| 981 | Ga0070671_100000005 | |||
| 982 | Ga0070671_100067244 | |||
| 983 | Ga0070671_100186306 | |||
| 984 | Ga0070674_100016308 | |||
| 985 | Ga0070673_100083073 | |||
| 986 | Ga0070688_100004996 | |||
| 987 | Ga0070688_100045907 | |||
| 988 | Ga0070659_100017634 | |||
| 989 | Ga0070659_100132082 | |||
| 990 | Ga0070659_100209567 | |||
| 991 | Ga0070667_100021629 | |||
| 992 | Ga0070667_100207098 | |||
| 993 | Ga0070714_100432594 | |||
| 994 | Ga0070713_100368594 | |||
| 995 | Ga0070710_10187201 | |||
| 996 | Ga0070700_100025794 | |||
| 997 | Ga0070694_100187145 | |||
| 998 | Ga0070708_100021449 | |||
| 999 | Ga0070663_100050356 | |||
| 1000 | Ga0070663_100645155 | |||
| 1001 | Ga0070678_100049859 | |||
| 1002 | Ga0070662_100251530 | |||
| 1003 | Ga0070681_10013407 | |||
| 1004 | Ga0070681_10024397 | |||
| 1005 | Ga0070681_10046789 | |||
| 1006 | Ga0070681_10167330 | |||
| 1007 | Ga0070681_10194105 | |||
| 1008 | Ga0070681_10199336 | |||
| 1009 | Ga0070681_10272796 | |||
| 1010 | Ga0070681_10506439 | |||
| 1011 | Ga0070685_10000155 | |||
| 1012 | Ga0070707_100136600 | |||
| 1013 | Ga0070707_100332576 | |||
| 1014 | Ga0070698_100003881 | |||
| 1015 | Ga0070699_100082691 | |||
| 1016 | Ga0070679_100108824 | |||
| 1017 | Ga0070679_100165670 | |||
| 1018 | Ga0070679_100245169 | |||
| 1019 | Ga0070684_100153420 | |||
| 1020 | Ga0070697_100298596 | |||
| 1021 | Ga0068853_100784584 | |||
| 1022 | Ga0070686_100000091 | |||
| 1023 | Ga0070665_100000019 | |||
| 1024 | Ga0070665_100000148 | |||
| 1025 | Ga0070665_100043313 | |||
| 1026 | Ga0070665_100189335 | |||
| 1027 | Ga0068855_100016827 | |||
| 1028 | Ga0068855_100022850 | |||
| 1029 | Ga0068855_100938848 | |||
| 1030 | Ga0070664_100016307 | |||
| 1031 | Ga0070664_100486215 | |||
| 1032 | Ga0068854_100459371 | |||
| 1033 | Ga0068854_100504303 | |||
| 1034 | Ga0068856_100490559 | |||
| 1035 | Ga0068852_100007430 | |||
| 1036 | Ga0068852_100042768 | |||
| 1037 | Ga0068852_100092276 | |||
| 1038 | Ga0068852_100639984 | |||
| 1039 | Ga0068859_100022381 | |||
| 1040 | Ga0068859_100213616 | |||
| 1041 | Ga0068861_100012358 | |||
| 1042 | Ga0068851_10077419 | |||
| 1043 | Ga0068863_100000118 | |||
| 1044 | Ga0068863_100014260 | |||
| 1045 | Ga0068863_100316090 | |||
| 1046 | Ga0068863_100523847 | |||
| 1047 | Ga0068858_100000723 | |||
| 1048 | Ga0068858_100002727 | |||
| 1049 | Ga0068858_100005339 | |||
| 1050 | Ga0068860_100000014 | |||
| 1051 | Ga0068860_100001093 | |||
| 1052 | Ga0068860_100134992 | |||
| 1053 | Ga0068862_100000014 | |||
| 1054 | Ga0068862_100000503 | |||
| 1055 | Ga0068862_100001001 | |||
| 1056 | Ga0081455_10002509 | |||
| 1057 | Ga0081455_10064681 | |||
| 1058 | Ga0081538_10068599 | |||
| 1059 | Ga0081540_1014204 | |||
| 1060 | Ga0081539_10014301 | |||
| 1061 | Ga0070717_10854828 | |||
| 1062 | Ga0075365_10015277 | |||
| 1063 | Ga0070712_100001034 | |||
| 1064 | Ga0070712_100511112 | |||
| 1065 | Ga0075367_10178454 | |||
| 1066 | Ga0075367_10298417 | |||
| 1067 | Ga0075366_10003290 | |||
| 1068 | Ga0075366_10019985 | |||
| 1069 | Ga0068871_100359928 | |||
| 1070 | Ga0075428_100205281 | |||
| 1071 | Ga0075428_100311554 | |||
| 1072 | Ga0075431_100020447 | |||
| 1073 | Ga0075431_100058054 | |||
| 1074 | Ga0075433_10052600 | |||
| 1075 | Ga0075433_10124576 | |||
| 1076 | Ga0075434_100000986 | |||
| 1077 | Ga0075434_100074790 | |||
| 1078 | Ga0075434_100465951 | |||
| 1079 | Ga0075429_100057848 | |||
| 1080 | Ga0075436_100065280 | |||
| 1081 | Ga0097620_100022380 | |||
| 1082 | Ga0097620_100213618 | |||
| 1083 | Ga0075435_100036045 | |||
| 1084 | Ga0075435_100345783 | |||
| 1085 | Ga0105240_10295843 | |||
| 1086 | Ga0105240_10597732 | |||
| 1087 | Ga0105240_10678746 | |||
| 1088 | Ga0111539_10335230 | |||
| 1089 | Ga0111539_10422510 | |||
| 1090 | Ga0105245_10133351 | |||
| 1091 | Ga0105247_10000830 | |||
| 1092 | Ga0105247_10039951 | |||
| 1093 | Ga0105247_10093791 | |||
| 1094 | Ga0105247_10115726 | |||
| 1095 | Ga0105247_10151643 | |||
| 1096 | Ga0114129_10054562 | |||
| 1097 | Ga0114129_11134092 | |||
| 1098 | Ga0105243_10138496 | |||
| 1099 | Ga0105242_10096458 | |||
| 1100 | Ga0105248_10028861 | |||
| 1101 | Ga0105248_10056676 | |||
| 1102 | Ga0105237_10047573 | |||
| 1103 | Ga0105237_10078994 | |||
| 1104 | Ga0105238_10416014 | |||
| 1105 | Ga0105238_10454160 | |||
| 1106 | Ga0105249_10000002 | |||
| 1107 | Ga0105249_10000035 | |||
| 1108 | Ga0105249_10385060 | |||
| 1109 | Ga0105249_10416469 | |||
| 1110 | Ga0099796_10010288 | |||
| 1111 | Ga0105239_10034581 | |||
| 1112 | Ga0157373_10022779 | |||
| 1113 | Ga0157373_10105027 | |||
| 1114 | Ga0157371_10147730 | |||
| 1115 | Ga0157371_10269119 | |||
| 1116 | Ga0157370_10014955 | |||
| 1117 | Ga0157370_10028926 | |||
| 1118 | Ga0157370_10112520 | |||
| 1119 | Ga0157369_10000043 | |||
| 1120 | Ga0157369_10007581 | |||
| 1121 | Ga0157369_10094209 | |||
| 1122 | Ga0157369_10111023 | |||
| 1123 | Ga0157369_10847637 | |||
| 1124 | Ga0157374_10023802 | |||
| 1125 | Ga0157378_10333651 | |||
| 1126 | Ga0157378_10382343 | |||
| 1127 | Ga0163162_10014044 | |||
| 1128 | Ga0163162_10036563 | |||
| 1129 | Ga0163162_10114980 | |||
| 1130 | Ga0163162_10154001 | |||
| 1131 | Ga0163162_10206538 | |||
| 1132 | Ga0157372_10276084 | |||
| 1133 | Ga0157375_11173984 | |||
| 1134 | Ga0163163_10005537 | |||
| 1135 | Ga0163163_10019657 | |||
| 1136 | Ga0157380_10004798 | |||
| 1137 | Ga0157380_10062201 | |||
| 1138 | Ga0157379_10008890 | |||
| 1139 | Ga0157379_10405318 | |||
| 1140 | Ga0157379_10455885 | |||
| 1141 | Ga0157379_10581161 | |||
| 1142 | Ga0182005_1064129 | |||
| 1143 | Ga0163161_10000102 | |||
| 1144 | Ga0213872_10014988 | |||
| 1145 | Ga0213874_10062776 | |||
| 1146 | Ga0213875_10150129 | |||
| 1147 | Ga0209758_1000128 | |||
| 1148 | Ga0207697_10009619 | |||
| 1149 | Ga0207697_10013327 | |||
| 1150 | Ga0207697_10055657 | |||
| 1151 | Ga0207656_10078538 | |||
| 1152 | Ga0207656_10102693 | |||
| 1153 | Ga0207682_10000147 | |||
| 1154 | Ga0207710_10022092 | |||
| 1155 | Ga0207710_10029664 | |||
| 1156 | Ga0207710_10092185 | |||
| 1157 | Ga0207710_10122998 | |||
| 1158 | Ga0207688_10002303 | |||
| 1159 | Ga0207688_10157154 | |||
| 1160 | Ga0207680_10000011 | |||
| 1161 | Ga0207680_10024594 | |||
| 1162 | Ga0207680_10201301 | |||
| 1163 | Ga0207647_10008450 | |||
| 1164 | Ga0207647_10055215 | |||
| 1165 | Ga0207647_10207689 | |||
| 1166 | Ga0207645_10022266 | |||
| 1167 | Ga0207643_10027485 | |||
| 1168 | Ga0207643_10180488 | |||
| 1169 | Ga0207705_10000033 | |||
| 1170 | Ga0207705_10180163 | |||
| 1171 | Ga0207705_10310735 | |||
| 1172 | Ga0207684_10479254 | |||
| 1173 | Ga0207654_10000285 | |||
| 1174 | Ga0207707_10016805 | |||
| 1175 | Ga0207707_10150528 | |||
| 1176 | Ga0207707_10159254 | |||
| 1177 | Ga0207707_10605427 | |||
| 1178 | Ga0207695_10002074 | |||
| 1179 | Ga0207671_10012192 | |||
| 1180 | Ga0207693_10009479 | |||
| 1181 | Ga0207693_10017330 | |||
| 1182 | Ga0207693_10042503 | |||
| 1183 | Ga0207693_10078129 | |||
| 1184 | Ga0207693_10205671 | |||
| 1185 | Ga0207660_10002059 | |||
| 1186 | Ga0207660_10029613 | |||
| 1187 | Ga0207660_10245440 | |||
| 1188 | Ga0207662_10221508 | |||
| 1189 | Ga0207657_10091569 | |||
| 1190 | Ga0207657_10168929 | |||
| 1191 | Ga0207649_10000444 | |||
| 1192 | Ga0207649_10074284 | |||
| 1193 | Ga0207649_10100090 | |||
| 1194 | Ga0207652_10188151 | |||
| 1195 | Ga0207646_10214716 | |||
| 1196 | Ga0207681_10000096 | |||
| 1197 | Ga0207681_10000112 | |||
| 1198 | Ga0207681_10021738 | |||
| 1199 | Ga0207681_10323687 | |||
| 1200 | Ga0207694_10004187 | |||
| 1201 | Ga0207694_10198752 | |||
| 1202 | Ga0207687_10019713 | |||
| 1203 | Ga0207687_10051601 | |||
| 1204 | Ga0207700_10023911 | |||
| 1205 | Ga0207664_10286062 | |||
| 1206 | Ga0207664_10878560 | |||
| 1207 | Ga0207644_10000008 | |||
| 1208 | Ga0207644_10009210 | |||
| 1209 | Ga0207644_10014179 | |||
| 1210 | Ga0207644_10351399 | |||
| 1211 | Ga0207690_10011704 | |||
| 1212 | Ga0207706_10109808 | |||
| 1213 | Ga0207706_10123536 | |||
| 1214 | Ga0207706_10278816 | |||
| 1215 | Ga0207706_10298024 | |||
| 1216 | Ga0207686_10076118 | |||
| 1217 | Ga0207686_10127490 | |||
| 1218 | Ga0207709_10252546 | |||
| 1219 | Ga0207670_10006506 | |||
| 1220 | Ga0207670_10061467 | |||
| 1221 | Ga0207704_10249315 | |||
| 1222 | Ga0207665_10370326 | |||
| 1223 | Ga0207691_10042109 | |||
| 1224 | Ga0207691_10429741 | |||
| 1225 | Ga0207711_10020384 | |||
| 1226 | Ga0207711_10056159 | |||
| 1227 | Ga0207711_10165981 | |||
| 1228 | Ga0207689_10072495 | |||
| 1229 | Ga0207661_10174628 | |||
| 1230 | Ga0207661_10349253 | |||
| 1231 | Ga0207679_10029237 | |||
| 1232 | Ga0207679_10191126 | |||
| 1233 | Ga0207667_10007324 | |||
| 1234 | Ga0207667_10012362 | |||
| 1235 | Ga0207667_10022285 | |||
| 1236 | Ga0207667_10042471 | |||
| 1237 | Ga0207667_10074478 | |||
| 1238 | Ga0207651_10109481 | |||
| 1239 | Ga0207712_10000002 | |||
| 1240 | Ga0207712_10000013 | |||
| 1241 | Ga0207712_10079828 | |||
| 1242 | Ga0207668_10007115 | |||
| 1243 | Ga0207668_10066392 | |||
| 1244 | Ga0207668_10096978 | |||
| 1245 | Ga0207640_10063192 | |||
| 1246 | Ga0207640_10215809 | |||
| 1247 | Ga0207640_10591692 | |||
| 1248 | Ga0207658_10000689 | |||
| 1249 | Ga0207658_10102311 | |||
| 1250 | Ga0207658_10163505 | |||
| 1251 | Ga0207703_10001006 | |||
| 1252 | Ga0207703_10009748 | |||
| 1253 | Ga0207703_10013788 | |||
| 1254 | Ga0207703_10136533 | |||
| 1255 | Ga0207639_10043651 | |||
| 1256 | Ga0207639_10261723 | |||
| 1257 | Ga0207639_10616822 | |||
| 1258 | Ga0207678_10320833 | |||
| 1259 | Ga0207708_10036299 | |||
| 1260 | Ga0207708_10043986 | |||
| 1261 | Ga0207702_10007648 | |||
| 1262 | Ga0207702_10307501 | |||
| 1263 | Ga0207641_10000101 | |||
| 1264 | Ga0207641_10003069 | |||
| 1265 | Ga0207676_10001834 | |||
| 1266 | Ga0207674_10030099 | |||
| 1267 | Ga0207674_10039328 | |||
| 1268 | Ga0207674_10231985 | |||
| 1269 | Ga0207674_10445601 | |||
| 1270 | Ga0207674_10581922 | |||
| 1271 | Ga0207675_100011489 | |||
| 1272 | Ga0207675_100118534 | |||
| 1273 | Ga0207683_10095843 | |||
| 1274 | Ga0207683_10148744 | |||
| 1275 | Ga0207698_10001849 | |||
| 1276 | Ga0207698_10013844 | |||
| 1277 | Ga0207698_10038387 | |||
| 1278 | Ga0268266_10000025 | |||
| 1279 | Ga0268266_10000626 | |||
| 1280 | Ga0268266_10108335 | |||
| 1281 | Ga0268266_10137786 | |||
| 1282 | Ga0268266_10942846 | |||
| 1283 | Ga0268265_10000048 | |||
| 1284 | Ga0268265_10000316 | |||
| 1285 | Ga0268265_10000975 | |||
| 1286 | Ga0268264_10000037 | |||
| 1287 | Ga0268264_10000439 | |||
| 1288 | Ga0268264_10161279 | |||
| 1289 | Ga0265760_10026725 | |||
| 1290 | Ga0265328_10070937 | |||
| 1291 | Ga0265329_10046276 | |||
| 1292 | Ga0265340_10022791 | |||
| 1293 | Ga0265340_10029387 | |||
| 1294 | Ga0265339_10058674 | |||
| 1295 | Ga0265339_10195298 | |||
| 1296 | Ga0265331_10002807 | |||
| 1297 | Ga0265331_10019075 | |||
| 1298 | Ga0307513_10494841 | |||
| 1299 | Ga0265313_10000021 | |||
| 1300 | Ga0316575_10106133 | |||
| 1301 | Ga0316579_10153587 | |||
| 1302 | Ga0265314_10000279 | |||
| 1303 | Ga0265314_10025954 | |||
| 1304 | Ga0265314_10058157 | |||
| 1305 | Ga0265342_10009824 | |||
| 1306 | Ga0265342_10065920 | |||
| 1307 | Ga0316578_10038730 | |||
| 1308 | Ga0307405_10555396 | |||
| 1309 | Ga0307413_10220122 | |||
| 1310 | Ga0307412_10144788 | |||
| 1311 | Ga0307412_10225018 | |||
| 1312 | Ga0307412_10302574 | |||
| 1313 | Ga0307409_100079291 | |||
| 1314 | Ga0307414_10057088 | |||
| 1315 | Ga0307414_10071542 | |||
| 1316 | Ga0307414_10229974 | |||
| 1317 | Ga0307411_10563347 | |||
| 1318 | Ga0307415_100252775 | |||
| 1319 | Ga0316583_10001287 | |||
| 1320 | Ga0316593_10033295 | |||
| 1321 | Ga0307510_10000248 | |||
| 1322 | Ga0316592_1012612 | |||
| 1323 | Ga0316592_1056016 | |||
| 1324 | Ga0373930_0035672 | |||
| 1325 | Ga0373958_0024349 | |||
| 1326 | Ga0373959_0045163 | |||
| 1327 | Ga0373938_0090185 | |||
| 1328 | Ga0373926_0005063 | |||
| 1329 | Ga0373926_0008334 | |||
| 1330 | Ga0373929_0012346 | |||
| 1331 | Ga0373940_0080405 | |||
| 1332 | Ga0373944_0002213 | |||
| 1333 | Ga0373923_0041409 | |||
| 1334 | Ga0373923_0050859 | |||
| 1335 | Ga0373923_0085332 | |||
| 1336 | Ga0373932_0151554 | |||
| 1337 | Ga0373936_0067593 | |||
| 1338 | Ga0373941_0090086 | |||
| 1339 | Ga0373945_0012237 | |||
| 1340 | Ga0373953_0213947 | |||
| 1341 | Ga0373954_0039018 | |||
| 1342 | Ga0373954_0127770 | |||
| 1343 | Ga0373957_0204054 | |||
| 1344 | Ga0373943_0000038 | |||
| 1345 | Ga0373943_0006907 | |||
| 1346 | Ga0373943_0084078 | |||
| 1347 | Ga0373946_0003198 | |||
| 1348 | Ga0373955_0045922 | |||
| 1349 | Ga0373955_0173865 | |||
| 1350 | Ga0373942_0052239 | |||
| 1351 | Ga0373961_0028678 | |||
| 1352 | Ga0316574_0473080 | |||
| 1353 | Ga0373924_0043034 | |||
| 1354 | Ga0373931_0197657 | |||
| 1355 | Ga0373931_0381779 | |||
| 1356 | Ga0373931_0393176 | |||
| 1357 | Ga0373935_0274025 | |||
| 1358 | Ga0373935_0297920 | |||
| 1359 | Ga0373927_0000651 | |||
| 1360 | Ga0373927_0025823 | |||
| 1361 | Ga0373927_0230645 | |||
| 1362 | Ga0373927_0263089 | |||
| 1363 | Ga0373933_0024606 | |||
| 1364 | Ga0373947_0000024 | |||
| 1365 | Ga0373947_0013366 | |||
| 1366 | Ga0373947_0091793 | |||
| 1367 | Ga0373947_0094215 | |||
| 1368 | Ga0373947_0131845 | |||
| 1369 | Ga0373937_0005793 | |||
| 1370 | Ga0373937_0020159 | |||
| 1371 | Ga0373937_0580248 | |||
| 1372 | Ga0316582_0018667 | |||
| 1373 | Ga0316584_0007550 | |||
| 1374 | Ga0373925_0018395 | |||
| 1375 | Ga0373925_0153430 | |||
| 1376 | Ga0373925_0491408 | |||
| 1377 | Ga0395899_0000137 | |||
| 1378 | Ga0395899_0125111 | |||
| 1379 | Ga0395900_0000108 | |||
| 1380 | Ga0395900_0018679 | |||
| 1381 | Ga0395900_0032943 | |||
| 1382 | Ga0395900_0034968 | |||
| 1383 | Ga0395900_0043072 | |||
| 1384 | Ga0395900_0045893 | |||
| 1385 | Ga0395900_0170835 | |||
| 1386 | Ga0395898_0000632 | |||
| 1387 | Ga0395898_0024358 | |||
| 1388 | Ga0395898_0044477 | |||
| 1389 | Ga0395898_0053895 | |||
| 1390 | Ga0395905_0000780 | |||
| 1391 | Ga0395905_0096596 | |||
| 1392 | Ga0436364_0013094 | |||
| 1393 | Ga0436364_0195157 | |||
| 1394 | Ga0436364_0526272 | |||
| 1395 | Ga0436364_1108265 | |||
| 1396 | Ga0395901_0000050 | |||
| 1397 | Ga0395901_0000086 | |||
| 1398 | Ga0395901_0026198 | |||
| 1399 | Ga0395901_0051291 | |||
| 1400 | Ga0395901_0244060 | |||
| 1401 | Ga0395901_0390029 | |||
| 1402 | Ga0395901_0485823 | |||
| 1403 | Ga0400483_136809 | |||
| 1404 | Ga0400483_206045 | |||
| 1405 | Ga0436365_1896329 | |||
| 1406 | Ga0436360_0048356 | |||
| 1407 | Ga0436360_1007073 | |||
| 1408 | Ga0436361_0009329 | |||
| 1409 | Ga0436361_0194635 | |||
| 1410 | Ga0436361_0231853 | |||
| 1411 | Ga0436361_0770494 | |||
| 1412 | Ga0436363_0211911 | |||
| 1413 | Ga0436363_0576058 | |||
| 1414 | Ga0439448_0027222 | |||
| 1415 | Ga0439448_0160677 | |||
| 1416 | Ga0439456_017035 | |||
| 1417 | Ga0453683_0002196 | |||
| 1418 | Ga0466966_0020726 | |||
| 1419 | Ga0466961_0012256 | |||
| 1420 | Ga0466963_0034953 | |||
| 1421 | Ga0466963_0068019 | |||
| 1422 | Ga0453684_0028704 | |||
| 1423 | Ga0453684_0105894 | |||
| 1424 | Ga0453684_0494753 | |||
| 1425 | Ga0453684_0870126 | |||
| 1426 | Ga0466971_0017973 | |||
| 1427 | Ga0466970_0009668 | |||
| 1428 | Ga0466957_0055470 | |||
| 1429 | Ga0466960_0134560 | |||
| 1430 | Ga0466959_0008062 | |||
| 1431 | Ga0451576_0001224 | |||
| 1432 | Ga0451576_0004466 | |||
| 1433 | Ga0451576_0012315 | |||
| 1434 | Ga0451576_0156267 | |||
| 1435 | Ga0451576_0186575 | |||
| 1436 | Ga0466958_0002196 | |||
| 1437 | Ga0466967_0032500 | |||
| 1438 | Ga0466967_0438975 | |||
| 1439 | Ga0495592_0008885 | |||
| 1440 | Ga0495603_0022743 | |||
| 1441 | Ga0495603_0098291 | |||
| 1442 | Ga0495629_0001636 | |||
| 1443 | Ga0495629_0015778 | |||
| 1444 | Ga0495629_0412197 | |||
| 1445 | Ga0495629_0431396 | |||
| 1446 | Ga0495638_0001117 | |||
| 1447 | Ga0495638_0064102 | |||
| 1448 | Ga0495641_0037738 | |||
| 1449 | Ga0495651_0000860 | |||
| 1450 | Ga0495651_0085272 | |||
| 1451 | Ga0495653_0002396 | |||
| 1452 | Ga0495580_0082128 | |||
| 1453 | Ga0495582_0127994 | |||
| 1454 | Ga0495639_0029254 | |||
| 1455 | Ga0495662_0041905 | |||
| 1456 | Ga0495662_0215780 | |||
| 1457 | Ga0495664_0014194 | |||
| 1458 | Ga0495664_0231080 | |||
| 1459 | Ga0495584_0054269 | |||
| 1460 | Ga0495584_0182285 | |||
| 1461 | Ga0495585_0011012 | |||
| 1462 | Ga0495594_0005510 | |||
| 1463 | Ga0495607_0004756 | |||
| 1464 | Ga0495608_0002790 | |||
| 1465 | Ga0495608_0093221 | |||
| 1466 | Ga0495620_0122087 | |||
| 1467 | Ga0495628_0016517 | |||
| 1468 | Ga0495628_0322965 | |||
| 1469 | Ga0495628_0341313 | |||
| 1470 | Ga0495628_0690018 | |||
| 1471 | Ga0495630_0102927 | |||
| 1472 | Ga0495630_0121908 | |||
| 1473 | Ga0495630_0264974 | |||
| 1474 | Ga0495637_0016075 | |||
| 1475 | Ga0495637_0043659 | |||
| 1476 | Ga0495643_0080976 | |||
| 1477 | Ga0495644_0003154 | |||
| 1478 | Ga0495644_0097544 | |||
| 1479 | Ga0495648_0075932 | |||
| 1480 | Ga0495666_0020658 | |||
| 1481 | Ga0495666_0174480 | |||
| 1482 | Ga0495652_0009824 | |||
| 1483 | Ga0495652_0062137 | |||
| 1484 | Ga0495652_0381484 | |||
| 1485 | Ga0495665_0013078 | |||
| 1486 | Ga0495665_0026036 | |||
| 1487 | Ga0495640_0027323 | |||
| 1488 | Ga0495640_0039590 | |||
| 1489 | Ga0495640_0085978 | |||
| 1490 | Ga0495587_0005187 | |||
| 1491 | Ga0495645_0290115 | |||
| 1492 | Ga0495667_0001836 | |||
| 1493 | Ga0495667_0263455 | |||
| 1494 | Ga0495667_0354623 | |||
| 1495 | Ga0495656_0005971 | |||
| 1496 | Ga0495634_0016406 | |||
| 1497 | Ga0495625_0070430 | |||
| 1498 | Ga0495625_0200594 | |||
| 1499 | Ga0495635_0008770 | |||
| 1500 | Ga0495635_0241348 | |||
| 1501 | Ga0495635_0388504 | |||
| 1502 | Ga0495657_0198990 | |||
| 1503 | Ga0495599_0004247 | |||
| 1504 | Ga0495623_0002702 | |||
| 1505 | Ga0495646_0003305 | |||
| 1506 | Ga0495647_0002950 | |||
| 1507 | Ga0495647_0018044 | |||
| 1508 | Ga0495658_0014556 | |||
| 1509 | Ga0495613_0074116 | |||
| 1510 | Ga0495613_0157226 | |||
| 1511 | Ga0495624_0004781 | |||
| 1512 | Ga0495624_0086224 | |||
| 1513 | Ga0495670_0001709 | |||
| 1514 | Ga0495670_0008540 | |||
| 1515 | Ga0495670_0084260 | |||
| 1516 | Ga0495600_0157468 | |||
| 1517 | Ga0495600_0309258 | |||
| 1518 | Ga0495581_0013861 | |||
| 1519 | Ga0495581_0101832 | |||
| 1520 | Ga0495581_0158978 | |||
| 1521 | Ga0495604_0001315 | |||
| 1522 | Ga0495604_0093810 | |||
| 1523 | Ga0495674_0000145 | |||
| 1524 | Ga0495674_0106941 | |||
| 1525 | Ga0495672_0111331 | |||
| 1526 | Ga0495676_0015903 | |||
| 1527 | Ga0495676_0113249 | |||
| 1528 | Ga0495676_0130375 | |||
| 1529 | Ga0495676_0202922 | |||
| 1530 | Ga0495680_0003388 | |||
| 1531 | Ga0495680_0145384 | |||
| 1532 | Ga0495675_0003692 | |||
| 1533 | Ga0495675_0388210 | |||
| 1534 | Ga0495677_0019390 | |||
| 1535 | Ga0495684_0000209 | |||
| 1536 | Ga0495684_0022282 | |||
| 1537 | Ga0495684_0114332 | |||
| 1538 | Ga0495684_0218547 | |||
| 1539 | Ga0495602_0010058 | |||
| 1540 | Ga0495602_0357651 | |||
| 1541 | Ga0496100_0039775 | |||
| 1542 | Ga0496100_0049795 | |||
| 1543 | Ga0496100_0117889 | |||
| 1544 | Ga0496100_0373458 | |||
| 1545 | Ga0496100_0451373 | |||
| 1546 | Ga0496101_0003779 | |||
| 1547 | Ga0496101_0031548 | |||
| 1548 | Ga0496101_0371114 | |||
| 1549 | Ga0496102_0012833 | |||
| 1550 | Ga0496102_0017546 | |||
| 1551 | Ga0496102_0143856 | |||
| 1552 | Ga0496102_0169470 | |||
| 1553 | Ga0496102_0200919 | |||
| 1554 | Ga0496102_0593267 | |||
| 1555 | Ga0496103_0003334 | |||
| 1556 | Ga0496104_0002148 | |||
| 1557 | Ga0496104_0003136 | |||
| 1558 | Ga0496104_0009810 | |||
| 1559 | Ga0496104_0026954 | |||
| 1560 | Ga0496104_0042587 | |||
| 1561 | Ga0496104_0055314 | |||
| 1562 | Ga0496104_0104710 | |||
| 1563 | Ga0496104_0106466 | |||
| 1564 | Ga0496104_0232421 | |||
| 1565 | Ga0496105_0000882 | |||
| 1566 | Ga0496105_0012680 | |||
| 1567 | Ga0496105_0013528 | |||
| 1568 | Ga0496105_0017190 | |||
| 1569 | Ga0496105_0029423 | |||
| 1570 | Ga0496105_0043061 | |||
| 1571 | Ga0496105_0309730 | |||
| 1572 | Ga0496105_0421979 | |||
| 1573 | Ga0496106_0002149 | |||
| 1574 | Ga0496106_0002837 | |||
| 1575 | Ga0496106_0095642 | |||
| 1576 | Ga0496106_0193717 | |||
| 1577 | Ga0496107_0005939 | |||
| 1578 | Ga0496107_0010755 | |||
| 1579 | Ga0496107_0011930 | |||
| 1580 | Ga0496107_0033374 | |||
| 1581 | Ga0496108_0006835 | |||
| 1582 | Ga0496108_0011301 | |||
| 1583 | Ga0496108_0049348 | |||
| 1584 | Ga0496109_0005176 | |||
| 1585 | Ga0496109_0017543 | |||
| 1586 | Ga0496109_0022885 | |||
| 1587 | Ga0496109_0119498 | |||
| 1588 | Ga0496109_0128459 | |||
| 1589 | Ga0496109_0162856 | |||
| 1590 | Ga0496110_0004030 | |||
| 1591 | Ga0496110_0013474 | |||
| 1592 | Ga0496110_0034708 | |||
| 1593 | Ga0496110_0098102 | |||
| 1594 | Ga0496110_0187090 | |||
| 1595 | Ga0496110_0221215 | |||
| 1596 | Ga0496111_0010614 | |||
| 1597 | Ga0496111_0017179 | |||
| 1598 | Ga0496111_0175123 | |||
| 1599 | Ga0496111_0206854 | |||
| 1600 | Ga0496111_0273777 | |||
| 1601 | Ga0496111_0468431 | |||
| 1602 | Ga0496112_0002737 | |||
| 1603 | Ga0496112_0008660 | |||
| 1604 | Ga0496112_0034196 | |||
| 1605 | Ga0496112_0057103 | |||
| 1606 | Ga0496112_0072266 | |||
| 1607 | Ga0496112_0093100 | |||
| 1608 | Ga0496112_0098327 | |||
| 1609 | Ga0496112_0157400 | |||
| 1610 | Ga0496112_0285303 | |||
| 1611 | Ga0496112_0327421 | |||
| 1612 | Ga0496113_0003871 | |||
| 1613 | Ga0496113_0009682 | |||
| 1614 | Ga0496113_0055224 | |||
| 1615 | Ga0496113_0406263 | |||
| 1616 | Ga0496113_0414392 | |||
| 1617 | Ga0496113_0486196 | |||
| 1618 | Ga0496114_0245324 | |||
| 1619 | Ga0496114_0299955 | |||
| 1620 | Ga0496115_0001345 | |||
| 1621 | Ga0496115_0065665 | |||
| 1622 | Ga0496115_0198692 | |||
| 1623 | Ga0496115_0212947 | |||
| 1624 | Ga0496115_0434223 | |||
| 1625 | Ga0496117_0037727 | |||
| 1626 | Ga0496118_0078175 | |||
| 1627 | Ga0496125_0205690 | |||
| 1628 | Ga0496126_0001890 | |||
| 1629 | Ga0496126_0517092 | |||
| 1630 | Ga0501290_000271 | |||
| 1631 | Ga0501292_000003 | |||
| 1632 | Ga0501294_000455 | |||
| 1633 | Ga0501300_000439 | |||
| 1634 | Ga0501032_0004263 | |||
| 1635 | Ga0501032_0021362 | |||
| 1636 | Ga0501032_0091875 | |||
| 1637 | Ga0501032_0099781 | |||
| 1638 | Ga0501032_0106862 | |||
| 1639 | Ga0501032_0140434 | |||
| 1640 | Ga0501032_0341181 | |||
| 1641 | Ga0501032_0493815 | |||
| 1642 | Ga0501033_0033047 | |||
| 1643 | Ga0501033_0043744 | |||
| 1644 | Ga0501033_0086125 | |||
| 1645 | Ga0501033_0110581 | |||
| 1646 | Ga0501033_0216789 | |||
| 1647 | Ga0501033_0258270 | |||
| 1648 | Ga0501034_0001899 | |||
| 1649 | Ga0501034_0024465 | |||
| 1650 | Ga0501034_0025674 | |||
| 1651 | Ga0501034_0045159 | |||
| 1652 | Ga0501034_0052705 | |||
| 1653 | Ga0501034_0081133 | |||
| 1654 | Ga0501034_0093965 | |||
| 1655 | Ga0501034_0143844 | |||
| 1656 | Ga0501034_0243790 | |||
| 1657 | Ga0501034_0571233 | |||
| 1658 | Ga0501036_0003218 | |||
| 1659 | Ga0501036_0020141 | |||
| 1660 | Ga0501036_0067993 | |||
| 1661 | Ga0501036_0075584 | |||
| 1662 | Ga0501036_0247731 | |||
| 1663 | Ga0501036_0648907 | |||
| 1664 | Ga0501037_0229598 | |||
| 1665 | Ga0501037_0238688 | |||
| 1666 | Ga0501038_0050512 | |||
| 1667 | Ga0501038_0061324 | |||
| 1668 | Ga0501038_0100002 | |||
| 1669 | Ga0501038_0129631 | |||
| 1670 | Ga0501038_0153588 | |||
| 1671 | Ga0501038_0536318 | |||
| 1672 | Ga0501038_0566408 | |||
| 1673 | Ga0501039_0120913 | |||
| 1674 | Ga0501039_0138114 | |||
| 1675 | Ga0501040_0027148 | |||
| 1676 | Ga0501042_0018714 | |||
| 1677 | Ga0501042_0052098 | |||
| 1678 | Ga0501042_0176734 | |||
| 1679 | Ga0501042_0251988 | |||
| 1680 | Ga0501043_0000380 | |||
| 1681 | Ga0501043_0021924 | |||
| 1682 | Ga0501043_0030658 | |||
| 1683 | Ga0501043_0059130 | |||
| 1684 | Ga0501043_0085612 | |||
| 1685 | Ga0501043_0223860 | |||
| 1686 | Ga0501043_0291908 | |||
| 1687 | Ga0501046_0010856 | |||
| 1688 | Ga0501046_0011538 | |||
| 1689 | Ga0501046_0012127 | |||
| 1690 | Ga0501046_0266618 | |||
| 1691 | Ga0501046_0296737 | |||
| 1692 | Ga0501047_0007528 | |||
| 1693 | Ga0501047_0018522 | |||
| 1694 | Ga0501047_0020095 | |||
| 1695 | Ga0501047_0045295 | |||
| 1696 | Ga0501047_0091556 | |||
| 1697 | Ga0501047_0115158 | |||
| 1698 | Ga0501047_0133669 | |||
| 1699 | Ga0501047_0245573 | |||
| 1700 | Ga0501047_0304642 | |||
| 1701 | Ga0501047_0465015 | |||
| 1702 | Ga0501048_0000424 | |||
| 1703 | Ga0501048_0037378 | |||
| 1704 | Ga0501048_0241404 | |||
| 1705 | Ga0501067_0000224 | |||
| 1706 | Ga0501067_0003270 | |||
| 1707 | Ga0501067_0234834 | |||
| 1708 | Ga0501068_0006315 | |||
| 1709 | Ga0501069_0000251 | |||
| 1710 | Ga0501069_0034265 | |||
| 1711 | Ga0501069_0080190 | |||
| 1712 | Ga0501069_0336743 | |||
| 1713 | Ga0501070_0003929 | |||
| 1714 | Ga0501070_0007814 | |||
| 1715 | Ga0501070_0009582 | |||
| 1716 | Ga0501070_0035482 | |||
| 1717 | Ga0501070_0077965 | |||
| 1718 | Ga0501070_0194580 | |||
| 1719 | Ga0501070_0574693 | |||
| 1720 | Ga0501071_0024156 | |||
| 1721 | Ga0501071_0087704 | |||
| 1722 | Ga0501071_0281177 | |||
| 1723 | Ga0501072_0379588 | |||
| 1724 | Ga0501073_0005963 | |||
| 1725 | Ga0501073_0011271 | |||
| 1726 | Ga0501073_0035524 | |||
| 1727 | Ga0501073_0049686 | |||
| 1728 | Ga0501073_0111398 | |||
| 1729 | Ga0501073_0161388 | |||
| 1730 | Ga0501073_0194619 | |||
| 1731 | Ga0501073_0363937 | |||
| 1732 | Ga0501074_0006850 | |||
| 1733 | Ga0501074_0015486 | |||
| 1734 | Ga0501074_0082702 | |||
| 1735 | Ga0501074_0104132 | |||
| 1736 | Ga0501074_0359330 | |||
| 1737 | Ga0501076_0347310 | |||
| 1738 | Ga0501077_0139924 | |||
| 1739 | Ga0501206_004121 | |||
| 1740 | Ga0501222_000807 | |||
| 1741 | Ga0501223_000796 | |||
| 1742 | Ga0501224_001001 | |||
| 1743 | Ga0501227_001098 | |||
| 1744 | Ga0501252_008839 | |||
| 1745 | Ga0501257_020712 | |||
| 1746 | Ga0501259_000913 | |||
| 1747 | Ga0501261_000066 | |||
| 1748 | Ga0501225_0016325 | |||
| 1749 | Ga0501079_0096855 | |||
| 1750 | Ga0501079_0377315 | |||
| 1751 | Ga0501079_0633420 | |||
| 1752 | Ga0501080_0000112 | |||
| 1753 | Ga0501080_0003244 | |||
| 1754 | Ga0501080_0018241 | |||
| 1755 | Ga0501080_0056888 | |||
| 1756 | Ga0501080_0130513 | |||
| 1757 | Ga0501080_0225582 | |||
| 1758 | Ga0501083_0007146 | |||
| 1759 | Ga0501083_0010656 | |||
| 1760 | Ga0501083_0046768 | |||
| 1761 | Ga0501083_0068040 | |||
| 1762 | Ga0501083_0173071 | |||
| 1763 | Ga0501241_051067 | |||
| 1764 | Ga0501279_000040 | |||
| 1765 | Ga0501280_000144 | |||
| 1766 | Ga0501281_00385 | |||
| 1767 | Ga0501282_000071 | |||
| 1768 | Ga0501035_0014537 | |||
| 1769 | Ga0501035_0025766 | |||
| 1770 | Ga0501035_0027254 | |||
| 1771 | Ga0501035_0029360 | |||
| 1772 | Ga0501035_0351949 | |||
| 1773 | Ga0501044_0000658 | |||
| 1774 | Ga0501044_0003453 | |||
| 1775 | Ga0501044_0020081 | |||
| 1776 | Ga0501044_0025440 | |||
| 1777 | Ga0501044_0057121 | |||
| 1778 | Ga0501044_0062271 | |||
| 1779 | Ga0501044_0068185 | |||
| 1780 | Ga0501044_0193914 | |||
| 1781 | Ga0501044_0217258 | |||
| 1782 | Ga0501044_0279089 | |||
| 1783 | Ga0501044_0751910 | |||
| 1784 | Ga0501045_0056418 | |||
| 1785 | Ga0501045_0093089 | |||
| 1786 | nmdc:mga03683_27069_c1 | |||
| 1787 | nmdc:mga00v17_385813_c1 | |||
| 1788 | nmdc:mga0yw44_30437_c1 | |||
| 1789 | nmdc:mga0k408_2287_c1 | |||
| 1790 | nmdc:mga0k408_95314_c1 | |||
| 1791 | nmdc:mga05p37_43907_c1 | |||
| 1792 | nmdc:mga05p37_751430_c1 | |||
| 1793 | nmdc:mga09592_503163_c1 | |||
| 1794 | nmdc:mga06r32_207952_c1 | |||
| 1795 | nmdc:mga06r32_213150_c1 | |||
| 1796 | nmdc:mga08y16_303449_c1 | |||
| 1797 | nmdc:mga08y16_44774_c1 | |||
| 1798 | nmdc:mga08y16_636227_c1 | |||
| 1799 | nmdc:mga0n895_125963_c1 | |||
| 1800 | nmdc:mga0n895_2174_c1 | |||
| 1801 | nmdc:mga0n895_72521_c1 | |||
| 1802 | nmdc:mga0rr50_19771_c1 | |||
| 1803 | nmdc:mga08x19_59086_c1 | |||
| 1804 | nmdc:mga0a205_325893_c1 | |||
| 1805 | nmdc:mga0a205_62019_c1 | |||
| 1806 | Ga0495601_0000947 | |||
| 1807 | Ga0495601_0015896 | |||
| 1808 | Ga0495601_0028555 | |||
| 1809 | Ga0495601_0031852 | |||
| 1810 | Ga0495612_0000797 | |||
| 1811 | Ga0495612_0004285 | |||
| 1812 | Ga0495612_0059162 | |||
| 1813 | Ga0495612_0092251 | |||
| 1814 | Ga0495655_0017666 | |||
| 1815 | Ga0495595_0001078 | |||
| 1816 | Ga0495595_0035101 | |||
| 1817 | Ga0495595_0173151 | |||
| 1818 | Ga0495595_0285484 | |||
| 1819 | Ga0495619_0001656 | |||
| 1820 | Ga0495619_0030530 | |||
| 1821 | Ga0500643_019996 | |||
| 1822 | Ga0500647_0131142 | |||
| 1823 | Ga0500555_044219 | |||
| 1824 | Ga0500556_0017319 | |||
| 1825 | Ga0500556_0117629 | |||
| 1826 | Ga0500642_0086461 | |||
| 1827 | Ga0500655_000033 | |||
| 1828 | Ga0500658_0002175 | |||
| 1829 | Ga0500568_0000406 | |||
| 1830 | Ga0500590_013244 | |||
| 1831 | Ga0500604_0000583 | |||
| 1832 | Ga0500616_0000084 | |||
| 1833 | Ga0500616_0000161 | |||
| 1834 | Ga0500616_0000805 | |||
| 1835 | Ga0500616_0011661 | |||
| 1836 | Ga0500616_0231333 | |||
| 1837 | Ga0500587_000809 | |||
| 1838 | Ga0501084_0004384 | |||
| 1839 | Ga0501084_0076860 | |||
| 1840 | Ga0501084_0090968 | |||
| 1841 | Ga0501084_0094190 | |||
| 1842 | Ga0501084_0114033 | |||
| 1843 | Ga0501082_0006226 | |||
| 1844 | Ga0501082_0011332 | |||
| 1845 | Ga0501082_0111262 | |||
| 1846 | Ga0501082_0128860 | |||
| 1847 | Ga0501082_0384604 | |||
| 1848 | Ga0501082_0503484 | |||
| 1849 | Ga0530510_0097350 | |||
| 1850 | 2508735756 | |||
| 1851 | 2617913383 | |||
| 1852 | 2643755515 | |||
| 1853 | 2738946168 | |||
| 1854 | 2776259030 | |||
| 1855 | 2831428310 | |||
| 1856 | 2835313563 | |||
| 1857 | 2848698472 | |||
| 1858 | 2849666178 | |||
| 1859 | 2882461521 | |||
| 1860 | 2884299721 | |||
| 1861 | 2886633913 | |||
| 1862 | 2894240136 | |||
| 1863 | 2913311247 | |||
| 1864 | 2913845598 | |||
| 1865 | 2913917531 | |||
| 1866 | 2913941558 | |||
| 1867 | 2919455263 | |||
| 1868 | 642600782 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fli-assembly1.cif.gz_E | the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate | 0.9789 | 5 | 218 |
| 1tqj-assembly1.cif.gz_E | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9743 | 4 | 218 |
| 1tqj-assembly1.cif.gz_B | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.974 | 4 | 220 |
| 1tqj-assembly1.cif.gz_F | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9711 | 4 | 218 |
| 3inp-assembly1.cif.gz_A | 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. | 0.9707 | 5 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9791 | 3 | 218 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9725 | 4 | 218 | 3.20.20.70 |
| 1tqjD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9698 | 4 | 220 | 3.20.20.70 |
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9695 | 5 | 218 | 3.20.20.70 |
| af_P9WI51_4_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9569 | 3 | 218 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W6EV29-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9929 | 5 | 219 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A162JL25-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.991 | 1 | 218 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A844ZET1-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9909 | 5 | 220 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A1I4C0L9-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9896 | 3 | 218 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A382V2T8-F1-model_v4 | ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9891 | 3 | 199 |
GO:0004750
GO:0005975 GO:0006098 |