F486140

General Info

Members Datasets Scaffolds Average Seq Length
934 573 1868 146

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0296666|Ga0501042_0296666_190_711
Length 173
Sequence MAAHGGIAAGAERAMLGAGSRRAVLEGNMTLHLIKLCVGCESIEDLASWQKERLGERRKAGEKRPQLFHRTFQMPKRRDELLAGGSLYWVIKGLVACRQPLLGIKPFTDKDGIGRCHLLLDPVVIPVEPRPSRPFQGWRYLASRDAPRDLKAGRGLAKMPEELRQELAQLGLI

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
64 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
65 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
113 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
151 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
154 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
155 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
156 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
163 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
164 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
165 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
168 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
285 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
286 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
290 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
291 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
292 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
293 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
294 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
297 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
298 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
299 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
304 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
305 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
306 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
311 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
312 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
313 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
314 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
317 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
318 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
319 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
320 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
321 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
322 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
323 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
324 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
325 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
326 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
327 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
328 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
329 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
330 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
331 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
332 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
333 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
334 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
335 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
336 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
337 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
338 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
339 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
340 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
341 2519899620 Rhizobium sp. Pop5 Isolate Nodule
342 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
343 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
344 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
345 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
346 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
347 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
348 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
349 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
350 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
351 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
352 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
353 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
354 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
355 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
356 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
357 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
358 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
359 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
360 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
361 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
362 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
363 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
364 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
365 2643221558 Rhizobium sp. Root149 Isolate Unclassified
366 2643221568 Rhizobium sp. Root564 Isolate Unclassified
367 2643221582 Rhizobium sp. Root651 Isolate Unclassified
368 2643221599 Rhizobium sp. Root708 Isolate Unclassified
369 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
370 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
371 2643221693 Rhizobium sp. Root491 Isolate Unclassified
372 2718217882 Rhizobium sp. N741 Isolate Nodule
373 2718217927 Rhizobium sp. N324 Isolate Nodule
374 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
375 2718218009 Rhizobium sp. N561 Isolate Nodule
376 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
377 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
378 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
379 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
380 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
381 2718218363 Rhizobium sp. N113 Isolate Nodule
382 2718218365 Rhizobium sp. N731 Isolate Nodule
383 2718218366 Rhizobium sp. N621 Isolate Nodule
384 2718218423 Rhizobium sp. N941 Isolate Nodule
385 2721755514 Rhizobium sp. N6212 Isolate Nodule
386 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
387 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
388 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
389 2721755809 Rhizobium sp. N541 Isolate Nodule
390 2721755810 Rhizobium sp. N871 Isolate Nodule
391 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
392 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
393 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
394 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
395 2728369365 Rhizobium sp. N1341 Isolate Nodule
396 2728369397 Rhizobium sp. N1314 Isolate Nodule
397 2738541293 Rhizobium sp. GV031 Isolate Unclassified
398 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
399 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
400 2791355256 Rhizobium sp. M10 Isolate Nodule
401 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
402 2791355260 Rhizobium sp. L9 Isolate Nodule
403 2791355261 Rhizobium sp. J15 Isolate Nodule
404 2791355262 Rhizobium sp. M1 Isolate Nodule
405 2791355263 Rhizobium chutanense C5 Isolate Nodule
406 2791355264 Rhizobium sp. S9 Isolate Nodule
407 2791355265 Rhizobium sp. H4 Isolate Nodule
408 2791355266 Rhizobium sp. L43 Isolate Nodule
409 2791355267 Rhizobium sp. L18 Isolate Nodule
410 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
411 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
412 2802429633 Rhizobium anhuiense J3 Isolate Nodule
413 2802429634 Rhizobium anhuiense S10 Isolate Nodule
414 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
415 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
416 2802429637 Rhizobium anhuiense C15 Isolate Nodule
417 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
418 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
419 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
420 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
421 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
422 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
423 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
424 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
425 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
426 2838048938 Rhizobium pisi 27/80 Isolate Nodule
427 2838061910 Rhizobium phaseoli L15 Isolate Nodule
428 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
429 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
430 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
431 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
432 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
433 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
434 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
435 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
436 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
437 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
438 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
439 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
440 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
441 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
442 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
443 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
444 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
445 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
446 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
447 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
448 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
449 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
450 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
451 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
452 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
453 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
454 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
455 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
456 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
457 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
458 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
459 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
460 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
461 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
462 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
463 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
464 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
465 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
466 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
467 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
468 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
469 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
470 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
471 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
472 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
473 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
474 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
475 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
476 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
477 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
478 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
479 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
480 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
481 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
482 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
483 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
484 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
485 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
486 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
487 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
488 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
489 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
490 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
491 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
492 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
493 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
494 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
495 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
496 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
497 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
498 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
499 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
500 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
501 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
502 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
503 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
504 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
505 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
506 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
507 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
508 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
509 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
510 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
511 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
512 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
513 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
514 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
515 2933599457 Rhizobium phaseoli M3 Isolate Nodule
516 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
517 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
518 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
519 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
520 2936381700 Rhizobium chutanense C16 Isolate Unclassified
521 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
522 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
523 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
524 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
525 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
526 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
527 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
528 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
529 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
530 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
531 2996887358 Rhizobium sp. R711 Isolate Nodule
532 2996893221 Rhizobium sp. R635 Isolate Nodule
533 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
534 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
535 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
536 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
537 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
538 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
539 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
540 8005258706 Rhizobium sp. R693 Isolate Nodule
541 8005275841 Rhizobium sp. N4311 Isolate Nodule
542 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
543 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
544 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
545 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
546 8005321885 Rhizobium sp. R72 Isolate Nodule
547 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
548 8005382845 Rhizobium sp. R634 Isolate Nodule
549 8005395548 Rhizobium sp. R339 Isolate Nodule
550 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
551 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
552 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
553 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
554 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
555 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
556 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
557 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
558 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
559 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
560 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
561 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
562 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
563 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
564 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
565 8018176218 Rhizobium sp. N122 Isolate Nodule
566 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
567 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
568 8024501048 Rhizobium sp. H4 Isolate Nodule
569 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
570 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
571 8056382006 Rhizobium croatiense 13T Isolate Nodule
572 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
573 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.06
Metatranscriptomes 0.32
Isolates 27.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 23.77
Nodule 19.91
Rhizoplane 2.46
Rhizosphere 35.22
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0296666 3300049578 Bacteria 1168
2 JGI25158J39367_1000033 3300002739 Bacteria 30955
3 JGI25152J39213_1000526 3300002773 Bacteria 21222
4 JGI25152J39213_1004775 3300002773 Bacteria 4163
5 JGI25152J39213_1005934 3300002773 Bacteria 3436
6 JGI25152J39213_1008818 3300002773 Bacteria 2463
7 JGI25152J39213_1011566 3300002773 Bacteria 1946
8 JGI25152J39213_1011567 3300002773 Bacteria 1946
9 JGI25150J39212_1000010 3300002774 Bacteria 236260
10 JGI25150J39212_1002491 3300002774 Bacteria 4561
11 JGI25159J45721_1002570 3300002987 Bacteria 6808
12 JGI25151J46595_10000026 3300003187 Bacteria 211045
13 JGI25151J46595_10000942 3300003187 Bacteria 22517
14 JGI25151J46595_10004710 3300003187 Bacteria 7173
15 JGI25151J46595_10011116 3300003187 Bacteria 4149
16 JGI25151J46595_10069449 3300003187 Bacteria 1075
17 JGI25151J46595_10140627 3300003187 Bacteria 589
18 JGI25153J46596_10003998 3300003215 Bacteria 8052
19 JGI25153J46596_10009882 3300003215 Bacteria 4376
20 JGI25153J46596_10028302 3300003215 Bacteria 1946
21 JGI25153J46596_10028308 3300003215 Bacteria 1946
22 JGI25153J46596_10045921 3300003215 Bacteria 1299
23 JGI25153J46596_10051881 3300003215 Bacteria 1171
24 JGI25153J46596_10113137 3300003215 Bacteria 621
25 rootH1_10018254 3300003316 Bacteria 3091
26 rootH2_10083074 3300003320 Bacteria 1886
27 rootH1_10209458 3300003323 Bacteria 1823
28 JGI25160J50197_1002155 3300003354 Bacteria 9321
29 JGI25160J50197_1060657 3300003354 Bacteria 757
30 JGI25161J50226_1000285 3300003374 Bacteria 28780
31 JGI25161J50226_1000346 3300003374 Bacteria 24757
32 JGI25161J50226_1001041 3300003374 Bacteria 9526
33 Ga0006562J51391_1040093 3300003578 Bacteria 2006
34 Ga0055526_1001677 3300003771 Bacteria 15538
35 Ga0055526_1008048 3300003771 Bacteria 5326
36 Ga0055526_1012169 3300003771 Bacteria 3782
37 Ga0055526_1026624 3300003771 Bacteria 1816
38 Ga0055526_1053312 3300003771 Bacteria 906
39 Ga0055524_1002383 3300003775 Bacteria 9739
40 Ga0055524_1005290 3300003775 Bacteria 5795
41 Ga0055524_1008069 3300003775 Bacteria 4403
42 Ga0055524_1008900 3300003775 Bacteria 4132
43 Ga0055524_1035651 3300003775 Bacteria 1353
44 Ga0055536_1011865 3300003781 Bacteria 3290
45 Ga0055528_1000851 3300003790 Bacteria 20725
46 Ga0055528_1001075 3300003790 Bacteria 18004
47 Ga0055528_1001905 3300003790 Bacteria 11844
48 Ga0055528_1014016 3300003790 Bacteria 2995
49 Ga0055530_10020414 3300003791 Bacteria 1979
50 Ga0055540_1000620 3300003792 Bacteria 25294
51 Ga0055540_1001108 3300003792 Bacteria 16992
52 Ga0055540_1002555 3300003792 Bacteria 9485
53 Ga0055540_1013077 3300003792 Bacteria 2559
54 Ga0055540_1018768 3300003792 Bacteria 1885
55 Ga0055531_10005313 3300003794 Bacteria 7558
56 Ga0058692_1000424 3300003856 Bacteria 19461
57 Ga0058692_1000954 3300003856 Bacteria 11370
58 Ga0055543_1000032 3300004625 Bacteria 130218
59 Ga0055543_1000507 3300004625 Bacteria 22412
60 Ga0065165_1003516 3300005262 Bacteria 10870
61 Ga0065165_1009353 3300005262 Bacteria 4407
62 Ga0065165_1024876 3300005262 Bacteria 2002
63 Ga0070670_100038746 3300005331 Bacteria 4098
64 Ga0070660_100201442 3300005339 Bacteria 1614
65 Ga0070660_100651878 3300005339 Bacteria 882
66 Ga0070668_100771571 3300005347 Bacteria 852
67 Ga0070668_100837491 3300005347 Bacteria 819
68 Ga0070669_100062353 3300005353 Bacteria 2741
69 Ga0070669_100073137 3300005353 Bacteria 2539
70 Ga0070659_100530984 3300005366 Bacteria 1005
71 Ga0070713_100083761 3300005436 Bacteria 2727
72 Ga0070710_10114578 3300005437 Bacteria 1624
73 Ga0070710_10383778 3300005437 Bacteria 938
74 Ga0070678_100178951 3300005456 Bacteria 1734
75 Ga0070662_100619462 3300005457 Bacteria 911
76 Ga0070681_10117048 3300005458 Bacteria 2601
77 Ga0070679_100185033 3300005530 Bacteria 2054
78 Ga0068853_100036646 3300005539 Bacteria 4172
79 Ga0070665_100012992 3300005548 Bacteria 8388
80 Ga0070665_100263110 3300005548 Bacteria 1726
81 Ga0068855_100247060 3300005563 Bacteria 1991
82 Ga0068855_100269142 3300005563 Bacteria 1895
83 Ga0068857_100437125 3300005577 Bacteria 1222
84 Ga0068852_100574031 3300005616 Bacteria 1130
85 Ga0068863_100097227 3300005841 Bacteria 2796
86 Ga0081455_10016377 3300005937 Bacteria 7160
87 Ga0081538_10064338 3300005981 Bacteria 2075
88 Ga0081540_1025775 3300005983 Bacteria 3374
89 Ga0075365_10004225 3300006038 Bacteria 7571
90 Ga0075365_10006168 3300006038 Bacteria 6565
91 Ga0075365_10154341 3300006038 Bacteria 1598
92 Ga0075365_10275338 3300006038 Bacteria 1184
93 Ga0075368_10017047 3300006042 Bacteria 2714
94 Ga0075368_10162980 3300006042 Bacteria 935
95 Ga0075363_100511895 3300006048 Bacteria 714
96 Ga0075364_10000170 3300006051 Bacteria 29008
97 Ga0075364_10232346 3300006051 Bacteria 1252
98 Ga0075364_10337542 3300006051 Bacteria 1027
99 Ga0075364_10362265 3300006051 Bacteria 989
100 Ga0075364_10394792 3300006051 Bacteria 944
101 Ga0075364_10575475 3300006051 Bacteria 770
102 Ga0075364_10795008 3300006051 Bacteria 645
103 Ga0070716_100431425 3300006173 Bacteria 956
104 Ga0070712_100362024 3300006175 Bacteria 1190
105 Ga0075362_10000803 3300006177 Bacteria 9374
106 Ga0075362_10010765 3300006177 Bacteria 3582
107 Ga0075362_10027933 3300006177 Bacteria 2419
108 Ga0075367_10001565 3300006178 Bacteria 9892
109 Ga0075367_10005669 3300006178 Bacteria 6231
110 Ga0075367_10019031 3300006178 Bacteria 3800
111 Ga0075367_10501875 3300006178 Bacteria 770
112 Ga0075369_10000650 3300006186 Bacteria 11063
113 Ga0075369_10028406 3300006186 Bacteria 2344
114 Ga0075369_10151567 3300006186 Bacteria 1060
115 Ga0075369_10305039 3300006186 Bacteria 744
116 Ga0075366_10451194 3300006195 Bacteria 793
117 Ga0075370_10040386 3300006353 Bacteria 2631
118 Ga0075370_10670238 3300006353 Bacteria 630
119 Ga0079104_1000209 3300006946 Bacteria 81844
120 Ga0099826_10000103 3300006948 Bacteria 39924
121 Ga0105240_10899515 3300009093 Bacteria 952
122 Ga0105243_10124642 3300009148 Bacteria 2177
123 Ga0105243_11153790 3300009148 Bacteria 786
124 Ga0105241_11943512 3300009174 Bacteria 578
125 Ga0105248_10908857 3300009177 Bacteria 994
126 Ga0105237_10067121 3300009545 Bacteria 3581
127 Ga0105238_10282255 3300009551 Bacteria 1642
128 Ga0105238_11232641 3300009551 Bacteria 773
129 Ga0123340_1081144 3300009763 Bacteria 646
130 Ga0123341_1001018 3300009765 Bacteria 19906
131 Ga0123341_1032179 3300009765 Bacteria 3860
132 Ga0123342_1036935 3300009766 Bacteria 1989
133 Ga0105239_10699119 3300010375 Bacteria 1159
134 Ga0105246_11803613 3300011119 Unclassified 585
135 Ga0157319_1001870 3300012497 Bacteria 1143
136 Ga0157373_10012025 3300013100 Bacteria 6363
137 Ga0157373_10040944 3300013100 Bacteria 3315
138 Ga0157373_10594276 3300013100 Bacteria 805
139 Ga0157371_10000015 3300013102 Bacteria 339838
140 Ga0157371_10041317 3300013102 Bacteria 3292
141 Ga0157370_10000309 3300013104 Bacteria 61167
142 Ga0157370_10083084 3300013104 Bacteria 3012
143 Ga0157370_10227534 3300013104 Bacteria 1726
144 Ga0157369_10026552 3300013105 Bacteria 6422
145 Ga0163163_11423371 3300014325 Bacteria 755
146 Ga0163163_11926299 3300014325 Bacteria 651
147 Ga0213872_10119664 3300021361 Bacteria 1165
148 Ga0213874_10018750 3300021377 Bacteria 1874
149 Ga0213876_10051446 3300021384 Bacteria 2177
150 Ga0213876_10221343 3300021384 Bacteria 1006
151 Ga0213871_10182512 3300021441 Bacteria 649
152 Ga0213871_10204647 3300021441 Bacteria 617
153 Ga0209436_100001 3300025208 Bacteria 304543
154 Ga0207425_1000010 3300025245 Bacteria 572898
155 Ga0207425_1000826 3300025245 Bacteria 15458
156 Ga0207425_1011745 3300025245 Bacteria 2075
157 Ga0209129_1000099 3300025258 Bacteria 162471
158 Ga0209129_1000580 3300025258 Bacteria 25201
159 Ga0209129_1000593 3300025258 Bacteria 24734
160 Ga0209129_1001147 3300025258 Bacteria 15336
161 Ga0209129_1002836 3300025258 Bacteria 8018
162 Ga0209129_1004971 3300025258 Bacteria 4922
163 Ga0209129_1007616 3300025258 Bacteria 3180
164 Ga0209565_1021755 3300025263 Bacteria 1335
165 Ga0209673_1000013 3300025273 Bacteria 571633
166 Ga0209673_1000048 3300025273 Bacteria 287976
167 Ga0209673_1000841 3300025273 Bacteria 40004
168 Ga0209673_1001196 3300025273 Bacteria 27855
169 Ga0209673_1001233 3300025273 Bacteria 26813
170 Ga0209673_1001920 3300025273 Bacteria 16520
171 Ga0209673_1007723 3300025273 Bacteria 4897
172 Ga0209673_1009029 3300025273 Bacteria 4370
173 Ga0209673_1011162 3300025273 Bacteria 3724
174 Ga0209673_1054429 3300025273 Bacteria 1037
175 Ga0209130_1000004 3300025284 Bacteria 633436
176 Ga0209130_1008084 3300025284 Bacteria 3150
177 Ga0209130_1026826 3300025284 Bacteria 1231
178 Ga0209130_1032942 3300025284 Bacteria 1052
179 Ga0209675_1025138 3300025291 Bacteria 1507
180 Ga0209676_1001764 3300025292 Bacteria 18335
181 Ga0209676_1030148 3300025292 Bacteria 1663
182 Ga0209025_1000022 3300025294 Bacteria 574487
183 Ga0209025_1000787 3300025294 Bacteria 52060
184 Ga0209025_1001289 3300025294 Bacteria 34281
185 Ga0209025_1001860 3300025294 Bacteria 24723
186 Ga0209025_1002946 3300025294 Bacteria 16924
187 Ga0209025_1007031 3300025294 Bacteria 8526
188 Ga0209025_1017404 3300025294 Bacteria 4151
189 Ga0209025_1018065 3300025294 Bacteria 4030
190 Ga0209025_1024099 3300025294 Bacteria 3155
191 Ga0209564_1000566 3300025295 Bacteria 58647
192 Ga0209564_1000906 3300025295 Bacteria 38845
193 Ga0209564_1004549 3300025295 Bacteria 8421
194 Ga0209564_1007058 3300025295 Bacteria 5881
195 Ga0209564_1019336 3300025295 Bacteria 2550
196 Ga0209758_1000086 3300025297 Bacteria 254778
197 Ga0209758_1000821 3300025297 Bacteria 43465
198 Ga0209758_1000977 3300025297 Bacteria 38489
199 Ga0209758_1001150 3300025297 Bacteria 33851
200 Ga0209758_1001420 3300025297 Bacteria 28346
201 Ga0209758_1005307 3300025297 Bacteria 10057
202 Ga0209758_1012058 3300025297 Bacteria 4899
203 Ga0209758_1072740 3300025297 Bacteria 1074
204 Ga0209758_1132444 3300025297 Bacteria 657
205 Ga0209050_1001733 3300025298 Bacteria 21711
206 Ga0209050_1048154 3300025298 Bacteria 1104
207 Ga0209256_1000947 3300025299 Bacteria 35197
208 Ga0209256_1001331 3300025299 Bacteria 26356
209 Ga0209256_1002910 3300025299 Bacteria 12910
210 Ga0209256_1009756 3300025299 Bacteria 4144
211 Ga0209256_1019473 3300025299 Bacteria 2158
212 Ga0209256_1035721 3300025299 Bacteria 1310
213 Ga0207426_1000003 3300025302 Bacteria 1063212
214 Ga0207426_1000427 3300025302 Bacteria 68840
215 Ga0207426_1003684 3300025302 Bacteria 8039
216 Ga0209051_1000125 3300025303 Bacteria 142863
217 Ga0209051_1001061 3300025303 Bacteria 25637
218 Ga0209051_1002163 3300025303 Bacteria 14581
219 Ga0209051_1014843 3300025303 Bacteria 3615
220 Ga0209051_1149955 3300025303 Bacteria 548
221 Ga0209257_1001014 3300025304 Bacteria 37770
222 Ga0209257_1001705 3300025304 Bacteria 24654
223 Ga0209257_1065890 3300025304 Bacteria 970
224 Ga0207647_10032694 3300025904 Bacteria 3339
225 Ga0207705_10366009 3300025909 Bacteria 1112
226 Ga0207705_10530484 3300025909 Bacteria 915
227 Ga0207693_10038062 3300025915 Bacteria 3789
228 Ga0207660_10093030 3300025917 Bacteria 2239
229 Ga0207657_10002501 3300025919 Bacteria 19880
230 Ga0207657_10493979 3300025919 Bacteria 959
231 Ga0207652_10531851 3300025921 Bacteria 1057
232 Ga0207681_10301986 3300025923 Bacteria 1267
233 Ga0207681_10343899 3300025923 Bacteria 1192
234 Ga0207650_10026479 3300025925 Bacteria 4137
235 Ga0207664_10781767 3300025929 Bacteria 859
236 Ga0207706_10787589 3300025933 Bacteria 808
237 Ga0207709_10182291 3300025935 Bacteria 1484
238 Ga0207709_10890427 3300025935 Unclassified 723
239 Ga0207711_10780460 3300025941 Bacteria 890
240 Ga0207667_10225867 3300025949 Bacteria 1918
241 Ga0207668_10236653 3300025972 Bacteria 1475
242 Ga0207668_10882044 3300025972 Bacteria 795
243 Ga0207678_10403505 3300026067 Bacteria 1184
244 Ga0207641_10055424 3300026088 Bacteria 3366
245 Ga0207648_10687806 3300026089 Bacteria 947
246 Ga0207683_10216327 3300026121 Bacteria 1745
247 Ga0209281_1000580 3300027111 Bacteria 43078
248 Ga0209371_1000058 3300027312 Bacteria 237920
249 Ga0209371_1000904 3300027312 Bacteria 23544
250 Ga0209282_1000095 3300027666 Bacteria 60099
251 Ga0209813_10023353 3300027866 Bacteria 1758
252 Ga0268266_10083220 3300028379 Bacteria 2793
253 Ga0268266_10126895 3300028379 Bacteria 2278
254 Ga0268266_11138298 3300028379 Bacteria 755
255 Ga0268265_10340830 3300028380 Bacteria 1365
256 Ga0307515_10001393 3300028794 Bacteria 54715
257 Ga0307515_10004439 3300028794 Bacteria 29051
258 Ga0307515_10072377 3300028794 Bacteria 4653
259 Ga0265338_10105959 3300028800 Bacteria 2278
260 Ga0268256_1000056 3300030500 Bacteria 231684
261 Ga0268256_1004374 3300030500 Bacteria 5888
262 Ga0316182_1233033 3300030745 Bacteria 1192
263 Ga0265320_10012013 3300031240 Bacteria 5066
264 Ga0265325_10179200 3300031241 Bacteria 988
265 Ga0265340_10350755 3300031247 Bacteria 652
266 Ga0265327_10038869 3300031251 Bacteria 2591
267 Ga0307513_10024524 3300031456 Bacteria 7017
268 Ga0307408_100020868 3300031548 Bacteria 4426
269 Ga0265314_10011047 3300031711 Bacteria 7487
270 Ga0265314_10211308 3300031711 Bacteria 1139
271 Ga0316576_10059041 3300031727 Bacteria 2807
272 Ga0316578_10005669 3300031728 Bacteria 6078
273 Ga0307516_10359782 3300031730 Bacteria 1120
274 Ga0307405_10021745 3300031731 Bacteria 3611
275 Ga0307406_10019146 3300031901 Bacteria 4015
276 Ga0307412_10002546 3300031911 Bacteria 10129
277 Ga0307416_100194009 3300032002 Bacteria 1919
278 Ga0307510_10196832 3300033180 Bacteria 1556
279 Ga0373952_0224739 3300035092 Bacteria 559
280 Ga0316574_0000978 3300035398 Bacteria 12825
281 Ga0373935_0035232 3300035692 Bacteria 3124
282 Ga0316584_0270665 3300036712 Bacteria 1236
283 Ga0373925_0008671 3300037068 Bacteria 7409
284 Ga0395899_0350773 3300037312 Bacteria 987
285 Ga0395900_0132273 3300037418 Bacteria 2556
286 Ga0395901_0056893 3300038443 Bacteria 4068
287 Ga0395901_0277390 3300038443 Bacteria 1743
288 Ga0436365_1716423 3300039437 Bacteria 4980
289 Ga0436360_0668397 3300039438 Bacteria 1774
290 Ga0436360_0672973 3300039438 Bacteria 1674
291 Ga0436360_0726396 3300039438 Bacteria 656
292 Ga0436360_0772974 3300039438 Bacteria 1727
293 Ga0436360_0891092 3300039438 Bacteria 544
294 Ga0436360_0966143 3300039438 Bacteria 4069
295 Ga0436360_1263519 3300039438 Bacteria 891
296 Ga0436360_1279400 3300039438 Bacteria 5324
297 Ga0436360_1280006 3300039438 Bacteria 2161
298 Ga0436360_1349174 3300039438 Bacteria 1979
299 Ga0436361_0056445 3300039447 Bacteria 1833
300 Ga0436361_0195628 3300039447 Bacteria 3486
301 Ga0436361_0504000 3300039447 Bacteria 828
302 Ga0436361_1066451 3300039447 Bacteria 748
303 Ga0436361_1131419 3300039447 Bacteria 1398
304 Ga0436362_1271493 3300039453 Bacteria 548
305 Ga0436362_1294587 3300039453 Bacteria 1693
306 Ga0439436_0061624 3300041404 Bacteria 1050
307 Ga0439438_064870 3300041405 Bacteria 910
308 Ga0439466_0186910 3300041411 Bacteria 631
309 Ga0439465_0002039 3300041413 Bacteria 6621
310 Ga0439465_0014447 3300041413 Bacteria 2460
311 Ga0439465_0062128 3300041413 Bacteria 1239
312 Ga0439465_0096782 3300041413 Bacteria 1015
313 Ga0451787_483819 3300041441 Bacteria 688
314 Ga0451789_0132731 3300041443 Bacteria 780
315 Ga0451791_0446157 3300041451 Bacteria 1961
316 Ga0451797_0099719 3300041453 Bacteria 540
317 Ga0451802_0003539 3300041460 Bacteria 568
318 Ga0451804_0654900 3300041463 Bacteria 1281
319 Ga0451833_0487316 3300041491 Bacteria 1954
320 Ga0451833_0973106 3300041491 Bacteria 2052
321 Ga0451835_0582272 3300041492 Bacteria 2579
322 Ga0451837_0252729 3300041494 Bacteria 1497
323 Ga0451837_1669237 3300041494 Bacteria 1910
324 Ga0451839_0052569 3300041496 Bacteria 1934
325 Ga0451839_0226926 3300041496 Bacteria 1753
326 Ga0451839_1053254 3300041496 Bacteria 1169
327 Ga0451841_0507248 3300041498 Bacteria 1521
328 Ga0451841_1220323 3300041498 Bacteria 1325
329 Ga0451845_0011679 3300041501 Bacteria 4968
330 Ga0451847_0191909 3300041503 Bacteria 2978
331 Ga0451847_1000258 3300041503 Bacteria 905
332 Ga0451849_0371999 3300041505 Bacteria 1278
333 Ga0451850_01285 3300041506 Bacteria 529
334 Ga0451851_0136593 3300041507 Bacteria 2601
335 Ga0451843_0529508 3300041509 Bacteria 3948
336 Ga0451843_1322506 3300041509 Bacteria 619
337 Ga0451854_37769 3300041510 Bacteria 788
338 Ga0451853_1427546 3300041512 Bacteria 698
339 Ga0451853_3057193 3300041512 Bacteria 1423
340 Ga0439432_094870 3300042006 Bacteria 896
341 Ga0439449_0044732 3300042007 Bacteria 1642
342 Ga0439449_0164469 3300042007 Bacteria 829
343 Ga0450900_013192 3300042136 Bacteria 1089
344 Ga0450900_051686 3300042136 Bacteria 630
345 Ga0451577_0170953 3300042876 Bacteria 1958
346 Ga0453683_0105549 3300044673 Bacteria 1770
347 Ga0453683_0677123 3300044673 Bacteria 675
348 Ga0466965_0183085 3300044683 Bacteria 1106
349 Ga0453684_0352126 3300044712 Bacteria 1660
350 Ga0451576_0000752 3300045051 Bacteria 64762
351 Ga0451576_0016110 3300045051 Bacteria 8260
352 Ga0451576_0065534 3300045051 Bacteria 3782
353 Ga0451576_0761571 3300045051 Bacteria 1017
354 Ga0495617_048343 3300046452 Bacteria 1416
355 Ga0495592_0390125 3300046454 Bacteria 884
356 Ga0495603_0169952 3300046455 Bacteria 1263
357 Ga0495629_0119616 3300046459 Bacteria 1835
358 Ga0495638_0000597 3300046460 Bacteria 40647
359 Ga0495638_0048834 3300046460 Bacteria 2647
360 Ga0495638_0250344 3300046460 Bacteria 977
361 Ga0495638_0451292 3300046460 Bacteria 656
362 Ga0495651_0170300 3300046462 Bacteria 1551
363 Ga0495651_0427307 3300046462 Bacteria 860
364 Ga0495650_0062085 3300046471 Bacteria 1494
365 Ga0495650_0067025 3300046471 Bacteria 1419
366 Ga0495650_0082224 3300046471 Bacteria 1239
367 Ga0495605_0010494 3300046474 Bacteria 5180
368 Ga0495605_0052317 3300046474 Bacteria 1985
369 Ga0495605_0110426 3300046474 Bacteria 1255
370 Ga0495662_0042557 3300046476 Bacteria 2192
371 Ga0495585_0008606 3300046492 Bacteria 6179
372 Ga0495585_0014614 3300046492 Bacteria 4569
373 Ga0495585_0062670 3300046492 Bacteria 2042
374 Ga0495607_0020706 3300046501 Bacteria 4151
375 Ga0495607_0078852 3300046501 Bacteria 1816
376 Ga0495607_0109190 3300046501 Bacteria 1469
377 Ga0495583_0004644 3300046506 Bacteria 9693
378 Ga0495583_0038373 3300046506 Bacteria 2263
379 Ga0495583_0059957 3300046506 Bacteria 1703
380 Ga0495606_0001192 3300046507 Bacteria 36659
381 Ga0495606_0014966 3300046507 Bacteria 6016
382 Ga0495606_0080629 3300046507 Bacteria 2025
383 Ga0495606_0172548 3300046507 Bacteria 1253
384 Ga0495606_0310973 3300046507 Bacteria 850
385 Ga0495610_0000823 3300046512 Bacteria 29049
386 Ga0495610_0013855 3300046512 Bacteria 4766
387 Ga0495616_0099882 3300046513 Bacteria 1362
388 Ga0495616_0308931 3300046513 Bacteria 666
389 Ga0495620_0006195 3300046515 Bacteria 6590
390 Ga0495620_0016721 3300046515 Bacteria 3674
391 Ga0495620_0048443 3300046515 Bacteria 1824
392 Ga0495620_0079383 3300046515 Bacteria 1329
393 Ga0495620_0108720 3300046515 Bacteria 1100
394 Ga0495631_0000740 3300046518 Bacteria 20967
395 Ga0495631_0114198 3300046518 Bacteria 1161
396 Ga0495631_0260989 3300046518 Bacteria 738
397 Ga0495632_0002039 3300046519 Bacteria 15901
398 Ga0495632_0017858 3300046519 Bacteria 3904
399 Ga0495632_0044674 3300046519 Bacteria 2211
400 Ga0495632_0278320 3300046519 Bacteria 745
401 Ga0495637_0139725 3300046520 Bacteria 920
402 Ga0495643_0058453 3300046522 Bacteria 2052
403 Ga0495643_0133632 3300046522 Bacteria 1243
404 Ga0495652_0161142 3300046529 Bacteria 1742
405 Ga0495654_0000641 3300046530 Bacteria 27579
406 Ga0495654_0416245 3300046530 Bacteria 532
407 Ga0495640_0360520 3300046533 Bacteria 896
408 Ga0495587_0426661 3300046536 Bacteria 736
409 Ga0495609_0129367 3300046538 Bacteria 1082
410 Ga0495597_0015218 3300046542 Bacteria 3644
411 Ga0495597_0164750 3300046542 Bacteria 903
412 Ga0495622_0175598 3300046557 Bacteria 962
413 Ga0495633_0012938 3300046558 Bacteria 4415
414 Ga0495633_0079454 3300046558 Bacteria 1527
415 Ga0495633_0183738 3300046558 Bacteria 962
416 Ga0495633_0443469 3300046558 Bacteria 586
417 Ga0495668_0004290 3300046616 Bacteria 10222
418 Ga0495668_0024255 3300046616 Bacteria 3451
419 Ga0495634_0702416 3300046642 Bacteria 581
420 Ga0495611_0005299 3300046648 Bacteria 5521
421 Ga0495611_0297048 3300046648 Bacteria 745
422 Ga0495611_0394647 3300046648 Bacteria 633
423 Ga0495625_0001750 3300046660 Bacteria 25112
424 Ga0495625_0120200 3300046660 Bacteria 1788
425 Ga0495625_0196758 3300046660 Bacteria 1332
426 Ga0495661_0058247 3300046665 Bacteria 2303
427 Ga0495661_0161776 3300046665 Bacteria 1201
428 Ga0495658_0319812 3300046683 Bacteria 983
429 Ga0495613_0515563 3300046689 Bacteria 804
430 Ga0495624_0445747 3300046690 Bacteria 776
431 Ga0495670_0025865 3300046691 Bacteria 2905
432 Ga0495670_0055914 3300046691 Bacteria 1979
433 Ga0495671_0066511 3300046692 Bacteria 1774
434 Ga0495671_0366336 3300046692 Bacteria 691
435 Ga0495589_0033057 3300046794 Bacteria 2599
436 Ga0495600_0061319 3300046809 Bacteria 2456
437 Ga0495660_0013150 3300046810 Bacteria 4797
438 Ga0495660_0073249 3300046810 Bacteria 1812
439 Ga0495604_0074492 3300047317 Bacteria 2558
440 Ga0495672_0007762 3300047320 Bacteria 8029
441 Ga0495683_0019292 3300047323 Bacteria 3520
442 Ga0495685_201877 3300047447 Bacteria 637
443 Ga0495681_0041135 3300047470 Bacteria 2245
444 Ga0495686_0003300 3300047472 Bacteria 14084
445 Ga0495686_0010445 3300047472 Bacteria 6604
446 Ga0495686_0012162 3300047472 Bacteria 6036
447 Ga0495686_0013205 3300047472 Bacteria 5743
448 Ga0495686_0082206 3300047472 Bacteria 1966
449 Ga0495686_0256162 3300047472 Bacteria 981
450 Ga0495686_0551787 3300047472 Bacteria 601
451 Ga0495686_0636159 3300047472 Bacteria 549
452 Ga0495615_0147023 3300048090 Bacteria 699
453 Ga0495626_0087468 3300048091 Bacteria 1375
454 Ga0496100_0129364 3300048903 Bacteria 1777
455 Ga0496101_0556962 3300048904 Bacteria 907
456 Ga0496104_0273064 3300048907 Bacteria 1603
457 Ga0496104_0420617 3300048907 Bacteria 1248
458 Ga0496105_0753326 3300048908 Bacteria 744
459 Ga0496106_0000801 3300048909 Bacteria 22763
460 Ga0496106_0170481 3300048909 Bacteria 1725
461 Ga0496107_0343330 3300048910 Bacteria 1111
462 Ga0496107_0408015 3300048910 Bacteria 1010
463 Ga0496110_0518323 3300048913 Bacteria 1085
464 Ga0496110_1381248 3300048913 Bacteria 614
465 Ga0496110_1409562 3300048913 Bacteria 606
466 Ga0496111_0000625 3300048914 Bacteria 18727
467 Ga0496114_0599271 3300048917 Bacteria 972
468 Ga0496116_0000043 3300048919 Bacteria 328085
469 Ga0496116_0002893 3300048919 Bacteria 17567
470 Ga0496116_0048551 3300048919 Bacteria 2847
471 Ga0496116_0066801 3300048919 Bacteria 2299
472 Ga0496116_0083983 3300048919 Bacteria 1963
473 Ga0496116_0135199 3300048919 Bacteria 1398
474 Ga0496116_0135754 3300048919 Bacteria 1393
475 Ga0496116_0151396 3300048919 Bacteria 1288
476 Ga0496116_0165662 3300048919 Bacteria 1205
477 Ga0496117_0000002 3300048920 Bacteria 2483758
478 Ga0496117_0002492 3300048920 Bacteria 23104
479 Ga0496117_0017063 3300048920 Bacteria 6080
480 Ga0496117_0049600 3300048920 Bacteria 2984
481 Ga0496117_0053258 3300048920 Bacteria 2844
482 Ga0496117_0091707 3300048920 Bacteria 1953
483 Ga0496117_0317675 3300048920 Bacteria 817
484 Ga0496118_0001850 3300048921 Bacteria 30309
485 Ga0496118_0002255 3300048921 Bacteria 26416
486 Ga0496118_0055604 3300048921 Bacteria 2984
487 Ga0496118_0055781 3300048921 Bacteria 2977
488 Ga0496118_0070257 3300048921 Bacteria 2529
489 Ga0496118_0119184 3300048921 Bacteria 1726
490 Ga0496118_0190656 3300048921 Bacteria 1226
491 Ga0496118_0333192 3300048921 Bacteria 817
492 Ga0496119_0009038 3300048922 Bacteria 8639
493 Ga0496119_0055250 3300048922 Bacteria 2412
494 Ga0496119_0068361 3300048922 Bacteria 2092
495 Ga0496119_0077578 3300048922 Bacteria 1924
496 Ga0496119_0291363 3300048922 Bacteria 808
497 Ga0496119_0336704 3300048922 Bacteria 734
498 Ga0496119_0421149 3300048922 Bacteria 634
499 Ga0496119_0537224 3300048922 Bacteria 539
500 Ga0496120_0000078 3300048923 Bacteria 162312
501 Ga0496120_0117643 3300048923 Bacteria 1378
502 Ga0496120_0216153 3300048923 Bacteria 919
503 Ga0496121_0000003 3300048924 Bacteria 1191431
504 Ga0496121_0000751 3300048924 Bacteria 59594
505 Ga0496121_0005759 3300048924 Bacteria 15725
506 Ga0496121_0016740 3300048924 Bacteria 7544
507 Ga0496121_0033826 3300048924 Bacteria 4614
508 Ga0496121_0037070 3300048924 Bacteria 4335
509 Ga0496121_0050317 3300048924 Bacteria 3521
510 Ga0496121_0055812 3300048924 Bacteria 3287
511 Ga0496121_0185828 3300048924 Bacteria 1495
512 Ga0496121_0241327 3300048924 Bacteria 1259
513 Ga0496121_0247651 3300048924 Bacteria 1238
514 Ga0496121_0375424 3300048924 Bacteria 939
515 Ga0496121_0388232 3300048924 Bacteria 918
516 Ga0496121_0414040 3300048924 Bacteria 879
517 Ga0496122_0000001 3300048925 Bacteria 1827766
518 Ga0496122_0000399 3300048925 Bacteria 92476
519 Ga0496122_0043507 3300048925 Bacteria 3517
520 Ga0496122_0047654 3300048925 Bacteria 3306
521 Ga0496122_0175972 3300048925 Bacteria 1282
522 Ga0496122_0200130 3300048925 Bacteria 1169
523 Ga0496122_0221660 3300048925 Bacteria 1084
524 Ga0496122_0243563 3300048925 Bacteria 1011
525 Ga0496123_0000001 3300048926 Bacteria 1831497
526 Ga0496123_0002112 3300048926 Bacteria 25505
527 Ga0496123_0007774 3300048926 Bacteria 9990
528 Ga0496123_0018288 3300048926 Bacteria 5581
529 Ga0496123_0032077 3300048926 Bacteria 3811
530 Ga0496123_0055467 3300048926 Bacteria 2599
531 Ga0496123_0148710 3300048926 Bacteria 1267
532 Ga0496123_0177001 3300048926 Bacteria 1118
533 Ga0496124_0000377 3300048927 Bacteria 81321
534 Ga0496124_0002648 3300048927 Bacteria 23011
535 Ga0496124_0007941 3300048927 Bacteria 11170
536 Ga0496124_0039431 3300048927 Bacteria 4094
537 Ga0496124_0083345 3300048927 Bacteria 2623
538 Ga0496124_0085245 3300048927 Bacteria 2589
539 Ga0496124_0089750 3300048927 Bacteria 2508
540 Ga0496124_0241109 3300048927 Bacteria 1344
541 Ga0496124_0245429 3300048927 Bacteria 1328
542 Ga0496124_0264933 3300048927 Bacteria 1262
543 Ga0496124_0384363 3300048927 Bacteria 980
544 Ga0496124_0443009 3300048927 Bacteria 888
545 Ga0496125_0000141 3300048928 Bacteria 158991
546 Ga0496125_0001650 3300048928 Bacteria 31436
547 Ga0496125_0030094 3300048928 Bacteria 4863
548 Ga0496125_0059323 3300048928 Bacteria 3084
549 Ga0496126_0000362 3300048929 Bacteria 94734
550 Ga0496126_0001055 3300048929 Bacteria 46595
551 Ga0496126_0108174 3300048929 Bacteria 2424
552 Ga0496126_0133653 3300048929 Bacteria 2142
553 Ga0496126_0178712 3300048929 Bacteria 1804
554 Ga0496126_0307160 3300048929 Bacteria 1307
555 Ga0496126_0355000 3300048929 Bacteria 1198
556 Ga0496126_0401876 3300048929 Bacteria 1111
557 Ga0496126_0721480 3300048929 Bacteria 772
558 Ga0496126_0980343 3300048929 Bacteria 635
559 Ga0495678_014086 3300049459 Bacteria 3730
560 Ga0495678_029360 3300049459 Bacteria 2310
561 Ga0495682_0111537 3300049460 Bacteria 980
562 Ga0501031_0262833 3300049568 Bacteria 1121
563 Ga0501032_0043453 3300049569 Bacteria 3043
564 Ga0501032_0322287 3300049569 Bacteria 997
565 Ga0501032_0957740 3300049569 Bacteria 538
566 Ga0501033_0001044 3300049570 Bacteria 25238
567 Ga0501033_0083686 3300049570 Bacteria 2338
568 Ga0501033_1133102 3300049570 Bacteria 519
569 Ga0501034_0011050 3300049571 Bacteria 9376
570 Ga0501034_0041937 3300049571 Bacteria 4631
571 Ga0501034_0270792 3300049571 Bacteria 1639
572 Ga0501034_0489838 3300049571 Bacteria 1144
573 Ga0501036_0019092 3300049572 Bacteria 5753
574 Ga0501036_0054502 3300049572 Bacteria 3387
575 Ga0501036_0654855 3300049572 Bacteria 869
576 Ga0501037_0047500 3300049573 Bacteria 3146
577 Ga0501037_0145295 3300049573 Bacteria 1696
578 Ga0501038_0359874 3300049574 Bacteria 1132
579 Ga0501038_0628707 3300049574 Bacteria 810
580 Ga0501039_0213010 3300049575 Bacteria 1519
581 Ga0501039_0403908 3300049575 Bacteria 1073
582 Ga0501043_0021712 3300049579 Bacteria 5032
583 Ga0501043_0595146 3300049579 Bacteria 817
584 Ga0501046_0068367 3300049580 Bacteria 2765
585 Ga0501046_0543615 3300049580 Bacteria 829
586 Ga0501046_0963078 3300049580 Bacteria 593
587 Ga0501047_0009309 3300049581 Bacteria 9276
588 Ga0501047_0472262 3300049581 Bacteria 1082
589 Ga0501048_0126905 3300049582 Bacteria 1804
590 Ga0501048_0129826 3300049582 Bacteria 1782
591 Ga0501048_0233882 3300049582 Bacteria 1304
592 Ga0501067_0053980 3300049583 Bacteria 2227
593 Ga0501068_0129075 3300049584 Bacteria 1580
594 Ga0501070_0608971 3300049586 Bacteria 870
595 Ga0501071_0122293 3300049587 Bacteria 1930
596 Ga0501073_0084268 3300049589 Bacteria 2212
597 Ga0501073_0150329 3300049589 Bacteria 1614
598 Ga0501073_0551658 3300049589 Bacteria 796
599 Ga0501074_0090849 3300049590 Bacteria 2187
600 Ga0501079_0594495 3300049741 Bacteria 871
601 Ga0501079_0734447 3300049741 Bacteria 777
602 Ga0501080_0187661 3300049742 Bacteria 1901
603 Ga0501080_0381235 3300049742 Bacteria 1270
604 Ga0501083_0266414 3300049744 Bacteria 1114
605 Ga0501035_0001225 3300049822 Bacteria 26738
606 Ga0501035_0036982 3300049822 Bacteria 4422
607 Ga0501044_0106055 3300049823 Bacteria 2822
608 nmdc:mga03683_16720_c2 3300050489 Bacteria 2247
609 nmdc:mga03683_1843_c1 3300050489 Bacteria 6438
610 nmdc:mga03n38_501576_c1 3300050490 Bacteria 681
611 nmdc:mga00v17_232788_c1 3300050491 Bacteria 1194
612 nmdc:mga00v17_291_c1 3300050491 Bacteria 29216
613 nmdc:mga00v17_430441_c1 3300050491 Bacteria 857
614 nmdc:mga00v17_725615_c1 3300050491 Bacteria 636
615 nmdc:mga00v17_831775_c1 3300050491 Bacteria 587
616 nmdc:mga0yw44_174970_c1 3300050492 Bacteria 1411
617 nmdc:mga0yw44_26184_c1 3300050492 Bacteria 3328
618 nmdc:mga0yw44_30132_c1 3300050492 Bacteria 910
619 nmdc:mga0k408_12066_c1 3300050493 Bacteria 4718
620 nmdc:mga06z11_144358_c1 3300050494 Bacteria 1348
621 nmdc:mga06z11_375383_c1 3300050494 Bacteria 854
622 nmdc:mga04h51_38387_c1 3300050495 Bacteria 1551
623 nmdc:mga07m45_26904_c2 3300050496 Bacteria 2760
624 nmdc:mga07m45_375564_c1 3300050496 Bacteria 826
625 nmdc:mga07m45_619570_c1 3300050496 Bacteria 624
626 nmdc:mga0sz30_174166_c1 3300050516 Bacteria 954
627 nmdc:mga0sz30_17576_c2 3300050516 Bacteria 1648
628 nmdc:mga0sz30_271449_c1 3300050516 Bacteria 755
629 Ga0495619_0126977 3300053085 Bacteria 1751
630 Ga0500578_0188161 3300053086 Bacteria 1268
631 Ga0500578_0233289 3300053086 Bacteria 1114
632 Ga0500643_043370 3300053087 Bacteria 1312
633 Ga0500643_073048 3300053087 Bacteria 950
634 Ga0500583_0310640 3300053092 Bacteria 770
635 Ga0500651_0064859 3300053093 Bacteria 2277
636 Ga0500651_0096023 3300053093 Bacteria 1821
637 Ga0500641_0170765 3300053096 Bacteria 936
638 Ga0500557_063408 3300053105 Bacteria 1203
639 Ga0500560_000049 3300053107 Bacteria 11683
640 Ga0500562_061128 3300053108 Bacteria 1012
641 Ga0500569_004820 3300053109 Bacteria 2865
642 Ga0500572_000978 3300053111 Bacteria 8651
643 Ga0500594_0062570 3300053118 Bacteria 1076
644 Ga0500594_0107070 3300053118 Bacteria 866
645 Ga0500595_016597 3300053119 Bacteria 2738
646 Ga0500595_083161 3300053119 Bacteria 934
647 Ga0500607_177570 3300053121 Bacteria 949
648 Ga0500618_000125 3300053125 Bacteria 63168
649 Ga0500618_000289 3300053125 Bacteria 38453
650 Ga0500618_003300 3300053125 Bacteria 5599
651 Ga0500618_012009 3300053125 Bacteria 2279
652 Ga0500628_038501 3300053129 Bacteria 1080
653 Ga0500642_0099012 3300053130 Bacteria 1354
654 Ga0500658_0001913 3300053134 Bacteria 8158
655 Ga0500658_0452703 3300053134 Bacteria 584
656 Ga0500561_0000141 3300053137 Bacteria 14001
657 Ga0500568_0000411 3300053139 Bacteria 32773
658 Ga0500568_0001577 3300053139 Bacteria 14417
659 Ga0500573_0003547 3300053140 Bacteria 8085
660 Ga0500573_0076549 3300053140 Bacteria 1904
661 Ga0500577_0025801 3300053142 Bacteria 1993
662 Ga0500590_002241 3300053148 Bacteria 8467
663 Ga0500604_0030499 3300053151 Bacteria 1577
664 Ga0500616_0000661 3300053153 Bacteria 41050
665 Ga0500616_0013882 3300053153 Bacteria 4650
666 Ga0500620_260879 3300053155 Bacteria 573
667 Ga0500622_0000428 3300053156 Bacteria 39928
668 Ga0500624_000266 3300053157 Bacteria 18246
669 Ga0500624_072200 3300053157 Bacteria 676
670 Ga0500633_0003216 3300053160 Bacteria 3520
671 Ga0500634_0053147 3300053161 Bacteria 2174
672 Ga0500636_0000202 3300053177 Bacteria 32341
673 Ga0500636_0002748 3300053177 Bacteria 9799
674 Ga0500636_0202751 3300053177 Bacteria 1048
675 Ga0500611_050321 3300053727 Bacteria 952
676 Ga0501082_0398967 3300060353 Bacteria 1200
677 2509386798 2509276021 Bacteria 7634384
678 2509442345 2509276033 Bacteria 7180565
679 2510133190 2510065019 Bacteria 6903379
680 2510894556 2510461076 Bacteria 8618824
681 2511175608 2510917026 Bacteria 7046020
682 2511183838 2510917028 Bacteria 6185411
683 2511193357 2510917030 Bacteria 7460662
684 2513572236 2513237084 Bacteria 7231967
685 2513579605 2513237085 Bacteria 7695351
686 2513594481 2513237088 Bacteria 6927906
687 2513634377 2513237093 Bacteria 7545552
688 2513708847 2513237103 Bacteria 7647401
689 2513866900 2513237138 Bacteria 7368160
690 2513914022 2513237144 Bacteria 7530820
691 2513926737 2513237146 Bacteria 7166346
692 2514022813 2513237162 Bacteria 7468464
693 2515112152 2515075009 Bacteria 7288508
694 2515635619 2515154113 Bacteria 7807172
695 2515646181 2515154114 Bacteria 7848616
696 2515657295 2515154116 Bacteria 7552979
697 2515738700 2515154134 Bacteria 7220242
698 2517035886 2516653077 Bacteria 7555578
699 2517076274 2516653085 Bacteria 7346596
700 2517095031 2517093000 Bacteria 7412387
701 2517406664 2517287029 Bacteria 6905599
702 2520379365 2519899620 Bacteria 6499161
703 2530645409 2529292951 Bacteria 6916614
704 2535516368 2534681796 Bacteria 7146037
705 2537876568 2537561587 Bacteria 5425293
706 2554247831 2554235003 Bacteria 5877155
707 2559294961 2558860242 Bacteria 5568029
708 2585200054 2582581294 Bacteria 6626667
709 2585224234 2582581298 Bacteria 7315509
710 2585230172 2582581299 Bacteria 6518058
711 2585254601 2582581304 Bacteria 5831370
712 2585403554 2582581867 Bacteria 7184437
713 2585529813 2585427526 Bacteria 7258840
714 2585542337 2585427528 Bacteria 6842387
715 2585546355 2585427529 Bacteria 7395659
716 2585819478 2585427590 Bacteria 6824633
717 2585838828 2585427593 Bacteria 7141551
718 2585845867 2585427594 Bacteria 6180594
719 2585995933 2585427633 Bacteria 6413184
720 2586000501 2585427634 Bacteria 6455027
721 2599417837 2599185170 Bacteria 7295545
722 2599601356 2599185210 Bacteria 5624189
723 2599720915 2599185236 Bacteria 6875203
724 2600375754 2600254933 Bacteria 4750527
725 2616292581 2615840624 Bacteria 6557588
726 2643811973 2643221558 Bacteria 5460675
727 2643855546 2643221568 Bacteria 5187270
728 2643919455 2643221582 Bacteria 5804683
729 2644005813 2643221599 Bacteria 6292121
730 2644193040 2643221634 Bacteria 6705461
731 2644239471 2643221643 Bacteria 5749658
732 2644522357 2643221693 Bacteria 5513853
733 2719181058 2718217882 Bacteria 6556348
734 2719385673 2718217927 Bacteria 6972593
735 2719665492 2718217997 Bacteria 6740740
736 2719731807 2718218009 Bacteria 6478651
737 2720491912 2718218199 Bacteria 6740745
738 2720613179 2718218232 Bacteria 6720332
739 2720620034 2718218233 Bacteria 6662049
740 2720631459 2718218235 Bacteria 6630699
741 2720775187 2718218269 Bacteria 6906114
742 2721147152 2718218363 Bacteria 6524337
743 2721158686 2718218365 Bacteria 6274507
744 2721164070 2718218366 Bacteria 6425255
745 2721399453 2718218423 Bacteria 6438183
746 2722840240 2721755514 Bacteria 6424414
747 2723026824 2721755556 Bacteria 6745503
748 2723560441 2721755684 Bacteria 6859907
749 2723567006 2721755685 Bacteria 6704835
750 2724038266 2721755809 Bacteria 6438790
751 2724044563 2721755810 Bacteria 6479005
752 2724089794 2721755819 Bacteria 6906405
753 2724104271 2721755822 Bacteria 6726041
754 2724110086 2721755823 Bacteria 6752556
755 2730107760 2728369352 Bacteria 6745171
756 2730164295 2728369365 Bacteria 6555560
757 2730298318 2728369397 Bacteria 6274511
758 2738799057 2738541293 Bacteria 7065685
759 2739038115 2738541333 Bacteria 7106503
760 2766063050 2765235942 Bacteria 7445910
761 2793298150 2791355256 Bacteria 6798008
762 2793313640 2791355259 Bacteria 7254731
763 2793322151 2791355260 Bacteria 6598818
764 2793326554 2791355261 Bacteria 6661293
765 2793337225 2791355262 Bacteria 6774204
766 2793341406 2791355263 Bacteria 6872478
767 2793350470 2791355264 Bacteria 6429314
768 2793352501 2791355265 Bacteria 6539969
769 2793361287 2791355266 Bacteria 7116587
770 2793369554 2791355267 Bacteria 7222458
771 2805931060 2802429605 Bacteria 6875453
772 2805938097 2802429606 Bacteria 6346811
773 2806047927 2802429633 Bacteria 7341974
774 2806056322 2802429634 Bacteria 7083200
775 2806061609 2802429635 Bacteria 7650140
776 2806070116 2802429636 Bacteria 7597525
777 2806072493 2802429637 Bacteria 7067217
778 2808985268 2808606387 Bacteria 5697198
779 2819559699 2818991439 Bacteria 6907412
780 2819688621 2818991461 Bacteria 7026071
781 2821127769 2821123053 Bacteria 7836056
782 2828305736 2828305725 Bacteria 4916900
783 2838021031 2838016132 Bacteria 6577831
784 2838027975 2838022645 Bacteria 6494267
785 2838041657 2838035591 Bacteria 7166484
786 2838043308 2838042994 Bacteria 6046894
787 2838052543 2838048938 Bacteria 6044578
788 2838066069 2838061910 Bacteria 6794874
789 2838071593 2838068647 Bacteria 6208656
790 2838666382 2838661181 Bacteria 7385261
791 2838673992 2838668709 Bacteria 6671819
792 2838682347 2838680041 Bacteria 6545511
793 2838689365 2838686498 Bacteria 7807632
794 2838696918 2838694306 Bacteria 6853137
795 2838706370 2838701080 Bacteria 6669771
796 2838709841 2838707686 Bacteria 6619912
797 2838714987 2838714209 Bacteria 5525906
798 2838721212 2838719591 Bacteria 5523910
799 2838730698 2838729681 Bacteria 7400765
800 2838738193 2838736955 Bacteria 5760694
801 2838743639 2838742623 Bacteria 7396178
802 2841841437 2841840854 Bacteria 5761912
803 2841848170 2841846520 Bacteria 5345850
804 2841854685 2841851746 Bacteria 7532261
805 2841864679 2841864319 Bacteria 6742987
806 2842078015 2842077413 Bacteria 6508645
807 2842110623 2842110456 Bacteria 7656360
808 2842119477 2842118031 Bacteria 7033875
809 2842141215 2842140634 Bacteria 5759631
810 2842148704 2842146304 Bacteria 5957337
811 2842157548 2842156927 Bacteria 6894975
812 2842164740 2842163707 Bacteria 6916235
813 2842171231 2842170452 Bacteria 5525737
814 2842180867 2842180545 Bacteria 6888678
815 2842188096 2842187318 Bacteria 5524014
816 2842196750 2842192696 Bacteria 6147454
817 2842203869 2842198810 Bacteria 6608673
818 2842206173 2842205361 Bacteria 6340321
819 2842212407 2842211629 Bacteria 5523832
820 2842217106 2842217011 Bacteria 7497767
821 2842225974 2842224351 Bacteria 5524473
822 2842231075 2842229732 Bacteria 7475766
823 2842239254 2842237096 Bacteria 6620661
824 2842244818 2842243621 Bacteria 7421798
825 2842256110 2842250916 Bacteria 6579627
826 2842258631 2842257432 Bacteria 7401195
827 2842268156 2842264693 Bacteria 6472963
828 2842273385 2842271015 Bacteria 7807131
829 2842279630 2842278818 Bacteria 6340002
830 2842286271 2842285085 Bacteria 6011953
831 2842291678 2842291075 Bacteria 7076806
832 2842304162 2842304105 Bacteria 7023636
833 2842313793 2842311132 Bacteria 6616990
834 2842318044 2842317721 Bacteria 6793725
835 2842345958 2842341865 Bacteria 7003929
836 2842364414 2842363717 Bacteria 6844742
837 2842372913 2842370503 Bacteria 7038661
838 2842378074 2842377471 Bacteria 7140707
839 2842385985 2842384541 Bacteria 7057858
840 2842397542 2842395702 Bacteria 6780583
841 2842408012 2842402390 Bacteria 6681310
842 2842414773 2842409023 Bacteria 6687331
843 2842421344 2842415677 Bacteria 6596907
844 2842424749 2842422224 Bacteria 6239196
845 2842431609 2842428310 Bacteria 6767288
846 2842438431 2842434925 Bacteria 6502746
847 2842445061 2842441272 Bacteria 6769273
848 2842452376 2842447887 Bacteria 6754142
849 2842465981 2842462802 Bacteria 6588055
850 2842473046 2842469257 Bacteria 6752936
851 2842492991 2842489311 Bacteria 6620893
852 2842496314 2842495871 Bacteria 6820686
853 2844459295 2844454524 Bacteria 7952546
854 2854899305 2854896431 Bacteria 5869725
855 2854919261 2854916844 Bacteria 5725939
856 2857518593 2857516855 Bacteria 7787325
857 2857534490 2857531043 Bacteria 6754041
858 2889794122 2889790730 Bacteria 5689708
859 2889915877 2889914905 Bacteria 5702301
860 2891374386 2891373044 Bacteria 5202277
861 2899804791 2899803654 Bacteria 5577784
862 2899846458 2899845264 Bacteria 5672268
863 2919106955 2919100787 Bacteria 7710546
864 2919167689 2919166419 Bacteria 4952238
865 2919175029 2919171160 Bacteria 6499771
866 2919451089 2919450847 Bacteria 5631160
867 2923557805 2923556063 Bacteria 6793593
868 2926756043 2926754445 Bacteria 5964435
869 2926760359 2926760298 Bacteria 5505990
870 2929140553 2929138655 Bacteria 5810547
871 2933008476 2933006813 Bacteria 4912075
872 2933013291 2933011516 Bacteria 5439334
873 2933016881 2933016740 Bacteria 6355406
874 2933571441 2933570622 Bacteria 7023390
875 2933586649 2933586486 Bacteria 7667493
876 2933602392 2933599457 Bacteria 5858799
877 2935897227 2935894831 Bacteria 6620579
878 2935904613 2935901341 Bacteria 7341747
879 2936372850 2936367885 Bacteria 7324495
880 2936376724 2936375103 Bacteria 6652732
881 2936385099 2936381700 Bacteria 7006523
882 2978974148 2978969890 Bacteria 5400756
883 2979094363 2979089926 Bacteria 5670289
884 2979098254 2979095461 Bacteria 5669583
885 2979103606 2979100975 Bacteria 5423623
886 2984511831 2984509177 Bacteria 5274802
887 2984521809 2984518228 Bacteria 5277463
888 2984541107 2984537506 Bacteria 5277481
889 2984589475 2984587000 Bacteria 5263363
890 2984603386 2984601300 Bacteria 5455244
891 2989353181 2989349275 Bacteria 6349068
892 2996890005 2996887358 Bacteria 5795980
893 2996898266 2996893221 Bacteria 5823108
894 3005415269 3005409236 Bacteria 7188837
895 3005447397 3005445848 Bacteria 6906074
896 3005454007 3005452660 Bacteria 5889319
897 639648419 639633055 Bacteria 7751309
898 650740220 650716007 Bacteria 5573770
899 8001848951 8001845381 Bacteria 5804942
900 8003571283 8003570095 Bacteria 5747666
901 8005261725 8005258706 Bacteria 6184835
902 8005280448 8005275841 Bacteria 6929066
903 8005285667 8005282627 Bacteria 6675747
904 8005290724 8005289223 Bacteria 6634003
905 8005302276 8005301065 Bacteria 6614431
906 8005314401 8005307578 Bacteria 7395396
907 8005324532 8005321885 Bacteria 5795980
908 8005379067 8005376324 Bacteria 6590079
909 8005388210 8005382845 Bacteria 6732062
910 8005397264 8005395548 Bacteria 6806915
911 8005433619 8005430974 Bacteria 6689030
912 8005462812 8005460587 Bacteria 7157962
913 8005500213 8005497431 Bacteria 6477605
914 8005545018 8005542996 Bacteria 7077758
915 8005557844 8005556819 Bacteria 6908598
916 8005569016 8005563573 Bacteria 7153261
917 8005572155 8005570704 Bacteria 6957481
918 8005621505 8005619151 Bacteria 7030230
919 8005631150 8005626139 Bacteria 6534237
920 8005671629 8005668836 Bacteria 6953162
921 8005689849 8005688590 Bacteria 6610080
922 8005700150 8005695170 Bacteria 6912330
923 8018129789 8018127388 Bacteria 7351159
924 8018155515 8018150411 Bacteria 5549903
925 8018166929 8018163183 Bacteria 7277977
926 8018179962 8018176218 Bacteria 6896178
927 8023685522 8023680758 Bacteria 7729763
928 8024482169 8024479707 Bacteria 6954785
929 8024506733 8024501048 Bacteria 6427847
930 8054462800 8054460903 Bacteria 4872905
931 8056377302 8056375014 Bacteria 7006639
932 8056388216 8056382006 Bacteria 6408074
933 8056877581 8056875544 Bacteria 4355797
934 8057875194 8057874678 Bacteria 7494653
935 Ga0501042_0296666
936 JGI25158J39367_1000033
937 JGI25152J39213_1000526
938 JGI25152J39213_1004775
939 JGI25152J39213_1005934
940 JGI25152J39213_1008818
941 JGI25152J39213_1011566
942 JGI25152J39213_1011567
943 JGI25150J39212_1000010
944 JGI25150J39212_1002491
945 JGI25159J45721_1002570
946 JGI25151J46595_10000026
947 JGI25151J46595_10000942
948 JGI25151J46595_10004710
949 JGI25151J46595_10011116
950 JGI25151J46595_10069449
951 JGI25151J46595_10140627
952 JGI25153J46596_10003998
953 JGI25153J46596_10009882
954 JGI25153J46596_10028302
955 JGI25153J46596_10028308
956 JGI25153J46596_10045921
957 JGI25153J46596_10051881
958 JGI25153J46596_10113137
959 rootH1_10018254
960 rootH2_10083074
961 rootH1_10209458
962 JGI25160J50197_1002155
963 JGI25160J50197_1060657
964 JGI25161J50226_1000285
965 JGI25161J50226_1000346
966 JGI25161J50226_1001041
967 Ga0006562J51391_1040093
968 Ga0055526_1001677
969 Ga0055526_1008048
970 Ga0055526_1012169
971 Ga0055526_1026624
972 Ga0055526_1053312
973 Ga0055524_1002383
974 Ga0055524_1005290
975 Ga0055524_1008069
976 Ga0055524_1008900
977 Ga0055524_1035651
978 Ga0055536_1011865
979 Ga0055528_1000851
980 Ga0055528_1001075
981 Ga0055528_1001905
982 Ga0055528_1014016
983 Ga0055530_10020414
984 Ga0055540_1000620
985 Ga0055540_1001108
986 Ga0055540_1002555
987 Ga0055540_1013077
988 Ga0055540_1018768
989 Ga0055531_10005313
990 Ga0058692_1000424
991 Ga0058692_1000954
992 Ga0055543_1000032
993 Ga0055543_1000507
994 Ga0065165_1003516
995 Ga0065165_1009353
996 Ga0065165_1024876
997 Ga0070670_100038746
998 Ga0070660_100201442
999 Ga0070660_100651878
1000 Ga0070668_100771571
1001 Ga0070668_100837491
1002 Ga0070669_100062353
1003 Ga0070669_100073137
1004 Ga0070659_100530984
1005 Ga0070713_100083761
1006 Ga0070710_10114578
1007 Ga0070710_10383778
1008 Ga0070678_100178951
1009 Ga0070662_100619462
1010 Ga0070681_10117048
1011 Ga0070679_100185033
1012 Ga0068853_100036646
1013 Ga0070665_100012992
1014 Ga0070665_100263110
1015 Ga0068855_100247060
1016 Ga0068855_100269142
1017 Ga0068857_100437125
1018 Ga0068852_100574031
1019 Ga0068863_100097227
1020 Ga0081455_10016377
1021 Ga0081538_10064338
1022 Ga0081540_1025775
1023 Ga0075365_10004225
1024 Ga0075365_10006168
1025 Ga0075365_10154341
1026 Ga0075365_10275338
1027 Ga0075368_10017047
1028 Ga0075368_10162980
1029 Ga0075363_100511895
1030 Ga0075364_10000170
1031 Ga0075364_10232346
1032 Ga0075364_10337542
1033 Ga0075364_10362265
1034 Ga0075364_10394792
1035 Ga0075364_10575475
1036 Ga0075364_10795008
1037 Ga0070716_100431425
1038 Ga0070712_100362024
1039 Ga0075362_10000803
1040 Ga0075362_10010765
1041 Ga0075362_10027933
1042 Ga0075367_10001565
1043 Ga0075367_10005669
1044 Ga0075367_10019031
1045 Ga0075367_10501875
1046 Ga0075369_10000650
1047 Ga0075369_10028406
1048 Ga0075369_10151567
1049 Ga0075369_10305039
1050 Ga0075366_10451194
1051 Ga0075370_10040386
1052 Ga0075370_10670238
1053 Ga0079104_1000209
1054 Ga0099826_10000103
1055 Ga0105240_10899515
1056 Ga0105243_10124642
1057 Ga0105243_11153790
1058 Ga0105241_11943512
1059 Ga0105248_10908857
1060 Ga0105237_10067121
1061 Ga0105238_10282255
1062 Ga0105238_11232641
1063 Ga0123340_1081144
1064 Ga0123341_1001018
1065 Ga0123341_1032179
1066 Ga0123342_1036935
1067 Ga0105239_10699119
1068 Ga0105246_11803613
1069 Ga0157319_1001870
1070 Ga0157373_10012025
1071 Ga0157373_10040944
1072 Ga0157373_10594276
1073 Ga0157371_10000015
1074 Ga0157371_10041317
1075 Ga0157370_10000309
1076 Ga0157370_10083084
1077 Ga0157370_10227534
1078 Ga0157369_10026552
1079 Ga0163163_11423371
1080 Ga0163163_11926299
1081 Ga0213872_10119664
1082 Ga0213874_10018750
1083 Ga0213876_10051446
1084 Ga0213876_10221343
1085 Ga0213871_10182512
1086 Ga0213871_10204647
1087 Ga0209436_100001
1088 Ga0207425_1000010
1089 Ga0207425_1000826
1090 Ga0207425_1011745
1091 Ga0209129_1000099
1092 Ga0209129_1000580
1093 Ga0209129_1000593
1094 Ga0209129_1001147
1095 Ga0209129_1002836
1096 Ga0209129_1004971
1097 Ga0209129_1007616
1098 Ga0209565_1021755
1099 Ga0209673_1000013
1100 Ga0209673_1000048
1101 Ga0209673_1000841
1102 Ga0209673_1001196
1103 Ga0209673_1001233
1104 Ga0209673_1001920
1105 Ga0209673_1007723
1106 Ga0209673_1009029
1107 Ga0209673_1011162
1108 Ga0209673_1054429
1109 Ga0209130_1000004
1110 Ga0209130_1008084
1111 Ga0209130_1026826
1112 Ga0209130_1032942
1113 Ga0209675_1025138
1114 Ga0209676_1001764
1115 Ga0209676_1030148
1116 Ga0209025_1000022
1117 Ga0209025_1000787
1118 Ga0209025_1001289
1119 Ga0209025_1001860
1120 Ga0209025_1002946
1121 Ga0209025_1007031
1122 Ga0209025_1017404
1123 Ga0209025_1018065
1124 Ga0209025_1024099
1125 Ga0209564_1000566
1126 Ga0209564_1000906
1127 Ga0209564_1004549
1128 Ga0209564_1007058
1129 Ga0209564_1019336
1130 Ga0209758_1000086
1131 Ga0209758_1000821
1132 Ga0209758_1000977
1133 Ga0209758_1001150
1134 Ga0209758_1001420
1135 Ga0209758_1005307
1136 Ga0209758_1012058
1137 Ga0209758_1072740
1138 Ga0209758_1132444
1139 Ga0209050_1001733
1140 Ga0209050_1048154
1141 Ga0209256_1000947
1142 Ga0209256_1001331
1143 Ga0209256_1002910
1144 Ga0209256_1009756
1145 Ga0209256_1019473
1146 Ga0209256_1035721
1147 Ga0207426_1000003
1148 Ga0207426_1000427
1149 Ga0207426_1003684
1150 Ga0209051_1000125
1151 Ga0209051_1001061
1152 Ga0209051_1002163
1153 Ga0209051_1014843
1154 Ga0209051_1149955
1155 Ga0209257_1001014
1156 Ga0209257_1001705
1157 Ga0209257_1065890
1158 Ga0207647_10032694
1159 Ga0207705_10366009
1160 Ga0207705_10530484
1161 Ga0207693_10038062
1162 Ga0207660_10093030
1163 Ga0207657_10002501
1164 Ga0207657_10493979
1165 Ga0207652_10531851
1166 Ga0207681_10301986
1167 Ga0207681_10343899
1168 Ga0207650_10026479
1169 Ga0207664_10781767
1170 Ga0207706_10787589
1171 Ga0207709_10182291
1172 Ga0207709_10890427
1173 Ga0207711_10780460
1174 Ga0207667_10225867
1175 Ga0207668_10236653
1176 Ga0207668_10882044
1177 Ga0207678_10403505
1178 Ga0207641_10055424
1179 Ga0207648_10687806
1180 Ga0207683_10216327
1181 Ga0209281_1000580
1182 Ga0209371_1000058
1183 Ga0209371_1000904
1184 Ga0209282_1000095
1185 Ga0209813_10023353
1186 Ga0268266_10083220
1187 Ga0268266_10126895
1188 Ga0268266_11138298
1189 Ga0268265_10340830
1190 Ga0307515_10001393
1191 Ga0307515_10004439
1192 Ga0307515_10072377
1193 Ga0265338_10105959
1194 Ga0268256_1000056
1195 Ga0268256_1004374
1196 Ga0316182_1233033
1197 Ga0265320_10012013
1198 Ga0265325_10179200
1199 Ga0265340_10350755
1200 Ga0265327_10038869
1201 Ga0307513_10024524
1202 Ga0307408_100020868
1203 Ga0265314_10011047
1204 Ga0265314_10211308
1205 Ga0316576_10059041
1206 Ga0316578_10005669
1207 Ga0307516_10359782
1208 Ga0307405_10021745
1209 Ga0307406_10019146
1210 Ga0307412_10002546
1211 Ga0307416_100194009
1212 Ga0307510_10196832
1213 Ga0373952_0224739
1214 Ga0316574_0000978
1215 Ga0373935_0035232
1216 Ga0316584_0270665
1217 Ga0373925_0008671
1218 Ga0395899_0350773
1219 Ga0395900_0132273
1220 Ga0395901_0056893
1221 Ga0395901_0277390
1222 Ga0436365_1716423
1223 Ga0436360_0668397
1224 Ga0436360_0672973
1225 Ga0436360_0726396
1226 Ga0436360_0772974
1227 Ga0436360_0891092
1228 Ga0436360_0966143
1229 Ga0436360_1263519
1230 Ga0436360_1279400
1231 Ga0436360_1280006
1232 Ga0436360_1349174
1233 Ga0436361_0056445
1234 Ga0436361_0195628
1235 Ga0436361_0504000
1236 Ga0436361_1066451
1237 Ga0436361_1131419
1238 Ga0436362_1271493
1239 Ga0436362_1294587
1240 Ga0439436_0061624
1241 Ga0439438_064870
1242 Ga0439466_0186910
1243 Ga0439465_0002039
1244 Ga0439465_0014447
1245 Ga0439465_0062128
1246 Ga0439465_0096782
1247 Ga0451787_483819
1248 Ga0451789_0132731
1249 Ga0451791_0446157
1250 Ga0451797_0099719
1251 Ga0451802_0003539
1252 Ga0451804_0654900
1253 Ga0451833_0487316
1254 Ga0451833_0973106
1255 Ga0451835_0582272
1256 Ga0451837_0252729
1257 Ga0451837_1669237
1258 Ga0451839_0052569
1259 Ga0451839_0226926
1260 Ga0451839_1053254
1261 Ga0451841_0507248
1262 Ga0451841_1220323
1263 Ga0451845_0011679
1264 Ga0451847_0191909
1265 Ga0451847_1000258
1266 Ga0451849_0371999
1267 Ga0451850_01285
1268 Ga0451851_0136593
1269 Ga0451843_0529508
1270 Ga0451843_1322506
1271 Ga0451854_37769
1272 Ga0451853_1427546
1273 Ga0451853_3057193
1274 Ga0439432_094870
1275 Ga0439449_0044732
1276 Ga0439449_0164469
1277 Ga0450900_013192
1278 Ga0450900_051686
1279 Ga0451577_0170953
1280 Ga0453683_0105549
1281 Ga0453683_0677123
1282 Ga0466965_0183085
1283 Ga0453684_0352126
1284 Ga0451576_0000752
1285 Ga0451576_0016110
1286 Ga0451576_0065534
1287 Ga0451576_0761571
1288 Ga0495617_048343
1289 Ga0495592_0390125
1290 Ga0495603_0169952
1291 Ga0495629_0119616
1292 Ga0495638_0000597
1293 Ga0495638_0048834
1294 Ga0495638_0250344
1295 Ga0495638_0451292
1296 Ga0495651_0170300
1297 Ga0495651_0427307
1298 Ga0495650_0062085
1299 Ga0495650_0067025
1300 Ga0495650_0082224
1301 Ga0495605_0010494
1302 Ga0495605_0052317
1303 Ga0495605_0110426
1304 Ga0495662_0042557
1305 Ga0495585_0008606
1306 Ga0495585_0014614
1307 Ga0495585_0062670
1308 Ga0495607_0020706
1309 Ga0495607_0078852
1310 Ga0495607_0109190
1311 Ga0495583_0004644
1312 Ga0495583_0038373
1313 Ga0495583_0059957
1314 Ga0495606_0001192
1315 Ga0495606_0014966
1316 Ga0495606_0080629
1317 Ga0495606_0172548
1318 Ga0495606_0310973
1319 Ga0495610_0000823
1320 Ga0495610_0013855
1321 Ga0495616_0099882
1322 Ga0495616_0308931
1323 Ga0495620_0006195
1324 Ga0495620_0016721
1325 Ga0495620_0048443
1326 Ga0495620_0079383
1327 Ga0495620_0108720
1328 Ga0495631_0000740
1329 Ga0495631_0114198
1330 Ga0495631_0260989
1331 Ga0495632_0002039
1332 Ga0495632_0017858
1333 Ga0495632_0044674
1334 Ga0495632_0278320
1335 Ga0495637_0139725
1336 Ga0495643_0058453
1337 Ga0495643_0133632
1338 Ga0495652_0161142
1339 Ga0495654_0000641
1340 Ga0495654_0416245
1341 Ga0495640_0360520
1342 Ga0495587_0426661
1343 Ga0495609_0129367
1344 Ga0495597_0015218
1345 Ga0495597_0164750
1346 Ga0495622_0175598
1347 Ga0495633_0012938
1348 Ga0495633_0079454
1349 Ga0495633_0183738
1350 Ga0495633_0443469
1351 Ga0495668_0004290
1352 Ga0495668_0024255
1353 Ga0495634_0702416
1354 Ga0495611_0005299
1355 Ga0495611_0297048
1356 Ga0495611_0394647
1357 Ga0495625_0001750
1358 Ga0495625_0120200
1359 Ga0495625_0196758
1360 Ga0495661_0058247
1361 Ga0495661_0161776
1362 Ga0495658_0319812
1363 Ga0495613_0515563
1364 Ga0495624_0445747
1365 Ga0495670_0025865
1366 Ga0495670_0055914
1367 Ga0495671_0066511
1368 Ga0495671_0366336
1369 Ga0495589_0033057
1370 Ga0495600_0061319
1371 Ga0495660_0013150
1372 Ga0495660_0073249
1373 Ga0495604_0074492
1374 Ga0495672_0007762
1375 Ga0495683_0019292
1376 Ga0495685_201877
1377 Ga0495681_0041135
1378 Ga0495686_0003300
1379 Ga0495686_0010445
1380 Ga0495686_0012162
1381 Ga0495686_0013205
1382 Ga0495686_0082206
1383 Ga0495686_0256162
1384 Ga0495686_0551787
1385 Ga0495686_0636159
1386 Ga0495615_0147023
1387 Ga0495626_0087468
1388 Ga0496100_0129364
1389 Ga0496101_0556962
1390 Ga0496104_0273064
1391 Ga0496104_0420617
1392 Ga0496105_0753326
1393 Ga0496106_0000801
1394 Ga0496106_0170481
1395 Ga0496107_0343330
1396 Ga0496107_0408015
1397 Ga0496110_0518323
1398 Ga0496110_1381248
1399 Ga0496110_1409562
1400 Ga0496111_0000625
1401 Ga0496114_0599271
1402 Ga0496116_0000043
1403 Ga0496116_0002893
1404 Ga0496116_0048551
1405 Ga0496116_0066801
1406 Ga0496116_0083983
1407 Ga0496116_0135199
1408 Ga0496116_0135754
1409 Ga0496116_0151396
1410 Ga0496116_0165662
1411 Ga0496117_0000002
1412 Ga0496117_0002492
1413 Ga0496117_0017063
1414 Ga0496117_0049600
1415 Ga0496117_0053258
1416 Ga0496117_0091707
1417 Ga0496117_0317675
1418 Ga0496118_0001850
1419 Ga0496118_0002255
1420 Ga0496118_0055604
1421 Ga0496118_0055781
1422 Ga0496118_0070257
1423 Ga0496118_0119184
1424 Ga0496118_0190656
1425 Ga0496118_0333192
1426 Ga0496119_0009038
1427 Ga0496119_0055250
1428 Ga0496119_0068361
1429 Ga0496119_0077578
1430 Ga0496119_0291363
1431 Ga0496119_0336704
1432 Ga0496119_0421149
1433 Ga0496119_0537224
1434 Ga0496120_0000078
1435 Ga0496120_0117643
1436 Ga0496120_0216153
1437 Ga0496121_0000003
1438 Ga0496121_0000751
1439 Ga0496121_0005759
1440 Ga0496121_0016740
1441 Ga0496121_0033826
1442 Ga0496121_0037070
1443 Ga0496121_0050317
1444 Ga0496121_0055812
1445 Ga0496121_0185828
1446 Ga0496121_0241327
1447 Ga0496121_0247651
1448 Ga0496121_0375424
1449 Ga0496121_0388232
1450 Ga0496121_0414040
1451 Ga0496122_0000001
1452 Ga0496122_0000399
1453 Ga0496122_0043507
1454 Ga0496122_0047654
1455 Ga0496122_0175972
1456 Ga0496122_0200130
1457 Ga0496122_0221660
1458 Ga0496122_0243563
1459 Ga0496123_0000001
1460 Ga0496123_0002112
1461 Ga0496123_0007774
1462 Ga0496123_0018288
1463 Ga0496123_0032077
1464 Ga0496123_0055467
1465 Ga0496123_0148710
1466 Ga0496123_0177001
1467 Ga0496124_0000377
1468 Ga0496124_0002648
1469 Ga0496124_0007941
1470 Ga0496124_0039431
1471 Ga0496124_0083345
1472 Ga0496124_0085245
1473 Ga0496124_0089750
1474 Ga0496124_0241109
1475 Ga0496124_0245429
1476 Ga0496124_0264933
1477 Ga0496124_0384363
1478 Ga0496124_0443009
1479 Ga0496125_0000141
1480 Ga0496125_0001650
1481 Ga0496125_0030094
1482 Ga0496125_0059323
1483 Ga0496126_0000362
1484 Ga0496126_0001055
1485 Ga0496126_0108174
1486 Ga0496126_0133653
1487 Ga0496126_0178712
1488 Ga0496126_0307160
1489 Ga0496126_0355000
1490 Ga0496126_0401876
1491 Ga0496126_0721480
1492 Ga0496126_0980343
1493 Ga0495678_014086
1494 Ga0495678_029360
1495 Ga0495682_0111537
1496 Ga0501031_0262833
1497 Ga0501032_0043453
1498 Ga0501032_0322287
1499 Ga0501032_0957740
1500 Ga0501033_0001044
1501 Ga0501033_0083686
1502 Ga0501033_1133102
1503 Ga0501034_0011050
1504 Ga0501034_0041937
1505 Ga0501034_0270792
1506 Ga0501034_0489838
1507 Ga0501036_0019092
1508 Ga0501036_0054502
1509 Ga0501036_0654855
1510 Ga0501037_0047500
1511 Ga0501037_0145295
1512 Ga0501038_0359874
1513 Ga0501038_0628707
1514 Ga0501039_0213010
1515 Ga0501039_0403908
1516 Ga0501043_0021712
1517 Ga0501043_0595146
1518 Ga0501046_0068367
1519 Ga0501046_0543615
1520 Ga0501046_0963078
1521 Ga0501047_0009309
1522 Ga0501047_0472262
1523 Ga0501048_0126905
1524 Ga0501048_0129826
1525 Ga0501048_0233882
1526 Ga0501067_0053980
1527 Ga0501068_0129075
1528 Ga0501070_0608971
1529 Ga0501071_0122293
1530 Ga0501073_0084268
1531 Ga0501073_0150329
1532 Ga0501073_0551658
1533 Ga0501074_0090849
1534 Ga0501079_0594495
1535 Ga0501079_0734447
1536 Ga0501080_0187661
1537 Ga0501080_0381235
1538 Ga0501083_0266414
1539 Ga0501035_0001225
1540 Ga0501035_0036982
1541 Ga0501044_0106055
1542 nmdc:mga03683_16720_c2
1543 nmdc:mga03683_1843_c1
1544 nmdc:mga03n38_501576_c1
1545 nmdc:mga00v17_232788_c1
1546 nmdc:mga00v17_291_c1
1547 nmdc:mga00v17_430441_c1
1548 nmdc:mga00v17_725615_c1
1549 nmdc:mga00v17_831775_c1
1550 nmdc:mga0yw44_174970_c1
1551 nmdc:mga0yw44_26184_c1
1552 nmdc:mga0yw44_30132_c1
1553 nmdc:mga0k408_12066_c1
1554 nmdc:mga06z11_144358_c1
1555 nmdc:mga06z11_375383_c1
1556 nmdc:mga04h51_38387_c1
1557 nmdc:mga07m45_26904_c2
1558 nmdc:mga07m45_375564_c1
1559 nmdc:mga07m45_619570_c1
1560 nmdc:mga0sz30_174166_c1
1561 nmdc:mga0sz30_17576_c2
1562 nmdc:mga0sz30_271449_c1
1563 Ga0495619_0126977
1564 Ga0500578_0188161
1565 Ga0500578_0233289
1566 Ga0500643_043370
1567 Ga0500643_073048
1568 Ga0500583_0310640
1569 Ga0500651_0064859
1570 Ga0500651_0096023
1571 Ga0500641_0170765
1572 Ga0500557_063408
1573 Ga0500560_000049
1574 Ga0500562_061128
1575 Ga0500569_004820
1576 Ga0500572_000978
1577 Ga0500594_0062570
1578 Ga0500594_0107070
1579 Ga0500595_016597
1580 Ga0500595_083161
1581 Ga0500607_177570
1582 Ga0500618_000125
1583 Ga0500618_000289
1584 Ga0500618_003300
1585 Ga0500618_012009
1586 Ga0500628_038501
1587 Ga0500642_0099012
1588 Ga0500658_0001913
1589 Ga0500658_0452703
1590 Ga0500561_0000141
1591 Ga0500568_0000411
1592 Ga0500568_0001577
1593 Ga0500573_0003547
1594 Ga0500573_0076549
1595 Ga0500577_0025801
1596 Ga0500590_002241
1597 Ga0500604_0030499
1598 Ga0500616_0000661
1599 Ga0500616_0013882
1600 Ga0500620_260879
1601 Ga0500622_0000428
1602 Ga0500624_000266
1603 Ga0500624_072200
1604 Ga0500633_0003216
1605 Ga0500634_0053147
1606 Ga0500636_0000202
1607 Ga0500636_0002748
1608 Ga0500636_0202751
1609 Ga0500611_050321
1610 Ga0501082_0398967
1611 2509386798
1612 2509442345
1613 2510133190
1614 2510894556
1615 2511175608
1616 2511183838
1617 2511193357
1618 2513572236
1619 2513579605
1620 2513594481
1621 2513634377
1622 2513708847
1623 2513866900
1624 2513914022
1625 2513926737
1626 2514022813
1627 2515112152
1628 2515635619
1629 2515646181
1630 2515657295
1631 2515738700
1632 2517035886
1633 2517076274
1634 2517095031
1635 2517406664
1636 2520379365
1637 2530645409
1638 2535516368
1639 2537876568
1640 2554247831
1641 2559294961
1642 2585200054
1643 2585224234
1644 2585230172
1645 2585254601
1646 2585403554
1647 2585529813
1648 2585542337
1649 2585546355
1650 2585819478
1651 2585838828
1652 2585845867
1653 2585995933
1654 2586000501
1655 2599417837
1656 2599601356
1657 2599720915
1658 2600375754
1659 2616292581
1660 2643811973
1661 2643855546
1662 2643919455
1663 2644005813
1664 2644193040
1665 2644239471
1666 2644522357
1667 2719181058
1668 2719385673
1669 2719665492
1670 2719731807
1671 2720491912
1672 2720613179
1673 2720620034
1674 2720631459
1675 2720775187
1676 2721147152
1677 2721158686
1678 2721164070
1679 2721399453
1680 2722840240
1681 2723026824
1682 2723560441
1683 2723567006
1684 2724038266
1685 2724044563
1686 2724089794
1687 2724104271
1688 2724110086
1689 2730107760
1690 2730164295
1691 2730298318
1692 2738799057
1693 2739038115
1694 2766063050
1695 2793298150
1696 2793313640
1697 2793322151
1698 2793326554
1699 2793337225
1700 2793341406
1701 2793350470
1702 2793352501
1703 2793361287
1704 2793369554
1705 2805931060
1706 2805938097
1707 2806047927
1708 2806056322
1709 2806061609
1710 2806070116
1711 2806072493
1712 2808985268
1713 2819559699
1714 2819688621
1715 2821127769
1716 2828305736
1717 2838021031
1718 2838027975
1719 2838041657
1720 2838043308
1721 2838052543
1722 2838066069
1723 2838071593
1724 2838666382
1725 2838673992
1726 2838682347
1727 2838689365
1728 2838696918
1729 2838706370
1730 2838709841
1731 2838714987
1732 2838721212
1733 2838730698
1734 2838738193
1735 2838743639
1736 2841841437
1737 2841848170
1738 2841854685
1739 2841864679
1740 2842078015
1741 2842110623
1742 2842119477
1743 2842141215
1744 2842148704
1745 2842157548
1746 2842164740
1747 2842171231
1748 2842180867
1749 2842188096
1750 2842196750
1751 2842203869
1752 2842206173
1753 2842212407
1754 2842217106
1755 2842225974
1756 2842231075
1757 2842239254
1758 2842244818
1759 2842256110
1760 2842258631
1761 2842268156
1762 2842273385
1763 2842279630
1764 2842286271
1765 2842291678
1766 2842304162
1767 2842313793
1768 2842318044
1769 2842345958
1770 2842364414
1771 2842372913
1772 2842378074
1773 2842385985
1774 2842397542
1775 2842408012
1776 2842414773
1777 2842421344
1778 2842424749
1779 2842431609
1780 2842438431
1781 2842445061
1782 2842452376
1783 2842465981
1784 2842473046
1785 2842492991
1786 2842496314
1787 2844459295
1788 2854899305
1789 2854919261
1790 2857518593
1791 2857534490
1792 2889794122
1793 2889915877
1794 2891374386
1795 2899804791
1796 2899846458
1797 2919106955
1798 2919167689
1799 2919175029
1800 2919451089
1801 2923557805
1802 2926756043
1803 2926760359
1804 2929140553
1805 2933008476
1806 2933013291
1807 2933016881
1808 2933571441
1809 2933586649
1810 2933602392
1811 2935897227
1812 2935904613
1813 2936372850
1814 2936376724
1815 2936385099
1816 2978974148
1817 2979094363
1818 2979098254
1819 2979103606
1820 2984511831
1821 2984521809
1822 2984541107
1823 2984589475
1824 2984603386
1825 2989353181
1826 2996890005
1827 2996898266
1828 3005415269
1829 3005447397
1830 3005454007
1831 639648419
1832 650740220
1833 8001848951
1834 8003571283
1835 8005261725
1836 8005280448
1837 8005285667
1838 8005290724
1839 8005302276
1840 8005314401
1841 8005324532
1842 8005379067
1843 8005388210
1844 8005397264
1845 8005433619
1846 8005462812
1847 8005500213
1848 8005545018
1849 8005557844
1850 8005569016
1851 8005572155
1852 8005621505
1853 8005631150
1854 8005671629
1855 8005689849
1856 8005700150
1857 8018129789
1858 8018155515
1859 8018166929
1860 8018179962
1861 8023685522
1862 8024482169
1863 8024506733
1864 8054462800
1865 8056377302
1866 8056388216
1867 8056877581
1868 8057875194

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07370

DUF1489

Protein of unknown function (DUF1489)

33

173

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6unp-assembly2.cif.gz_B crystal structure of the kinase domain of bmpr2-d485g 0.7597 70 92
5o1v-assembly1.cif.gz_B crystal structure of wnk3 kinase domain in a monophosphorylated apo state (a-loop swapped) 0.7514 70 92
7avy-assembly1.cif.gz_A mertk kinase domain in complex with quinazoline-based inhbitor 0.7401 70 92
3g2f-assembly2.cif.gz_B crystal structure of the kinase domain of bone morphogenetic protein receptor type ii (bmpr2) at 2.35 a resolution 0.7353 70 92
4wua-assembly1.cif.gz_A crystal structure of human srpk1 complexed to an inhibitor srpin340 0.7248 70 92
ID Description Score Start End Superfamily
af_Q59SK8_134_235_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8527 74 90 3.30.780.10
af_Q9VK37_32_125_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8222 70 92 3.30.200.20
af_A4HXQ3_17_104_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8166 70 92 3.30.200.20
af_Q6NQB8_66_391_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7808 75 89 1.10.10.10
af_B0V0H4_197_291_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7442 70 92 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A4Q3CD48-F1-model_v4 DUF1489 family protein 1.001 1 98
AF-A0A7J4VR54-F1-model_v4 DUF1489 family protein 0.9922 1 145
AF-A0A4Q3CD48-F1-model_v4 DUF1489 family protein 0.9904 1 98
AF-A0A2A6K051-F1-model_v4 DUF1489 domain-containing protein 0.9885 1 145
AF-A0A6A8A181-F1-model_v4 DUF1489 family protein 0.9709 1 145

Map