F486142

General Info

Members Datasets Scaffolds Average Seq Length
934 475 1868 377

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2829745981|2829748377
Length 393
Sequence RTAVAGATARKQVSHTGRIASAPRMGLAPSVQRLPRLPLDEILIGDCIAAMERLPAESVDCVFADPPYNLQLGEAGLTRPDHSVVDAVDDDWDKFSSFEAYDDFTRAWLKAARRAMKPNATLWVIGSYHNIFRVGSALQDLGYWILNDIVWRKANPMPNFRGKRFTNAHETLIWASRSPQAKYTFHYDALKAGNEDLQMRSDWFLPLCTGEERLKDGAGRKVHPTQKPEALVARTLMAATNPGDVVLDPFFGSGTTGAVAKRLGRHFIGCERDKTYAAAAQARIDAVETLSSASLALATPKRAEPRVPFLSVVEAGLVRPGETLTDERRRFKATVRPDGQLGIGPAMGSIHKVGALVQGLPACNGWTFWHAERGGKLVCIDEFRSQMRARAES

Samples

Sample ID Description Type Environment
1 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
128 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
129 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
130 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
212 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
213 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
220 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
221 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
227 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
311 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
312 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
313 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
314 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
315 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
316 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
317 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
318 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
322 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
323 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
324 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
325 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
326 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
327 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
328 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
329 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
330 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
331 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
332 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
333 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
334 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
335 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
336 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
337 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
338 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
339 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
340 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
341 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
342 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
343 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
344 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
345 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
346 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
347 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
348 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
349 2643221629 Devosia sp. Root105 Isolate Unclassified
350 2643221651 Afipia sp. Root123D2 Isolate Unclassified
351 2643221662 Devosia sp. Root413D1 Isolate Unclassified
352 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
353 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
354 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
355 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
356 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
357 2773857925 Microvirga vignae BR3299 Isolate Unclassified
358 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
359 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
360 2791355199
361 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
362 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
363 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
364 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
365 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
366 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
367 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
368 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
369 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
370 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
371 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
372 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
373 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
374 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
375 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
376 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
377 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
378 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
379 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
380 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
381 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
382 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
383 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
384 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
385 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
386 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
387 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
388 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
389 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
390 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
391 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
392 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
393 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
394 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
395 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
396 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
397 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
398 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
399 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
400 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
401 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
402 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
403 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
404 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
405 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
406 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
407 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
408 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
409 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
410 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
411 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
412 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
413 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
414 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
415 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
416 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
417 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
418 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
419 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
420 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
421 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
422 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
423 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
424 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
425 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
426 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
427 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
428 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
429 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
430 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
431 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
432 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
433 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
434 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
435 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
436 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
437 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
438 641522639 Methylobacterium sp. 4-46 Isolate Nodule
439 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
440 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
441 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
442 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
443 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
444 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
445 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
446 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
447 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
448 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
449 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
450 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
451 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
452 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
453 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
454 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
455 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
456 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
457 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
458 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
459 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
460 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
461 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
462 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
463 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
464 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
465 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
466 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
467 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
468 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
469 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
470 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
471 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
472 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
473 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
474 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
475 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.49
Metatranscriptomes 0
Isolates 16.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.32
Nodule 15.95
Rhizoplane 2.25
Rhizosphere 71.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilYngRDRAFT_c00262 3300000042 Bacteria 8106
2 ARcpr5yngRDRAFT_c000410 3300000043 Bacteria 5625
3 ARSoilOldRDRAFT_c000163 3300000044 Bacteria 11284
4 ARSoilOldRDRAFT_c001504 3300000044 Bacteria 2164
5 ARCol0yngRDRAFT_1000276 3300000652 Bacteria 8111
6 JGI24739J22299_10000209 3300001989 Bacteria 19461
7 JGI24737J22298_10008663 3300001990 Bacteria 3400
8 JGI24737J22298_10028274 3300001990 Bacteria 1763
9 JGI24743J22301_10005489 3300001991 Bacteria 2120
10 JGI24748J21848_1003329 3300002074 Bacteria 1833
11 JGI24738J21930_10000520 3300002075 Bacteria 10976
12 JGI24744J21845_10001082 3300002077 Bacteria 5276
13 JGI24034J26672_10000769 3300002239 Bacteria 4137
14 JGI24742J22300_10001936 3300002244 Bacteria 3297
15 JGI24742J22300_10007211 3300002244 Bacteria 1833
16 JGI24751J29686_10016041 3300002459 Bacteria 1545
17 JGI25406J46586_10014105 3300003203 Bacteria 3406
18 JGI25153J46596_10004362 3300003215 Bacteria 7635
19 JGI26129J50193_1001490 3300003349 Bacteria 1595
20 Ga0055542_1003388 3300003762 Bacteria 4346
21 Ga0055531_10001950 3300003794 Bacteria 14425
22 JGI25405J52794_10001619 3300003911 Bacteria 3734
23 Ga0065165_1001570 3300005262 Bacteria 23574
24 Ga0065712_10078574 3300005290 Bacteria 3329
25 Ga0065715_10005127 3300005293 Bacteria 4022
26 Ga0065715_10093447 3300005293 Bacteria 4678
27 Ga0070676_10003190 3300005328 Bacteria 8502
28 Ga0070676_10011775 3300005328 Bacteria 4761
29 Ga0070676_10086982 3300005328 Bacteria 1907
30 Ga0070683_100009959 3300005329 Bacteria 8151
31 Ga0070683_100018569 3300005329 Bacteria 6163
32 Ga0070683_100120252 3300005329 Bacteria 2481
33 Ga0070690_100021672 3300005330 Bacteria 3925
34 Ga0070690_100043051 3300005330 Bacteria 2862
35 Ga0070690_100072075 3300005330 Bacteria 2245
36 Ga0070690_100104519 3300005330 Bacteria 1881
37 Ga0070670_100008185 3300005331 Bacteria 8903
38 Ga0070670_100081197 3300005331 Bacteria 2786
39 Ga0070677_10000109 3300005333 Bacteria 26990
40 Ga0068869_100000729 3300005334 Bacteria 18701
41 Ga0068869_100083556 3300005334 Bacteria 2388
42 Ga0070666_10010649 3300005335 Bacteria 5757
43 Ga0070666_10012981 3300005335 Bacteria 5273
44 Ga0070666_10112596 3300005335 Bacteria 1882
45 Ga0070680_100076082 3300005336 Bacteria 2763
46 Ga0070680_100146059 3300005336 Bacteria 1984
47 Ga0070680_100265593 3300005336 Bacteria 1452
48 Ga0070682_100000459 3300005337 Bacteria 25698
49 Ga0070682_100021137 3300005337 Bacteria 3835
50 Ga0068868_100000443 3300005338 Bacteria 27815
51 Ga0068868_100017966 3300005338 Bacteria 5278
52 Ga0068868_100084074 3300005338 Bacteria 2556
53 Ga0070660_100001113 3300005339 Bacteria 18130
54 Ga0070660_100009423 3300005339 Bacteria 6867
55 Ga0070689_100000423 3300005340 Bacteria 24943
56 Ga0070689_100074167 3300005340 Bacteria 2662
57 Ga0070689_100195808 3300005340 Bacteria 1647
58 Ga0070691_10001337 3300005341 Bacteria 10491
59 Ga0070691_10013427 3300005341 Bacteria 3750
60 Ga0070691_10046321 3300005341 Bacteria 2065
61 Ga0070687_100000851 3300005343 Bacteria 10218
62 Ga0070687_100025800 3300005343 Bacteria 2824
63 Ga0070687_100038078 3300005343 Bacteria 2408
64 Ga0070661_100003440 3300005344 Bacteria 10933
65 Ga0070661_100018051 3300005344 Bacteria 5012
66 Ga0070692_10013172 3300005345 Bacteria 3849
67 Ga0070692_10013687 3300005345 Bacteria 3789
68 Ga0070668_100025701 3300005347 Bacteria 4466
69 Ga0070668_100201595 3300005347 Bacteria 1633
70 Ga0070668_100202098 3300005347 Bacteria 1631
71 Ga0070669_100001552 3300005353 Bacteria 16619
72 Ga0070669_100042432 3300005353 Bacteria 3310
73 Ga0070669_100050939 3300005353 Bacteria 3025
74 Ga0070669_100286396 3300005353 Bacteria 1321
75 Ga0070675_100011646 3300005354 Bacteria 6891
76 Ga0070675_100205049 3300005354 Bacteria 1712
77 Ga0070671_100000889 3300005355 Bacteria 21815
78 Ga0070671_100004731 3300005355 Bacteria 10809
79 Ga0070671_100117185 3300005355 Bacteria 2239
80 Ga0070671_100238220 3300005355 Bacteria 1545
81 Ga0070674_100001251 3300005356 Bacteria 13361
82 Ga0070674_100008867 3300005356 Bacteria 6004
83 Ga0070674_100012692 3300005356 Bacteria 5180
84 Ga0070673_100000050 3300005364 Bacteria 49499
85 Ga0070673_100141213 3300005364 Bacteria 2031
86 Ga0070688_100001813 3300005365 Bacteria 10708
87 Ga0070688_100004548 3300005365 Bacteria 7232
88 Ga0070688_100041335 3300005365 Bacteria 2829
89 Ga0070688_100043306 3300005365 Bacteria 2773
90 Ga0070688_100151520 3300005365 Bacteria 1586
91 Ga0070659_100011380 3300005366 Bacteria 6580
92 Ga0070659_100043607 3300005366 Bacteria 3508
93 Ga0070659_100136608 3300005366 Bacteria 1994
94 Ga0070667_100001872 3300005367 Bacteria 18695
95 Ga0070667_100038258 3300005367 Bacteria 4022
96 Ga0070667_100049643 3300005367 Bacteria 3534
97 Ga0070709_10000525 3300005434 Bacteria 22547
98 Ga0070709_10088719 3300005434 Bacteria 2035
99 Ga0070714_100039245 3300005435 Bacteria 3985
100 Ga0070714_100172671 3300005435 Bacteria 1963
101 Ga0070714_100186847 3300005435 Bacteria 1888
102 Ga0070713_100002218 3300005436 Bacteria 12588
103 Ga0070713_100006229 3300005436 Bacteria 8256
104 Ga0070713_100020864 3300005436 Bacteria 5030
105 Ga0070713_100075589 3300005436 Bacteria 2857
106 Ga0070713_100087367 3300005436 Bacteria 2674
107 Ga0070713_100104124 3300005436 Bacteria 2463
108 Ga0070713_100109412 3300005436 Bacteria 2408
109 Ga0070710_10000635 3300005437 Bacteria 16717
110 Ga0070710_10011579 3300005437 Bacteria 4361
111 Ga0070710_10037299 3300005437 Bacteria 2662
112 Ga0070710_10128956 3300005437 Bacteria 1540
113 Ga0070710_10152704 3300005437 Bacteria 1425
114 Ga0070701_10000093 3300005438 Bacteria 25004
115 Ga0070701_10045104 3300005438 Bacteria 2261
116 Ga0070701_10127992 3300005438 Bacteria 1439
117 Ga0070711_100004210 3300005439 Bacteria 8454
118 Ga0070711_100025068 3300005439 Bacteria 3898
119 Ga0070711_100036564 3300005439 Bacteria 3290
120 Ga0070711_100110943 3300005439 Bacteria 2013
121 Ga0070705_100003661 3300005440 Bacteria 7526
122 Ga0070700_100004285 3300005441 Bacteria 7447
123 Ga0070700_100058962 3300005441 Bacteria 2414
124 Ga0070700_100188668 3300005441 Bacteria 1440
125 Ga0070694_100004866 3300005444 Bacteria 8087
126 Ga0070694_100041729 3300005444 Bacteria 3062
127 Ga0070694_100064828 3300005444 Bacteria 2501
128 Ga0070663_100002633 3300005455 Bacteria 10158
129 Ga0070663_100047211 3300005455 Bacteria 3050
130 Ga0070663_100117061 3300005455 Bacteria 2009
131 Ga0070663_100120842 3300005455 Bacteria 1978
132 Ga0070663_100238191 3300005455 Bacteria 1435
133 Ga0070678_100010551 3300005456 Bacteria 5651
134 Ga0070678_100020541 3300005456 Bacteria 4335
135 Ga0070678_100062839 3300005456 Bacteria 2744
136 Ga0070678_100120174 3300005456 Bacteria 2070
137 Ga0070678_100149033 3300005456 Bacteria 1882
138 Ga0070678_100149391 3300005456 Bacteria 1880
139 Ga0070662_100021063 3300005457 Bacteria 4447
140 Ga0070662_100044031 3300005457 Bacteria 3196
141 Ga0070662_100161953 3300005457 Bacteria 1750
142 Ga0070681_10001623 3300005458 Bacteria 20035
143 Ga0070681_10065290 3300005458 Bacteria 3608
144 Ga0068867_100001138 3300005459 Bacteria 18176
145 Ga0068867_100013132 3300005459 Bacteria 5864
146 Ga0068867_100147037 3300005459 Bacteria 1848
147 Ga0068867_100169018 3300005459 Bacteria 1730
148 Ga0070685_10001254 3300005466 Bacteria 13468
149 Ga0070685_10024925 3300005466 Bacteria 3289
150 Ga0070685_10032155 3300005466 Bacteria 2937
151 Ga0070685_10164042 3300005466 Bacteria 1418
152 Ga0070707_100111151 3300005468 Bacteria 2657
153 Ga0070679_100055033 3300005530 Bacteria 3962
154 Ga0070679_100065552 3300005530 Bacteria 3620
155 Ga0070679_100144536 3300005530 Bacteria 2357
156 Ga0070679_100177560 3300005530 Bacteria 2102
157 Ga0070684_100011442 3300005535 Bacteria 7068
158 Ga0070684_100030528 3300005535 Bacteria 4579
159 Ga0070684_100050160 3300005535 Bacteria 3624
160 Ga0070684_100318971 3300005535 Bacteria 1427
161 Ga0068853_100009153 3300005539 Bacteria 7976
162 Ga0068853_100077959 3300005539 Bacteria 2895
163 Ga0070672_100155583 3300005543 Bacteria 1893
164 Ga0070686_100001868 3300005544 Bacteria 11736
165 Ga0070686_100002806 3300005544 Bacteria 9592
166 Ga0070686_100016931 3300005544 Bacteria 4249
167 Ga0070686_100032561 3300005544 Bacteria 3197
168 Ga0070686_100121068 3300005544 Bacteria 1797
169 Ga0070695_100018566 3300005545 Bacteria 4224
170 Ga0070695_100034489 3300005545 Bacteria 3173
171 Ga0070695_100109198 3300005545 Bacteria 1874
172 Ga0070696_100018921 3300005546 Bacteria 4662
173 Ga0070696_100021024 3300005546 Bacteria 4423
174 Ga0070696_100025251 3300005546 Bacteria 4038
175 Ga0070696_100067689 3300005546 Bacteria 2506
176 Ga0070693_100025096 3300005547 Bacteria 3205
177 Ga0070665_100009621 3300005548 Bacteria 9777
178 Ga0070665_100032380 3300005548 Bacteria 5261
179 Ga0070665_100053068 3300005548 Bacteria 4066
180 Ga0070665_100131953 3300005548 Bacteria 2500
181 Ga0070704_100000970 3300005549 Bacteria 14563
182 Ga0070704_100079559 3300005549 Bacteria 2408
183 Ga0068855_100009019 3300005563 Bacteria 12054
184 Ga0068855_100081242 3300005563 Bacteria 3757
185 Ga0068855_100084736 3300005563 Bacteria 3668
186 Ga0068855_100134563 3300005563 Bacteria 2820
187 Ga0068855_100161011 3300005563 Bacteria 2547
188 Ga0070664_100013823 3300005564 Bacteria 6580
189 Ga0070664_100022104 3300005564 Bacteria 5245
190 Ga0070664_100211796 3300005564 Bacteria 1732
191 Ga0070664_100412190 3300005564 Bacteria 1236
192 Ga0068857_100025388 3300005577 Bacteria 5217
193 Ga0068857_100036560 3300005577 Bacteria 4351
194 Ga0068857_100052885 3300005577 Bacteria 3602
195 Ga0068857_100114218 3300005577 Bacteria 2428
196 Ga0068854_100023018 3300005578 Bacteria 4252
197 Ga0068854_100136141 3300005578 Bacteria 1880
198 Ga0068856_100003821 3300005614 Bacteria 15095
199 Ga0068856_100070183 3300005614 Bacteria 3465
200 Ga0068856_100144726 3300005614 Bacteria 2384
201 Ga0068856_100156405 3300005614 Bacteria 2290
202 Ga0068856_100172012 3300005614 Bacteria 2178
203 Ga0068856_100371798 3300005614 Bacteria 1448
204 Ga0070702_100000497 3300005615 Bacteria 14109
205 Ga0070702_100065933 3300005615 Bacteria 2122
206 Ga0070702_100108090 3300005615 Bacteria 1719
207 Ga0068852_100001222 3300005616 Bacteria 17091
208 Ga0068852_100043163 3300005616 Bacteria 3823
209 Ga0068852_100047920 3300005616 Bacteria 3649
210 Ga0068859_100009942 3300005617 Bacteria 9597
211 Ga0068859_100014942 3300005617 Bacteria 7793
212 Ga0068864_100008385 3300005618 Bacteria 8527
213 Ga0068866_10007896 3300005718 Bacteria 4466
214 Ga0068866_10026422 3300005718 Bacteria 2741
215 Ga0068866_10038874 3300005718 Bacteria 2346
216 Ga0068866_10131713 3300005718 Bacteria 1423
217 Ga0068861_100048566 3300005719 Bacteria 3209
218 Ga0068861_100170931 3300005719 Bacteria 1801
219 Ga0068861_100222418 3300005719 Bacteria 1596
220 Ga0068861_100225740 3300005719 Bacteria 1585
221 Ga0068870_10000051 3300005840 Bacteria 36782
222 Ga0068870_10030865 3300005840 Bacteria 2711
223 Ga0068870_10069194 3300005840 Bacteria 1920
224 Ga0068863_100005913 3300005841 Bacteria 11997
225 Ga0068863_100020698 3300005841 Bacteria 6283
226 Ga0068858_100007984 3300005842 Bacteria 10202
227 Ga0068858_100023725 3300005842 Bacteria 5715
228 Ga0068858_100135051 3300005842 Bacteria 2314
229 Ga0068858_100207925 3300005842 Bacteria 1852
230 Ga0068860_100021096 3300005843 Bacteria 6309
231 Ga0068860_100031898 3300005843 Bacteria 5065
232 Ga0068860_100172660 3300005843 Bacteria 2088
233 Ga0068860_100298602 3300005843 Bacteria 1577
234 Ga0068860_100329578 3300005843 Bacteria 1499
235 Ga0068862_100212012 3300005844 Bacteria 1750
236 Ga0081455_10000081 3300005937 Bacteria 103752
237 Ga0081455_10006845 3300005937 Bacteria 12146
238 Ga0081455_10008003 3300005937 Bacteria 11048
239 Ga0081455_10010270 3300005937 Bacteria 9519
240 Ga0081455_10034931 3300005937 Bacteria 4500
241 Ga0081455_10035553 3300005937 Bacteria 4449
242 Ga0081455_10042591 3300005937 Bacteria 3980
243 Ga0081538_10033224 3300005981 Bacteria 3438
244 Ga0081538_10035779 3300005981 Bacteria 3255
245 Ga0081540_1003048 3300005983 Bacteria 13423
246 Ga0081540_1004585 3300005983 Bacteria 10467
247 Ga0081540_1011726 3300005983 Bacteria 5834
248 Ga0081540_1036983 3300005983 Bacteria 2594
249 Ga0081540_1054345 3300005983 Bacteria 1958
250 Ga0081540_1091720 3300005983 Bacteria 1335
251 Ga0081539_10000003 3300005985 Bacteria 594833
252 Ga0081539_10000306 3300005985 Bacteria 110402
253 Ga0081539_10002527 3300005985 Bacteria 25540
254 Ga0081539_10023760 3300005985 Bacteria 4004
255 Ga0070717_10020052 3300006028 Bacteria 5253
256 Ga0070717_10033974 3300006028 Bacteria 4118
257 Ga0070717_10111478 3300006028 Bacteria 2334
258 Ga0070717_10137306 3300006028 Bacteria 2107
259 Ga0075365_10048156 3300006038 Bacteria 2804
260 Ga0075365_10098902 3300006038 Bacteria 1996
261 Ga0075365_10202259 3300006038 Bacteria 1391
262 Ga0075363_100006875 3300006048 Bacteria 5199
263 Ga0075363_100048854 3300006048 Bacteria 2251
264 Ga0075363_100064238 3300006048 Bacteria 1983
265 Ga0075363_100130261 3300006048 Bacteria 1410
266 Ga0075364_10046435 3300006051 Bacteria 2828
267 Ga0075364_10108963 3300006051 Bacteria 1847
268 Ga0075364_10152018 3300006051 Bacteria 1560
269 Ga0075364_10178925 3300006051 Bacteria 1434
270 Ga0075432_10025053 3300006058 Bacteria 2046
271 Ga0070715_10002070 3300006163 Bacteria 6053
272 Ga0070715_10009060 3300006163 Bacteria 3494
273 Ga0070715_10046025 3300006163 Bacteria 1853
274 Ga0070716_100069879 3300006173 Bacteria 2060
275 Ga0070716_100089258 3300006173 Bacteria 1861
276 Ga0070712_100020258 3300006175 Bacteria 4351
277 Ga0070712_100058109 3300006175 Bacteria 2720
278 Ga0070712_100125157 3300006175 Bacteria 1940
279 Ga0070712_100214678 3300006175 Bacteria 1519
280 Ga0075362_10004304 3300006177 Bacteria 5091
281 Ga0075362_10085689 3300006177 Bacteria 1457
282 Ga0075367_10048054 3300006178 Bacteria 2512
283 Ga0075367_10056191 3300006178 Bacteria 2338
284 Ga0075367_10064177 3300006178 Bacteria 2196
285 Ga0075366_10011174 3300006195 Bacteria 5062
286 Ga0075366_10101753 3300006195 Bacteria 1724
287 Ga0075366_10160938 3300006195 Bacteria 1360
288 Ga0097621_100004220 3300006237 Bacteria 9978
289 Ga0075370_10010077 3300006353 Bacteria 4928
290 Ga0068871_100000576 3300006358 Bacteria 25122
291 Ga0068871_100025203 3300006358 Bacteria 4623
292 Ga0068871_100319663 3300006358 Bacteria 1366
293 Ga0075428_100003920 3300006844 Bacteria 16345
294 Ga0075428_100031029 3300006844 Bacteria 5910
295 Ga0075428_100142622 3300006844 Bacteria 2604
296 Ga0075428_100231714 3300006844 Bacteria 1993
297 Ga0075428_100415260 3300006844 Bacteria 1442
298 Ga0075430_100001133 3300006846 Bacteria 21251
299 Ga0075431_100003810 3300006847 Bacteria 14660
300 Ga0075431_100156439 3300006847 Bacteria 2345
301 Ga0075431_100171226 3300006847 Bacteria 2231
302 Ga0075433_10000012 3300006852 Bacteria 71065
303 Ga0075434_100000310 3300006871 Bacteria 34771
304 Ga0075434_100001837 3300006871 Bacteria 18334
305 Ga0075434_100026003 3300006871 Bacteria 5731
306 Ga0075434_100093858 3300006871 Bacteria 3005
307 Ga0075434_100361430 3300006871 Bacteria 1473
308 Ga0075434_100470295 3300006871 Bacteria 1278
309 Ga0075429_100000098 3300006880 Bacteria 47888
310 Ga0068865_100027909 3300006881 Bacteria 3734
311 Ga0068865_100037048 3300006881 Bacteria 3291
312 Ga0068865_100048077 3300006881 Bacteria 2935
313 Ga0075436_100023283 3300006914 Bacteria 4254
314 Ga0075436_100074113 3300006914 Bacteria 2356
315 Ga0097620_100009942 3300006931 Bacteria 9597
316 Ga0097620_100014943 3300006931 Bacteria 7793
317 Ga0099824_1039060 3300006942 Bacteria 1231
318 Ga0075435_100008925 3300007076 Bacteria 7226
319 Ga0075435_100034077 3300007076 Bacteria 4031
320 Ga0099795_10031576 3300007788 Bacteria 1825
321 Ga0105243_10197405 3300009148 Bacteria 1762
322 Ga0105238_10161699 3300009551 Bacteria 2215
323 Ga0105239_10228911 3300010375 Bacteria 2086
324 Ga0157372_10160573 3300013307 Bacteria 2597
325 Ga0163163_10064912 3300014325 Bacteria 3623
326 Ga0157379_10061381 3300014968 Bacteria 3361
327 Ga0182005_1011719 3300015265 Bacteria 2493
328 Ga0214544_1000136 3300021320 Bacteria 107814
329 Ga0214544_1018524 3300021320 Bacteria 5736
330 Ga0214542_1000127 3300021321 Bacteria 107829
331 Ga0214542_1018644 3300021321 Bacteria 5788
332 Ga0214545_1000063 3300021324 Bacteria 107829
333 Ga0214545_1019592 3300021324 Bacteria 5734
334 Ga0214543_1000238 3300021327 Bacteria 84004
335 Ga0213872_10023985 3300021361 Bacteria 2806
336 Ga0224572_1001293 3300024225 Bacteria 3618
337 Ga0228598_1012243 3300024227 Bacteria 1704
338 Ga0209148_1000529 3300025254 Bacteria 37615
339 Ga0209233_1001938 3300025261 Bacteria 7888
340 Ga0209233_1004282 3300025261 Bacteria 4883
341 Ga0207666_1000294 3300025271 Bacteria 7053
342 Ga0209455_1002870 3300025272 Bacteria 6381
343 Ga0209455_1007449 3300025272 Bacteria 3087
344 Ga0207673_1002060 3300025290 Bacteria 2253
345 Ga0209025_1043885 3300025294 Bacteria 1877
346 Ga0209564_1001218 3300025295 Bacteria 29178
347 Ga0209564_1005756 3300025295 Bacteria 6918
348 Ga0209564_1007436 3300025295 Bacteria 5656
349 Ga0209758_1000011 3300025297 Bacteria 1049685
350 Ga0209758_1001693 3300025297 Bacteria 24822
351 Ga0209758_1003535 3300025297 Bacteria 14083
352 Ga0209758_1008617 3300025297 Bacteria 6554
353 Ga0209758_1013315 3300025297 Bacteria 4497
354 Ga0209256_1003503 3300025299 Bacteria 10940
355 Ga0207426_1000669 3300025302 Bacteria 41627
356 Ga0207426_1001272 3300025302 Bacteria 22005
357 Ga0207697_10000883 3300025315 Bacteria 16973
358 Ga0207653_10000546 3300025885 Bacteria 13918
359 Ga0207682_10000072 3300025893 Bacteria 44659
360 Ga0207682_10001384 3300025893 Bacteria 11193
361 Ga0207682_10037916 3300025893 Bacteria 1954
362 Ga0207692_10003747 3300025898 Bacteria 5970
363 Ga0207692_10021564 3300025898 Bacteria 2949
364 Ga0207692_10027919 3300025898 Bacteria 2663
365 Ga0207692_10045881 3300025898 Bacteria 2188
366 Ga0207692_10102421 3300025898 Bacteria 1574
367 Ga0207642_10069634 3300025899 Bacteria 1669
368 Ga0207710_10000558 3300025900 Bacteria 22251
369 Ga0207710_10005750 3300025900 Bacteria 5321
370 Ga0207710_10038320 3300025900 Bacteria 2119
371 Ga0207710_10053989 3300025900 Bacteria 1809
372 Ga0207688_10000329 3300025901 Bacteria 21973
373 Ga0207688_10131982 3300025901 Bacteria 1465
374 Ga0207680_10006444 3300025903 Bacteria 5672
375 Ga0207680_10009603 3300025903 Bacteria 4806
376 Ga0207680_10167041 3300025903 Bacteria 1479
377 Ga0207647_10015267 3300025904 Bacteria 5271
378 Ga0207647_10031280 3300025904 Bacteria 3426
379 Ga0207647_10123830 3300025904 Bacteria 1523
380 Ga0207685_10015324 3300025905 Bacteria 2427
381 Ga0207685_10030348 3300025905 Bacteria 1924
382 Ga0207699_10000365 3300025906 Bacteria 23951
383 Ga0207699_10013113 3300025906 Bacteria 4231
384 Ga0207699_10040973 3300025906 Bacteria 2672
385 Ga0207699_10057605 3300025906 Bacteria 2321
386 Ga0207699_10228019 3300025906 Bacteria 1275
387 Ga0207645_10001534 3300025907 Bacteria 18885
388 Ga0207645_10004741 3300025907 Bacteria 10008
389 Ga0207645_10007080 3300025907 Bacteria 7977
390 Ga0207645_10062196 3300025907 Bacteria 2385
391 Ga0207645_10127541 3300025907 Bacteria 1654
392 Ga0207643_10000004 3300025908 Bacteria 187006
393 Ga0207643_10019880 3300025908 Bacteria 3682
394 Ga0207643_10022650 3300025908 Bacteria 3461
395 Ga0207705_10080762 3300025909 Bacteria 2369
396 Ga0207705_10081108 3300025909 Bacteria 2364
397 Ga0207705_10092910 3300025909 Bacteria 2211
398 Ga0207684_10144485 3300025910 Bacteria 2046
399 Ga0207654_10000955 3300025911 Bacteria 15883
400 Ga0207654_10082892 3300025911 Bacteria 1935
401 Ga0207707_10010417 3300025912 Bacteria 8067
402 Ga0207707_10010719 3300025912 Bacteria 7963
403 Ga0207707_10015930 3300025912 Bacteria 6558
404 Ga0207707_10146806 3300025912 Bacteria 2062
405 Ga0207695_10000503 3300025913 Bacteria 83026
406 Ga0207695_10004855 3300025913 Bacteria 18146
407 Ga0207695_10064111 3300025913 Bacteria 3785
408 Ga0207695_10107255 3300025913 Bacteria 2778
409 Ga0207695_10248230 3300025913 Bacteria 1680
410 Ga0207671_10034616 3300025914 Bacteria 3752
411 Ga0207671_10226531 3300025914 Bacteria 1466
412 Ga0207671_10298324 3300025914 Bacteria 1273
413 Ga0207693_10002261 3300025915 Bacteria 16762
414 Ga0207693_10002741 3300025915 Bacteria 15256
415 Ga0207693_10007535 3300025915 Bacteria 8941
416 Ga0207693_10026950 3300025915 Bacteria 4545
417 Ga0207693_10030079 3300025915 Bacteria 4287
418 Ga0207693_10041528 3300025915 Bacteria 3621
419 Ga0207663_10000475 3300025916 Bacteria 17433
420 Ga0207663_10035092 3300025916 Bacteria 3006
421 Ga0207663_10116096 3300025916 Bacteria 1824
422 Ga0207660_10000648 3300025917 Bacteria 23454
423 Ga0207660_10010766 3300025917 Bacteria 5943
424 Ga0207662_10000456 3300025918 Bacteria 18157
425 Ga0207662_10002036 3300025918 Bacteria 10002
426 Ga0207662_10105458 3300025918 Bacteria 1751
427 Ga0207662_10159625 3300025918 Bacteria 1439
428 Ga0207657_10006593 3300025919 Bacteria 12024
429 Ga0207657_10053057 3300025919 Bacteria 3515
430 Ga0207657_10055350 3300025919 Bacteria 3427
431 Ga0207657_10079802 3300025919 Bacteria 2752
432 Ga0207657_10089683 3300025919 Bacteria 2568
433 Ga0207649_10000262 3300025920 Bacteria 41689
434 Ga0207652_10015412 3300025921 Bacteria 6209
435 Ga0207652_10033984 3300025921 Bacteria 4295
436 Ga0207652_10192779 3300025921 Bacteria 1833
437 Ga0207652_10296856 3300025921 Bacteria 1458
438 Ga0207681_10011215 3300025923 Bacteria 5504
439 Ga0207681_10058168 3300025923 Bacteria 2646
440 Ga0207681_10139073 3300025923 Bacteria 1806
441 Ga0207694_10000212 3300025924 Bacteria 56506
442 Ga0207694_10048000 3300025924 Bacteria 3302
443 Ga0207694_10070063 3300025924 Bacteria 2740
444 Ga0207694_10205909 3300025924 Bacteria 1602
445 Ga0207694_10250255 3300025924 Bacteria 1450
446 Ga0207650_10001947 3300025925 Bacteria 14527
447 Ga0207650_10004313 3300025925 Bacteria 9709
448 Ga0207650_10044435 3300025925 Bacteria 3265
449 Ga0207650_10060788 3300025925 Bacteria 2819
450 Ga0207650_10104966 3300025925 Bacteria 2180
451 Ga0207650_10150120 3300025925 Bacteria 1839
452 Ga0207650_10190838 3300025925 Bacteria 1637
453 Ga0207650_10202118 3300025925 Bacteria 1592
454 Ga0207659_10024061 3300025926 Bacteria 4075
455 Ga0207659_10271542 3300025926 Bacteria 1383
456 Ga0207687_10001501 3300025927 Bacteria 15981
457 Ga0207687_10045360 3300025927 Bacteria 3038
458 Ga0207687_10347868 3300025927 Bacteria 1207
459 Ga0207700_10008558 3300025928 Bacteria 6349
460 Ga0207700_10075285 3300025928 Bacteria 2615
461 Ga0207700_10102193 3300025928 Bacteria 2289
462 Ga0207700_10137441 3300025928 Bacteria 2004
463 Ga0207700_10185057 3300025928 Bacteria 1747
464 Ga0207700_10356952 3300025928 Bacteria 1274
465 Ga0207664_10112106 3300025929 Bacteria 2270
466 Ga0207664_10228326 3300025929 Bacteria 1617
467 Ga0207664_10233159 3300025929 Bacteria 1600
468 Ga0207644_10000467 3300025931 Bacteria 26087
469 Ga0207644_10006439 3300025931 Bacteria 7653
470 Ga0207644_10028393 3300025931 Bacteria 3872
471 Ga0207644_10077145 3300025931 Bacteria 2453
472 Ga0207644_10226352 3300025931 Bacteria 1484
473 Ga0207690_10001228 3300025932 Bacteria 16182
474 Ga0207690_10045739 3300025932 Bacteria 2894
475 Ga0207690_10050277 3300025932 Bacteria 2782
476 Ga0207690_10228713 3300025932 Bacteria 1426
477 Ga0207690_10228871 3300025932 Bacteria 1426
478 Ga0207706_10002789 3300025933 Bacteria 16973
479 Ga0207706_10019343 3300025933 Bacteria 6125
480 Ga0207706_10022888 3300025933 Bacteria 5608
481 Ga0207706_10048120 3300025933 Bacteria 3772
482 Ga0207686_10004704 3300025934 Bacteria 7318
483 Ga0207686_10013214 3300025934 Bacteria 4564
484 Ga0207686_10065671 3300025934 Bacteria 2315
485 Ga0207709_10026810 3300025935 Bacteria 3313
486 Ga0207709_10054126 3300025935 Bacteria 2473
487 Ga0207709_10061406 3300025935 Bacteria 2349
488 Ga0207670_10001648 3300025936 Bacteria 11654
489 Ga0207670_10009649 3300025936 Bacteria 5517
490 Ga0207670_10083388 3300025936 Bacteria 2242
491 Ga0207669_10002049 3300025937 Bacteria 8529
492 Ga0207669_10004490 3300025937 Bacteria 6152
493 Ga0207704_10008504 3300025938 Bacteria 4914
494 Ga0207704_10165715 3300025938 Bacteria 1578
495 Ga0207704_10179743 3300025938 Bacteria 1528
496 Ga0207665_10000090 3300025939 Bacteria 58962
497 Ga0207665_10001035 3300025939 Bacteria 18728
498 Ga0207665_10006306 3300025939 Bacteria 7862
499 Ga0207665_10102671 3300025939 Bacteria 1998
500 Ga0207665_10107032 3300025939 Bacteria 1960
501 Ga0207665_10109983 3300025939 Bacteria 1935
502 Ga0207691_10002658 3300025940 Bacteria 17467
503 Ga0207691_10003654 3300025940 Bacteria 14925
504 Ga0207691_10178715 3300025940 Bacteria 1855
505 Ga0207711_10031583 3300025941 Bacteria 4471
506 Ga0207711_10110870 3300025941 Bacteria 2440
507 Ga0207711_10126796 3300025941 Bacteria 2284
508 Ga0207689_10000203 3300025942 Bacteria 52425
509 Ga0207689_10003505 3300025942 Bacteria 14337
510 Ga0207689_10049085 3300025942 Bacteria 3482
511 Ga0207661_10013912 3300025944 Bacteria 5882
512 Ga0207661_10104692 3300025944 Bacteria 2383
513 Ga0207661_10231752 3300025944 Bacteria 1635
514 Ga0207679_10000157 3300025945 Bacteria 56166
515 Ga0207679_10038719 3300025945 Bacteria 3399
516 Ga0207679_10046306 3300025945 Bacteria 3152
517 Ga0207679_10347724 3300025945 Bacteria 1291
518 Ga0207667_10013999 3300025949 Bacteria 9159
519 Ga0207667_10049063 3300025949 Bacteria 4461
520 Ga0207667_10212568 3300025949 Bacteria 1982
521 Ga0207667_10480259 3300025949 Bacteria 1262
522 Ga0207651_10013916 3300025960 Bacteria 4626
523 Ga0207651_10022606 3300025960 Bacteria 3849
524 Ga0207712_10065223 3300025961 Bacteria 2599
525 Ga0207668_10025801 3300025972 Bacteria 3807
526 Ga0207668_10071074 3300025972 Bacteria 2484
527 Ga0207640_10003255 3300025981 Bacteria 8752
528 Ga0207640_10240971 3300025981 Bacteria 1397
529 Ga0207658_10055835 3300025986 Bacteria 2928
530 Ga0207658_10084461 3300025986 Bacteria 2443
531 Ga0207658_10120018 3300025986 Bacteria 2094
532 Ga0207677_10062746 3300026023 Bacteria 2579
533 Ga0207677_10117118 3300026023 Bacteria 1996
534 Ga0207677_10212642 3300026023 Bacteria 1545
535 Ga0207677_10248932 3300026023 Bacteria 1442
536 Ga0207703_10001346 3300026035 Bacteria 22503
537 Ga0207703_10006480 3300026035 Bacteria 9347
538 Ga0207703_10291949 3300026035 Bacteria 1484
539 Ga0207639_10006466 3300026041 Bacteria 7971
540 Ga0207639_10048698 3300026041 Bacteria 3209
541 Ga0207639_10062377 3300026041 Bacteria 2882
542 Ga0207639_10196447 3300026041 Bacteria 1727
543 Ga0207678_10002498 3300026067 Bacteria 16727
544 Ga0207678_10012062 3300026067 Bacteria 7588
545 Ga0207678_10088787 3300026067 Bacteria 2642
546 Ga0207678_10155535 3300026067 Bacteria 1952
547 Ga0207708_10000784 3300026075 Bacteria 23952
548 Ga0207708_10001393 3300026075 Bacteria 18157
549 Ga0207702_10000003 3300026078 Bacteria 434196
550 Ga0207702_10003404 3300026078 Bacteria 14557
551 Ga0207702_10086432 3300026078 Bacteria 2735
552 Ga0207702_10342313 3300026078 Bacteria 1429
553 Ga0207641_10006340 3300026088 Bacteria 9989
554 Ga0207641_10013359 3300026088 Bacteria 6734
555 Ga0207648_10001783 3300026089 Bacteria 23588
556 Ga0207648_10002310 3300026089 Bacteria 20581
557 Ga0207648_10011313 3300026089 Bacteria 8411
558 Ga0207648_10318318 3300026089 Bacteria 1398
559 Ga0207676_10000990 3300026095 Bacteria 21882
560 Ga0207676_10029007 3300026095 Bacteria 4138
561 Ga0207674_10002887 3300026116 Bacteria 21351
562 Ga0207674_10040792 3300026116 Bacteria 4805
563 Ga0207674_10059413 3300026116 Bacteria 3869
564 Ga0207675_100001741 3300026118 Bacteria 21760
565 Ga0207675_100002594 3300026118 Bacteria 17887
566 Ga0207683_10000824 3300026121 Bacteria 28453
567 Ga0207683_10001176 3300026121 Bacteria 23694
568 Ga0207683_10008180 3300026121 Bacteria 8949
569 Ga0207683_10010994 3300026121 Bacteria 7718
570 Ga0207683_10034926 3300026121 Bacteria 4373
571 Ga0207683_10176200 3300026121 Bacteria 1938
572 Ga0207683_10193163 3300026121 Bacteria 1849
573 Ga0207698_10013372 3300026142 Bacteria 5413
574 Ga0207698_10065776 3300026142 Bacteria 2850
575 Ga0209389_1000088 3300027296 Bacteria 83578
576 Ga0209589_1000007 3300027357 Bacteria 425699
577 Ga0209589_1000189 3300027357 Bacteria 71403
578 Ga0209489_100008 3300027361 Bacteria 425699
579 Ga0209489_100085 3300027361 Bacteria 126199
580 Ga0209700_100009 3300027363 Bacteria 425699
581 Ga0209998_10003384 3300027717 Bacteria 3497
582 Ga0207428_10000137 3300027907 Bacteria 98535
583 Ga0207428_10011738 3300027907 Bacteria 7727
584 Ga0268266_10001075 3300028379 Bacteria 34218
585 Ga0268266_10002267 3300028379 Bacteria 20910
586 Ga0268266_10014909 3300028379 Bacteria 6674
587 Ga0268266_10036292 3300028379 Bacteria 4195
588 Ga0268266_10046433 3300028379 Bacteria 3718
589 Ga0268266_10183323 3300028379 Bacteria 1907
590 Ga0268265_10002187 3300028380 Bacteria 15094
591 Ga0268265_10093297 3300028380 Bacteria 2411
592 Ga0268264_10000168 3300028381 Bacteria 146056
593 Ga0268264_10020190 3300028381 Bacteria 5445
594 Ga0268264_10266604 3300028381 Bacteria 1598
595 Ga0265337_1018093 3300028556 Bacteria 2245
596 Ga0265319_1026647 3300028563 Bacteria 2056
597 Ga0265318_10014356 3300028577 Bacteria 3327
598 Ga0265323_10004923 3300028653 Bacteria 5706
599 Ga0265336_10000865 3300028666 Bacteria 15680
600 Ga0307517_10000071 3300028786 Bacteria 138548
601 Ga0265338_10000085 3300028800 Bacteria 175080
602 Ga0265338_10117922 3300028800 Bacteria 2122
603 Ga0307511_10053640 3300030521 Bacteria 3191
604 Ga0265330_10037886 3300031235 Bacteria 2144
605 Ga0265328_10000982 3300031239 Bacteria 13096
606 Ga0265325_10000073 3300031241 Bacteria 70109
607 Ga0265325_10000234 3300031241 Bacteria 39472
608 Ga0265325_10012865 3300031241 Bacteria 4774
609 Ga0265325_10047437 3300031241 Bacteria 2223
610 Ga0265340_10013164 3300031247 Bacteria 4353
611 Ga0265340_10041090 3300031247 Bacteria 2275
612 Ga0265339_10002865 3300031249 Bacteria 12213
613 Ga0265339_10004523 3300031249 Bacteria 9466
614 Ga0265339_10016161 3300031249 Bacteria 4456
615 Ga0265339_10057944 3300031249 Bacteria 2093
616 Ga0265339_10069736 3300031249 Bacteria 1876
617 Ga0265327_10035869 3300031251 Bacteria 2735
618 Ga0265316_10040075 3300031344 Bacteria 3757
619 Ga0307408_100205491 3300031548 Bacteria 1597
620 Ga0265313_10003770 3300031595 Bacteria 12027
621 Ga0265313_10025133 3300031595 Bacteria 3165
622 Ga0265313_10026353 3300031595 Bacteria 3063
623 Ga0265313_10079360 3300031595 Bacteria 1494
624 Ga0307508_10000008 3300031616 Bacteria 265023
625 Ga0307508_10055649 3300031616 Bacteria 3504
626 Ga0307508_10212708 3300031616 Bacteria 1533
627 Ga0265314_10006006 3300031711 Bacteria 10823
628 Ga0265314_10023216 3300031711 Bacteria 4736
629 Ga0265314_10038356 3300031711 Bacteria 3462
630 Ga0265314_10040806 3300031711 Bacteria 3327
631 Ga0265342_10000548 3300031712 Bacteria 39664
632 Ga0265342_10011621 3300031712 Bacteria 6010
633 Ga0307406_10057596 3300031901 Bacteria 2493
634 Ga0307406_10161200 3300031901 Bacteria 1612
635 Ga0307415_100129931 3300032126 Bacteria 1905
636 Ga0307510_10200982 3300033180 Bacteria 1528
637 Ga0315911_1000004 3300033442 Bacteria 472637
638 Ga0373937_0005496 3300036401 Bacteria 10861
639 Ga0373925_0210419 3300037068 Bacteria 1549
640 Ga0395900_0001040 3300037418 Bacteria 35567
641 Ga0395900_0035092 3300037418 Bacteria 5166
642 Ga0395900_0174078 3300037418 Bacteria 2190
643 Ga0436364_0053055 3300037853 Bacteria 1495
644 Ga0395901_0157312 3300038443 Bacteria 2387
645 Ga0436365_1081029 3300039437 Bacteria 1501
646 Ga0436365_1440709 3300039437 Bacteria 5223
647 Ga0436360_0084371 3300039438 Bacteria 7058
648 Ga0436363_1162359 3300039450 Bacteria 1311
649 Ga0436363_1274559 3300039450 Bacteria 1387
650 Ga0466966_0016947 3300044684 Bacteria 4816
651 Ga0466961_0000060 3300044693 Bacteria 65360
652 Ga0466961_0223603 3300044693 Bacteria 1160
653 Ga0466957_0019803 3300044842 Bacteria 3961
654 Ga0466959_0010444 3300045049 Bacteria 6640
655 Ga0466959_0053246 3300045049 Bacteria 2959
656 Ga0466958_0049650 3300045836 Bacteria 2539
657 Ga0495631_0079938 3300046518 Bacteria 1411
658 Ga0495634_0153783 3300046642 Bacteria 1453
659 Ga0496100_0006810 3300048903 Bacteria 6262
660 Ga0496103_0039032 3300048906 Bacteria 2917
661 Ga0496103_0163568 3300048906 Bacteria 1428
662 Ga0496104_0022151 3300048907 Bacteria 5838
663 Ga0496104_0148088 3300048907 Bacteria 2254
664 Ga0496105_0000017 3300048908 Bacteria 210323
665 Ga0496105_0085676 3300048908 Bacteria 2603
666 Ga0496105_0192068 3300048908 Bacteria 1669
667 Ga0496106_0089703 3300048909 Bacteria 2371
668 Ga0496107_0076514 3300048910 Bacteria 2437
669 Ga0496108_0018798 3300048911 Bacteria 5664
670 Ga0496109_0208804 3300048912 Bacteria 1836
671 Ga0496110_0065486 3300048913 Bacteria 3213
672 Ga0496110_0194986 3300048913 Bacteria 1839
673 Ga0496111_0013938 3300048914 Bacteria 5482
674 Ga0496111_0122499 3300048914 Bacteria 1921
675 Ga0496112_0032501 3300048915 Bacteria 5067
676 Ga0496112_0194903 3300048915 Bacteria 1987
677 Ga0496113_0138101 3300048916 Bacteria 1916
678 Ga0496115_0147101 3300048918 Bacteria 1945
679 Ga0496116_0077993 3300048919 Bacteria 2068
680 Ga0496119_0001093 3300048922 Bacteria 34137
681 Ga0496121_0010429 3300048924 Bacteria 10482
682 Ga0496121_0080989 3300048924 Bacteria 2571
683 Ga0496125_0057353 3300048928 Bacteria 3154
684 Ga0496126_0025003 3300048929 Bacteria 5756
685 Ga0496126_0169680 3300048929 Bacteria 1860
686 Ga0496126_0283259 3300048929 Bacteria 1372
687 Ga0501031_0012876 3300049568 Bacteria 5464
688 Ga0501031_0019462 3300049568 Bacteria 4423
689 Ga0501032_0010837 3300049569 Bacteria 6561
690 Ga0501032_0012413 3300049569 Bacteria 6087
691 Ga0501033_0003732 3300049570 Bacteria 12392
692 Ga0501033_0023364 3300049570 Bacteria 4662
693 Ga0501034_0017043 3300049571 Bacteria 7449
694 Ga0501034_0064192 3300049571 Bacteria 3686
695 Ga0501036_0168935 3300049572 Bacteria 1843
696 Ga0501036_0170742 3300049572 Bacteria 1832
697 Ga0501037_0005052 3300049573 Bacteria 9600
698 Ga0501037_0028345 3300049573 Bacteria 4136
699 Ga0501037_0045419 3300049573 Bacteria 3225
700 Ga0501038_0007440 3300049574 Bacteria 10106
701 Ga0501038_0021514 3300049574 Bacteria 5787
702 Ga0501038_0076643 3300049574 Bacteria 2824
703 Ga0501038_0078114 3300049574 Bacteria 2793
704 Ga0501039_0065023 3300049575 Bacteria 2828
705 Ga0501039_0075724 3300049575 Bacteria 2616
706 Ga0501039_0145914 3300049575 Bacteria 1859
707 Ga0501041_0043287 3300049577 Bacteria 2737
708 Ga0501042_0064150 3300049578 Bacteria 2625
709 Ga0501042_0118757 3300049578 Bacteria 1903
710 Ga0501043_0000251 3300049579 Bacteria 48637
711 Ga0501043_0003880 3300049579 Bacteria 12273
712 Ga0501043_0045584 3300049579 Bacteria 3448
713 Ga0501046_0129748 3300049580 Bacteria 1912
714 Ga0501047_0000480 3300049581 Bacteria 43454
715 Ga0501047_0009581 3300049581 Bacteria 9154
716 Ga0501047_0192811 3300049581 Bacteria 1900
717 Ga0501047_0245663 3300049581 Bacteria 1639
718 Ga0501048_0020437 3300049582 Bacteria 4852
719 Ga0501048_0078033 3300049582 Bacteria 2337
720 Ga0501067_0019535 3300049583 Bacteria 3752
721 Ga0501067_0042504 3300049583 Bacteria 2523
722 Ga0501069_0017721 3300049585 Bacteria 3838
723 Ga0501069_0025858 3300049585 Bacteria 3211
724 Ga0501069_0196547 3300049585 Bacteria 1168
725 Ga0501070_0004158 3300049586 Bacteria 12451
726 Ga0501070_0121407 3300049586 Bacteria 2159
727 Ga0501072_0006969 3300049588 Bacteria 8577
728 Ga0501072_0037706 3300049588 Bacteria 3791
729 Ga0501072_0197017 3300049588 Bacteria 1606
730 Ga0501073_0083717 3300049589 Bacteria 2219
731 Ga0501073_0238014 3300049589 Bacteria 1257
732 Ga0501075_0011798 3300049591 Bacteria 6196
733 Ga0501076_0031681 3300049592 Bacteria 4126
734 Ga0501079_0042540 3300049741 Bacteria 3507
735 Ga0501080_0017082 3300049742 Bacteria 6702
736 Ga0501080_0019518 3300049742 Bacteria 6279
737 Ga0501080_0083287 3300049742 Bacteria 2971
738 Ga0501080_0112835 3300049742 Bacteria 2519
739 Ga0501080_0254928 3300049742 Bacteria 1599
740 Ga0501083_0002317 3300049744 Bacteria 13009
741 Ga0501083_0101074 3300049744 Bacteria 1901
742 Ga0501035_0006501 3300049822 Bacteria 10980
743 Ga0501035_0294088 3300049822 Bacteria 1370
744 Ga0501044_0006151 3300049823 Bacteria 13258
745 Ga0501044_0008552 3300049823 Bacteria 11218
746 Ga0501044_0096551 3300049823 Bacteria 2977
747 Ga0501044_0101218 3300049823 Bacteria 2899
748 Ga0501044_0122361 3300049823 Bacteria 2601
749 Ga0501044_0124729 3300049823 Bacteria 2573
750 nmdc:mga03n38_14619_c1 3300050490 Bacteria 3013
751 nmdc:mga00v17_34066_c1 3300050491 Bacteria 3022
752 nmdc:mga0yw44_95952_c1 3300050492 Bacteria 1882
753 nmdc:mga06z11_34133_c1 3300050494 Bacteria 2495
754 nmdc:mga06z11_87944_c1 3300050494 Bacteria 1681
755 nmdc:mga07m45_24279_c1 3300050496 Bacteria 3319
756 nmdc:mga07m45_36837_c1 3300050496 Bacteria 2726
757 nmdc:mga0n895_179615_c1 3300050512 Bacteria 2148
758 nmdc:mga0n895_7911_c1 3300050512 Bacteria 9163
759 nmdc:mga0n895_86222_c1 3300050512 Bacteria 3136
760 Ga0495601_0047589 3300053077 Bacteria 2700
761 Ga0495619_0103254 3300053085 Bacteria 1942
762 Ga0500583_0079399 3300053092 Bacteria 1583
763 Ga0500562_009706 3300053108 Bacteria 2434
764 Ga0500572_000411 3300053111 Bacteria 15062
765 Ga0500608_001603 3300053122 Bacteria 8120
766 Ga0500559_0000644 3300053136 Bacteria 23534
767 Ga0500559_0004658 3300053136 Bacteria 6462
768 Ga0500577_0001900 3300053142 Bacteria 5354
769 Ga0500630_001521 3300053159 Bacteria 11076
770 Ga0500638_005425 3300053162 Bacteria 5076
771 Ga0500639_000135 3300053163 Bacteria 35350
772 Ga0500639_017812 3300053163 Bacteria 3749
773 Ga0501084_0055145 3300054114 Bacteria 3325
774 Ga0501084_0066139 3300054114 Bacteria 3024
775 Ga0501084_0073128 3300054114 Bacteria 2871
776 Ga0501082_0002026 3300060353 Bacteria 17822
777 Ga0501082_0005794 3300060353 Bacteria 10725
778 Ga0501082_0014291 3300060353 Bacteria 6832
779 Ga0501082_0048340 3300060353 Bacteria 3666
780 2829748377 2829745981 Bacteria 5406054
781 2507507233 2507262055 Bacteria 8048963
782 2508541285 2508501009 Bacteria 7784016
783 2508693386 2508501042 Bacteria 8719808
784 2509080144 2508501114 Bacteria 7082538
785 2509148777 2508501128 Bacteria 8613869
786 2511395818 2511231028 Bacteria 8046582
787 2513592465 2513237087 Bacteria 5817514
788 2513626425 2513237092 Bacteria 8341956
789 2513652476 2513237095 Bacteria 8976980
790 2513657630 2513237096 Bacteria 8722461
791 2513677089 2513237098 Bacteria 9902361
792 2513693238 2513237101 Bacteria 7952346
793 2513705066 2513237102 Bacteria 7703324
794 2513862098 2513237137 Bacteria 9558895
795 2513876705 2513237139 Bacteria 8737671
796 2513919629 2513237145 Bacteria 8979722
797 2514012250 2513237161 Bacteria 8871253
798 2515628747 2515154112 Bacteria 8294334
799 2517104840 2517093001 Bacteria 9002274
800 2517895373 2517572143 Bacteria 9484767
801 2524440649 2524023205 Bacteria 8918781
802 2524467710 2524023210 Bacteria 9029266
803 2524540525 2524023228 Bacteria 10118060
804 2528853623 2528768022 Bacteria 10457665
805 2545676985 2545555834 Bacteria 8130841
806 2617347958 2617270735 Bacteria 9163226
807 2617377817 2617270741 Bacteria 8201522
808 2644168926 2643221629 Bacteria 5850260
809 2644289426 2643221651 Bacteria 4798932
810 2644347478 2643221662 Bacteria 5851492
811 2671120290 2667528175 Bacteria 7532676
812 2723848145 2721755755 Bacteria 8322773
813 2728750892 2728368998 Bacteria 8720350
814 2739350716 2738543031 Bacteria 5769731
815 2745077891 2744054633 Bacteria 8678936
816 2774872826 2773857925 Bacteria 6472445
817 2776261667 2775506901 Bacteria 9631051
818 2793069347 2791355197 Bacteria 8420563
819 2793078147
820 2805918685 2802429603 Bacteria 8777136
821 2818237023 2816332527 Bacteria 8933356
822 2835313252 2835312727 Bacteria 7413381
823 2861693706 2861691609 Bacteria 5628931
824 2882456927 2882456835 Bacteria 6863978
825 2894233923 2894232714 Bacteria 8834183
826 2904698712 2904690495 Bacteria 9412302
827 2932789418 2932784394 Bacteria 9704911
828 2932797758 2932794094 Bacteria 7915132
829 2932804276 2932801729 Bacteria 7987968
830 2932816467 2932809354 Bacteria 9135765
831 2932827195 2932818245 Bacteria 9955613
832 2932832025 2932828146 Bacteria 9745859
833 2933584761 2933577622 Bacteria 9116884
834 2935610389 2935608549 Bacteria 8203142
835 2935621964 2935616580 Bacteria 9032984
836 2935631109 2935630451 Bacteria 8169952
837 2935644026 2935638405 Bacteria 10015038
838 2935651365 2935648319 Bacteria 8801166
839 2935659545 2935656913 Bacteria 8965014
840 2935669059 2935665750 Bacteria 9571747
841 2935683383 2935675223 Bacteria 9928132
842 2935692323 2935684952 Bacteria 9590419
843 2935700505 2935694250 Bacteria 9291695
844 2935708866 2935703347 Bacteria 10242284
845 2935720439 2935713505 Bacteria 9608509
846 2935729720 2935722832 Bacteria 9608746
847 2935739298 2935732158 Bacteria 9706831
848 2935748161 2935741537 Bacteria 9707219
849 2935758364 2935750917 Bacteria 9590372
850 2935767442 2935760218 Bacteria 9817913
851 2935771077 2935769743 Bacteria 7878163
852 2935781245 2935777560 Bacteria 8077691
853 2935786222 2935785616 Bacteria 7962367
854 2935793981 2935793552 Bacteria 8012592
855 2935805775 2935801545 Bacteria 9301974
856 2935815667 2935810662 Bacteria 9401221
857 2935823550 2935819856 Bacteria 8261050
858 2935833278 2935827899 Bacteria 10038562
859 2935843146 2935837841 Bacteria 9454360
860 2935849075 2935847175 Bacteria 8228321
861 2935860211 2935855204 Bacteria 9035059
862 2935867608 2935864058 Bacteria 9784707
863 2935878582 2935873716 Bacteria 9632195
864 2935888302 2935883170 Bacteria 7964738
865 2935912836 2935908558 Bacteria 8568796
866 2935922845 2935916978 Bacteria 9113783
867 2935930270 2935926038 Bacteria 8601059
868 2935939171 2935934488 Bacteria 8602579
869 2935946118 2935942939 Bacteria 8599779
870 2935955455 2935951376 Bacteria 8602333
871 2935965282 2935959822 Bacteria 7869783
872 2935972174 2935967501 Bacteria 8603075
873 2935976099 2935975950 Bacteria 8347125
874 2935986407 2935984226 Bacteria 8302647
875 2935998141 2935992306 Bacteria 9802711
876 2936006841 2936002035 Bacteria 9362176
877 2936013960 2936011229 Bacteria 8801034
878 2936022516 2936019824 Bacteria 8804134
879 2936035565 2936028420 Bacteria 8965941
880 2936040905 2936037263 Bacteria 9446081
881 2936049066 2936046547 Bacteria 8903709
882 2936060356 2936055302 Bacteria 8785755
883 2940564268 2940556831 Bacteria 9590747
884 2941507761 2941507105 Bacteria 8166816
885 2941516187 2941515067 Bacteria 8166720
886 2941523104 2941523033 Bacteria 8169134
887 2941531654 2941531003 Bacteria 7653939
888 2941544692 2941538514 Bacteria 9402094
889 3003671840 3003665799 Bacteria 7279786
890 3005476965 3005474847 Bacteria 9259049
891 3005485650 3005483717 Bacteria 7877331
892 3005511591 3005506211 Bacteria 6943378
893 3005594474 3005587118 Bacteria 7794411
894 3005600821 3005594810 Bacteria 8716512
895 3005716233 3005710791 Bacteria 7622528
896 3005723611 3005718088 Bacteria 8283608
897 641641029 641522639 Bacteria 7737025
898 643599209 643348564 Bacteria 8839022
899 8001850309 8001845381 Bacteria 5804942
900 8006934455 8006933436 Bacteria 10410654
901 8006968920 8006964411 Bacteria 8966052
902 8006974425 8006973647 Bacteria 10679141
903 8006985199 8006984368 Bacteria 9651211
904 8007000890 8006994254 Bacteria 8309700
905 8016528055 8016522445 Bacteria 8156687
906 8016533177 8016530956 Bacteria 8155261
907 8016564061 8016557553 Bacteria 8154380
908 8016575751 8016575299 Bacteria 8154085
909 8016594940 8016583857 Bacteria 10421953
910 8016601769 8016595262 Bacteria 8149947
911 8016608485 8016603502 Bacteria 8731218
912 8016616385 8016613128 Bacteria 8794220
913 8016624751 8016622563 Bacteria 7999408
914 8017065412 8017057580 Bacteria 10023680
915 8019532975 8019530166 Bacteria 8155624
916 8019546873 8019538911 Bacteria 7872763
917 8019551792 8019547302 Bacteria 7996444
918 8019564228 8019555841 Bacteria 9642137
919 8019574308 8019565922 Bacteria 9639779
920 8019584805 8019576017 Bacteria 10049540
921 8019592752 8019586578 Bacteria 10212056
922 8019598693 8019597564 Bacteria 10041141
923 8019609677 8019608314 Bacteria 10042931
924 8019620269 8019619141 Bacteria 9218857
925 8019655595 8019648815 Bacteria 10014479
926 8019660692 8019659431 Bacteria 8577854
927 8019670106 8019668869 Bacteria 8791617
928 8019685988 8019678201 Bacteria 8863603
929 8019692148 8019687851 Bacteria 8712826
930 8055744603 8055742211 Bacteria 9226248
931 8056675952 8056673599 Bacteria 7871253
932 8056682207 8056681323 Bacteria 8472857
933 8056690359 8056689827 Bacteria 6712655
934 8056971886 8056967851 Bacteria 9038162
935 ARSoilYngRDRAFT_c00262
936 ARcpr5yngRDRAFT_c000410
937 ARSoilOldRDRAFT_c000163
938 ARSoilOldRDRAFT_c001504
939 ARCol0yngRDRAFT_1000276
940 JGI24739J22299_10000209
941 JGI24737J22298_10008663
942 JGI24737J22298_10028274
943 JGI24743J22301_10005489
944 JGI24748J21848_1003329
945 JGI24738J21930_10000520
946 JGI24744J21845_10001082
947 JGI24034J26672_10000769
948 JGI24742J22300_10001936
949 JGI24742J22300_10007211
950 JGI24751J29686_10016041
951 JGI25406J46586_10014105
952 JGI25153J46596_10004362
953 JGI26129J50193_1001490
954 Ga0055542_1003388
955 Ga0055531_10001950
956 JGI25405J52794_10001619
957 Ga0065165_1001570
958 Ga0065712_10078574
959 Ga0065715_10005127
960 Ga0065715_10093447
961 Ga0070676_10003190
962 Ga0070676_10011775
963 Ga0070676_10086982
964 Ga0070683_100009959
965 Ga0070683_100018569
966 Ga0070683_100120252
967 Ga0070690_100021672
968 Ga0070690_100043051
969 Ga0070690_100072075
970 Ga0070690_100104519
971 Ga0070670_100008185
972 Ga0070670_100081197
973 Ga0070677_10000109
974 Ga0068869_100000729
975 Ga0068869_100083556
976 Ga0070666_10010649
977 Ga0070666_10012981
978 Ga0070666_10112596
979 Ga0070680_100076082
980 Ga0070680_100146059
981 Ga0070680_100265593
982 Ga0070682_100000459
983 Ga0070682_100021137
984 Ga0068868_100000443
985 Ga0068868_100017966
986 Ga0068868_100084074
987 Ga0070660_100001113
988 Ga0070660_100009423
989 Ga0070689_100000423
990 Ga0070689_100074167
991 Ga0070689_100195808
992 Ga0070691_10001337
993 Ga0070691_10013427
994 Ga0070691_10046321
995 Ga0070687_100000851
996 Ga0070687_100025800
997 Ga0070687_100038078
998 Ga0070661_100003440
999 Ga0070661_100018051
1000 Ga0070692_10013172
1001 Ga0070692_10013687
1002 Ga0070668_100025701
1003 Ga0070668_100201595
1004 Ga0070668_100202098
1005 Ga0070669_100001552
1006 Ga0070669_100042432
1007 Ga0070669_100050939
1008 Ga0070669_100286396
1009 Ga0070675_100011646
1010 Ga0070675_100205049
1011 Ga0070671_100000889
1012 Ga0070671_100004731
1013 Ga0070671_100117185
1014 Ga0070671_100238220
1015 Ga0070674_100001251
1016 Ga0070674_100008867
1017 Ga0070674_100012692
1018 Ga0070673_100000050
1019 Ga0070673_100141213
1020 Ga0070688_100001813
1021 Ga0070688_100004548
1022 Ga0070688_100041335
1023 Ga0070688_100043306
1024 Ga0070688_100151520
1025 Ga0070659_100011380
1026 Ga0070659_100043607
1027 Ga0070659_100136608
1028 Ga0070667_100001872
1029 Ga0070667_100038258
1030 Ga0070667_100049643
1031 Ga0070709_10000525
1032 Ga0070709_10088719
1033 Ga0070714_100039245
1034 Ga0070714_100172671
1035 Ga0070714_100186847
1036 Ga0070713_100002218
1037 Ga0070713_100006229
1038 Ga0070713_100020864
1039 Ga0070713_100075589
1040 Ga0070713_100087367
1041 Ga0070713_100104124
1042 Ga0070713_100109412
1043 Ga0070710_10000635
1044 Ga0070710_10011579
1045 Ga0070710_10037299
1046 Ga0070710_10128956
1047 Ga0070710_10152704
1048 Ga0070701_10000093
1049 Ga0070701_10045104
1050 Ga0070701_10127992
1051 Ga0070711_100004210
1052 Ga0070711_100025068
1053 Ga0070711_100036564
1054 Ga0070711_100110943
1055 Ga0070705_100003661
1056 Ga0070700_100004285
1057 Ga0070700_100058962
1058 Ga0070700_100188668
1059 Ga0070694_100004866
1060 Ga0070694_100041729
1061 Ga0070694_100064828
1062 Ga0070663_100002633
1063 Ga0070663_100047211
1064 Ga0070663_100117061
1065 Ga0070663_100120842
1066 Ga0070663_100238191
1067 Ga0070678_100010551
1068 Ga0070678_100020541
1069 Ga0070678_100062839
1070 Ga0070678_100120174
1071 Ga0070678_100149033
1072 Ga0070678_100149391
1073 Ga0070662_100021063
1074 Ga0070662_100044031
1075 Ga0070662_100161953
1076 Ga0070681_10001623
1077 Ga0070681_10065290
1078 Ga0068867_100001138
1079 Ga0068867_100013132
1080 Ga0068867_100147037
1081 Ga0068867_100169018
1082 Ga0070685_10001254
1083 Ga0070685_10024925
1084 Ga0070685_10032155
1085 Ga0070685_10164042
1086 Ga0070707_100111151
1087 Ga0070679_100055033
1088 Ga0070679_100065552
1089 Ga0070679_100144536
1090 Ga0070679_100177560
1091 Ga0070684_100011442
1092 Ga0070684_100030528
1093 Ga0070684_100050160
1094 Ga0070684_100318971
1095 Ga0068853_100009153
1096 Ga0068853_100077959
1097 Ga0070672_100155583
1098 Ga0070686_100001868
1099 Ga0070686_100002806
1100 Ga0070686_100016931
1101 Ga0070686_100032561
1102 Ga0070686_100121068
1103 Ga0070695_100018566
1104 Ga0070695_100034489
1105 Ga0070695_100109198
1106 Ga0070696_100018921
1107 Ga0070696_100021024
1108 Ga0070696_100025251
1109 Ga0070696_100067689
1110 Ga0070693_100025096
1111 Ga0070665_100009621
1112 Ga0070665_100032380
1113 Ga0070665_100053068
1114 Ga0070665_100131953
1115 Ga0070704_100000970
1116 Ga0070704_100079559
1117 Ga0068855_100009019
1118 Ga0068855_100081242
1119 Ga0068855_100084736
1120 Ga0068855_100134563
1121 Ga0068855_100161011
1122 Ga0070664_100013823
1123 Ga0070664_100022104
1124 Ga0070664_100211796
1125 Ga0070664_100412190
1126 Ga0068857_100025388
1127 Ga0068857_100036560
1128 Ga0068857_100052885
1129 Ga0068857_100114218
1130 Ga0068854_100023018
1131 Ga0068854_100136141
1132 Ga0068856_100003821
1133 Ga0068856_100070183
1134 Ga0068856_100144726
1135 Ga0068856_100156405
1136 Ga0068856_100172012
1137 Ga0068856_100371798
1138 Ga0070702_100000497
1139 Ga0070702_100065933
1140 Ga0070702_100108090
1141 Ga0068852_100001222
1142 Ga0068852_100043163
1143 Ga0068852_100047920
1144 Ga0068859_100009942
1145 Ga0068859_100014942
1146 Ga0068864_100008385
1147 Ga0068866_10007896
1148 Ga0068866_10026422
1149 Ga0068866_10038874
1150 Ga0068866_10131713
1151 Ga0068861_100048566
1152 Ga0068861_100170931
1153 Ga0068861_100222418
1154 Ga0068861_100225740
1155 Ga0068870_10000051
1156 Ga0068870_10030865
1157 Ga0068870_10069194
1158 Ga0068863_100005913
1159 Ga0068863_100020698
1160 Ga0068858_100007984
1161 Ga0068858_100023725
1162 Ga0068858_100135051
1163 Ga0068858_100207925
1164 Ga0068860_100021096
1165 Ga0068860_100031898
1166 Ga0068860_100172660
1167 Ga0068860_100298602
1168 Ga0068860_100329578
1169 Ga0068862_100212012
1170 Ga0081455_10000081
1171 Ga0081455_10006845
1172 Ga0081455_10008003
1173 Ga0081455_10010270
1174 Ga0081455_10034931
1175 Ga0081455_10035553
1176 Ga0081455_10042591
1177 Ga0081538_10033224
1178 Ga0081538_10035779
1179 Ga0081540_1003048
1180 Ga0081540_1004585
1181 Ga0081540_1011726
1182 Ga0081540_1036983
1183 Ga0081540_1054345
1184 Ga0081540_1091720
1185 Ga0081539_10000003
1186 Ga0081539_10000306
1187 Ga0081539_10002527
1188 Ga0081539_10023760
1189 Ga0070717_10020052
1190 Ga0070717_10033974
1191 Ga0070717_10111478
1192 Ga0070717_10137306
1193 Ga0075365_10048156
1194 Ga0075365_10098902
1195 Ga0075365_10202259
1196 Ga0075363_100006875
1197 Ga0075363_100048854
1198 Ga0075363_100064238
1199 Ga0075363_100130261
1200 Ga0075364_10046435
1201 Ga0075364_10108963
1202 Ga0075364_10152018
1203 Ga0075364_10178925
1204 Ga0075432_10025053
1205 Ga0070715_10002070
1206 Ga0070715_10009060
1207 Ga0070715_10046025
1208 Ga0070716_100069879
1209 Ga0070716_100089258
1210 Ga0070712_100020258
1211 Ga0070712_100058109
1212 Ga0070712_100125157
1213 Ga0070712_100214678
1214 Ga0075362_10004304
1215 Ga0075362_10085689
1216 Ga0075367_10048054
1217 Ga0075367_10056191
1218 Ga0075367_10064177
1219 Ga0075366_10011174
1220 Ga0075366_10101753
1221 Ga0075366_10160938
1222 Ga0097621_100004220
1223 Ga0075370_10010077
1224 Ga0068871_100000576
1225 Ga0068871_100025203
1226 Ga0068871_100319663
1227 Ga0075428_100003920
1228 Ga0075428_100031029
1229 Ga0075428_100142622
1230 Ga0075428_100231714
1231 Ga0075428_100415260
1232 Ga0075430_100001133
1233 Ga0075431_100003810
1234 Ga0075431_100156439
1235 Ga0075431_100171226
1236 Ga0075433_10000012
1237 Ga0075434_100000310
1238 Ga0075434_100001837
1239 Ga0075434_100026003
1240 Ga0075434_100093858
1241 Ga0075434_100361430
1242 Ga0075434_100470295
1243 Ga0075429_100000098
1244 Ga0068865_100027909
1245 Ga0068865_100037048
1246 Ga0068865_100048077
1247 Ga0075436_100023283
1248 Ga0075436_100074113
1249 Ga0097620_100009942
1250 Ga0097620_100014943
1251 Ga0099824_1039060
1252 Ga0075435_100008925
1253 Ga0075435_100034077
1254 Ga0099795_10031576
1255 Ga0105243_10197405
1256 Ga0105238_10161699
1257 Ga0105239_10228911
1258 Ga0157372_10160573
1259 Ga0163163_10064912
1260 Ga0157379_10061381
1261 Ga0182005_1011719
1262 Ga0214544_1000136
1263 Ga0214544_1018524
1264 Ga0214542_1000127
1265 Ga0214542_1018644
1266 Ga0214545_1000063
1267 Ga0214545_1019592
1268 Ga0214543_1000238
1269 Ga0213872_10023985
1270 Ga0224572_1001293
1271 Ga0228598_1012243
1272 Ga0209148_1000529
1273 Ga0209233_1001938
1274 Ga0209233_1004282
1275 Ga0207666_1000294
1276 Ga0209455_1002870
1277 Ga0209455_1007449
1278 Ga0207673_1002060
1279 Ga0209025_1043885
1280 Ga0209564_1001218
1281 Ga0209564_1005756
1282 Ga0209564_1007436
1283 Ga0209758_1000011
1284 Ga0209758_1001693
1285 Ga0209758_1003535
1286 Ga0209758_1008617
1287 Ga0209758_1013315
1288 Ga0209256_1003503
1289 Ga0207426_1000669
1290 Ga0207426_1001272
1291 Ga0207697_10000883
1292 Ga0207653_10000546
1293 Ga0207682_10000072
1294 Ga0207682_10001384
1295 Ga0207682_10037916
1296 Ga0207692_10003747
1297 Ga0207692_10021564
1298 Ga0207692_10027919
1299 Ga0207692_10045881
1300 Ga0207692_10102421
1301 Ga0207642_10069634
1302 Ga0207710_10000558
1303 Ga0207710_10005750
1304 Ga0207710_10038320
1305 Ga0207710_10053989
1306 Ga0207688_10000329
1307 Ga0207688_10131982
1308 Ga0207680_10006444
1309 Ga0207680_10009603
1310 Ga0207680_10167041
1311 Ga0207647_10015267
1312 Ga0207647_10031280
1313 Ga0207647_10123830
1314 Ga0207685_10015324
1315 Ga0207685_10030348
1316 Ga0207699_10000365
1317 Ga0207699_10013113
1318 Ga0207699_10040973
1319 Ga0207699_10057605
1320 Ga0207699_10228019
1321 Ga0207645_10001534
1322 Ga0207645_10004741
1323 Ga0207645_10007080
1324 Ga0207645_10062196
1325 Ga0207645_10127541
1326 Ga0207643_10000004
1327 Ga0207643_10019880
1328 Ga0207643_10022650
1329 Ga0207705_10080762
1330 Ga0207705_10081108
1331 Ga0207705_10092910
1332 Ga0207684_10144485
1333 Ga0207654_10000955
1334 Ga0207654_10082892
1335 Ga0207707_10010417
1336 Ga0207707_10010719
1337 Ga0207707_10015930
1338 Ga0207707_10146806
1339 Ga0207695_10000503
1340 Ga0207695_10004855
1341 Ga0207695_10064111
1342 Ga0207695_10107255
1343 Ga0207695_10248230
1344 Ga0207671_10034616
1345 Ga0207671_10226531
1346 Ga0207671_10298324
1347 Ga0207693_10002261
1348 Ga0207693_10002741
1349 Ga0207693_10007535
1350 Ga0207693_10026950
1351 Ga0207693_10030079
1352 Ga0207693_10041528
1353 Ga0207663_10000475
1354 Ga0207663_10035092
1355 Ga0207663_10116096
1356 Ga0207660_10000648
1357 Ga0207660_10010766
1358 Ga0207662_10000456
1359 Ga0207662_10002036
1360 Ga0207662_10105458
1361 Ga0207662_10159625
1362 Ga0207657_10006593
1363 Ga0207657_10053057
1364 Ga0207657_10055350
1365 Ga0207657_10079802
1366 Ga0207657_10089683
1367 Ga0207649_10000262
1368 Ga0207652_10015412
1369 Ga0207652_10033984
1370 Ga0207652_10192779
1371 Ga0207652_10296856
1372 Ga0207681_10011215
1373 Ga0207681_10058168
1374 Ga0207681_10139073
1375 Ga0207694_10000212
1376 Ga0207694_10048000
1377 Ga0207694_10070063
1378 Ga0207694_10205909
1379 Ga0207694_10250255
1380 Ga0207650_10001947
1381 Ga0207650_10004313
1382 Ga0207650_10044435
1383 Ga0207650_10060788
1384 Ga0207650_10104966
1385 Ga0207650_10150120
1386 Ga0207650_10190838
1387 Ga0207650_10202118
1388 Ga0207659_10024061
1389 Ga0207659_10271542
1390 Ga0207687_10001501
1391 Ga0207687_10045360
1392 Ga0207687_10347868
1393 Ga0207700_10008558
1394 Ga0207700_10075285
1395 Ga0207700_10102193
1396 Ga0207700_10137441
1397 Ga0207700_10185057
1398 Ga0207700_10356952
1399 Ga0207664_10112106
1400 Ga0207664_10228326
1401 Ga0207664_10233159
1402 Ga0207644_10000467
1403 Ga0207644_10006439
1404 Ga0207644_10028393
1405 Ga0207644_10077145
1406 Ga0207644_10226352
1407 Ga0207690_10001228
1408 Ga0207690_10045739
1409 Ga0207690_10050277
1410 Ga0207690_10228713
1411 Ga0207690_10228871
1412 Ga0207706_10002789
1413 Ga0207706_10019343
1414 Ga0207706_10022888
1415 Ga0207706_10048120
1416 Ga0207686_10004704
1417 Ga0207686_10013214
1418 Ga0207686_10065671
1419 Ga0207709_10026810
1420 Ga0207709_10054126
1421 Ga0207709_10061406
1422 Ga0207670_10001648
1423 Ga0207670_10009649
1424 Ga0207670_10083388
1425 Ga0207669_10002049
1426 Ga0207669_10004490
1427 Ga0207704_10008504
1428 Ga0207704_10165715
1429 Ga0207704_10179743
1430 Ga0207665_10000090
1431 Ga0207665_10001035
1432 Ga0207665_10006306
1433 Ga0207665_10102671
1434 Ga0207665_10107032
1435 Ga0207665_10109983
1436 Ga0207691_10002658
1437 Ga0207691_10003654
1438 Ga0207691_10178715
1439 Ga0207711_10031583
1440 Ga0207711_10110870
1441 Ga0207711_10126796
1442 Ga0207689_10000203
1443 Ga0207689_10003505
1444 Ga0207689_10049085
1445 Ga0207661_10013912
1446 Ga0207661_10104692
1447 Ga0207661_10231752
1448 Ga0207679_10000157
1449 Ga0207679_10038719
1450 Ga0207679_10046306
1451 Ga0207679_10347724
1452 Ga0207667_10013999
1453 Ga0207667_10049063
1454 Ga0207667_10212568
1455 Ga0207667_10480259
1456 Ga0207651_10013916
1457 Ga0207651_10022606
1458 Ga0207712_10065223
1459 Ga0207668_10025801
1460 Ga0207668_10071074
1461 Ga0207640_10003255
1462 Ga0207640_10240971
1463 Ga0207658_10055835
1464 Ga0207658_10084461
1465 Ga0207658_10120018
1466 Ga0207677_10062746
1467 Ga0207677_10117118
1468 Ga0207677_10212642
1469 Ga0207677_10248932
1470 Ga0207703_10001346
1471 Ga0207703_10006480
1472 Ga0207703_10291949
1473 Ga0207639_10006466
1474 Ga0207639_10048698
1475 Ga0207639_10062377
1476 Ga0207639_10196447
1477 Ga0207678_10002498
1478 Ga0207678_10012062
1479 Ga0207678_10088787
1480 Ga0207678_10155535
1481 Ga0207708_10000784
1482 Ga0207708_10001393
1483 Ga0207702_10000003
1484 Ga0207702_10003404
1485 Ga0207702_10086432
1486 Ga0207702_10342313
1487 Ga0207641_10006340
1488 Ga0207641_10013359
1489 Ga0207648_10001783
1490 Ga0207648_10002310
1491 Ga0207648_10011313
1492 Ga0207648_10318318
1493 Ga0207676_10000990
1494 Ga0207676_10029007
1495 Ga0207674_10002887
1496 Ga0207674_10040792
1497 Ga0207674_10059413
1498 Ga0207675_100001741
1499 Ga0207675_100002594
1500 Ga0207683_10000824
1501 Ga0207683_10001176
1502 Ga0207683_10008180
1503 Ga0207683_10010994
1504 Ga0207683_10034926
1505 Ga0207683_10176200
1506 Ga0207683_10193163
1507 Ga0207698_10013372
1508 Ga0207698_10065776
1509 Ga0209389_1000088
1510 Ga0209589_1000007
1511 Ga0209589_1000189
1512 Ga0209489_100008
1513 Ga0209489_100085
1514 Ga0209700_100009
1515 Ga0209998_10003384
1516 Ga0207428_10000137
1517 Ga0207428_10011738
1518 Ga0268266_10001075
1519 Ga0268266_10002267
1520 Ga0268266_10014909
1521 Ga0268266_10036292
1522 Ga0268266_10046433
1523 Ga0268266_10183323
1524 Ga0268265_10002187
1525 Ga0268265_10093297
1526 Ga0268264_10000168
1527 Ga0268264_10020190
1528 Ga0268264_10266604
1529 Ga0265337_1018093
1530 Ga0265319_1026647
1531 Ga0265318_10014356
1532 Ga0265323_10004923
1533 Ga0265336_10000865
1534 Ga0307517_10000071
1535 Ga0265338_10000085
1536 Ga0265338_10117922
1537 Ga0307511_10053640
1538 Ga0265330_10037886
1539 Ga0265328_10000982
1540 Ga0265325_10000073
1541 Ga0265325_10000234
1542 Ga0265325_10012865
1543 Ga0265325_10047437
1544 Ga0265340_10013164
1545 Ga0265340_10041090
1546 Ga0265339_10002865
1547 Ga0265339_10004523
1548 Ga0265339_10016161
1549 Ga0265339_10057944
1550 Ga0265339_10069736
1551 Ga0265327_10035869
1552 Ga0265316_10040075
1553 Ga0307408_100205491
1554 Ga0265313_10003770
1555 Ga0265313_10025133
1556 Ga0265313_10026353
1557 Ga0265313_10079360
1558 Ga0307508_10000008
1559 Ga0307508_10055649
1560 Ga0307508_10212708
1561 Ga0265314_10006006
1562 Ga0265314_10023216
1563 Ga0265314_10038356
1564 Ga0265314_10040806
1565 Ga0265342_10000548
1566 Ga0265342_10011621
1567 Ga0307406_10057596
1568 Ga0307406_10161200
1569 Ga0307415_100129931
1570 Ga0307510_10200982
1571 Ga0315911_1000004
1572 Ga0373937_0005496
1573 Ga0373925_0210419
1574 Ga0395900_0001040
1575 Ga0395900_0035092
1576 Ga0395900_0174078
1577 Ga0436364_0053055
1578 Ga0395901_0157312
1579 Ga0436365_1081029
1580 Ga0436365_1440709
1581 Ga0436360_0084371
1582 Ga0436363_1162359
1583 Ga0436363_1274559
1584 Ga0466966_0016947
1585 Ga0466961_0000060
1586 Ga0466961_0223603
1587 Ga0466957_0019803
1588 Ga0466959_0010444
1589 Ga0466959_0053246
1590 Ga0466958_0049650
1591 Ga0495631_0079938
1592 Ga0495634_0153783
1593 Ga0496100_0006810
1594 Ga0496103_0039032
1595 Ga0496103_0163568
1596 Ga0496104_0022151
1597 Ga0496104_0148088
1598 Ga0496105_0000017
1599 Ga0496105_0085676
1600 Ga0496105_0192068
1601 Ga0496106_0089703
1602 Ga0496107_0076514
1603 Ga0496108_0018798
1604 Ga0496109_0208804
1605 Ga0496110_0065486
1606 Ga0496110_0194986
1607 Ga0496111_0013938
1608 Ga0496111_0122499
1609 Ga0496112_0032501
1610 Ga0496112_0194903
1611 Ga0496113_0138101
1612 Ga0496115_0147101
1613 Ga0496116_0077993
1614 Ga0496119_0001093
1615 Ga0496121_0010429
1616 Ga0496121_0080989
1617 Ga0496125_0057353
1618 Ga0496126_0025003
1619 Ga0496126_0169680
1620 Ga0496126_0283259
1621 Ga0501031_0012876
1622 Ga0501031_0019462
1623 Ga0501032_0010837
1624 Ga0501032_0012413
1625 Ga0501033_0003732
1626 Ga0501033_0023364
1627 Ga0501034_0017043
1628 Ga0501034_0064192
1629 Ga0501036_0168935
1630 Ga0501036_0170742
1631 Ga0501037_0005052
1632 Ga0501037_0028345
1633 Ga0501037_0045419
1634 Ga0501038_0007440
1635 Ga0501038_0021514
1636 Ga0501038_0076643
1637 Ga0501038_0078114
1638 Ga0501039_0065023
1639 Ga0501039_0075724
1640 Ga0501039_0145914
1641 Ga0501041_0043287
1642 Ga0501042_0064150
1643 Ga0501042_0118757
1644 Ga0501043_0000251
1645 Ga0501043_0003880
1646 Ga0501043_0045584
1647 Ga0501046_0129748
1648 Ga0501047_0000480
1649 Ga0501047_0009581
1650 Ga0501047_0192811
1651 Ga0501047_0245663
1652 Ga0501048_0020437
1653 Ga0501048_0078033
1654 Ga0501067_0019535
1655 Ga0501067_0042504
1656 Ga0501069_0017721
1657 Ga0501069_0025858
1658 Ga0501069_0196547
1659 Ga0501070_0004158
1660 Ga0501070_0121407
1661 Ga0501072_0006969
1662 Ga0501072_0037706
1663 Ga0501072_0197017
1664 Ga0501073_0083717
1665 Ga0501073_0238014
1666 Ga0501075_0011798
1667 Ga0501076_0031681
1668 Ga0501079_0042540
1669 Ga0501080_0017082
1670 Ga0501080_0019518
1671 Ga0501080_0083287
1672 Ga0501080_0112835
1673 Ga0501080_0254928
1674 Ga0501083_0002317
1675 Ga0501083_0101074
1676 Ga0501035_0006501
1677 Ga0501035_0294088
1678 Ga0501044_0006151
1679 Ga0501044_0008552
1680 Ga0501044_0096551
1681 Ga0501044_0101218
1682 Ga0501044_0122361
1683 Ga0501044_0124729
1684 nmdc:mga03n38_14619_c1
1685 nmdc:mga00v17_34066_c1
1686 nmdc:mga0yw44_95952_c1
1687 nmdc:mga06z11_34133_c1
1688 nmdc:mga06z11_87944_c1
1689 nmdc:mga07m45_24279_c1
1690 nmdc:mga07m45_36837_c1
1691 nmdc:mga0n895_179615_c1
1692 nmdc:mga0n895_7911_c1
1693 nmdc:mga0n895_86222_c1
1694 Ga0495601_0047589
1695 Ga0495619_0103254
1696 Ga0500583_0079399
1697 Ga0500562_009706
1698 Ga0500572_000411
1699 Ga0500608_001603
1700 Ga0500559_0000644
1701 Ga0500559_0004658
1702 Ga0500577_0001900
1703 Ga0500630_001521
1704 Ga0500638_005425
1705 Ga0500639_000135
1706 Ga0500639_017812
1707 Ga0501084_0055145
1708 Ga0501084_0066139
1709 Ga0501084_0073128
1710 Ga0501082_0002026
1711 Ga0501082_0005794
1712 Ga0501082_0014291
1713 Ga0501082_0048340
1714 2829748377
1715 2507507233
1716 2508541285
1717 2508693386
1718 2509080144
1719 2509148777
1720 2511395818
1721 2513592465
1722 2513626425
1723 2513652476
1724 2513657630
1725 2513677089
1726 2513693238
1727 2513705066
1728 2513862098
1729 2513876705
1730 2513919629
1731 2514012250
1732 2515628747
1733 2517104840
1734 2517895373
1735 2524440649
1736 2524467710
1737 2524540525
1738 2528853623
1739 2545676985
1740 2617347958
1741 2617377817
1742 2644168926
1743 2644289426
1744 2644347478
1745 2671120290
1746 2723848145
1747 2728750892
1748 2739350716
1749 2745077891
1750 2774872826
1751 2776261667
1752 2793069347
1753 2793078147
1754 2805918685
1755 2818237023
1756 2835313252
1757 2861693706
1758 2882456927
1759 2894233923
1760 2904698712
1761 2932789418
1762 2932797758
1763 2932804276
1764 2932816467
1765 2932827195
1766 2932832025
1767 2933584761
1768 2935610389
1769 2935621964
1770 2935631109
1771 2935644026
1772 2935651365
1773 2935659545
1774 2935669059
1775 2935683383
1776 2935692323
1777 2935700505
1778 2935708866
1779 2935720439
1780 2935729720
1781 2935739298
1782 2935748161
1783 2935758364
1784 2935767442
1785 2935771077
1786 2935781245
1787 2935786222
1788 2935793981
1789 2935805775
1790 2935815667
1791 2935823550
1792 2935833278
1793 2935843146
1794 2935849075
1795 2935860211
1796 2935867608
1797 2935878582
1798 2935888302
1799 2935912836
1800 2935922845
1801 2935930270
1802 2935939171
1803 2935946118
1804 2935955455
1805 2935965282
1806 2935972174
1807 2935976099
1808 2935986407
1809 2935998141
1810 2936006841
1811 2936013960
1812 2936022516
1813 2936035565
1814 2936040905
1815 2936049066
1816 2936060356
1817 2940564268
1818 2941507761
1819 2941516187
1820 2941523104
1821 2941531654
1822 2941544692
1823 3003671840
1824 3005476965
1825 3005485650
1826 3005511591
1827 3005594474
1828 3005600821
1829 3005716233
1830 3005723611
1831 641641029
1832 643599209
1833 8001850309
1834 8006934455
1835 8006968920
1836 8006974425
1837 8006985199
1838 8007000890
1839 8016528055
1840 8016533177
1841 8016564061
1842 8016575751
1843 8016594940
1844 8016601769
1845 8016608485
1846 8016616385
1847 8016624751
1848 8017065412
1849 8019532975
1850 8019546873
1851 8019551792
1852 8019564228
1853 8019574308
1854 8019584805
1855 8019592752
1856 8019598693
1857 8019609677
1858 8019620269
1859 8019655595
1860 8019660692
1861 8019670106
1862 8019685988
1863 8019692148
1864 8055744603
1865 8056675952
1866 8056682207
1867 8056690359
1868 8056971886

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01555

N6_N4_Mtase

DNA methylase

59

282

0.98

PF18755

RAMA

Restriction Enzyme Adenine Methylase Associated

289

393

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8s9n-assembly1.cif.gz_A-2 dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - c2 crystal form 0.8579 24 271
8s9o-assembly1.cif.gz_A dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form 0.8483 24 271
5hek-assembly2.cif.gz_C crystal structure of m1.hpyavi 0.8469 23 267
1g60-assembly1.cif.gz_B crystal structure of methyltransferase mboiia (moraxella bovis) 0.8455 24 269
5hfj-assembly3.cif.gz_D crystal structure of m1.hpyavi-sam complex 0.8442 23 266
ID Description Score Start End Superfamily
1g60B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8455 24 269 3.40.50.150
af_Q4E4W2_8_255_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8432 221 266 3.40.50.150
3tm4B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8356 26 158 3.40.50.150
1g60B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8243 24 269 3.40.50.150
3tmaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.822 26 158 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A850NR23-F1-model_v4 RAMA domain-containing protein 0.9727 292 374
AF-A0A2N3C8Q8-F1-model_v4 Modification methylase 0.9628 287 376 GO:0008168
GO:0032259
AF-A0A435UNH2-F1-model_v4 Modification methylase 0.9601 292 379 GO:0008168
GO:0032259
AF-A0A435UNH2-F1-model_v4 Modification methylase 0.9394 292 379 GO:0008168
GO:0032259
AF-A0A5A7NKG5-F1-model_v4 RAMA domain-containing protein 0.9355 297 375

Map