F486137

General Info

Members Datasets Scaffolds Average Seq Length
934 539 1868 194

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0482429|Ga0496104_0482429_311_982
Length 223
Sequence LRGPPRAGALCADAAIDYGFGRRITRPETCSMTQPIAKRFPIPSIDKLPEDIRTRLLAVQEKSGFIPNVFLTLAYRPDEFRAFFAYHDALMEKDGGLTKAEREMIVVATSSANQCLYCVIAHGAILRIRAKNPQLADQIAVNYRKADIAPRHRAMLDFAMKVSTEAHSISEADFSAVASHGFSDDDIWDIAAIAAFFALSNRIANVTGMRPNDEFYLMGRLPK

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
109 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
195 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
202 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
203 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
204 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
208 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
209 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
210 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
211 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
212 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
213 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
214 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
254 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
273 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
274 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
275 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
276 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
277 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
278 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
279 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
280 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
281 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
282 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
283 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
284 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
285 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
286 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
287 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
288 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
289 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
290 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
291 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
292 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
293 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
294 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
295 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
296 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
297 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
298 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
299 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
300 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
301 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
304 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
305 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
306 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
307 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
308 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
311 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
312 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
313 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
314 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
333 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
334 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
335 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
336 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
337 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
338 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
339 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
340 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
341 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
342 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
343 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
344 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
345 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
346 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
347 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
348 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
349 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
350 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
351 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
352 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
353 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
354 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
355 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
358 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
359 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
360 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
361 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
362 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
363 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
364 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
365 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
366 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
367 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
368 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
369 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
370 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
371 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
372 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
373 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
374 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
375 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
376 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
377 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
378 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
379 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
380 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
381 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
382 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
383 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
384 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
385 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
386 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
387 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
396 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
409 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
410 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
411 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
412 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
413 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
414 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
415 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
416 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
417 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
418 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
419 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
421 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
422 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
423 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
424 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
425 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
426 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
427 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
428 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
429 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
430 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
431 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
432 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
433 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
434 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
435 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
436 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
437 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
438 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
439 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
440 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
441 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
442 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
443 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
444 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
445 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
446 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
447 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
448 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
449 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
450 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
451 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
452 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
453 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
454 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
455 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
456 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
457 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
458 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
459 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
460 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
461 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
462 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
463 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
464 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
465 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
466 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
467 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
469 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
470 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
471 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
472 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
473 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
474 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
475 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
476 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
477 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
478 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
479 2643221570 Acidovorax sp. Root568 Isolate Unclassified
480 2643221596 Acidovorax sp. Root70 Isolate Unclassified
481 2643221609 Acidovorax sp. Root217 Isolate Unclassified
482 2643221611 Acidovorax sp. Root219 Isolate Unclassified
483 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
484 2643221652 Acidovorax sp. Root402 Isolate Unclassified
485 2643221658 Variovorax sp. Root411 Isolate Unclassified
486 2643221672 Variovorax sp. Root434 Isolate Unclassified
487 2643221683 Variovorax sp. Root473 Isolate Unclassified
488 2643221717 Acidovorax sp. Root267 Isolate Unclassified
489 2738541277 Variovorax sp. GV051 Isolate Unclassified
490 2738541307 Variovorax sp. GV008 Isolate Unclassified
491 2738543012 Acidovorax sp. CF301 Isolate Unclassified
492 2738543013 Variovorax sp. BT01 Isolate Unclassified
493 2738543019 Variovorax sp. GV040 Isolate Unclassified
494 2816332133 Acidovorax radicis 2721A Isolate Unclassified
495 2818991446 Variovorax sp. 1180 Isolate Unclassified
496 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
497 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
498 2842677519 Variovorax sp. R-72495 Isolate Unclassified
499 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
500 2842733646 Variovorax sp. R-72446 Isolate Unclassified
501 2842747753 Variovorax sp. R-72060 Isolate Unclassified
502 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
503 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
504 2885198086 Variovorax sp. 679 Isolate Unclassified
505 2885211737 Variovorax sp. 553 Isolate Unclassified
506 2885266251 Ralstonia sp. SET104 Isolate Nodule
507 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
508 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
509 2899924645 Variovorax sp. 369 Isolate Unclassified
510 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
511 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
512 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
513 2904456579 Variovorax sp. 2002 Isolate Unclassified
514 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
515 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
516 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
517 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
518 2928037797 Variovorax sp. 1126 Isolate Unclassified
519 2928044640 Variovorax sp. 1128 Isolate Unclassified
520 2928051484 Variovorax sp. 1133 Isolate Unclassified
521 2928058823 Ralstonia sp. 1138 Isolate Unclassified
522 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
523 2928070936 Variovorax gossypii 1167 Isolate Unclassified
524 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
525 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
526 2929520902 Variovorax beijingensis 502 Isolate Unclassified
527 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
528 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
529 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
530 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
531 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
532 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
533 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
534 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
535 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
536 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
537 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
538 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
539 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.86
Metatranscriptomes 0.64
Isolates 7.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.23
Nodule 1.82
Rhizoplane 2.14
Rhizosphere 61.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0482429 3300048907 Bacteria 1151
2 JGI24741J21665_1000148 3300001915 Bacteria 19713
3 JGI24740J21852_10000034 3300001979 Bacteria 45131
4 JGI24740J21852_10003193 3300001979 Bacteria 7228
5 JGI25156J39149_1002021 3300002705 Bacteria 7748
6 JGI25156J39149_1005929 3300002705 Bacteria 3427
7 JGI25154J39366_1000469 3300002738 Bacteria 21111
8 JGI25152J39213_1003923 3300002773 Bacteria 4877
9 JGI25151J46595_10001043 3300003187 Bacteria 20675
10 JGI25151J46595_10003018 3300003187 Bacteria 9565
11 JGI25151J46595_10006379 3300003187 Bacteria 5931
12 JGI25406J46586_10000027 3300003203 Bacteria 70625
13 rootH1_10054944 3300003323 Bacteria 1835
14 JGI25160J50197_1009372 3300003354 Bacteria 3636
15 Ga0006562J51391_1072237 3300003578 Bacteria 2000
16 Ga0055538_1005489 3300003751 Bacteria 1307
17 Ga0055538_1005500 3300003751 Bacteria 1305
18 Ga0055539_1000110 3300003752 Bacteria 90594
19 Ga0055533_1003648 3300003756 Bacteria 3030
20 Ga0055532_1000028 3300003758 Bacteria 234512
21 Ga0055525_1000162 3300003759 Bacteria 87273
22 Ga0055527_1000668 3300003760 Bacteria 10288
23 Ga0055535_1000022 3300003761 Bacteria 234512
24 Ga0055535_1001588 3300003761 Bacteria 10859
25 Ga0055542_1000004 3300003762 Bacteria 553532
26 Ga0055542_1001577 3300003762 Bacteria 10618
27 Ga0055529_1000063 3300003763 Bacteria 181573
28 Ga0055526_1011512 3300003771 Bacteria 3974
29 Ga0055526_1030970 3300003771 Bacteria 1547
30 Ga0055537_1005523 3300003773 Bacteria 3378
31 Ga0055536_1000020 3300003781 Bacteria 199649
32 Ga0055536_1000693 3300003781 Bacteria 22609
33 Ga0055534_1000593 3300003784 Bacteria 18802
34 Ga0055534_1004320 3300003784 Bacteria 4159
35 Ga0055528_1016007 3300003790 Bacteria 2676
36 Ga0055530_10000376 3300003791 Bacteria 40438
37 Ga0055530_10018063 3300003791 Bacteria 2187
38 Ga0055530_10018734 3300003791 Bacteria 2122
39 Ga0055540_1001215 3300003792 Bacteria 15838
40 Ga0055540_1004153 3300003792 Bacteria 6689
41 Ga0055540_1004399 3300003792 Bacteria 6376
42 Ga0055531_10002105 3300003794 Bacteria 13680
43 Ga0055541_1000956 3300003841 Bacteria 6813
44 Ga0065714_10109289 3300005288 Bacteria 1502
45 Ga0065714_10172108 3300005288 Bacteria 999
46 Ga0065704_10082939 3300005289 Bacteria 3532
47 Ga0070658_11292820 3300005327 Bacteria 634
48 Ga0070683_100007257 3300005329 Bacteria 9349
49 Ga0070683_100209240 3300005329 Bacteria 1853
50 Ga0068869_100289549 3300005334 Bacteria 1319
51 Ga0070682_100013306 3300005337 Bacteria 4732
52 Ga0070691_10212308 3300005341 Bacteria 1022
53 Ga0070661_100000127 3300005344 Bacteria 63148
54 Ga0070669_100013641 3300005353 Bacteria 5776
55 Ga0070674_100519434 3300005356 Bacteria 994
56 Ga0070659_100000487 3300005366 Bacteria 29096
57 Ga0070659_100108791 3300005366 Bacteria 2237
58 Ga0070667_100250405 3300005367 Bacteria 1583
59 Ga0070709_10062260 3300005434 Bacteria 2378
60 Ga0070714_100012709 3300005435 Bacteria 6725
61 Ga0070714_100078586 3300005435 Bacteria 2868
62 Ga0070714_100118348 3300005435 Bacteria 2354
63 Ga0070713_100006657 3300005436 Bacteria 8039
64 Ga0070713_100031059 3300005436 Bacteria 4250
65 Ga0070713_100100021 3300005436 Bacteria 2509
66 Ga0070710_10001287 3300005437 Bacteria 11902
67 Ga0070710_10144315 3300005437 Bacteria 1462
68 Ga0070711_100119302 3300005439 Bacteria 1948
69 Ga0070711_100272738 3300005439 Bacteria 1335
70 Ga0070708_100365212 3300005445 Bacteria 1360
71 Ga0070663_100000005 3300005455 Bacteria 251758
72 Ga0070663_100450353 3300005455 Bacteria 1061
73 Ga0070678_100055066 3300005456 Bacteria 2902
74 Ga0070678_100733216 3300005456 Bacteria 893
75 Ga0070662_100014836 3300005457 Bacteria 5209
76 Ga0070681_11084128 3300005458 Bacteria 722
77 Ga0070699_100743308 3300005518 Bacteria 897
78 Ga0070679_100060150 3300005530 Bacteria 3786
79 Ga0070679_100139318 3300005530 Bacteria 2406
80 Ga0070684_100018906 3300005535 Bacteria 5689
81 Ga0068853_100072047 3300005539 Bacteria 3010
82 Ga0068855_100087394 3300005563 Bacteria 3603
83 Ga0068855_100677053 3300005563 Bacteria 1106
84 Ga0070664_100000001 3300005564 Bacteria 551832
85 Ga0070664_101159094 3300005564 Bacteria 729
86 Ga0068857_100055508 3300005577 Bacteria 3516
87 Ga0068857_101039165 3300005577 Bacteria 789
88 Ga0068854_100000565 3300005578 Bacteria 22177
89 Ga0068854_100687973 3300005578 Bacteria 881
90 Ga0068856_100000020 3300005614 Bacteria 146775
91 Ga0068856_100000231 3300005614 Bacteria 60650
92 Ga0068852_101074298 3300005616 Bacteria 825
93 Ga0068851_10002325 3300005834 Bacteria 8368
94 Ga0068863_100082272 3300005841 Bacteria 3051
95 Ga0068858_100376526 3300005842 Bacteria 1362
96 Ga0068862_100034765 3300005844 Bacteria 4266
97 Ga0081455_10141757 3300005937 Bacteria 1866
98 Ga0081540_1026197 3300005983 Bacteria 3335
99 Ga0081539_10000051 3300005985 Bacteria 268337
100 Ga0070717_10000905 3300006028 Bacteria 19709
101 Ga0070717_10179653 3300006028 Bacteria 1844
102 Ga0075365_10001229 3300006038 Bacteria 11330
103 Ga0075363_100014487 3300006048 Bacteria 3855
104 Ga0075363_100028278 3300006048 Bacteria 2882
105 Ga0075363_100040995 3300006048 Bacteria 2442
106 Ga0075364_10002710 3300006051 Bacteria 9950
107 Ga0075364_10006355 3300006051 Bacteria 6942
108 Ga0075364_10152896 3300006051 Bacteria 1555
109 Ga0075364_10524483 3300006051 Bacteria 810
110 Ga0075432_10014484 3300006058 Bacteria 2686
111 Ga0070716_100008083 3300006173 Bacteria 5209
112 Ga0070712_100023926 3300006175 Bacteria 4040
113 Ga0070712_100024139 3300006175 Bacteria 4025
114 Ga0075362_10001311 3300006177 Bacteria 7889
115 Ga0075367_10019696 3300006178 Bacteria 3745
116 Ga0075367_10099553 3300006178 Bacteria 1776
117 Ga0075367_10357913 3300006178 Bacteria 921
118 Ga0075367_10483062 3300006178 Bacteria 785
119 Ga0075369_10020529 3300006186 Bacteria 2705
120 Ga0075366_10007788 3300006195 Bacteria 5929
121 Ga0075366_10037162 3300006195 Bacteria 2873
122 Ga0075366_10073344 3300006195 Bacteria 2040
123 Ga0075366_10116494 3300006195 Bacteria 1609
124 Ga0075370_10001337 3300006353 Bacteria 10599
125 Ga0075370_10001451 3300006353 Bacteria 10301
126 Ga0075370_10021660 3300006353 Bacteria 3522
127 Ga0075370_10049934 3300006353 Bacteria 2372
128 Ga0075370_10155164 3300006353 Bacteria 1342
129 Ga0075370_10217244 3300006353 Bacteria 1129
130 Ga0075430_100263846 3300006846 Bacteria 1426
131 Ga0079104_1000007 3300006946 Bacteria 390531
132 Ga0099826_10001210 3300006948 Bacteria 15005
133 Ga0099826_10156337 3300006948 Bacteria 1298
134 Ga0099826_10249991 3300006948 Bacteria 935
135 Ga0099794_10210298 3300007265 Bacteria 998
136 Ga0099795_10019566 3300007788 Bacteria 2193
137 Ga0099795_10031002 3300007788 Bacteria 1839
138 Ga0105244_10003174 3300009036 Bacteria 11937
139 Ga0105250_10052293 3300009092 Bacteria 1639
140 Ga0105240_10320744 3300009093 Bacteria 1766
141 Ga0105247_10046730 3300009101 Bacteria 2658
142 Ga0105247_10228012 3300009101 Bacteria 1264
143 Ga0105243_10000690 3300009148 Bacteria 32829
144 Ga0105243_10001470 3300009148 Bacteria 20672
145 Ga0105243_10004088 3300009148 Bacteria 11620
146 Ga0105243_10086673 3300009148 Bacteria 2569
147 Ga0105241_10076405 3300009174 Bacteria 2612
148 Ga0105241_10179275 3300009174 Bacteria 1756
149 Ga0105242_10000960 3300009176 Bacteria 22493
150 Ga0105237_10104860 3300009545 Bacteria 2819
151 Ga0105237_10350273 3300009545 Bacteria 1481
152 Ga0099796_10024110 3300010159 Bacteria 1907
153 Ga0105239_10168111 3300010375 Bacteria 2452
154 Ga0105239_10404375 3300010375 Bacteria 1545
155 Ga0157373_10001322 3300013100 Bacteria 18957
156 Ga0157373_10026944 3300013100 Bacteria 4148
157 Ga0157371_10000166 3300013102 Bacteria 96000
158 Ga0157370_10000021 3300013104 Bacteria 166168
159 Ga0157370_10011723 3300013104 Bacteria 9151
160 Ga0157370_10096278 3300013104 Bacteria 2777
161 Ga0157370_10307899 3300013104 Bacteria 1462
162 Ga0157369_10014737 3300013105 Bacteria 8821
163 Ga0157369_10016409 3300013105 Bacteria 8329
164 Ga0157369_10026776 3300013105 Bacteria 6394
165 Ga0157374_11206593 3300013296 Bacteria 778
166 Ga0157372_10000136 3300013307 Bacteria 81136
167 Ga0157372_10078726 3300013307 Bacteria 3725
168 Ga0157372_10120829 3300013307 Bacteria 3009
169 Ga0157372_10122123 3300013307 Bacteria 2993
170 Ga0157372_10215607 3300013307 Bacteria 2225
171 Ga0157375_10559502 3300013308 Bacteria 1305
172 Ga0157380_10426961 3300014326 Bacteria 1266
173 Ga0182008_10000163 3300014497 Bacteria 52248
174 Ga0182008_10003150 3300014497 Bacteria 10096
175 Ga0182008_10033743 3300014497 Bacteria 2568
176 Ga0157376_10101660 3300014969 Bacteria 2513
177 Ga0182006_1002901 3300015261 Bacteria 9100
178 Ga0182006_1030738 3300015261 Bacteria 2168
179 Ga0182006_1037687 3300015261 Bacteria 1915
180 Ga0182007_10001559 3300015262 Bacteria 12222
181 Ga0182007_10001915 3300015262 Bacteria 10797
182 Ga0182007_10004906 3300015262 Bacteria 5973
183 Ga0183362_10001 3300015683 Bacteria 2046624
184 Ga0183361_10005 3300016635 Bacteria 413599
185 Ga0163161_10000861 3300017792 Bacteria 23679
186 Ga0163161_10008770 3300017792 Bacteria 6990
187 Ga0163161_10052470 3300017792 Bacteria 2956
188 Ga0163161_10151591 3300017792 Bacteria 1762
189 Ga0206356_11440482 3300020070 Bacteria 972
190 Ga0206351_10478166 3300020077 Bacteria 2232
191 Ga0154015_1141018 3300020610 Bacteria 10433
192 Ga0213873_10004620 3300021358 Bacteria 2584
193 Ga0213872_10008077 3300021361 Bacteria 5114
194 Ga0213876_10001197 3300021384 Bacteria 16387
195 Ga0213871_10004096 3300021441 Bacteria 2883
196 Ga0209784_100014 3300025224 Bacteria 496182
197 Ga0209784_100499 3300025224 Bacteria 15443
198 Ga0209566_100011 3300025225 Bacteria 496182
199 Ga0209566_100265 3300025225 Bacteria 49043
200 Ga0209566_100768 3300025225 Bacteria 17270
201 Ga0209674_100032 3300025226 Bacteria 426888
202 Ga0209674_100178 3300025226 Bacteria 77795
203 Ga0209672_100230 3300025228 Bacteria 42658
204 Ga0209672_100542 3300025228 Bacteria 20441
205 Ga0209672_101967 3300025228 Bacteria 5778
206 Ga0209147_100002 3300025229 Bacteria 2158988
207 Ga0209147_101233 3300025229 Bacteria 10181
208 Ga0209563_100029 3300025230 Bacteria 496182
209 Ga0209563_103559 3300025230 Bacteria 3186
210 Ga0209563_108656 3300025230 Bacteria 1590
211 Ga0209258_100002 3300025242 Bacteria 2158988
212 Ga0209258_100022 3300025242 Bacteria 553584
213 Ga0207425_1000630 3300025245 Bacteria 20024
214 Ga0209646_1000058 3300025246 Bacteria 259999
215 Ga0209026_1012090 3300025250 Bacteria 1518
216 Ga0209677_100042 3300025253 Bacteria 225037
217 Ga0209677_110156 3300025253 Bacteria 1598
218 Ga0209148_1000034 3300025254 Bacteria 553584
219 Ga0209148_1000043 3300025254 Bacteria 461531
220 Ga0209148_1005542 3300025254 Bacteria 2878
221 Ga0209759_1001157 3300025256 Bacteria 16767
222 Ga0209759_1006518 3300025256 Bacteria 3910
223 Ga0209759_1021030 3300025256 Bacteria 1498
224 Ga0209129_1000111 3300025258 Bacteria 148853
225 Ga0209129_1001316 3300025258 Bacteria 14061
226 Ga0209129_1010851 3300025258 Bacteria 2228
227 Ga0209565_1000040 3300025263 Bacteria 266543
228 Ga0209565_1000136 3300025263 Bacteria 103019
229 Ga0209565_1000146 3300025263 Bacteria 97720
230 Ga0209565_1005749 3300025263 Bacteria 3569
231 Ga0209455_1000009 3300025272 Bacteria 1042273
232 Ga0209673_1000109 3300025273 Bacteria 183000
233 Ga0209673_1000175 3300025273 Bacteria 131239
234 Ga0209673_1000664 3300025273 Bacteria 49941
235 Ga0209673_1004580 3300025273 Bacteria 7331
236 Ga0209673_1009956 3300025273 Bacteria 4055
237 Ga0209130_1000546 3300025284 Bacteria 37680
238 Ga0209130_1000566 3300025284 Bacteria 36455
239 Ga0209130_1002388 3300025284 Bacteria 9501
240 Ga0209130_1004524 3300025284 Bacteria 5236
241 Ga0209130_1017895 3300025284 Bacteria 1677
242 Ga0209675_1000024 3300025291 Bacteria 312615
243 Ga0209675_1000541 3300025291 Bacteria 27686
244 Ga0209675_1000962 3300025291 Bacteria 18226
245 Ga0209675_1002172 3300025291 Bacteria 10329
246 Ga0209675_1003271 3300025291 Bacteria 7798
247 Ga0209675_1003738 3300025291 Bacteria 7056
248 Ga0209676_1000005 3300025292 Bacteria 1076001
249 Ga0209676_1000066 3300025292 Bacteria 317897
250 Ga0209676_1000254 3300025292 Bacteria 113136
251 Ga0209676_1000478 3300025292 Bacteria 65984
252 Ga0209676_1003608 3300025292 Bacteria 9318
253 Ga0209676_1004255 3300025292 Bacteria 8078
254 Ga0209676_1022411 3300025292 Bacteria 2095
255 Ga0209676_1048109 3300025292 Bacteria 1141
256 Ga0209676_1055974 3300025292 Bacteria 1007
257 Ga0209025_1000096 3300025294 Bacteria 239153
258 Ga0209025_1000116 3300025294 Bacteria 218293
259 Ga0209025_1000394 3300025294 Bacteria 90347
260 Ga0209025_1000471 3300025294 Bacteria 78395
261 Ga0209025_1000711 3300025294 Bacteria 56608
262 Ga0209025_1001264 3300025294 Bacteria 34892
263 Ga0209025_1045333 3300025294 Bacteria 1825
264 Ga0209025_1049298 3300025294 Bacteria 1696
265 Ga0209564_1000155 3300025295 Bacteria 165859
266 Ga0209564_1001277 3300025295 Bacteria 27704
267 Ga0209564_1001679 3300025295 Bacteria 21091
268 Ga0209564_1002082 3300025295 Bacteria 17157
269 Ga0209564_1002434 3300025295 Bacteria 14748
270 Ga0209758_1000107 3300025297 Bacteria 218293
271 Ga0209758_1013473 3300025297 Bacteria 4452
272 Ga0209050_1000007 3300025298 Bacteria 1187891
273 Ga0209050_1002418 3300025298 Bacteria 16092
274 Ga0209050_1003597 3300025298 Bacteria 11251
275 Ga0209256_1000038 3300025299 Bacteria 375225
276 Ga0209256_1000087 3300025299 Bacteria 218290
277 Ga0209256_1001536 3300025299 Bacteria 23185
278 Ga0207426_1000090 3300025302 Bacteria 280662
279 Ga0207426_1000123 3300025302 Bacteria 218290
280 Ga0207426_1021300 3300025302 Bacteria 2242
281 Ga0209051_1000009 3300025303 Bacteria 706778
282 Ga0209051_1000073 3300025303 Bacteria 208874
283 Ga0209051_1000092 3300025303 Bacteria 170056
284 Ga0209051_1000821 3300025303 Bacteria 32111
285 Ga0209051_1006929 3300025303 Bacteria 6293
286 Ga0209051_1010079 3300025303 Bacteria 4808
287 Ga0209051_1017832 3300025303 Bacteria 3160
288 Ga0209051_1035966 3300025303 Bacteria 1835
289 Ga0209257_1000011 3300025304 Bacteria 1112630
290 Ga0209257_1000139 3300025304 Bacteria 202285
291 Ga0209257_1013202 3300025304 Bacteria 3708
292 Ga0207655_1018504 3300025728 Bacteria 3689
293 Ga0207692_10000175 3300025898 Bacteria 20519
294 Ga0207692_10146161 3300025898 Bacteria 1349
295 Ga0207710_10101978 3300025900 Bacteria 1354
296 Ga0207688_10548021 3300025901 Bacteria 727
297 Ga0207699_10002794 3300025906 Bacteria 8247
298 Ga0207705_10129664 3300025909 Bacteria 1876
299 Ga0207654_10211686 3300025911 Bacteria 1281
300 Ga0207707_10016441 3300025912 Bacteria 6453
301 Ga0207695_10005940 3300025913 Bacteria 15993
302 Ga0207695_10006828 3300025913 Bacteria 14698
303 Ga0207695_10904399 3300025913 Bacteria 762
304 Ga0207671_10050676 3300025914 Bacteria 3074
305 Ga0207671_10090882 3300025914 Bacteria 2300
306 Ga0207693_10068291 3300025915 Bacteria 2782
307 Ga0207693_10129554 3300025915 Bacteria 1983
308 Ga0207663_10052291 3300025916 Bacteria 2547
309 Ga0207663_10339339 3300025916 Bacteria 1134
310 Ga0207660_10064084 3300025917 Bacteria 2652
311 Ga0207657_10102345 3300025919 Bacteria 2376
312 Ga0207657_10729827 3300025919 Bacteria 768
313 Ga0207649_10000185 3300025920 Bacteria 51071
314 Ga0207652_10192112 3300025921 Bacteria 1837
315 Ga0207652_10229849 3300025921 Bacteria 1672
316 Ga0207652_10539155 3300025921 Bacteria 1049
317 Ga0207646_10101454 3300025922 Bacteria 2580
318 Ga0207681_10010177 3300025923 Bacteria 5760
319 Ga0207694_10169676 3300025924 Bacteria 1766
320 Ga0207694_10347474 3300025924 Bacteria 1227
321 Ga0207659_10796574 3300025926 Bacteria 812
322 Ga0207687_10542323 3300025927 Bacteria 975
323 Ga0207687_10696084 3300025927 Bacteria 862
324 Ga0207700_10001663 3300025928 Bacteria 12623
325 Ga0207700_10081270 3300025928 Bacteria 2530
326 Ga0207700_10417901 3300025928 Bacteria 1177
327 Ga0207664_10007161 3300025929 Bacteria 7734
328 Ga0207664_10142567 3300025929 Bacteria 2029
329 Ga0207664_10418180 3300025929 Bacteria 1194
330 Ga0207664_10458485 3300025929 Bacteria 1138
331 Ga0207690_10001564 3300025932 Bacteria 14340
332 Ga0207690_10056527 3300025932 Bacteria 2647
333 Ga0207706_10030525 3300025933 Bacteria 4807
334 Ga0207686_10005163 3300025934 Bacteria 7019
335 Ga0207709_10000112 3300025935 Bacteria 127357
336 Ga0207709_10000233 3300025935 Bacteria 70451
337 Ga0207709_10000813 3300025935 Bacteria 24175
338 Ga0207709_10061457 3300025935 Bacteria 2348
339 Ga0207669_10820804 3300025937 Bacteria 772
340 Ga0207665_10003937 3300025939 Bacteria 9942
341 Ga0207665_10070934 3300025939 Bacteria 2378
342 Ga0207665_10184834 3300025939 Bacteria 1511
343 Ga0207691_10183460 3300025940 Bacteria 1828
344 Ga0207689_10270982 3300025942 Bacteria 1405
345 Ga0207661_10052447 3300025944 Bacteria 3258
346 Ga0207679_10000003 3300025945 Bacteria 597553
347 Ga0207679_10627790 3300025945 Bacteria 970
348 Ga0207667_10003980 3300025949 Bacteria 18160
349 Ga0207667_10244311 3300025949 Bacteria 1837
350 Ga0207712_10228128 3300025961 Bacteria 1493
351 Ga0207640_10000045 3300025981 Bacteria 100696
352 Ga0207640_10088750 3300025981 Bacteria 2135
353 Ga0207640_10296049 3300025981 Bacteria 1278
354 Ga0207658_10676604 3300025986 Bacteria 931
355 Ga0207703_10227711 3300026035 Bacteria 1670
356 Ga0207639_10046966 3300026041 Bacteria 3260
357 Ga0207639_10833445 3300026041 Bacteria 860
358 Ga0207678_10000002 3300026067 Bacteria 371723
359 Ga0207678_10183049 3300026067 Bacteria 1789
360 Ga0207702_10000046 3300026078 Bacteria 144265
361 Ga0207702_10000126 3300026078 Bacteria 90550
362 Ga0207641_10109057 3300026088 Bacteria 2451
363 Ga0207648_10408908 3300026089 Bacteria 1230
364 Ga0207674_10047105 3300026116 Bacteria 4422
365 Ga0207674_10095395 3300026116 Bacteria 2961
366 Ga0207674_11175887 3300026116 Bacteria 736
367 Ga0207683_10210081 3300026121 Bacteria 1771
368 Ga0207683_10825715 3300026121 Bacteria 860
369 Ga0209281_1000020 3300027111 Bacteria 575972
370 Ga0209982_1008579 3300027552 Bacteria 1500
371 Ga0209983_1086104 3300027665 Bacteria 706
372 Ga0209282_1000843 3300027666 Bacteria 15809
373 Ga0209282_1126244 3300027666 Bacteria 1271
374 Ga0209971_1097678 3300027682 Bacteria 718
375 Ga0209974_10011195 3300027876 Bacteria 3019
376 Ga0209974_10032684 3300027876 Bacteria 1724
377 Ga0209974_10097900 3300027876 Bacteria 1023
378 Ga0207428_10084855 3300027907 Bacteria 2467
379 Ga0268266_10007039 3300028379 Bacteria 10211
380 Ga0268266_10035469 3300028379 Bacteria 4243
381 Ga0268266_10475287 3300028379 Bacteria 1191
382 Ga0268265_10045469 3300028380 Bacteria 3276
383 Ga0265326_10035618 3300028558 Bacteria 1415
384 Ga0265334_10000456 3300028573 Bacteria 21294
385 Ga0265318_10024292 3300028577 Bacteria 2405
386 Ga0265323_10000424 3300028653 Bacteria 24236
387 Ga0265336_10000335 3300028666 Bacteria 31241
388 Ga0307515_10000028 3300028794 Bacteria 368467
389 Ga0307515_10000459 3300028794 Bacteria 97482
390 Ga0307515_10062835 3300028794 Bacteria 5234
391 Ga0265338_10000321 3300028800 Bacteria 87046
392 Ga0265324_10003194 3300029957 Bacteria 7934
393 Ga0307511_10046571 3300030521 Bacteria 3563
394 Ga0307512_10288286 3300030522 Bacteria 777
395 Ga0316177_1111932 3300030731 Bacteria 1725
396 Ga0314311_1013083 3300030733 Bacteria 6856
397 Ga0316178_1047919 3300030735 Bacteria 1378
398 Ga0316180_1174537 3300030736 Bacteria 1603
399 Ga0316183_1113265 3300030742 Bacteria 1951
400 Ga0316181_1247518 3300030744 Bacteria 1083
401 Ga0316181_1267722 3300030744 Bacteria 1831
402 Ga0316182_1032368 3300030745 Bacteria 4349
403 Ga0316182_1283731 3300030745 Bacteria 1716
404 Ga0265330_10000032 3300031235 Bacteria 130592
405 Ga0265332_10000001 3300031238 Bacteria 863783
406 Ga0265332_10228983 3300031238 Bacteria 770
407 Ga0265320_10257377 3300031240 Bacteria 774
408 Ga0265325_10024499 3300031241 Bacteria 3283
409 Ga0265340_10026792 3300031247 Bacteria 2911
410 Ga0265327_10000842 3300031251 Bacteria 45767
411 Ga0265327_10014001 3300031251 Bacteria 5282
412 Ga0307513_10000006 3300031456 Bacteria 470848
413 Ga0307513_10064738 3300031456 Bacteria 3850
414 Ga0307513_10194366 3300031456 Bacteria 1877
415 Ga0307513_10489998 3300031456 Bacteria 948
416 Ga0307509_10150600 3300031507 Bacteria 2242
417 Ga0307408_100000048 3300031548 Bacteria 165579
418 Ga0307408_100036713 3300031548 Bacteria 3446
419 Ga0307408_100076739 3300031548 Bacteria 2486
420 Ga0307408_100132006 3300031548 Bacteria 1949
421 Ga0307408_100205557 3300031548 Bacteria 1597
422 Ga0307408_100502861 3300031548 Bacteria 1061
423 Ga0307408_100720229 3300031548 Bacteria 898
424 Ga0265313_10071604 3300031595 Bacteria 1595
425 Ga0307508_10000018 3300031616 Bacteria 202701
426 Ga0307508_10066006 3300031616 Bacteria 3187
427 Ga0265314_10000022 3300031711 Bacteria 297299
428 Ga0316576_10026682 3300031727 Bacteria 4056
429 Ga0307516_10049184 3300031730 Bacteria 4145
430 Ga0307405_10020177 3300031731 Bacteria 3719
431 Ga0307405_10027664 3300031731 Bacteria 3291
432 Ga0307405_10054064 3300031731 Bacteria 2504
433 Ga0307405_10128742 3300031731 Bacteria 1745
434 Ga0307405_10310932 3300031731 Bacteria 1199
435 Ga0307405_10445272 3300031731 Bacteria 1025
436 Ga0307410_10165182 3300031852 Bacteria 1663
437 Ga0307406_10003632 3300031901 Bacteria 8401
438 Ga0307406_10007807 3300031901 Bacteria 5950
439 Ga0307406_10143576 3300031901 Bacteria 1693
440 Ga0307406_10308906 3300031901 Bacteria 1218
441 Ga0307406_10523830 3300031901 Bacteria 965
442 Ga0307406_10889520 3300031901 Bacteria 757
443 Ga0307412_10661515 3300031911 Bacteria 892
444 Ga0307412_10708954 3300031911 Bacteria 864
445 Ga0307412_10712524 3300031911 Bacteria 862
446 Ga0307412_10821375 3300031911 Bacteria 808
447 Ga0307412_10900036 3300031911 Bacteria 775
448 Ga0307416_100023276 3300032002 Bacteria 4492
449 Ga0307416_100203986 3300032002 Bacteria 1879
450 Ga0307416_100577990 3300032002 Bacteria 1200
451 Ga0307416_100688677 3300032002 Bacteria 1110
452 Ga0307416_101400665 3300032002 Bacteria 805
453 Ga0307414_10035395 3300032004 Bacteria 3322
454 Ga0307414_10335346 3300032004 Bacteria 1292
455 Ga0307414_10342488 3300032004 Bacteria 1280
456 Ga0307411_10103883 3300032005 Bacteria 2016
457 Ga0307411_10244901 3300032005 Bacteria 1406
458 Ga0307411_10388288 3300032005 Bacteria 1150
459 Ga0307415_100422152 3300032126 Bacteria 1145
460 Ga0307507_10018406 3300033179 Bacteria 7945
461 Ga0307510_10436462 3300033180 Bacteria 751
462 Ga0373930_0047290 3300034816 Bacteria 931
463 Ga0373926_0012705 3300035083 Bacteria 2849
464 Ga0373934_0088843 3300035086 Bacteria 1244
465 Ga0373944_0060135 3300035089 Bacteria 1217
466 Ga0373923_0025107 3300035111 Bacteria 2358
467 Ga0373936_0058980 3300035113 Bacteria 1563
468 Ga0373936_0102136 3300035113 Bacteria 1210
469 Ga0373936_0127971 3300035113 Bacteria 1089
470 Ga0373945_0031530 3300035116 Bacteria 1873
471 Ga0373945_0124483 3300035116 Bacteria 1027
472 Ga0373954_0012543 3300035118 Bacteria 3769
473 Ga0373956_0019990 3300035119 Bacteria 2844
474 Ga0373943_0023599 3300035170 Bacteria 2861
475 Ga0373946_0071677 3300035171 Bacteria 1498
476 Ga0373946_0080658 3300035171 Bacteria 1424
477 Ga0373955_0007905 3300035172 Bacteria 4910
478 Ga0373955_0012397 3300035172 Bacteria 4097
479 Ga0373955_0528083 3300035172 Bacteria 721
480 Ga0316574_0264288 3300035398 Bacteria 1098
481 Ga0373924_0031961 3300035410 Bacteria 2118
482 Ga0373924_0093030 3300035410 Bacteria 1291
483 Ga0373931_0150349 3300035691 Bacteria 1357
484 Ga0373935_0003280 3300035692 Bacteria 9358
485 Ga0373935_0012167 3300035692 Bacteria 5175
486 Ga0373935_0047296 3300035692 Bacteria 2720
487 Ga0373935_0204582 3300035692 Bacteria 1365
488 Ga0373927_0010043 3300035695 Bacteria 6339
489 Ga0373927_0014211 3300035695 Bacteria 5279
490 Ga0373927_0016888 3300035695 Bacteria 4813
491 Ga0373927_0094655 3300035695 Bacteria 1941
492 Ga0373933_0000199 3300035724 Bacteria 39593
493 Ga0373933_0291280 3300035724 Bacteria 1056
494 Ga0373947_0001007 3300035725 Bacteria 17183
495 Ga0373947_0011689 3300035725 Bacteria 5033
496 Ga0373947_0036433 3300035725 Bacteria 2917
497 Ga0373937_0008799 3300036401 Bacteria 8759
498 Ga0373937_0184508 3300036401 Bacteria 1959
499 Ga0373937_0254625 3300036401 Bacteria 1655
500 Ga0373937_0569176 3300036401 Bacteria 1076
501 Ga0372808_007091 3300036459 Bacteria 1527
502 Ga0373925_0086593 3300037068 Bacteria 2390
503 Ga0373925_0121179 3300037068 Bacteria 2030
504 Ga0373925_0160136 3300037068 Bacteria 1772
505 Ga0373925_0553967 3300037068 Bacteria 946
506 Ga0373925_0773647 3300037068 Bacteria 791
507 Ga0395900_0004253 3300037418 Bacteria 15194
508 Ga0395900_0136533 3300037418 Bacteria 2513
509 Ga0395898_0303349 3300037466 Bacteria 1523
510 Ga0395898_0505553 3300037466 Bacteria 1149
511 Ga0395905_0926792 3300037471 Bacteria 774
512 Ga0395901_0128090 3300038443 Bacteria 2668
513 Ga0395901_0236794 3300038443 Bacteria 1905
514 Ga0395901_0289274 3300038443 Bacteria 1701
515 Ga0436365_0170763 3300039437 Bacteria 37973
516 Ga0436360_0228422 3300039438 Bacteria 684
517 Ga0436361_0924706 3300039447 Bacteria 21263
518 Ga0436361_1047968 3300039447 Bacteria 1621
519 Ga0436363_1310819 3300039450 Bacteria 1159
520 Ga0436362_0010135 3300039453 Bacteria 1614
521 Ga0436362_0952081 3300039453 Bacteria 781
522 Ga0436362_1155672 3300039453 Bacteria 3903
523 Ga0439436_0000286 3300041404 Bacteria 12230
524 Ga0439436_0021886 3300041404 Bacteria 1896
525 Ga0439439_0016633 3300041406 Bacteria 1803
526 Ga0439461_0019810 3300041410 Bacteria 1328
527 Ga0439466_0028081 3300041411 Bacteria 1944
528 Ga0439466_0028201 3300041411 Bacteria 1939
529 Ga0439465_0000951 3300041413 Bacteria 9192
530 Ga0451798_0924623 3300041458 Bacteria 671
531 Ga0451800_1523891 3300041459 Bacteria 761
532 Ga0451849_0915040 3300041505 Bacteria 621
533 Ga0451849_1433168 3300041505 Bacteria 879
534 Ga0451853_0477501 3300041512 Bacteria 915
535 Ga0451853_3209351 3300041512 Bacteria 718
536 Ga0439431_0011074 3300041997 Bacteria 2056
537 Ga0439431_0043105 3300041997 Bacteria 1154
538 Ga0439433_0001421 3300041999 Bacteria 4934
539 Ga0439433_0006936 3300041999 Bacteria 2444
540 Ga0439442_002910 3300042002 Bacteria 3375
541 Ga0439445_0011452 3300042004 Bacteria 2116
542 Ga0439445_0012844 3300042004 Bacteria 2019
543 Ga0439445_0074342 3300042004 Bacteria 944
544 Ga0439432_005960 3300042006 Bacteria 4374
545 Ga0439449_0001357 3300042007 Bacteria 9596
546 Ga0439449_0003714 3300042007 Bacteria 5924
547 Ga0439449_0009909 3300042007 Bacteria 3603
548 Ga0439449_0076350 3300042007 Bacteria 1235
549 Ga0439452_008282 3300042010 Bacteria 3140
550 Ga0439452_008630 3300042010 Bacteria 3053
551 Ga0439457_020647 3300042014 Bacteria 1461
552 Ga0439462_0005949 3300042015 Bacteria 3022
553 Ga0439462_0008592 3300042015 Bacteria 2579
554 Ga0439462_0010920 3300042015 Bacteria 2307
555 Ga0450911_000739 3300042115 Bacteria 9409
556 Ga0450911_006909 3300042115 Bacteria 1669
557 Ga0450920_041192 3300042122 Bacteria 921
558 Ga0450897_012993 3300042128 Bacteria 827
559 Ga0450894_018314 3300042131 Bacteria 936
560 Ga0450898_015863 3300042134 Bacteria 1280
561 Ga0450898_020184 3300042134 Bacteria 1166
562 Ga0450906_035372 3300042145 Bacteria 881
563 Ga0450907_019264 3300042146 Bacteria 1144
564 Ga0450910_012751 3300042147 Bacteria 1217
565 Ga0439446_0029162 3300042156 Bacteria 1592
566 Ga0439446_0030956 3300042156 Bacteria 1547
567 Ga0450908_011305 3300042184 Bacteria 1635
568 Ga0439434_0001247 3300042435 Bacteria 7322
569 Ga0439434_0053487 3300042435 Bacteria 1255
570 Ga0450893_0028504 3300042532 Bacteria 988
571 Ga0450893_0045069 3300042532 Bacteria 816
572 Ga0451577_0009700 3300042876 Bacteria 9231
573 Ga0451577_0471364 3300042876 Bacteria 1140
574 Ga0466969_0064265 3300044656 Bacteria 1777
575 Ga0466972_0003977 3300044658 Bacteria 7366
576 Ga0466977_0006392 3300044666 Bacteria 6288
577 Ga0466978_0039070 3300044671 Bacteria 2932
578 Ga0453683_0290217 3300044673 Bacteria 1046
579 Ga0466965_0046134 3300044683 Bacteria 2156
580 Ga0466965_0225082 3300044683 Bacteria 1000
581 Ga0466966_0070596 3300044684 Bacteria 2190
582 Ga0466961_0000163 3300044693 Bacteria 45084
583 Ga0466964_0006910 3300044706 Bacteria 4238
584 Ga0453684_1489191 3300044712 Bacteria 699
585 Ga0466970_0003216 3300044765 Bacteria 7937
586 Ga0466957_0180493 3300044842 Bacteria 1378
587 Ga0466960_0102751 3300044901 Bacteria 1474
588 Ga0466959_0033826 3300045049 Bacteria 3780
589 Ga0466959_0043879 3300045049 Bacteria 3295
590 Ga0466959_0087836 3300045049 Bacteria 2236
591 Ga0451576_1145613 3300045051 Bacteria 813
592 Ga0466958_0126723 3300045836 Bacteria 1601
593 Ga0466958_0368306 3300045836 Bacteria 926
594 Ga0466967_0384842 3300045976 Bacteria 1362
595 Ga0466967_0837577 3300045976 Bacteria 914
596 Ga0495592_0001669 3300046454 Bacteria 15547
597 Ga0495592_0047124 3300046454 Bacteria 3211
598 Ga0495592_0098737 3300046454 Bacteria 2084
599 Ga0495603_0000464 3300046455 Bacteria 22234
600 Ga0495603_0036080 3300046455 Bacteria 2968
601 Ga0495629_0016724 3300046459 Bacteria 5263
602 Ga0495629_0040804 3300046459 Bacteria 3265
603 Ga0495638_0064259 3300046460 Bacteria 2261
604 Ga0495641_0011283 3300046461 Bacteria 5107
605 Ga0495651_0392690 3300046462 Bacteria 907
606 Ga0495650_0002924 3300046471 Bacteria 12972
607 Ga0495580_0002907 3300046472 Bacteria 14718
608 Ga0495580_0007795 3300046472 Bacteria 8578
609 Ga0495580_0076087 3300046472 Bacteria 2342
610 Ga0495582_0000174 3300046473 Bacteria 34996
611 Ga0495639_0000136 3300046475 Bacteria 37792
612 Ga0495639_0014455 3300046475 Bacteria 3418
613 Ga0495639_0024440 3300046475 Bacteria 2660
614 Ga0495662_0045819 3300046476 Bacteria 2111
615 Ga0495662_0372241 3300046476 Bacteria 702
616 Ga0495664_0003701 3300046477 Bacteria 8339
617 Ga0495664_0012734 3300046477 Bacteria 4763
618 Ga0495594_0002231 3300046499 Bacteria 10081
619 Ga0495594_0225192 3300046499 Bacteria 1069
620 Ga0495594_0240331 3300046499 Bacteria 1032
621 Ga0495606_0003754 3300046507 Bacteria 15805
622 Ga0495610_0018222 3300046512 Bacteria 3973
623 Ga0495616_0004613 3300046513 Bacteria 8654
624 Ga0495618_0014867 3300046514 Bacteria 4748
625 Ga0495618_0124232 3300046514 Bacteria 1652
626 Ga0495620_0002105 3300046515 Bacteria 11567
627 Ga0495628_0120729 3300046516 Bacteria 2011
628 Ga0495628_0157631 3300046516 Bacteria 1726
629 Ga0495628_0233772 3300046516 Bacteria 1377
630 Ga0495630_0013195 3300046517 Bacteria 6008
631 Ga0495630_0074459 3300046517 Bacteria 2557
632 Ga0495631_0002623 3300046518 Bacteria 10041
633 Ga0495632_0096817 3300046519 Bacteria 1393
634 Ga0495637_0023595 3300046520 Bacteria 2793
635 Ga0495637_0216971 3300046520 Bacteria 698
636 Ga0495666_0028785 3300046526 Bacteria 2733
637 Ga0495666_0039059 3300046526 Bacteria 2306
638 Ga0495642_0003736 3300046528 Bacteria 5963
639 Ga0495642_0015998 3300046528 Bacteria 2921
640 Ga0495642_0374541 3300046528 Bacteria 627
641 Ga0495652_0073811 3300046529 Bacteria 2839
642 Ga0495654_0031562 3300046530 Bacteria 2689
643 Ga0495665_0000026 3300046531 Bacteria 56855
644 Ga0495665_0022726 3300046531 Bacteria 3369
645 Ga0495640_0011314 3300046533 Bacteria 6871
646 Ga0495640_0052816 3300046533 Bacteria 2788
647 Ga0495587_0081832 3300046536 Bacteria 1871
648 Ga0495609_0127051 3300046538 Bacteria 1094
649 Ga0495597_0001363 3300046542 Bacteria 17689
650 Ga0495597_0020518 3300046542 Bacteria 3076
651 Ga0495645_0027278 3300046543 Bacteria 4148
652 Ga0495645_0140961 3300046543 Bacteria 1682
653 Ga0495622_0015791 3300046557 Bacteria 3511
654 Ga0495622_0078226 3300046557 Bacteria 1523
655 Ga0495622_0123776 3300046557 Bacteria 1180
656 Ga0495667_0040687 3300046559 Bacteria 3085
657 Ga0495667_0316334 3300046559 Bacteria 988
658 Ga0495656_0000072 3300046615 Bacteria 45119
659 Ga0495634_0052917 3300046642 Bacteria 2720
660 Ga0495625_0002706 3300046660 Bacteria 18803
661 Ga0495635_0006960 3300046663 Bacteria 7900
662 Ga0495635_0018662 3300046663 Bacteria 4838
663 Ga0495635_0135608 3300046663 Bacteria 1678
664 Ga0495661_0007336 3300046665 Bacteria 7685
665 Ga0495661_0195669 3300046665 Bacteria 1062
666 Ga0495588_0018524 3300046674 Bacteria 3397
667 Ga0495588_0020554 3300046674 Bacteria 3247
668 Ga0495588_0021488 3300046674 Bacteria 3180
669 Ga0495588_0059242 3300046674 Bacteria 1980
670 Ga0495657_0205468 3300046675 Bacteria 1199
671 Ga0495657_0313689 3300046675 Bacteria 933
672 Ga0495599_0067753 3300046678 Bacteria 2229
673 Ga0495599_0107301 3300046678 Bacteria 1740
674 Ga0495599_0329417 3300046678 Bacteria 918
675 Ga0495623_0285058 3300046679 Bacteria 917
676 Ga0495646_0080304 3300046680 Bacteria 1902
677 Ga0495647_0008135 3300046681 Bacteria 3524
678 Ga0495647_0027601 3300046681 Bacteria 2087
679 Ga0495647_0137509 3300046681 Bacteria 1040
680 Ga0495658_0000948 3300046683 Bacteria 15478
681 Ga0495658_0141337 3300046683 Bacteria 1472
682 Ga0495658_0707002 3300046683 Bacteria 645
683 Ga0495613_0002398 3300046689 Bacteria 14185
684 Ga0495613_0058403 3300046689 Bacteria 2831
685 Ga0495624_0005929 3300046690 Bacteria 8732
686 Ga0495624_0021012 3300046690 Bacteria 4334
687 Ga0495624_0060182 3300046690 Bacteria 2381
688 Ga0495670_0241752 3300046691 Bacteria 961
689 Ga0495670_0322172 3300046691 Bacteria 830
690 Ga0495660_0119919 3300046810 Bacteria 1332
691 Ga0495581_0241493 3300047315 Bacteria 1056
692 Ga0495581_0405018 3300047315 Bacteria 795
693 Ga0495604_0207345 3300047317 Bacteria 1356
694 Ga0495604_0226723 3300047317 Bacteria 1284
695 Ga0495604_0245914 3300047317 Bacteria 1221
696 Ga0495636_0051767 3300047318 Bacteria 1722
697 Ga0495674_0002401 3300047319 Bacteria 18338
698 Ga0495674_0063282 3300047319 Bacteria 3218
699 Ga0495676_0013334 3300047321 Bacteria 7384
700 Ga0495676_0257123 3300047321 Bacteria 1189
701 Ga0495676_0317344 3300047321 Bacteria 1047
702 Ga0495680_0075669 3300047322 Bacteria 2554
703 Ga0495680_0270560 3300047322 Bacteria 1200
704 Ga0495680_0317357 3300047322 Bacteria 1091
705 Ga0495687_027858 3300047443 Bacteria 2637
706 Ga0495684_0024931 3300047471 Bacteria 4600
707 Ga0495684_0306234 3300047471 Bacteria 1140
708 Ga0495593_0001257 3300047673 Bacteria 14870
709 Ga0495593_0052205 3300047673 Bacteria 2161
710 Ga0495593_0059049 3300047673 Bacteria 2010
711 Ga0495602_0219883 3300048088 Bacteria 1435
712 Ga0495614_0001448 3300048089 Bacteria 10261
713 Ga0495614_0061078 3300048089 Bacteria 1619
714 Ga0496101_0007890 3300048904 Bacteria 6928
715 Ga0496102_0013228 3300048905 Bacteria 7142
716 Ga0496102_0151926 3300048905 Bacteria 2176
717 Ga0496104_0004509 3300048907 Bacteria 12137
718 Ga0496106_0105500 3300048909 Bacteria 2189
719 Ga0496108_0035936 3300048911 Bacteria 4121
720 Ga0496108_0062509 3300048911 Bacteria 3135
721 Ga0496109_0122501 3300048912 Bacteria 2423
722 Ga0496110_0026992 3300048913 Bacteria 4919
723 Ga0496112_0000004 3300048915 Bacteria 553294
724 Ga0496113_0092812 3300048916 Bacteria 2329
725 Ga0496114_0313876 3300048917 Bacteria 1385
726 Ga0496115_0059942 3300048918 Bacteria 3066
727 Ga0496116_0015171 3300048919 Bacteria 6106
728 Ga0496116_0033263 3300048919 Bacteria 3661
729 Ga0496116_0076399 3300048919 Bacteria 2098
730 Ga0496116_0109953 3300048919 Bacteria 1623
731 Ga0496117_0008307 3300048920 Bacteria 9878
732 Ga0496117_0035955 3300048920 Bacteria 3712
733 Ga0496117_0136495 3300048920 Bacteria 1476
734 Ga0496118_0004964 3300048921 Bacteria 15387
735 Ga0496118_0019638 3300048921 Bacteria 6031
736 Ga0496121_0002820 3300048924 Bacteria 25702
737 Ga0496121_0038232 3300048924 Bacteria 4253
738 Ga0496121_0201633 3300048924 Bacteria 1417
739 Ga0496121_0204297 3300048924 Bacteria 1405
740 Ga0496121_0394420 3300048924 Bacteria 908
741 Ga0496122_0000342 3300048925 Bacteria 100753
742 Ga0496122_0074877 3300048925 Bacteria 2392
743 Ga0496122_0266100 3300048925 Bacteria 948
744 Ga0496123_0000057 3300048926 Bacteria 228608
745 Ga0496124_0002651 3300048927 Bacteria 22984
746 Ga0496124_0033680 3300048927 Bacteria 4505
747 Ga0496124_0223430 3300048927 Bacteria 1414
748 Ga0496124_0386410 3300048927 Bacteria 977
749 Ga0496125_0000060 3300048928 Bacteria 264143
750 Ga0496125_0005863 3300048928 Bacteria 13491
751 Ga0496125_0011190 3300048928 Bacteria 8993
752 Ga0496125_0012325 3300048928 Bacteria 8494
753 Ga0496125_0045843 3300048928 Bacteria 3674
754 Ga0496125_0101857 3300048928 Bacteria 2112
755 Ga0496125_0125477 3300048928 Bacteria 1820
756 Ga0496126_0030021 3300048929 Bacteria 5158
757 Ga0496126_0065196 3300048929 Bacteria 3260
758 Ga0496126_0100264 3300048929 Bacteria 2535
759 Ga0496126_0551736 3300048929 Bacteria 914
760 Ga0501033_0053363 3300049570 Bacteria 2994
761 Ga0501034_0000411 3300049571 Bacteria 72008
762 Ga0501037_0255026 3300049573 Bacteria 1227
763 Ga0501038_0072780 3300049574 Bacteria 2912
764 Ga0501043_0407794 3300049579 Bacteria 1026
765 Ga0501047_0049310 3300049581 Bacteria 4066
766 Ga0501047_0081967 3300049581 Bacteria 3101
767 Ga0501047_0358484 3300049581 Bacteria 1294
768 Ga0501048_0296774 3300049582 Bacteria 1150
769 Ga0501069_0002660 3300049585 Bacteria 9120
770 Ga0501070_0006673 3300049586 Bacteria 9829
771 Ga0501073_0006358 3300049589 Bacteria 8790
772 Ga0501208_040057 3300049655 Bacteria 863
773 Ga0501249_007682 3300049679 Bacteria 2232
774 Ga0501225_0006005 3300049705 Bacteria 3551
775 Ga0501079_0061717 3300049741 Bacteria 2891
776 Ga0501080_0025498 3300049742 Bacteria 5488
777 Ga0501080_0026926 3300049742 Bacteria 5346
778 Ga0501080_0097209 3300049742 Bacteria 2734
779 Ga0501083_0002695 3300049744 Bacteria 12241
780 Ga0501262_000392 3300049759 Bacteria 5330
781 Ga0501266_001380 3300049763 Bacteria 3100
782 Ga0501035_0164156 3300049822 Bacteria 1921
783 Ga0501035_0246141 3300049822 Bacteria 1519
784 Ga0501044_0019690 3300049823 Bacteria 7212
785 Ga0501044_0162661 3300049823 Bacteria 2207
786 Ga0501044_0188308 3300049823 Bacteria 2027
787 Ga0501044_0210797 3300049823 Bacteria 1897
788 nmdc:mga03683_21757_c1 3300050489 Bacteria 2478
789 nmdc:mga03n38_161025_c1 3300050490 Bacteria 1136
790 nmdc:mga03n38_205319_c1 3300050490 Bacteria 1022
791 nmdc:mga03n38_65126_c1 3300050490 Bacteria 1670
792 nmdc:mga00v17_9716_c1 3300050491 Bacteria 5220
793 nmdc:mga0yw44_19053_c1 3300050492 Bacteria 3776
794 nmdc:mga0yw44_67390_c1 3300050492 Bacteria 2212
795 nmdc:mga0yw44_677228_c1 3300050492 Bacteria 701
796 nmdc:mga0k408_10354_c1 3300050493 Bacteria 5042
797 nmdc:mga0k408_116135_c1 3300050493 Bacteria 1583
798 nmdc:mga0k408_120814_c1 3300050493 Bacteria 1551
799 nmdc:mga0k408_20608_c1 3300050493 Bacteria 3696
800 nmdc:mga0k408_91604_c1 3300050493 Bacteria 1786
801 nmdc:mga06z11_14694_c1 3300050494 Bacteria 3475
802 nmdc:mga07m45_1350_c1 3300050496 Bacteria 11177
803 nmdc:mga07m45_48368_c1 3300050496 Bacteria 2392
804 nmdc:mga07m45_81399_c1 3300050496 Bacteria 1849
805 nmdc:mga07m45_97999_c1 3300050496 Bacteria 1683
806 nmdc:mga0qj67_424440_c1 3300050509 Bacteria 1072
807 nmdc:mga0sz30_19489_c1 3300050516 Bacteria 2728
808 Ga0495601_0083622 3300053077 Bacteria 2050
809 Ga0495601_0345071 3300053077 Bacteria 968
810 Ga0495612_0030628 3300053078 Bacteria 2167
811 Ga0500610_0006075 3300053079 Bacteria 5026
812 Ga0500610_0008464 3300053079 Bacteria 4485
813 Ga0500610_0130748 3300053079 Bacteria 1276
814 Ga0500635_0016321 3300053080 Bacteria 2207
815 Ga0500635_0020236 3300053080 Bacteria 2036
816 Ga0495619_0013300 3300053085 Bacteria 5184
817 Ga0500647_0204483 3300053091 Bacteria 893
818 Ga0500651_0000052 3300053093 Bacteria 76301
819 Ga0500651_0320424 3300053093 Bacteria 885
820 Ga0500566_0000204 3300053094 Bacteria 31169
821 Ga0500640_001800 3300053095 Bacteria 6748
822 Ga0500557_000052 3300053105 Bacteria 50636
823 Ga0500571_001015 3300053110 Bacteria 12425
824 Ga0500572_000307 3300053111 Bacteria 17413
825 Ga0500572_000451 3300053111 Bacteria 14277
826 Ga0500593_001292 3300053117 Bacteria 9038
827 Ga0500594_0031915 3300053118 Bacteria 1392
828 Ga0500607_001189 3300053121 Bacteria 23935
829 Ga0500614_006398 3300053123 Bacteria 2475
830 Ga0500626_019774 3300053128 Bacteria 2991
831 Ga0500642_0000306 3300053130 Bacteria 17531
832 Ga0500655_004810 3300053133 Bacteria 2430
833 Ga0500658_0000033 3300053134 Bacteria 89738
834 Ga0500658_0000040 3300053134 Bacteria 79293
835 Ga0500559_0000143 3300053136 Bacteria 55572
836 Ga0500559_0000706 3300053136 Bacteria 21908
837 Ga0500559_0001066 3300053136 Bacteria 16626
838 Ga0500559_0012576 3300053136 Bacteria 3593
839 Ga0500568_0001051 3300053139 Bacteria 18831
840 Ga0500573_0042132 3300053140 Bacteria 2636
841 Ga0500574_000077 3300053141 Bacteria 11103
842 Ga0500586_002991 3300053145 Bacteria 3926
843 Ga0500590_172529 3300053148 Bacteria 949
844 Ga0500616_0006907 3300053153 Bacteria 7320
845 Ga0500616_0055674 3300053153 Bacteria 2067
846 Ga0500622_0131379 3300053156 Bacteria 1203
847 Ga0500627_0000079 3300053158 Bacteria 35871
848 Ga0500630_000027 3300053159 Bacteria 42085
849 Ga0500634_0012745 3300053161 Bacteria 4389
850 Ga0500634_0046658 3300053161 Bacteria 2340
851 Ga0500634_0242834 3300053161 Bacteria 754
852 Ga0500638_052277 3300053162 Bacteria 1974
853 Ga0500638_202634 3300053162 Bacteria 838
854 Ga0500639_000170 3300053163 Bacteria 31566
855 Ga0500636_0032785 3300053177 Bacteria 3074
856 Ga0500637_0028964 3300053178 Bacteria 3068
857 Ga0500637_0090612 3300053178 Bacteria 1770
858 Ga0500576_191379 3300053725 Bacteria 708
859 Ga0500596_000107 3300053735 Bacteria 11586
860 Ga0500596_004204 3300053735 Bacteria 2662
861 Ga0587072_003190 3300059643 Bacteria 2280
862 Ga0501082_0411948 3300060353 Bacteria 1180
863 Ga0466962_0005541 3300061719 Bacteria 6060
864 Ga0466962_0049709 3300061719 Bacteria 2004
865 2509151490 2508501128 Bacteria 8613869
866 2513229710 2513020051 Bacteria 6053213
867 2514042135 2513237165 Bacteria 6771773
868 2597029911 2596583598 Bacteria 5251611
869 2599443766 2599185178 Bacteria 5365746
870 2599625902 2599185214 Bacteria 8209958
871 2599675016 2599185226 Bacteria 8233575
872 2599683910 2599185227 Bacteria 8246414
873 2599695487 2599185229 Bacteria 8216126
874 2643866609 2643221570 Bacteria 5103772
875 2643991410 2643221596 Bacteria 5006805
876 2644062795 2643221609 Bacteria 6756331
877 2644076710 2643221611 Bacteria 6820941
878 2644162940 2643221628 Bacteria 5745828
879 2644296337 2643221652 Bacteria 5140275
880 2644329546 2643221658 Bacteria 6064537
881 2644398315 2643221672 Bacteria 6322190
882 2644465357 2643221683 Bacteria 5749203
883 2644647705 2643221717 Bacteria 5676132
884 2738722851 2738541277 Bacteria 7458140
885 2738883951 2738541307 Bacteria 8606193
886 2739244530 2738543012 Bacteria 7115078
887 2739249012 2738543013 Bacteria 5618633
888 2739283422 2738543019 Bacteria 7459457
889 2816474006 2816332133 Bacteria 7249298
890 2819596242 2818991446 Bacteria 7757362
891 2831270416 2831265667 Bacteria 7184833
892 2838056643 2838054893 Bacteria 7451788
893 2842681470 2842677519 Bacteria 5615038
894 2842722046 2842718218 Bacteria 4560148
895 2842738467 2842733646 Bacteria 5716726
896 2842751247 2842747753 Bacteria 5578255
897 2881104193 2881101125 Bacteria 4590519
898 2885194055 2885192300 Bacteria 5882526
899 2885199744 2885198086 Bacteria 7212419
900 2885213395 2885211737 Bacteria 7212420
901 2885267347 2885266251 Bacteria 4796748
902 2885375925 2885374607 Bacteria 8927485
903 2894025561 2894023352 Bacteria 5167372
904 2899925621 2899924645 Bacteria 7487985
905 2900579607 2900577576 Bacteria 5438534
906 2902407443 2902405164 Bacteria 6784948
907 2904454696 2904449895 Bacteria 6927402
908 2904460381 2904456579 Bacteria 6819253
909 2904481856 2904479285 Bacteria 5073931
910 2904546291 2904541872 Bacteria 8915136
911 2919464190 2919462493 Bacteria 5817112
912 2919704419 2919704043 Bacteria 5560311
913 2928038282 2928037797 Bacteria 7273642
914 2928046113 2928044640 Bacteria 7271509
915 2928053810 2928051484 Bacteria 7773759
916 2928062031 2928058823 Bacteria 5520022
917 2928067355 2928064002 Bacteria 7419480
918 2928076327 2928070936 Bacteria 8062541
919 2928088888 2928084124 Bacteria 7159212
920 2929164106 2929160207 Bacteria 9075316
921 2929524578 2929520902 Bacteria 6765052
922 2935631200 2935630451 Bacteria 8169952
923 2939632173 2939631187 Bacteria 6118131
924 2941509941 2941507105 Bacteria 8166816
925 2941518972 2941515067 Bacteria 8166720
926 2941525340 2941523033 Bacteria 8169134
927 2945912872 2945909444 Bacteria 7065066
928 2945947005 2945945610 Bacteria 5951079
929 2945976681 2945972063 Bacteria 6086495
930 2945984854 2945984333 Bacteria 7358892
931 2954771749 2954767861 Bacteria 5535784
932 2974323285 2974320154 Bacteria 4571377
933 2990712202 2990710928 Bacteria 5002431
934 8056692241 8056689827 Bacteria 6712655
935 Ga0496104_0482429
936 JGI24741J21665_1000148
937 JGI24740J21852_10000034
938 JGI24740J21852_10003193
939 JGI25156J39149_1002021
940 JGI25156J39149_1005929
941 JGI25154J39366_1000469
942 JGI25152J39213_1003923
943 JGI25151J46595_10001043
944 JGI25151J46595_10003018
945 JGI25151J46595_10006379
946 JGI25406J46586_10000027
947 rootH1_10054944
948 JGI25160J50197_1009372
949 Ga0006562J51391_1072237
950 Ga0055538_1005489
951 Ga0055538_1005500
952 Ga0055539_1000110
953 Ga0055533_1003648
954 Ga0055532_1000028
955 Ga0055525_1000162
956 Ga0055527_1000668
957 Ga0055535_1000022
958 Ga0055535_1001588
959 Ga0055542_1000004
960 Ga0055542_1001577
961 Ga0055529_1000063
962 Ga0055526_1011512
963 Ga0055526_1030970
964 Ga0055537_1005523
965 Ga0055536_1000020
966 Ga0055536_1000693
967 Ga0055534_1000593
968 Ga0055534_1004320
969 Ga0055528_1016007
970 Ga0055530_10000376
971 Ga0055530_10018063
972 Ga0055530_10018734
973 Ga0055540_1001215
974 Ga0055540_1004153
975 Ga0055540_1004399
976 Ga0055531_10002105
977 Ga0055541_1000956
978 Ga0065714_10109289
979 Ga0065714_10172108
980 Ga0065704_10082939
981 Ga0070658_11292820
982 Ga0070683_100007257
983 Ga0070683_100209240
984 Ga0068869_100289549
985 Ga0070682_100013306
986 Ga0070691_10212308
987 Ga0070661_100000127
988 Ga0070669_100013641
989 Ga0070674_100519434
990 Ga0070659_100000487
991 Ga0070659_100108791
992 Ga0070667_100250405
993 Ga0070709_10062260
994 Ga0070714_100012709
995 Ga0070714_100078586
996 Ga0070714_100118348
997 Ga0070713_100006657
998 Ga0070713_100031059
999 Ga0070713_100100021
1000 Ga0070710_10001287
1001 Ga0070710_10144315
1002 Ga0070711_100119302
1003 Ga0070711_100272738
1004 Ga0070708_100365212
1005 Ga0070663_100000005
1006 Ga0070663_100450353
1007 Ga0070678_100055066
1008 Ga0070678_100733216
1009 Ga0070662_100014836
1010 Ga0070681_11084128
1011 Ga0070699_100743308
1012 Ga0070679_100060150
1013 Ga0070679_100139318
1014 Ga0070684_100018906
1015 Ga0068853_100072047
1016 Ga0068855_100087394
1017 Ga0068855_100677053
1018 Ga0070664_100000001
1019 Ga0070664_101159094
1020 Ga0068857_100055508
1021 Ga0068857_101039165
1022 Ga0068854_100000565
1023 Ga0068854_100687973
1024 Ga0068856_100000020
1025 Ga0068856_100000231
1026 Ga0068852_101074298
1027 Ga0068851_10002325
1028 Ga0068863_100082272
1029 Ga0068858_100376526
1030 Ga0068862_100034765
1031 Ga0081455_10141757
1032 Ga0081540_1026197
1033 Ga0081539_10000051
1034 Ga0070717_10000905
1035 Ga0070717_10179653
1036 Ga0075365_10001229
1037 Ga0075363_100014487
1038 Ga0075363_100028278
1039 Ga0075363_100040995
1040 Ga0075364_10002710
1041 Ga0075364_10006355
1042 Ga0075364_10152896
1043 Ga0075364_10524483
1044 Ga0075432_10014484
1045 Ga0070716_100008083
1046 Ga0070712_100023926
1047 Ga0070712_100024139
1048 Ga0075362_10001311
1049 Ga0075367_10019696
1050 Ga0075367_10099553
1051 Ga0075367_10357913
1052 Ga0075367_10483062
1053 Ga0075369_10020529
1054 Ga0075366_10007788
1055 Ga0075366_10037162
1056 Ga0075366_10073344
1057 Ga0075366_10116494
1058 Ga0075370_10001337
1059 Ga0075370_10001451
1060 Ga0075370_10021660
1061 Ga0075370_10049934
1062 Ga0075370_10155164
1063 Ga0075370_10217244
1064 Ga0075430_100263846
1065 Ga0079104_1000007
1066 Ga0099826_10001210
1067 Ga0099826_10156337
1068 Ga0099826_10249991
1069 Ga0099794_10210298
1070 Ga0099795_10019566
1071 Ga0099795_10031002
1072 Ga0105244_10003174
1073 Ga0105250_10052293
1074 Ga0105240_10320744
1075 Ga0105247_10046730
1076 Ga0105247_10228012
1077 Ga0105243_10000690
1078 Ga0105243_10001470
1079 Ga0105243_10004088
1080 Ga0105243_10086673
1081 Ga0105241_10076405
1082 Ga0105241_10179275
1083 Ga0105242_10000960
1084 Ga0105237_10104860
1085 Ga0105237_10350273
1086 Ga0099796_10024110
1087 Ga0105239_10168111
1088 Ga0105239_10404375
1089 Ga0157373_10001322
1090 Ga0157373_10026944
1091 Ga0157371_10000166
1092 Ga0157370_10000021
1093 Ga0157370_10011723
1094 Ga0157370_10096278
1095 Ga0157370_10307899
1096 Ga0157369_10014737
1097 Ga0157369_10016409
1098 Ga0157369_10026776
1099 Ga0157374_11206593
1100 Ga0157372_10000136
1101 Ga0157372_10078726
1102 Ga0157372_10120829
1103 Ga0157372_10122123
1104 Ga0157372_10215607
1105 Ga0157375_10559502
1106 Ga0157380_10426961
1107 Ga0182008_10000163
1108 Ga0182008_10003150
1109 Ga0182008_10033743
1110 Ga0157376_10101660
1111 Ga0182006_1002901
1112 Ga0182006_1030738
1113 Ga0182006_1037687
1114 Ga0182007_10001559
1115 Ga0182007_10001915
1116 Ga0182007_10004906
1117 Ga0183362_10001
1118 Ga0183361_10005
1119 Ga0163161_10000861
1120 Ga0163161_10008770
1121 Ga0163161_10052470
1122 Ga0163161_10151591
1123 Ga0206356_11440482
1124 Ga0206351_10478166
1125 Ga0154015_1141018
1126 Ga0213873_10004620
1127 Ga0213872_10008077
1128 Ga0213876_10001197
1129 Ga0213871_10004096
1130 Ga0209784_100014
1131 Ga0209784_100499
1132 Ga0209566_100011
1133 Ga0209566_100265
1134 Ga0209566_100768
1135 Ga0209674_100032
1136 Ga0209674_100178
1137 Ga0209672_100230
1138 Ga0209672_100542
1139 Ga0209672_101967
1140 Ga0209147_100002
1141 Ga0209147_101233
1142 Ga0209563_100029
1143 Ga0209563_103559
1144 Ga0209563_108656
1145 Ga0209258_100002
1146 Ga0209258_100022
1147 Ga0207425_1000630
1148 Ga0209646_1000058
1149 Ga0209026_1012090
1150 Ga0209677_100042
1151 Ga0209677_110156
1152 Ga0209148_1000034
1153 Ga0209148_1000043
1154 Ga0209148_1005542
1155 Ga0209759_1001157
1156 Ga0209759_1006518
1157 Ga0209759_1021030
1158 Ga0209129_1000111
1159 Ga0209129_1001316
1160 Ga0209129_1010851
1161 Ga0209565_1000040
1162 Ga0209565_1000136
1163 Ga0209565_1000146
1164 Ga0209565_1005749
1165 Ga0209455_1000009
1166 Ga0209673_1000109
1167 Ga0209673_1000175
1168 Ga0209673_1000664
1169 Ga0209673_1004580
1170 Ga0209673_1009956
1171 Ga0209130_1000546
1172 Ga0209130_1000566
1173 Ga0209130_1002388
1174 Ga0209130_1004524
1175 Ga0209130_1017895
1176 Ga0209675_1000024
1177 Ga0209675_1000541
1178 Ga0209675_1000962
1179 Ga0209675_1002172
1180 Ga0209675_1003271
1181 Ga0209675_1003738
1182 Ga0209676_1000005
1183 Ga0209676_1000066
1184 Ga0209676_1000254
1185 Ga0209676_1000478
1186 Ga0209676_1003608
1187 Ga0209676_1004255
1188 Ga0209676_1022411
1189 Ga0209676_1048109
1190 Ga0209676_1055974
1191 Ga0209025_1000096
1192 Ga0209025_1000116
1193 Ga0209025_1000394
1194 Ga0209025_1000471
1195 Ga0209025_1000711
1196 Ga0209025_1001264
1197 Ga0209025_1045333
1198 Ga0209025_1049298
1199 Ga0209564_1000155
1200 Ga0209564_1001277
1201 Ga0209564_1001679
1202 Ga0209564_1002082
1203 Ga0209564_1002434
1204 Ga0209758_1000107
1205 Ga0209758_1013473
1206 Ga0209050_1000007
1207 Ga0209050_1002418
1208 Ga0209050_1003597
1209 Ga0209256_1000038
1210 Ga0209256_1000087
1211 Ga0209256_1001536
1212 Ga0207426_1000090
1213 Ga0207426_1000123
1214 Ga0207426_1021300
1215 Ga0209051_1000009
1216 Ga0209051_1000073
1217 Ga0209051_1000092
1218 Ga0209051_1000821
1219 Ga0209051_1006929
1220 Ga0209051_1010079
1221 Ga0209051_1017832
1222 Ga0209051_1035966
1223 Ga0209257_1000011
1224 Ga0209257_1000139
1225 Ga0209257_1013202
1226 Ga0207655_1018504
1227 Ga0207692_10000175
1228 Ga0207692_10146161
1229 Ga0207710_10101978
1230 Ga0207688_10548021
1231 Ga0207699_10002794
1232 Ga0207705_10129664
1233 Ga0207654_10211686
1234 Ga0207707_10016441
1235 Ga0207695_10005940
1236 Ga0207695_10006828
1237 Ga0207695_10904399
1238 Ga0207671_10050676
1239 Ga0207671_10090882
1240 Ga0207693_10068291
1241 Ga0207693_10129554
1242 Ga0207663_10052291
1243 Ga0207663_10339339
1244 Ga0207660_10064084
1245 Ga0207657_10102345
1246 Ga0207657_10729827
1247 Ga0207649_10000185
1248 Ga0207652_10192112
1249 Ga0207652_10229849
1250 Ga0207652_10539155
1251 Ga0207646_10101454
1252 Ga0207681_10010177
1253 Ga0207694_10169676
1254 Ga0207694_10347474
1255 Ga0207659_10796574
1256 Ga0207687_10542323
1257 Ga0207687_10696084
1258 Ga0207700_10001663
1259 Ga0207700_10081270
1260 Ga0207700_10417901
1261 Ga0207664_10007161
1262 Ga0207664_10142567
1263 Ga0207664_10418180
1264 Ga0207664_10458485
1265 Ga0207690_10001564
1266 Ga0207690_10056527
1267 Ga0207706_10030525
1268 Ga0207686_10005163
1269 Ga0207709_10000112
1270 Ga0207709_10000233
1271 Ga0207709_10000813
1272 Ga0207709_10061457
1273 Ga0207669_10820804
1274 Ga0207665_10003937
1275 Ga0207665_10070934
1276 Ga0207665_10184834
1277 Ga0207691_10183460
1278 Ga0207689_10270982
1279 Ga0207661_10052447
1280 Ga0207679_10000003
1281 Ga0207679_10627790
1282 Ga0207667_10003980
1283 Ga0207667_10244311
1284 Ga0207712_10228128
1285 Ga0207640_10000045
1286 Ga0207640_10088750
1287 Ga0207640_10296049
1288 Ga0207658_10676604
1289 Ga0207703_10227711
1290 Ga0207639_10046966
1291 Ga0207639_10833445
1292 Ga0207678_10000002
1293 Ga0207678_10183049
1294 Ga0207702_10000046
1295 Ga0207702_10000126
1296 Ga0207641_10109057
1297 Ga0207648_10408908
1298 Ga0207674_10047105
1299 Ga0207674_10095395
1300 Ga0207674_11175887
1301 Ga0207683_10210081
1302 Ga0207683_10825715
1303 Ga0209281_1000020
1304 Ga0209982_1008579
1305 Ga0209983_1086104
1306 Ga0209282_1000843
1307 Ga0209282_1126244
1308 Ga0209971_1097678
1309 Ga0209974_10011195
1310 Ga0209974_10032684
1311 Ga0209974_10097900
1312 Ga0207428_10084855
1313 Ga0268266_10007039
1314 Ga0268266_10035469
1315 Ga0268266_10475287
1316 Ga0268265_10045469
1317 Ga0265326_10035618
1318 Ga0265334_10000456
1319 Ga0265318_10024292
1320 Ga0265323_10000424
1321 Ga0265336_10000335
1322 Ga0307515_10000028
1323 Ga0307515_10000459
1324 Ga0307515_10062835
1325 Ga0265338_10000321
1326 Ga0265324_10003194
1327 Ga0307511_10046571
1328 Ga0307512_10288286
1329 Ga0316177_1111932
1330 Ga0314311_1013083
1331 Ga0316178_1047919
1332 Ga0316180_1174537
1333 Ga0316183_1113265
1334 Ga0316181_1247518
1335 Ga0316181_1267722
1336 Ga0316182_1032368
1337 Ga0316182_1283731
1338 Ga0265330_10000032
1339 Ga0265332_10000001
1340 Ga0265332_10228983
1341 Ga0265320_10257377
1342 Ga0265325_10024499
1343 Ga0265340_10026792
1344 Ga0265327_10000842
1345 Ga0265327_10014001
1346 Ga0307513_10000006
1347 Ga0307513_10064738
1348 Ga0307513_10194366
1349 Ga0307513_10489998
1350 Ga0307509_10150600
1351 Ga0307408_100000048
1352 Ga0307408_100036713
1353 Ga0307408_100076739
1354 Ga0307408_100132006
1355 Ga0307408_100205557
1356 Ga0307408_100502861
1357 Ga0307408_100720229
1358 Ga0265313_10071604
1359 Ga0307508_10000018
1360 Ga0307508_10066006
1361 Ga0265314_10000022
1362 Ga0316576_10026682
1363 Ga0307516_10049184
1364 Ga0307405_10020177
1365 Ga0307405_10027664
1366 Ga0307405_10054064
1367 Ga0307405_10128742
1368 Ga0307405_10310932
1369 Ga0307405_10445272
1370 Ga0307410_10165182
1371 Ga0307406_10003632
1372 Ga0307406_10007807
1373 Ga0307406_10143576
1374 Ga0307406_10308906
1375 Ga0307406_10523830
1376 Ga0307406_10889520
1377 Ga0307412_10661515
1378 Ga0307412_10708954
1379 Ga0307412_10712524
1380 Ga0307412_10821375
1381 Ga0307412_10900036
1382 Ga0307416_100023276
1383 Ga0307416_100203986
1384 Ga0307416_100577990
1385 Ga0307416_100688677
1386 Ga0307416_101400665
1387 Ga0307414_10035395
1388 Ga0307414_10335346
1389 Ga0307414_10342488
1390 Ga0307411_10103883
1391 Ga0307411_10244901
1392 Ga0307411_10388288
1393 Ga0307415_100422152
1394 Ga0307507_10018406
1395 Ga0307510_10436462
1396 Ga0373930_0047290
1397 Ga0373926_0012705
1398 Ga0373934_0088843
1399 Ga0373944_0060135
1400 Ga0373923_0025107
1401 Ga0373936_0058980
1402 Ga0373936_0102136
1403 Ga0373936_0127971
1404 Ga0373945_0031530
1405 Ga0373945_0124483
1406 Ga0373954_0012543
1407 Ga0373956_0019990
1408 Ga0373943_0023599
1409 Ga0373946_0071677
1410 Ga0373946_0080658
1411 Ga0373955_0007905
1412 Ga0373955_0012397
1413 Ga0373955_0528083
1414 Ga0316574_0264288
1415 Ga0373924_0031961
1416 Ga0373924_0093030
1417 Ga0373931_0150349
1418 Ga0373935_0003280
1419 Ga0373935_0012167
1420 Ga0373935_0047296
1421 Ga0373935_0204582
1422 Ga0373927_0010043
1423 Ga0373927_0014211
1424 Ga0373927_0016888
1425 Ga0373927_0094655
1426 Ga0373933_0000199
1427 Ga0373933_0291280
1428 Ga0373947_0001007
1429 Ga0373947_0011689
1430 Ga0373947_0036433
1431 Ga0373937_0008799
1432 Ga0373937_0184508
1433 Ga0373937_0254625
1434 Ga0373937_0569176
1435 Ga0372808_007091
1436 Ga0373925_0086593
1437 Ga0373925_0121179
1438 Ga0373925_0160136
1439 Ga0373925_0553967
1440 Ga0373925_0773647
1441 Ga0395900_0004253
1442 Ga0395900_0136533
1443 Ga0395898_0303349
1444 Ga0395898_0505553
1445 Ga0395905_0926792
1446 Ga0395901_0128090
1447 Ga0395901_0236794
1448 Ga0395901_0289274
1449 Ga0436365_0170763
1450 Ga0436360_0228422
1451 Ga0436361_0924706
1452 Ga0436361_1047968
1453 Ga0436363_1310819
1454 Ga0436362_0010135
1455 Ga0436362_0952081
1456 Ga0436362_1155672
1457 Ga0439436_0000286
1458 Ga0439436_0021886
1459 Ga0439439_0016633
1460 Ga0439461_0019810
1461 Ga0439466_0028081
1462 Ga0439466_0028201
1463 Ga0439465_0000951
1464 Ga0451798_0924623
1465 Ga0451800_1523891
1466 Ga0451849_0915040
1467 Ga0451849_1433168
1468 Ga0451853_0477501
1469 Ga0451853_3209351
1470 Ga0439431_0011074
1471 Ga0439431_0043105
1472 Ga0439433_0001421
1473 Ga0439433_0006936
1474 Ga0439442_002910
1475 Ga0439445_0011452
1476 Ga0439445_0012844
1477 Ga0439445_0074342
1478 Ga0439432_005960
1479 Ga0439449_0001357
1480 Ga0439449_0003714
1481 Ga0439449_0009909
1482 Ga0439449_0076350
1483 Ga0439452_008282
1484 Ga0439452_008630
1485 Ga0439457_020647
1486 Ga0439462_0005949
1487 Ga0439462_0008592
1488 Ga0439462_0010920
1489 Ga0450911_000739
1490 Ga0450911_006909
1491 Ga0450920_041192
1492 Ga0450897_012993
1493 Ga0450894_018314
1494 Ga0450898_015863
1495 Ga0450898_020184
1496 Ga0450906_035372
1497 Ga0450907_019264
1498 Ga0450910_012751
1499 Ga0439446_0029162
1500 Ga0439446_0030956
1501 Ga0450908_011305
1502 Ga0439434_0001247
1503 Ga0439434_0053487
1504 Ga0450893_0028504
1505 Ga0450893_0045069
1506 Ga0451577_0009700
1507 Ga0451577_0471364
1508 Ga0466969_0064265
1509 Ga0466972_0003977
1510 Ga0466977_0006392
1511 Ga0466978_0039070
1512 Ga0453683_0290217
1513 Ga0466965_0046134
1514 Ga0466965_0225082
1515 Ga0466966_0070596
1516 Ga0466961_0000163
1517 Ga0466964_0006910
1518 Ga0453684_1489191
1519 Ga0466970_0003216
1520 Ga0466957_0180493
1521 Ga0466960_0102751
1522 Ga0466959_0033826
1523 Ga0466959_0043879
1524 Ga0466959_0087836
1525 Ga0451576_1145613
1526 Ga0466958_0126723
1527 Ga0466958_0368306
1528 Ga0466967_0384842
1529 Ga0466967_0837577
1530 Ga0495592_0001669
1531 Ga0495592_0047124
1532 Ga0495592_0098737
1533 Ga0495603_0000464
1534 Ga0495603_0036080
1535 Ga0495629_0016724
1536 Ga0495629_0040804
1537 Ga0495638_0064259
1538 Ga0495641_0011283
1539 Ga0495651_0392690
1540 Ga0495650_0002924
1541 Ga0495580_0002907
1542 Ga0495580_0007795
1543 Ga0495580_0076087
1544 Ga0495582_0000174
1545 Ga0495639_0000136
1546 Ga0495639_0014455
1547 Ga0495639_0024440
1548 Ga0495662_0045819
1549 Ga0495662_0372241
1550 Ga0495664_0003701
1551 Ga0495664_0012734
1552 Ga0495594_0002231
1553 Ga0495594_0225192
1554 Ga0495594_0240331
1555 Ga0495606_0003754
1556 Ga0495610_0018222
1557 Ga0495616_0004613
1558 Ga0495618_0014867
1559 Ga0495618_0124232
1560 Ga0495620_0002105
1561 Ga0495628_0120729
1562 Ga0495628_0157631
1563 Ga0495628_0233772
1564 Ga0495630_0013195
1565 Ga0495630_0074459
1566 Ga0495631_0002623
1567 Ga0495632_0096817
1568 Ga0495637_0023595
1569 Ga0495637_0216971
1570 Ga0495666_0028785
1571 Ga0495666_0039059
1572 Ga0495642_0003736
1573 Ga0495642_0015998
1574 Ga0495642_0374541
1575 Ga0495652_0073811
1576 Ga0495654_0031562
1577 Ga0495665_0000026
1578 Ga0495665_0022726
1579 Ga0495640_0011314
1580 Ga0495640_0052816
1581 Ga0495587_0081832
1582 Ga0495609_0127051
1583 Ga0495597_0001363
1584 Ga0495597_0020518
1585 Ga0495645_0027278
1586 Ga0495645_0140961
1587 Ga0495622_0015791
1588 Ga0495622_0078226
1589 Ga0495622_0123776
1590 Ga0495667_0040687
1591 Ga0495667_0316334
1592 Ga0495656_0000072
1593 Ga0495634_0052917
1594 Ga0495625_0002706
1595 Ga0495635_0006960
1596 Ga0495635_0018662
1597 Ga0495635_0135608
1598 Ga0495661_0007336
1599 Ga0495661_0195669
1600 Ga0495588_0018524
1601 Ga0495588_0020554
1602 Ga0495588_0021488
1603 Ga0495588_0059242
1604 Ga0495657_0205468
1605 Ga0495657_0313689
1606 Ga0495599_0067753
1607 Ga0495599_0107301
1608 Ga0495599_0329417
1609 Ga0495623_0285058
1610 Ga0495646_0080304
1611 Ga0495647_0008135
1612 Ga0495647_0027601
1613 Ga0495647_0137509
1614 Ga0495658_0000948
1615 Ga0495658_0141337
1616 Ga0495658_0707002
1617 Ga0495613_0002398
1618 Ga0495613_0058403
1619 Ga0495624_0005929
1620 Ga0495624_0021012
1621 Ga0495624_0060182
1622 Ga0495670_0241752
1623 Ga0495670_0322172
1624 Ga0495660_0119919
1625 Ga0495581_0241493
1626 Ga0495581_0405018
1627 Ga0495604_0207345
1628 Ga0495604_0226723
1629 Ga0495604_0245914
1630 Ga0495636_0051767
1631 Ga0495674_0002401
1632 Ga0495674_0063282
1633 Ga0495676_0013334
1634 Ga0495676_0257123
1635 Ga0495676_0317344
1636 Ga0495680_0075669
1637 Ga0495680_0270560
1638 Ga0495680_0317357
1639 Ga0495687_027858
1640 Ga0495684_0024931
1641 Ga0495684_0306234
1642 Ga0495593_0001257
1643 Ga0495593_0052205
1644 Ga0495593_0059049
1645 Ga0495602_0219883
1646 Ga0495614_0001448
1647 Ga0495614_0061078
1648 Ga0496101_0007890
1649 Ga0496102_0013228
1650 Ga0496102_0151926
1651 Ga0496104_0004509
1652 Ga0496106_0105500
1653 Ga0496108_0035936
1654 Ga0496108_0062509
1655 Ga0496109_0122501
1656 Ga0496110_0026992
1657 Ga0496112_0000004
1658 Ga0496113_0092812
1659 Ga0496114_0313876
1660 Ga0496115_0059942
1661 Ga0496116_0015171
1662 Ga0496116_0033263
1663 Ga0496116_0076399
1664 Ga0496116_0109953
1665 Ga0496117_0008307
1666 Ga0496117_0035955
1667 Ga0496117_0136495
1668 Ga0496118_0004964
1669 Ga0496118_0019638
1670 Ga0496121_0002820
1671 Ga0496121_0038232
1672 Ga0496121_0201633
1673 Ga0496121_0204297
1674 Ga0496121_0394420
1675 Ga0496122_0000342
1676 Ga0496122_0074877
1677 Ga0496122_0266100
1678 Ga0496123_0000057
1679 Ga0496124_0002651
1680 Ga0496124_0033680
1681 Ga0496124_0223430
1682 Ga0496124_0386410
1683 Ga0496125_0000060
1684 Ga0496125_0005863
1685 Ga0496125_0011190
1686 Ga0496125_0012325
1687 Ga0496125_0045843
1688 Ga0496125_0101857
1689 Ga0496125_0125477
1690 Ga0496126_0030021
1691 Ga0496126_0065196
1692 Ga0496126_0100264
1693 Ga0496126_0551736
1694 Ga0501033_0053363
1695 Ga0501034_0000411
1696 Ga0501037_0255026
1697 Ga0501038_0072780
1698 Ga0501043_0407794
1699 Ga0501047_0049310
1700 Ga0501047_0081967
1701 Ga0501047_0358484
1702 Ga0501048_0296774
1703 Ga0501069_0002660
1704 Ga0501070_0006673
1705 Ga0501073_0006358
1706 Ga0501208_040057
1707 Ga0501249_007682
1708 Ga0501225_0006005
1709 Ga0501079_0061717
1710 Ga0501080_0025498
1711 Ga0501080_0026926
1712 Ga0501080_0097209
1713 Ga0501083_0002695
1714 Ga0501262_000392
1715 Ga0501266_001380
1716 Ga0501035_0164156
1717 Ga0501035_0246141
1718 Ga0501044_0019690
1719 Ga0501044_0162661
1720 Ga0501044_0188308
1721 Ga0501044_0210797
1722 nmdc:mga03683_21757_c1
1723 nmdc:mga03n38_161025_c1
1724 nmdc:mga03n38_205319_c1
1725 nmdc:mga03n38_65126_c1
1726 nmdc:mga00v17_9716_c1
1727 nmdc:mga0yw44_19053_c1
1728 nmdc:mga0yw44_67390_c1
1729 nmdc:mga0yw44_677228_c1
1730 nmdc:mga0k408_10354_c1
1731 nmdc:mga0k408_116135_c1
1732 nmdc:mga0k408_120814_c1
1733 nmdc:mga0k408_20608_c1
1734 nmdc:mga0k408_91604_c1
1735 nmdc:mga06z11_14694_c1
1736 nmdc:mga07m45_1350_c1
1737 nmdc:mga07m45_48368_c1
1738 nmdc:mga07m45_81399_c1
1739 nmdc:mga07m45_97999_c1
1740 nmdc:mga0qj67_424440_c1
1741 nmdc:mga0sz30_19489_c1
1742 Ga0495601_0083622
1743 Ga0495601_0345071
1744 Ga0495612_0030628
1745 Ga0500610_0006075
1746 Ga0500610_0008464
1747 Ga0500610_0130748
1748 Ga0500635_0016321
1749 Ga0500635_0020236
1750 Ga0495619_0013300
1751 Ga0500647_0204483
1752 Ga0500651_0000052
1753 Ga0500651_0320424
1754 Ga0500566_0000204
1755 Ga0500640_001800
1756 Ga0500557_000052
1757 Ga0500571_001015
1758 Ga0500572_000307
1759 Ga0500572_000451
1760 Ga0500593_001292
1761 Ga0500594_0031915
1762 Ga0500607_001189
1763 Ga0500614_006398
1764 Ga0500626_019774
1765 Ga0500642_0000306
1766 Ga0500655_004810
1767 Ga0500658_0000033
1768 Ga0500658_0000040
1769 Ga0500559_0000143
1770 Ga0500559_0000706
1771 Ga0500559_0001066
1772 Ga0500559_0012576
1773 Ga0500568_0001051
1774 Ga0500573_0042132
1775 Ga0500574_000077
1776 Ga0500586_002991
1777 Ga0500590_172529
1778 Ga0500616_0006907
1779 Ga0500616_0055674
1780 Ga0500622_0131379
1781 Ga0500627_0000079
1782 Ga0500630_000027
1783 Ga0500634_0012745
1784 Ga0500634_0046658
1785 Ga0500634_0242834
1786 Ga0500638_052277
1787 Ga0500638_202634
1788 Ga0500639_000170
1789 Ga0500636_0032785
1790 Ga0500637_0028964
1791 Ga0500637_0090612
1792 Ga0500576_191379
1793 Ga0500596_000107
1794 Ga0500596_004204
1795 Ga0587072_003190
1796 Ga0501082_0411948
1797 Ga0466962_0005541
1798 Ga0466962_0049709
1799 2509151490
1800 2513229710
1801 2514042135
1802 2597029911
1803 2599443766
1804 2599625902
1805 2599675016
1806 2599683910
1807 2599695487
1808 2643866609
1809 2643991410
1810 2644062795
1811 2644076710
1812 2644162940
1813 2644296337
1814 2644329546
1815 2644398315
1816 2644465357
1817 2644647705
1818 2738722851
1819 2738883951
1820 2739244530
1821 2739249012
1822 2739283422
1823 2816474006
1824 2819596242
1825 2831270416
1826 2838056643
1827 2842681470
1828 2842722046
1829 2842738467
1830 2842751247
1831 2881104193
1832 2885194055
1833 2885199744
1834 2885213395
1835 2885267347
1836 2885375925
1837 2894025561
1838 2899925621
1839 2900579607
1840 2902407443
1841 2904454696
1842 2904460381
1843 2904481856
1844 2904546291
1845 2919464190
1846 2919704419
1847 2928038282
1848 2928046113
1849 2928053810
1850 2928062031
1851 2928067355
1852 2928076327
1853 2928088888
1854 2929164106
1855 2929524578
1856 2935631200
1857 2939632173
1858 2941509941
1859 2941518972
1860 2941525340
1861 2945912872
1862 2945947005
1863 2945976681
1864 2945984854
1865 2954771749
1866 2974323285
1867 2990712202
1868 8056692241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

77

159

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.9918 6 195
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.9814 6 195
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.9631 6 192
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.9581 6 192
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.9565 6 192
ID Description Score Start End Superfamily
2prrB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9801 69 195 1.20.1290.10
2prrB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9722 69 195 1.20.1290.10
2prrG01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.9711 15 67 1.20.5.810
2prrD01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.969 15 67 1.20.5.810
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9654 69 192 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A6L7S6G7-F1-model_v4 Peroxidase-related enzyme 1.001 36 192 GO:0051920
AF-A0A4Q5R7J0-F1-model_v4 Alkylhydroperoxidase 0.9999 52 192 GO:0051920
AF-A0A6L3Y468-F1-model_v4 Peroxidase-related enzyme 0.9993 38 192 GO:0051920
AF-A0A7V2UMS3-F1-model_v4 Alkylhydroperoxidase 0.9992 9 165 GO:0051920
AF-A0A838BPA4-F1-model_v4 Peroxidase-related enzyme 0.9973 4 193 GO:0051920

Map