F486142
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 934 | 475 | 1868 | 377 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2829745981|2829748377 |
| Length | 393 |
| Sequence | RTAVAGATARKQVSHTGRIASAPRMGLAPSVQRLPRLPLDEILIGDCIAAMERLPAESVDCVFADPPYNLQLGEAGLTRPDHSVVDAVDDDWDKFSSFEAYDDFTRAWLKAARRAMKPNATLWVIGSYHNIFRVGSALQDLGYWILNDIVWRKANPMPNFRGKRFTNAHETLIWASRSPQAKYTFHYDALKAGNEDLQMRSDWFLPLCTGEERLKDGAGRKVHPTQKPEALVARTLMAATNPGDVVLDPFFGSGTTGAVAKRLGRHFIGCERDKTYAAAAQARIDAVETLSSASLALATPKRAEPRVPFLSVVEAGLVRPGETLTDERRRFKATVRPDGQLGIGPAMGSIHKVGALVQGLPACNGWTFWHAERGGKLVCIDEFRSQMRARAES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 128 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 129 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 130 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 133 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 134 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 227 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 240 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 241 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 242 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 306 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 311 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 312 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 313 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 315 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 316 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 317 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 318 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 322 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 323 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 324 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 325 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 326 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 327 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 328 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 329 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 330 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 331 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 332 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 333 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 334 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 335 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 336 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 337 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 338 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 339 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 340 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 341 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 342 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 343 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 344 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 345 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 346 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 347 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 348 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 349 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 350 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 351 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 352 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 353 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 354 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 355 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 356 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 357 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 358 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 359 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 360 | 2791355199 | |||
| 361 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 362 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 363 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 364 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 365 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 366 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 367 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 368 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 369 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 370 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 371 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 372 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 373 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 374 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 375 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 376 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 377 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 378 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 379 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 380 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 381 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 382 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 383 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 384 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 385 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 386 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 387 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 388 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 389 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 390 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 391 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 392 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 393 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 394 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 395 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 396 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 397 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 398 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 399 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 400 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 401 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 402 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 403 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 404 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 405 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 406 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 407 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 408 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 409 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 410 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 411 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 412 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 413 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 414 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 415 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 416 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 417 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 418 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 419 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 420 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 421 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 422 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 423 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 424 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 425 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 426 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 427 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 428 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 429 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 430 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 431 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 432 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 433 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 434 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 435 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 436 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 437 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 438 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 439 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 440 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 441 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 442 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 443 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 444 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 445 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 446 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 447 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 448 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 449 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 450 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 451 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 452 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 453 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 454 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 455 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 456 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 457 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 458 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 459 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 460 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 461 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 462 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 463 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 464 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 465 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 466 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 467 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 468 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 469 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 470 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 471 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 472 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 473 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 474 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 475 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.49 |
| Metatranscriptomes | 0 |
| Isolates | 16.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.32 |
| Nodule | 15.95 |
| Rhizoplane | 2.25 |
| Rhizosphere | 71.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilYngRDRAFT_c00262 | 3300000042 | Bacteria | 8106 |
| 2 | ARcpr5yngRDRAFT_c000410 | 3300000043 | Bacteria | 5625 |
| 3 | ARSoilOldRDRAFT_c000163 | 3300000044 | Bacteria | 11284 |
| 4 | ARSoilOldRDRAFT_c001504 | 3300000044 | Bacteria | 2164 |
| 5 | ARCol0yngRDRAFT_1000276 | 3300000652 | Bacteria | 8111 |
| 6 | JGI24739J22299_10000209 | 3300001989 | Bacteria | 19461 |
| 7 | JGI24737J22298_10008663 | 3300001990 | Bacteria | 3400 |
| 8 | JGI24737J22298_10028274 | 3300001990 | Bacteria | 1763 |
| 9 | JGI24743J22301_10005489 | 3300001991 | Bacteria | 2120 |
| 10 | JGI24748J21848_1003329 | 3300002074 | Bacteria | 1833 |
| 11 | JGI24738J21930_10000520 | 3300002075 | Bacteria | 10976 |
| 12 | JGI24744J21845_10001082 | 3300002077 | Bacteria | 5276 |
| 13 | JGI24034J26672_10000769 | 3300002239 | Bacteria | 4137 |
| 14 | JGI24742J22300_10001936 | 3300002244 | Bacteria | 3297 |
| 15 | JGI24742J22300_10007211 | 3300002244 | Bacteria | 1833 |
| 16 | JGI24751J29686_10016041 | 3300002459 | Bacteria | 1545 |
| 17 | JGI25406J46586_10014105 | 3300003203 | Bacteria | 3406 |
| 18 | JGI25153J46596_10004362 | 3300003215 | Bacteria | 7635 |
| 19 | JGI26129J50193_1001490 | 3300003349 | Bacteria | 1595 |
| 20 | Ga0055542_1003388 | 3300003762 | Bacteria | 4346 |
| 21 | Ga0055531_10001950 | 3300003794 | Bacteria | 14425 |
| 22 | JGI25405J52794_10001619 | 3300003911 | Bacteria | 3734 |
| 23 | Ga0065165_1001570 | 3300005262 | Bacteria | 23574 |
| 24 | Ga0065712_10078574 | 3300005290 | Bacteria | 3329 |
| 25 | Ga0065715_10005127 | 3300005293 | Bacteria | 4022 |
| 26 | Ga0065715_10093447 | 3300005293 | Bacteria | 4678 |
| 27 | Ga0070676_10003190 | 3300005328 | Bacteria | 8502 |
| 28 | Ga0070676_10011775 | 3300005328 | Bacteria | 4761 |
| 29 | Ga0070676_10086982 | 3300005328 | Bacteria | 1907 |
| 30 | Ga0070683_100009959 | 3300005329 | Bacteria | 8151 |
| 31 | Ga0070683_100018569 | 3300005329 | Bacteria | 6163 |
| 32 | Ga0070683_100120252 | 3300005329 | Bacteria | 2481 |
| 33 | Ga0070690_100021672 | 3300005330 | Bacteria | 3925 |
| 34 | Ga0070690_100043051 | 3300005330 | Bacteria | 2862 |
| 35 | Ga0070690_100072075 | 3300005330 | Bacteria | 2245 |
| 36 | Ga0070690_100104519 | 3300005330 | Bacteria | 1881 |
| 37 | Ga0070670_100008185 | 3300005331 | Bacteria | 8903 |
| 38 | Ga0070670_100081197 | 3300005331 | Bacteria | 2786 |
| 39 | Ga0070677_10000109 | 3300005333 | Bacteria | 26990 |
| 40 | Ga0068869_100000729 | 3300005334 | Bacteria | 18701 |
| 41 | Ga0068869_100083556 | 3300005334 | Bacteria | 2388 |
| 42 | Ga0070666_10010649 | 3300005335 | Bacteria | 5757 |
| 43 | Ga0070666_10012981 | 3300005335 | Bacteria | 5273 |
| 44 | Ga0070666_10112596 | 3300005335 | Bacteria | 1882 |
| 45 | Ga0070680_100076082 | 3300005336 | Bacteria | 2763 |
| 46 | Ga0070680_100146059 | 3300005336 | Bacteria | 1984 |
| 47 | Ga0070680_100265593 | 3300005336 | Bacteria | 1452 |
| 48 | Ga0070682_100000459 | 3300005337 | Bacteria | 25698 |
| 49 | Ga0070682_100021137 | 3300005337 | Bacteria | 3835 |
| 50 | Ga0068868_100000443 | 3300005338 | Bacteria | 27815 |
| 51 | Ga0068868_100017966 | 3300005338 | Bacteria | 5278 |
| 52 | Ga0068868_100084074 | 3300005338 | Bacteria | 2556 |
| 53 | Ga0070660_100001113 | 3300005339 | Bacteria | 18130 |
| 54 | Ga0070660_100009423 | 3300005339 | Bacteria | 6867 |
| 55 | Ga0070689_100000423 | 3300005340 | Bacteria | 24943 |
| 56 | Ga0070689_100074167 | 3300005340 | Bacteria | 2662 |
| 57 | Ga0070689_100195808 | 3300005340 | Bacteria | 1647 |
| 58 | Ga0070691_10001337 | 3300005341 | Bacteria | 10491 |
| 59 | Ga0070691_10013427 | 3300005341 | Bacteria | 3750 |
| 60 | Ga0070691_10046321 | 3300005341 | Bacteria | 2065 |
| 61 | Ga0070687_100000851 | 3300005343 | Bacteria | 10218 |
| 62 | Ga0070687_100025800 | 3300005343 | Bacteria | 2824 |
| 63 | Ga0070687_100038078 | 3300005343 | Bacteria | 2408 |
| 64 | Ga0070661_100003440 | 3300005344 | Bacteria | 10933 |
| 65 | Ga0070661_100018051 | 3300005344 | Bacteria | 5012 |
| 66 | Ga0070692_10013172 | 3300005345 | Bacteria | 3849 |
| 67 | Ga0070692_10013687 | 3300005345 | Bacteria | 3789 |
| 68 | Ga0070668_100025701 | 3300005347 | Bacteria | 4466 |
| 69 | Ga0070668_100201595 | 3300005347 | Bacteria | 1633 |
| 70 | Ga0070668_100202098 | 3300005347 | Bacteria | 1631 |
| 71 | Ga0070669_100001552 | 3300005353 | Bacteria | 16619 |
| 72 | Ga0070669_100042432 | 3300005353 | Bacteria | 3310 |
| 73 | Ga0070669_100050939 | 3300005353 | Bacteria | 3025 |
| 74 | Ga0070669_100286396 | 3300005353 | Bacteria | 1321 |
| 75 | Ga0070675_100011646 | 3300005354 | Bacteria | 6891 |
| 76 | Ga0070675_100205049 | 3300005354 | Bacteria | 1712 |
| 77 | Ga0070671_100000889 | 3300005355 | Bacteria | 21815 |
| 78 | Ga0070671_100004731 | 3300005355 | Bacteria | 10809 |
| 79 | Ga0070671_100117185 | 3300005355 | Bacteria | 2239 |
| 80 | Ga0070671_100238220 | 3300005355 | Bacteria | 1545 |
| 81 | Ga0070674_100001251 | 3300005356 | Bacteria | 13361 |
| 82 | Ga0070674_100008867 | 3300005356 | Bacteria | 6004 |
| 83 | Ga0070674_100012692 | 3300005356 | Bacteria | 5180 |
| 84 | Ga0070673_100000050 | 3300005364 | Bacteria | 49499 |
| 85 | Ga0070673_100141213 | 3300005364 | Bacteria | 2031 |
| 86 | Ga0070688_100001813 | 3300005365 | Bacteria | 10708 |
| 87 | Ga0070688_100004548 | 3300005365 | Bacteria | 7232 |
| 88 | Ga0070688_100041335 | 3300005365 | Bacteria | 2829 |
| 89 | Ga0070688_100043306 | 3300005365 | Bacteria | 2773 |
| 90 | Ga0070688_100151520 | 3300005365 | Bacteria | 1586 |
| 91 | Ga0070659_100011380 | 3300005366 | Bacteria | 6580 |
| 92 | Ga0070659_100043607 | 3300005366 | Bacteria | 3508 |
| 93 | Ga0070659_100136608 | 3300005366 | Bacteria | 1994 |
| 94 | Ga0070667_100001872 | 3300005367 | Bacteria | 18695 |
| 95 | Ga0070667_100038258 | 3300005367 | Bacteria | 4022 |
| 96 | Ga0070667_100049643 | 3300005367 | Bacteria | 3534 |
| 97 | Ga0070709_10000525 | 3300005434 | Bacteria | 22547 |
| 98 | Ga0070709_10088719 | 3300005434 | Bacteria | 2035 |
| 99 | Ga0070714_100039245 | 3300005435 | Bacteria | 3985 |
| 100 | Ga0070714_100172671 | 3300005435 | Bacteria | 1963 |
| 101 | Ga0070714_100186847 | 3300005435 | Bacteria | 1888 |
| 102 | Ga0070713_100002218 | 3300005436 | Bacteria | 12588 |
| 103 | Ga0070713_100006229 | 3300005436 | Bacteria | 8256 |
| 104 | Ga0070713_100020864 | 3300005436 | Bacteria | 5030 |
| 105 | Ga0070713_100075589 | 3300005436 | Bacteria | 2857 |
| 106 | Ga0070713_100087367 | 3300005436 | Bacteria | 2674 |
| 107 | Ga0070713_100104124 | 3300005436 | Bacteria | 2463 |
| 108 | Ga0070713_100109412 | 3300005436 | Bacteria | 2408 |
| 109 | Ga0070710_10000635 | 3300005437 | Bacteria | 16717 |
| 110 | Ga0070710_10011579 | 3300005437 | Bacteria | 4361 |
| 111 | Ga0070710_10037299 | 3300005437 | Bacteria | 2662 |
| 112 | Ga0070710_10128956 | 3300005437 | Bacteria | 1540 |
| 113 | Ga0070710_10152704 | 3300005437 | Bacteria | 1425 |
| 114 | Ga0070701_10000093 | 3300005438 | Bacteria | 25004 |
| 115 | Ga0070701_10045104 | 3300005438 | Bacteria | 2261 |
| 116 | Ga0070701_10127992 | 3300005438 | Bacteria | 1439 |
| 117 | Ga0070711_100004210 | 3300005439 | Bacteria | 8454 |
| 118 | Ga0070711_100025068 | 3300005439 | Bacteria | 3898 |
| 119 | Ga0070711_100036564 | 3300005439 | Bacteria | 3290 |
| 120 | Ga0070711_100110943 | 3300005439 | Bacteria | 2013 |
| 121 | Ga0070705_100003661 | 3300005440 | Bacteria | 7526 |
| 122 | Ga0070700_100004285 | 3300005441 | Bacteria | 7447 |
| 123 | Ga0070700_100058962 | 3300005441 | Bacteria | 2414 |
| 124 | Ga0070700_100188668 | 3300005441 | Bacteria | 1440 |
| 125 | Ga0070694_100004866 | 3300005444 | Bacteria | 8087 |
| 126 | Ga0070694_100041729 | 3300005444 | Bacteria | 3062 |
| 127 | Ga0070694_100064828 | 3300005444 | Bacteria | 2501 |
| 128 | Ga0070663_100002633 | 3300005455 | Bacteria | 10158 |
| 129 | Ga0070663_100047211 | 3300005455 | Bacteria | 3050 |
| 130 | Ga0070663_100117061 | 3300005455 | Bacteria | 2009 |
| 131 | Ga0070663_100120842 | 3300005455 | Bacteria | 1978 |
| 132 | Ga0070663_100238191 | 3300005455 | Bacteria | 1435 |
| 133 | Ga0070678_100010551 | 3300005456 | Bacteria | 5651 |
| 134 | Ga0070678_100020541 | 3300005456 | Bacteria | 4335 |
| 135 | Ga0070678_100062839 | 3300005456 | Bacteria | 2744 |
| 136 | Ga0070678_100120174 | 3300005456 | Bacteria | 2070 |
| 137 | Ga0070678_100149033 | 3300005456 | Bacteria | 1882 |
| 138 | Ga0070678_100149391 | 3300005456 | Bacteria | 1880 |
| 139 | Ga0070662_100021063 | 3300005457 | Bacteria | 4447 |
| 140 | Ga0070662_100044031 | 3300005457 | Bacteria | 3196 |
| 141 | Ga0070662_100161953 | 3300005457 | Bacteria | 1750 |
| 142 | Ga0070681_10001623 | 3300005458 | Bacteria | 20035 |
| 143 | Ga0070681_10065290 | 3300005458 | Bacteria | 3608 |
| 144 | Ga0068867_100001138 | 3300005459 | Bacteria | 18176 |
| 145 | Ga0068867_100013132 | 3300005459 | Bacteria | 5864 |
| 146 | Ga0068867_100147037 | 3300005459 | Bacteria | 1848 |
| 147 | Ga0068867_100169018 | 3300005459 | Bacteria | 1730 |
| 148 | Ga0070685_10001254 | 3300005466 | Bacteria | 13468 |
| 149 | Ga0070685_10024925 | 3300005466 | Bacteria | 3289 |
| 150 | Ga0070685_10032155 | 3300005466 | Bacteria | 2937 |
| 151 | Ga0070685_10164042 | 3300005466 | Bacteria | 1418 |
| 152 | Ga0070707_100111151 | 3300005468 | Bacteria | 2657 |
| 153 | Ga0070679_100055033 | 3300005530 | Bacteria | 3962 |
| 154 | Ga0070679_100065552 | 3300005530 | Bacteria | 3620 |
| 155 | Ga0070679_100144536 | 3300005530 | Bacteria | 2357 |
| 156 | Ga0070679_100177560 | 3300005530 | Bacteria | 2102 |
| 157 | Ga0070684_100011442 | 3300005535 | Bacteria | 7068 |
| 158 | Ga0070684_100030528 | 3300005535 | Bacteria | 4579 |
| 159 | Ga0070684_100050160 | 3300005535 | Bacteria | 3624 |
| 160 | Ga0070684_100318971 | 3300005535 | Bacteria | 1427 |
| 161 | Ga0068853_100009153 | 3300005539 | Bacteria | 7976 |
| 162 | Ga0068853_100077959 | 3300005539 | Bacteria | 2895 |
| 163 | Ga0070672_100155583 | 3300005543 | Bacteria | 1893 |
| 164 | Ga0070686_100001868 | 3300005544 | Bacteria | 11736 |
| 165 | Ga0070686_100002806 | 3300005544 | Bacteria | 9592 |
| 166 | Ga0070686_100016931 | 3300005544 | Bacteria | 4249 |
| 167 | Ga0070686_100032561 | 3300005544 | Bacteria | 3197 |
| 168 | Ga0070686_100121068 | 3300005544 | Bacteria | 1797 |
| 169 | Ga0070695_100018566 | 3300005545 | Bacteria | 4224 |
| 170 | Ga0070695_100034489 | 3300005545 | Bacteria | 3173 |
| 171 | Ga0070695_100109198 | 3300005545 | Bacteria | 1874 |
| 172 | Ga0070696_100018921 | 3300005546 | Bacteria | 4662 |
| 173 | Ga0070696_100021024 | 3300005546 | Bacteria | 4423 |
| 174 | Ga0070696_100025251 | 3300005546 | Bacteria | 4038 |
| 175 | Ga0070696_100067689 | 3300005546 | Bacteria | 2506 |
| 176 | Ga0070693_100025096 | 3300005547 | Bacteria | 3205 |
| 177 | Ga0070665_100009621 | 3300005548 | Bacteria | 9777 |
| 178 | Ga0070665_100032380 | 3300005548 | Bacteria | 5261 |
| 179 | Ga0070665_100053068 | 3300005548 | Bacteria | 4066 |
| 180 | Ga0070665_100131953 | 3300005548 | Bacteria | 2500 |
| 181 | Ga0070704_100000970 | 3300005549 | Bacteria | 14563 |
| 182 | Ga0070704_100079559 | 3300005549 | Bacteria | 2408 |
| 183 | Ga0068855_100009019 | 3300005563 | Bacteria | 12054 |
| 184 | Ga0068855_100081242 | 3300005563 | Bacteria | 3757 |
| 185 | Ga0068855_100084736 | 3300005563 | Bacteria | 3668 |
| 186 | Ga0068855_100134563 | 3300005563 | Bacteria | 2820 |
| 187 | Ga0068855_100161011 | 3300005563 | Bacteria | 2547 |
| 188 | Ga0070664_100013823 | 3300005564 | Bacteria | 6580 |
| 189 | Ga0070664_100022104 | 3300005564 | Bacteria | 5245 |
| 190 | Ga0070664_100211796 | 3300005564 | Bacteria | 1732 |
| 191 | Ga0070664_100412190 | 3300005564 | Bacteria | 1236 |
| 192 | Ga0068857_100025388 | 3300005577 | Bacteria | 5217 |
| 193 | Ga0068857_100036560 | 3300005577 | Bacteria | 4351 |
| 194 | Ga0068857_100052885 | 3300005577 | Bacteria | 3602 |
| 195 | Ga0068857_100114218 | 3300005577 | Bacteria | 2428 |
| 196 | Ga0068854_100023018 | 3300005578 | Bacteria | 4252 |
| 197 | Ga0068854_100136141 | 3300005578 | Bacteria | 1880 |
| 198 | Ga0068856_100003821 | 3300005614 | Bacteria | 15095 |
| 199 | Ga0068856_100070183 | 3300005614 | Bacteria | 3465 |
| 200 | Ga0068856_100144726 | 3300005614 | Bacteria | 2384 |
| 201 | Ga0068856_100156405 | 3300005614 | Bacteria | 2290 |
| 202 | Ga0068856_100172012 | 3300005614 | Bacteria | 2178 |
| 203 | Ga0068856_100371798 | 3300005614 | Bacteria | 1448 |
| 204 | Ga0070702_100000497 | 3300005615 | Bacteria | 14109 |
| 205 | Ga0070702_100065933 | 3300005615 | Bacteria | 2122 |
| 206 | Ga0070702_100108090 | 3300005615 | Bacteria | 1719 |
| 207 | Ga0068852_100001222 | 3300005616 | Bacteria | 17091 |
| 208 | Ga0068852_100043163 | 3300005616 | Bacteria | 3823 |
| 209 | Ga0068852_100047920 | 3300005616 | Bacteria | 3649 |
| 210 | Ga0068859_100009942 | 3300005617 | Bacteria | 9597 |
| 211 | Ga0068859_100014942 | 3300005617 | Bacteria | 7793 |
| 212 | Ga0068864_100008385 | 3300005618 | Bacteria | 8527 |
| 213 | Ga0068866_10007896 | 3300005718 | Bacteria | 4466 |
| 214 | Ga0068866_10026422 | 3300005718 | Bacteria | 2741 |
| 215 | Ga0068866_10038874 | 3300005718 | Bacteria | 2346 |
| 216 | Ga0068866_10131713 | 3300005718 | Bacteria | 1423 |
| 217 | Ga0068861_100048566 | 3300005719 | Bacteria | 3209 |
| 218 | Ga0068861_100170931 | 3300005719 | Bacteria | 1801 |
| 219 | Ga0068861_100222418 | 3300005719 | Bacteria | 1596 |
| 220 | Ga0068861_100225740 | 3300005719 | Bacteria | 1585 |
| 221 | Ga0068870_10000051 | 3300005840 | Bacteria | 36782 |
| 222 | Ga0068870_10030865 | 3300005840 | Bacteria | 2711 |
| 223 | Ga0068870_10069194 | 3300005840 | Bacteria | 1920 |
| 224 | Ga0068863_100005913 | 3300005841 | Bacteria | 11997 |
| 225 | Ga0068863_100020698 | 3300005841 | Bacteria | 6283 |
| 226 | Ga0068858_100007984 | 3300005842 | Bacteria | 10202 |
| 227 | Ga0068858_100023725 | 3300005842 | Bacteria | 5715 |
| 228 | Ga0068858_100135051 | 3300005842 | Bacteria | 2314 |
| 229 | Ga0068858_100207925 | 3300005842 | Bacteria | 1852 |
| 230 | Ga0068860_100021096 | 3300005843 | Bacteria | 6309 |
| 231 | Ga0068860_100031898 | 3300005843 | Bacteria | 5065 |
| 232 | Ga0068860_100172660 | 3300005843 | Bacteria | 2088 |
| 233 | Ga0068860_100298602 | 3300005843 | Bacteria | 1577 |
| 234 | Ga0068860_100329578 | 3300005843 | Bacteria | 1499 |
| 235 | Ga0068862_100212012 | 3300005844 | Bacteria | 1750 |
| 236 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 237 | Ga0081455_10006845 | 3300005937 | Bacteria | 12146 |
| 238 | Ga0081455_10008003 | 3300005937 | Bacteria | 11048 |
| 239 | Ga0081455_10010270 | 3300005937 | Bacteria | 9519 |
| 240 | Ga0081455_10034931 | 3300005937 | Bacteria | 4500 |
| 241 | Ga0081455_10035553 | 3300005937 | Bacteria | 4449 |
| 242 | Ga0081455_10042591 | 3300005937 | Bacteria | 3980 |
| 243 | Ga0081538_10033224 | 3300005981 | Bacteria | 3438 |
| 244 | Ga0081538_10035779 | 3300005981 | Bacteria | 3255 |
| 245 | Ga0081540_1003048 | 3300005983 | Bacteria | 13423 |
| 246 | Ga0081540_1004585 | 3300005983 | Bacteria | 10467 |
| 247 | Ga0081540_1011726 | 3300005983 | Bacteria | 5834 |
| 248 | Ga0081540_1036983 | 3300005983 | Bacteria | 2594 |
| 249 | Ga0081540_1054345 | 3300005983 | Bacteria | 1958 |
| 250 | Ga0081540_1091720 | 3300005983 | Bacteria | 1335 |
| 251 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 252 | Ga0081539_10000306 | 3300005985 | Bacteria | 110402 |
| 253 | Ga0081539_10002527 | 3300005985 | Bacteria | 25540 |
| 254 | Ga0081539_10023760 | 3300005985 | Bacteria | 4004 |
| 255 | Ga0070717_10020052 | 3300006028 | Bacteria | 5253 |
| 256 | Ga0070717_10033974 | 3300006028 | Bacteria | 4118 |
| 257 | Ga0070717_10111478 | 3300006028 | Bacteria | 2334 |
| 258 | Ga0070717_10137306 | 3300006028 | Bacteria | 2107 |
| 259 | Ga0075365_10048156 | 3300006038 | Bacteria | 2804 |
| 260 | Ga0075365_10098902 | 3300006038 | Bacteria | 1996 |
| 261 | Ga0075365_10202259 | 3300006038 | Bacteria | 1391 |
| 262 | Ga0075363_100006875 | 3300006048 | Bacteria | 5199 |
| 263 | Ga0075363_100048854 | 3300006048 | Bacteria | 2251 |
| 264 | Ga0075363_100064238 | 3300006048 | Bacteria | 1983 |
| 265 | Ga0075363_100130261 | 3300006048 | Bacteria | 1410 |
| 266 | Ga0075364_10046435 | 3300006051 | Bacteria | 2828 |
| 267 | Ga0075364_10108963 | 3300006051 | Bacteria | 1847 |
| 268 | Ga0075364_10152018 | 3300006051 | Bacteria | 1560 |
| 269 | Ga0075364_10178925 | 3300006051 | Bacteria | 1434 |
| 270 | Ga0075432_10025053 | 3300006058 | Bacteria | 2046 |
| 271 | Ga0070715_10002070 | 3300006163 | Bacteria | 6053 |
| 272 | Ga0070715_10009060 | 3300006163 | Bacteria | 3494 |
| 273 | Ga0070715_10046025 | 3300006163 | Bacteria | 1853 |
| 274 | Ga0070716_100069879 | 3300006173 | Bacteria | 2060 |
| 275 | Ga0070716_100089258 | 3300006173 | Bacteria | 1861 |
| 276 | Ga0070712_100020258 | 3300006175 | Bacteria | 4351 |
| 277 | Ga0070712_100058109 | 3300006175 | Bacteria | 2720 |
| 278 | Ga0070712_100125157 | 3300006175 | Bacteria | 1940 |
| 279 | Ga0070712_100214678 | 3300006175 | Bacteria | 1519 |
| 280 | Ga0075362_10004304 | 3300006177 | Bacteria | 5091 |
| 281 | Ga0075362_10085689 | 3300006177 | Bacteria | 1457 |
| 282 | Ga0075367_10048054 | 3300006178 | Bacteria | 2512 |
| 283 | Ga0075367_10056191 | 3300006178 | Bacteria | 2338 |
| 284 | Ga0075367_10064177 | 3300006178 | Bacteria | 2196 |
| 285 | Ga0075366_10011174 | 3300006195 | Bacteria | 5062 |
| 286 | Ga0075366_10101753 | 3300006195 | Bacteria | 1724 |
| 287 | Ga0075366_10160938 | 3300006195 | Bacteria | 1360 |
| 288 | Ga0097621_100004220 | 3300006237 | Bacteria | 9978 |
| 289 | Ga0075370_10010077 | 3300006353 | Bacteria | 4928 |
| 290 | Ga0068871_100000576 | 3300006358 | Bacteria | 25122 |
| 291 | Ga0068871_100025203 | 3300006358 | Bacteria | 4623 |
| 292 | Ga0068871_100319663 | 3300006358 | Bacteria | 1366 |
| 293 | Ga0075428_100003920 | 3300006844 | Bacteria | 16345 |
| 294 | Ga0075428_100031029 | 3300006844 | Bacteria | 5910 |
| 295 | Ga0075428_100142622 | 3300006844 | Bacteria | 2604 |
| 296 | Ga0075428_100231714 | 3300006844 | Bacteria | 1993 |
| 297 | Ga0075428_100415260 | 3300006844 | Bacteria | 1442 |
| 298 | Ga0075430_100001133 | 3300006846 | Bacteria | 21251 |
| 299 | Ga0075431_100003810 | 3300006847 | Bacteria | 14660 |
| 300 | Ga0075431_100156439 | 3300006847 | Bacteria | 2345 |
| 301 | Ga0075431_100171226 | 3300006847 | Bacteria | 2231 |
| 302 | Ga0075433_10000012 | 3300006852 | Bacteria | 71065 |
| 303 | Ga0075434_100000310 | 3300006871 | Bacteria | 34771 |
| 304 | Ga0075434_100001837 | 3300006871 | Bacteria | 18334 |
| 305 | Ga0075434_100026003 | 3300006871 | Bacteria | 5731 |
| 306 | Ga0075434_100093858 | 3300006871 | Bacteria | 3005 |
| 307 | Ga0075434_100361430 | 3300006871 | Bacteria | 1473 |
| 308 | Ga0075434_100470295 | 3300006871 | Bacteria | 1278 |
| 309 | Ga0075429_100000098 | 3300006880 | Bacteria | 47888 |
| 310 | Ga0068865_100027909 | 3300006881 | Bacteria | 3734 |
| 311 | Ga0068865_100037048 | 3300006881 | Bacteria | 3291 |
| 312 | Ga0068865_100048077 | 3300006881 | Bacteria | 2935 |
| 313 | Ga0075436_100023283 | 3300006914 | Bacteria | 4254 |
| 314 | Ga0075436_100074113 | 3300006914 | Bacteria | 2356 |
| 315 | Ga0097620_100009942 | 3300006931 | Bacteria | 9597 |
| 316 | Ga0097620_100014943 | 3300006931 | Bacteria | 7793 |
| 317 | Ga0099824_1039060 | 3300006942 | Bacteria | 1231 |
| 318 | Ga0075435_100008925 | 3300007076 | Bacteria | 7226 |
| 319 | Ga0075435_100034077 | 3300007076 | Bacteria | 4031 |
| 320 | Ga0099795_10031576 | 3300007788 | Bacteria | 1825 |
| 321 | Ga0105243_10197405 | 3300009148 | Bacteria | 1762 |
| 322 | Ga0105238_10161699 | 3300009551 | Bacteria | 2215 |
| 323 | Ga0105239_10228911 | 3300010375 | Bacteria | 2086 |
| 324 | Ga0157372_10160573 | 3300013307 | Bacteria | 2597 |
| 325 | Ga0163163_10064912 | 3300014325 | Bacteria | 3623 |
| 326 | Ga0157379_10061381 | 3300014968 | Bacteria | 3361 |
| 327 | Ga0182005_1011719 | 3300015265 | Bacteria | 2493 |
| 328 | Ga0214544_1000136 | 3300021320 | Bacteria | 107814 |
| 329 | Ga0214544_1018524 | 3300021320 | Bacteria | 5736 |
| 330 | Ga0214542_1000127 | 3300021321 | Bacteria | 107829 |
| 331 | Ga0214542_1018644 | 3300021321 | Bacteria | 5788 |
| 332 | Ga0214545_1000063 | 3300021324 | Bacteria | 107829 |
| 333 | Ga0214545_1019592 | 3300021324 | Bacteria | 5734 |
| 334 | Ga0214543_1000238 | 3300021327 | Bacteria | 84004 |
| 335 | Ga0213872_10023985 | 3300021361 | Bacteria | 2806 |
| 336 | Ga0224572_1001293 | 3300024225 | Bacteria | 3618 |
| 337 | Ga0228598_1012243 | 3300024227 | Bacteria | 1704 |
| 338 | Ga0209148_1000529 | 3300025254 | Bacteria | 37615 |
| 339 | Ga0209233_1001938 | 3300025261 | Bacteria | 7888 |
| 340 | Ga0209233_1004282 | 3300025261 | Bacteria | 4883 |
| 341 | Ga0207666_1000294 | 3300025271 | Bacteria | 7053 |
| 342 | Ga0209455_1002870 | 3300025272 | Bacteria | 6381 |
| 343 | Ga0209455_1007449 | 3300025272 | Bacteria | 3087 |
| 344 | Ga0207673_1002060 | 3300025290 | Bacteria | 2253 |
| 345 | Ga0209025_1043885 | 3300025294 | Bacteria | 1877 |
| 346 | Ga0209564_1001218 | 3300025295 | Bacteria | 29178 |
| 347 | Ga0209564_1005756 | 3300025295 | Bacteria | 6918 |
| 348 | Ga0209564_1007436 | 3300025295 | Bacteria | 5656 |
| 349 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 350 | Ga0209758_1001693 | 3300025297 | Bacteria | 24822 |
| 351 | Ga0209758_1003535 | 3300025297 | Bacteria | 14083 |
| 352 | Ga0209758_1008617 | 3300025297 | Bacteria | 6554 |
| 353 | Ga0209758_1013315 | 3300025297 | Bacteria | 4497 |
| 354 | Ga0209256_1003503 | 3300025299 | Bacteria | 10940 |
| 355 | Ga0207426_1000669 | 3300025302 | Bacteria | 41627 |
| 356 | Ga0207426_1001272 | 3300025302 | Bacteria | 22005 |
| 357 | Ga0207697_10000883 | 3300025315 | Bacteria | 16973 |
| 358 | Ga0207653_10000546 | 3300025885 | Bacteria | 13918 |
| 359 | Ga0207682_10000072 | 3300025893 | Bacteria | 44659 |
| 360 | Ga0207682_10001384 | 3300025893 | Bacteria | 11193 |
| 361 | Ga0207682_10037916 | 3300025893 | Bacteria | 1954 |
| 362 | Ga0207692_10003747 | 3300025898 | Bacteria | 5970 |
| 363 | Ga0207692_10021564 | 3300025898 | Bacteria | 2949 |
| 364 | Ga0207692_10027919 | 3300025898 | Bacteria | 2663 |
| 365 | Ga0207692_10045881 | 3300025898 | Bacteria | 2188 |
| 366 | Ga0207692_10102421 | 3300025898 | Bacteria | 1574 |
| 367 | Ga0207642_10069634 | 3300025899 | Bacteria | 1669 |
| 368 | Ga0207710_10000558 | 3300025900 | Bacteria | 22251 |
| 369 | Ga0207710_10005750 | 3300025900 | Bacteria | 5321 |
| 370 | Ga0207710_10038320 | 3300025900 | Bacteria | 2119 |
| 371 | Ga0207710_10053989 | 3300025900 | Bacteria | 1809 |
| 372 | Ga0207688_10000329 | 3300025901 | Bacteria | 21973 |
| 373 | Ga0207688_10131982 | 3300025901 | Bacteria | 1465 |
| 374 | Ga0207680_10006444 | 3300025903 | Bacteria | 5672 |
| 375 | Ga0207680_10009603 | 3300025903 | Bacteria | 4806 |
| 376 | Ga0207680_10167041 | 3300025903 | Bacteria | 1479 |
| 377 | Ga0207647_10015267 | 3300025904 | Bacteria | 5271 |
| 378 | Ga0207647_10031280 | 3300025904 | Bacteria | 3426 |
| 379 | Ga0207647_10123830 | 3300025904 | Bacteria | 1523 |
| 380 | Ga0207685_10015324 | 3300025905 | Bacteria | 2427 |
| 381 | Ga0207685_10030348 | 3300025905 | Bacteria | 1924 |
| 382 | Ga0207699_10000365 | 3300025906 | Bacteria | 23951 |
| 383 | Ga0207699_10013113 | 3300025906 | Bacteria | 4231 |
| 384 | Ga0207699_10040973 | 3300025906 | Bacteria | 2672 |
| 385 | Ga0207699_10057605 | 3300025906 | Bacteria | 2321 |
| 386 | Ga0207699_10228019 | 3300025906 | Bacteria | 1275 |
| 387 | Ga0207645_10001534 | 3300025907 | Bacteria | 18885 |
| 388 | Ga0207645_10004741 | 3300025907 | Bacteria | 10008 |
| 389 | Ga0207645_10007080 | 3300025907 | Bacteria | 7977 |
| 390 | Ga0207645_10062196 | 3300025907 | Bacteria | 2385 |
| 391 | Ga0207645_10127541 | 3300025907 | Bacteria | 1654 |
| 392 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 393 | Ga0207643_10019880 | 3300025908 | Bacteria | 3682 |
| 394 | Ga0207643_10022650 | 3300025908 | Bacteria | 3461 |
| 395 | Ga0207705_10080762 | 3300025909 | Bacteria | 2369 |
| 396 | Ga0207705_10081108 | 3300025909 | Bacteria | 2364 |
| 397 | Ga0207705_10092910 | 3300025909 | Bacteria | 2211 |
| 398 | Ga0207684_10144485 | 3300025910 | Bacteria | 2046 |
| 399 | Ga0207654_10000955 | 3300025911 | Bacteria | 15883 |
| 400 | Ga0207654_10082892 | 3300025911 | Bacteria | 1935 |
| 401 | Ga0207707_10010417 | 3300025912 | Bacteria | 8067 |
| 402 | Ga0207707_10010719 | 3300025912 | Bacteria | 7963 |
| 403 | Ga0207707_10015930 | 3300025912 | Bacteria | 6558 |
| 404 | Ga0207707_10146806 | 3300025912 | Bacteria | 2062 |
| 405 | Ga0207695_10000503 | 3300025913 | Bacteria | 83026 |
| 406 | Ga0207695_10004855 | 3300025913 | Bacteria | 18146 |
| 407 | Ga0207695_10064111 | 3300025913 | Bacteria | 3785 |
| 408 | Ga0207695_10107255 | 3300025913 | Bacteria | 2778 |
| 409 | Ga0207695_10248230 | 3300025913 | Bacteria | 1680 |
| 410 | Ga0207671_10034616 | 3300025914 | Bacteria | 3752 |
| 411 | Ga0207671_10226531 | 3300025914 | Bacteria | 1466 |
| 412 | Ga0207671_10298324 | 3300025914 | Bacteria | 1273 |
| 413 | Ga0207693_10002261 | 3300025915 | Bacteria | 16762 |
| 414 | Ga0207693_10002741 | 3300025915 | Bacteria | 15256 |
| 415 | Ga0207693_10007535 | 3300025915 | Bacteria | 8941 |
| 416 | Ga0207693_10026950 | 3300025915 | Bacteria | 4545 |
| 417 | Ga0207693_10030079 | 3300025915 | Bacteria | 4287 |
| 418 | Ga0207693_10041528 | 3300025915 | Bacteria | 3621 |
| 419 | Ga0207663_10000475 | 3300025916 | Bacteria | 17433 |
| 420 | Ga0207663_10035092 | 3300025916 | Bacteria | 3006 |
| 421 | Ga0207663_10116096 | 3300025916 | Bacteria | 1824 |
| 422 | Ga0207660_10000648 | 3300025917 | Bacteria | 23454 |
| 423 | Ga0207660_10010766 | 3300025917 | Bacteria | 5943 |
| 424 | Ga0207662_10000456 | 3300025918 | Bacteria | 18157 |
| 425 | Ga0207662_10002036 | 3300025918 | Bacteria | 10002 |
| 426 | Ga0207662_10105458 | 3300025918 | Bacteria | 1751 |
| 427 | Ga0207662_10159625 | 3300025918 | Bacteria | 1439 |
| 428 | Ga0207657_10006593 | 3300025919 | Bacteria | 12024 |
| 429 | Ga0207657_10053057 | 3300025919 | Bacteria | 3515 |
| 430 | Ga0207657_10055350 | 3300025919 | Bacteria | 3427 |
| 431 | Ga0207657_10079802 | 3300025919 | Bacteria | 2752 |
| 432 | Ga0207657_10089683 | 3300025919 | Bacteria | 2568 |
| 433 | Ga0207649_10000262 | 3300025920 | Bacteria | 41689 |
| 434 | Ga0207652_10015412 | 3300025921 | Bacteria | 6209 |
| 435 | Ga0207652_10033984 | 3300025921 | Bacteria | 4295 |
| 436 | Ga0207652_10192779 | 3300025921 | Bacteria | 1833 |
| 437 | Ga0207652_10296856 | 3300025921 | Bacteria | 1458 |
| 438 | Ga0207681_10011215 | 3300025923 | Bacteria | 5504 |
| 439 | Ga0207681_10058168 | 3300025923 | Bacteria | 2646 |
| 440 | Ga0207681_10139073 | 3300025923 | Bacteria | 1806 |
| 441 | Ga0207694_10000212 | 3300025924 | Bacteria | 56506 |
| 442 | Ga0207694_10048000 | 3300025924 | Bacteria | 3302 |
| 443 | Ga0207694_10070063 | 3300025924 | Bacteria | 2740 |
| 444 | Ga0207694_10205909 | 3300025924 | Bacteria | 1602 |
| 445 | Ga0207694_10250255 | 3300025924 | Bacteria | 1450 |
| 446 | Ga0207650_10001947 | 3300025925 | Bacteria | 14527 |
| 447 | Ga0207650_10004313 | 3300025925 | Bacteria | 9709 |
| 448 | Ga0207650_10044435 | 3300025925 | Bacteria | 3265 |
| 449 | Ga0207650_10060788 | 3300025925 | Bacteria | 2819 |
| 450 | Ga0207650_10104966 | 3300025925 | Bacteria | 2180 |
| 451 | Ga0207650_10150120 | 3300025925 | Bacteria | 1839 |
| 452 | Ga0207650_10190838 | 3300025925 | Bacteria | 1637 |
| 453 | Ga0207650_10202118 | 3300025925 | Bacteria | 1592 |
| 454 | Ga0207659_10024061 | 3300025926 | Bacteria | 4075 |
| 455 | Ga0207659_10271542 | 3300025926 | Bacteria | 1383 |
| 456 | Ga0207687_10001501 | 3300025927 | Bacteria | 15981 |
| 457 | Ga0207687_10045360 | 3300025927 | Bacteria | 3038 |
| 458 | Ga0207687_10347868 | 3300025927 | Bacteria | 1207 |
| 459 | Ga0207700_10008558 | 3300025928 | Bacteria | 6349 |
| 460 | Ga0207700_10075285 | 3300025928 | Bacteria | 2615 |
| 461 | Ga0207700_10102193 | 3300025928 | Bacteria | 2289 |
| 462 | Ga0207700_10137441 | 3300025928 | Bacteria | 2004 |
| 463 | Ga0207700_10185057 | 3300025928 | Bacteria | 1747 |
| 464 | Ga0207700_10356952 | 3300025928 | Bacteria | 1274 |
| 465 | Ga0207664_10112106 | 3300025929 | Bacteria | 2270 |
| 466 | Ga0207664_10228326 | 3300025929 | Bacteria | 1617 |
| 467 | Ga0207664_10233159 | 3300025929 | Bacteria | 1600 |
| 468 | Ga0207644_10000467 | 3300025931 | Bacteria | 26087 |
| 469 | Ga0207644_10006439 | 3300025931 | Bacteria | 7653 |
| 470 | Ga0207644_10028393 | 3300025931 | Bacteria | 3872 |
| 471 | Ga0207644_10077145 | 3300025931 | Bacteria | 2453 |
| 472 | Ga0207644_10226352 | 3300025931 | Bacteria | 1484 |
| 473 | Ga0207690_10001228 | 3300025932 | Bacteria | 16182 |
| 474 | Ga0207690_10045739 | 3300025932 | Bacteria | 2894 |
| 475 | Ga0207690_10050277 | 3300025932 | Bacteria | 2782 |
| 476 | Ga0207690_10228713 | 3300025932 | Bacteria | 1426 |
| 477 | Ga0207690_10228871 | 3300025932 | Bacteria | 1426 |
| 478 | Ga0207706_10002789 | 3300025933 | Bacteria | 16973 |
| 479 | Ga0207706_10019343 | 3300025933 | Bacteria | 6125 |
| 480 | Ga0207706_10022888 | 3300025933 | Bacteria | 5608 |
| 481 | Ga0207706_10048120 | 3300025933 | Bacteria | 3772 |
| 482 | Ga0207686_10004704 | 3300025934 | Bacteria | 7318 |
| 483 | Ga0207686_10013214 | 3300025934 | Bacteria | 4564 |
| 484 | Ga0207686_10065671 | 3300025934 | Bacteria | 2315 |
| 485 | Ga0207709_10026810 | 3300025935 | Bacteria | 3313 |
| 486 | Ga0207709_10054126 | 3300025935 | Bacteria | 2473 |
| 487 | Ga0207709_10061406 | 3300025935 | Bacteria | 2349 |
| 488 | Ga0207670_10001648 | 3300025936 | Bacteria | 11654 |
| 489 | Ga0207670_10009649 | 3300025936 | Bacteria | 5517 |
| 490 | Ga0207670_10083388 | 3300025936 | Bacteria | 2242 |
| 491 | Ga0207669_10002049 | 3300025937 | Bacteria | 8529 |
| 492 | Ga0207669_10004490 | 3300025937 | Bacteria | 6152 |
| 493 | Ga0207704_10008504 | 3300025938 | Bacteria | 4914 |
| 494 | Ga0207704_10165715 | 3300025938 | Bacteria | 1578 |
| 495 | Ga0207704_10179743 | 3300025938 | Bacteria | 1528 |
| 496 | Ga0207665_10000090 | 3300025939 | Bacteria | 58962 |
| 497 | Ga0207665_10001035 | 3300025939 | Bacteria | 18728 |
| 498 | Ga0207665_10006306 | 3300025939 | Bacteria | 7862 |
| 499 | Ga0207665_10102671 | 3300025939 | Bacteria | 1998 |
| 500 | Ga0207665_10107032 | 3300025939 | Bacteria | 1960 |
| 501 | Ga0207665_10109983 | 3300025939 | Bacteria | 1935 |
| 502 | Ga0207691_10002658 | 3300025940 | Bacteria | 17467 |
| 503 | Ga0207691_10003654 | 3300025940 | Bacteria | 14925 |
| 504 | Ga0207691_10178715 | 3300025940 | Bacteria | 1855 |
| 505 | Ga0207711_10031583 | 3300025941 | Bacteria | 4471 |
| 506 | Ga0207711_10110870 | 3300025941 | Bacteria | 2440 |
| 507 | Ga0207711_10126796 | 3300025941 | Bacteria | 2284 |
| 508 | Ga0207689_10000203 | 3300025942 | Bacteria | 52425 |
| 509 | Ga0207689_10003505 | 3300025942 | Bacteria | 14337 |
| 510 | Ga0207689_10049085 | 3300025942 | Bacteria | 3482 |
| 511 | Ga0207661_10013912 | 3300025944 | Bacteria | 5882 |
| 512 | Ga0207661_10104692 | 3300025944 | Bacteria | 2383 |
| 513 | Ga0207661_10231752 | 3300025944 | Bacteria | 1635 |
| 514 | Ga0207679_10000157 | 3300025945 | Bacteria | 56166 |
| 515 | Ga0207679_10038719 | 3300025945 | Bacteria | 3399 |
| 516 | Ga0207679_10046306 | 3300025945 | Bacteria | 3152 |
| 517 | Ga0207679_10347724 | 3300025945 | Bacteria | 1291 |
| 518 | Ga0207667_10013999 | 3300025949 | Bacteria | 9159 |
| 519 | Ga0207667_10049063 | 3300025949 | Bacteria | 4461 |
| 520 | Ga0207667_10212568 | 3300025949 | Bacteria | 1982 |
| 521 | Ga0207667_10480259 | 3300025949 | Bacteria | 1262 |
| 522 | Ga0207651_10013916 | 3300025960 | Bacteria | 4626 |
| 523 | Ga0207651_10022606 | 3300025960 | Bacteria | 3849 |
| 524 | Ga0207712_10065223 | 3300025961 | Bacteria | 2599 |
| 525 | Ga0207668_10025801 | 3300025972 | Bacteria | 3807 |
| 526 | Ga0207668_10071074 | 3300025972 | Bacteria | 2484 |
| 527 | Ga0207640_10003255 | 3300025981 | Bacteria | 8752 |
| 528 | Ga0207640_10240971 | 3300025981 | Bacteria | 1397 |
| 529 | Ga0207658_10055835 | 3300025986 | Bacteria | 2928 |
| 530 | Ga0207658_10084461 | 3300025986 | Bacteria | 2443 |
| 531 | Ga0207658_10120018 | 3300025986 | Bacteria | 2094 |
| 532 | Ga0207677_10062746 | 3300026023 | Bacteria | 2579 |
| 533 | Ga0207677_10117118 | 3300026023 | Bacteria | 1996 |
| 534 | Ga0207677_10212642 | 3300026023 | Bacteria | 1545 |
| 535 | Ga0207677_10248932 | 3300026023 | Bacteria | 1442 |
| 536 | Ga0207703_10001346 | 3300026035 | Bacteria | 22503 |
| 537 | Ga0207703_10006480 | 3300026035 | Bacteria | 9347 |
| 538 | Ga0207703_10291949 | 3300026035 | Bacteria | 1484 |
| 539 | Ga0207639_10006466 | 3300026041 | Bacteria | 7971 |
| 540 | Ga0207639_10048698 | 3300026041 | Bacteria | 3209 |
| 541 | Ga0207639_10062377 | 3300026041 | Bacteria | 2882 |
| 542 | Ga0207639_10196447 | 3300026041 | Bacteria | 1727 |
| 543 | Ga0207678_10002498 | 3300026067 | Bacteria | 16727 |
| 544 | Ga0207678_10012062 | 3300026067 | Bacteria | 7588 |
| 545 | Ga0207678_10088787 | 3300026067 | Bacteria | 2642 |
| 546 | Ga0207678_10155535 | 3300026067 | Bacteria | 1952 |
| 547 | Ga0207708_10000784 | 3300026075 | Bacteria | 23952 |
| 548 | Ga0207708_10001393 | 3300026075 | Bacteria | 18157 |
| 549 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 550 | Ga0207702_10003404 | 3300026078 | Bacteria | 14557 |
| 551 | Ga0207702_10086432 | 3300026078 | Bacteria | 2735 |
| 552 | Ga0207702_10342313 | 3300026078 | Bacteria | 1429 |
| 553 | Ga0207641_10006340 | 3300026088 | Bacteria | 9989 |
| 554 | Ga0207641_10013359 | 3300026088 | Bacteria | 6734 |
| 555 | Ga0207648_10001783 | 3300026089 | Bacteria | 23588 |
| 556 | Ga0207648_10002310 | 3300026089 | Bacteria | 20581 |
| 557 | Ga0207648_10011313 | 3300026089 | Bacteria | 8411 |
| 558 | Ga0207648_10318318 | 3300026089 | Bacteria | 1398 |
| 559 | Ga0207676_10000990 | 3300026095 | Bacteria | 21882 |
| 560 | Ga0207676_10029007 | 3300026095 | Bacteria | 4138 |
| 561 | Ga0207674_10002887 | 3300026116 | Bacteria | 21351 |
| 562 | Ga0207674_10040792 | 3300026116 | Bacteria | 4805 |
| 563 | Ga0207674_10059413 | 3300026116 | Bacteria | 3869 |
| 564 | Ga0207675_100001741 | 3300026118 | Bacteria | 21760 |
| 565 | Ga0207675_100002594 | 3300026118 | Bacteria | 17887 |
| 566 | Ga0207683_10000824 | 3300026121 | Bacteria | 28453 |
| 567 | Ga0207683_10001176 | 3300026121 | Bacteria | 23694 |
| 568 | Ga0207683_10008180 | 3300026121 | Bacteria | 8949 |
| 569 | Ga0207683_10010994 | 3300026121 | Bacteria | 7718 |
| 570 | Ga0207683_10034926 | 3300026121 | Bacteria | 4373 |
| 571 | Ga0207683_10176200 | 3300026121 | Bacteria | 1938 |
| 572 | Ga0207683_10193163 | 3300026121 | Bacteria | 1849 |
| 573 | Ga0207698_10013372 | 3300026142 | Bacteria | 5413 |
| 574 | Ga0207698_10065776 | 3300026142 | Bacteria | 2850 |
| 575 | Ga0209389_1000088 | 3300027296 | Bacteria | 83578 |
| 576 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 577 | Ga0209589_1000189 | 3300027357 | Bacteria | 71403 |
| 578 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 579 | Ga0209489_100085 | 3300027361 | Bacteria | 126199 |
| 580 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 581 | Ga0209998_10003384 | 3300027717 | Bacteria | 3497 |
| 582 | Ga0207428_10000137 | 3300027907 | Bacteria | 98535 |
| 583 | Ga0207428_10011738 | 3300027907 | Bacteria | 7727 |
| 584 | Ga0268266_10001075 | 3300028379 | Bacteria | 34218 |
| 585 | Ga0268266_10002267 | 3300028379 | Bacteria | 20910 |
| 586 | Ga0268266_10014909 | 3300028379 | Bacteria | 6674 |
| 587 | Ga0268266_10036292 | 3300028379 | Bacteria | 4195 |
| 588 | Ga0268266_10046433 | 3300028379 | Bacteria | 3718 |
| 589 | Ga0268266_10183323 | 3300028379 | Bacteria | 1907 |
| 590 | Ga0268265_10002187 | 3300028380 | Bacteria | 15094 |
| 591 | Ga0268265_10093297 | 3300028380 | Bacteria | 2411 |
| 592 | Ga0268264_10000168 | 3300028381 | Bacteria | 146056 |
| 593 | Ga0268264_10020190 | 3300028381 | Bacteria | 5445 |
| 594 | Ga0268264_10266604 | 3300028381 | Bacteria | 1598 |
| 595 | Ga0265337_1018093 | 3300028556 | Bacteria | 2245 |
| 596 | Ga0265319_1026647 | 3300028563 | Bacteria | 2056 |
| 597 | Ga0265318_10014356 | 3300028577 | Bacteria | 3327 |
| 598 | Ga0265323_10004923 | 3300028653 | Bacteria | 5706 |
| 599 | Ga0265336_10000865 | 3300028666 | Bacteria | 15680 |
| 600 | Ga0307517_10000071 | 3300028786 | Bacteria | 138548 |
| 601 | Ga0265338_10000085 | 3300028800 | Bacteria | 175080 |
| 602 | Ga0265338_10117922 | 3300028800 | Bacteria | 2122 |
| 603 | Ga0307511_10053640 | 3300030521 | Bacteria | 3191 |
| 604 | Ga0265330_10037886 | 3300031235 | Bacteria | 2144 |
| 605 | Ga0265328_10000982 | 3300031239 | Bacteria | 13096 |
| 606 | Ga0265325_10000073 | 3300031241 | Bacteria | 70109 |
| 607 | Ga0265325_10000234 | 3300031241 | Bacteria | 39472 |
| 608 | Ga0265325_10012865 | 3300031241 | Bacteria | 4774 |
| 609 | Ga0265325_10047437 | 3300031241 | Bacteria | 2223 |
| 610 | Ga0265340_10013164 | 3300031247 | Bacteria | 4353 |
| 611 | Ga0265340_10041090 | 3300031247 | Bacteria | 2275 |
| 612 | Ga0265339_10002865 | 3300031249 | Bacteria | 12213 |
| 613 | Ga0265339_10004523 | 3300031249 | Bacteria | 9466 |
| 614 | Ga0265339_10016161 | 3300031249 | Bacteria | 4456 |
| 615 | Ga0265339_10057944 | 3300031249 | Bacteria | 2093 |
| 616 | Ga0265339_10069736 | 3300031249 | Bacteria | 1876 |
| 617 | Ga0265327_10035869 | 3300031251 | Bacteria | 2735 |
| 618 | Ga0265316_10040075 | 3300031344 | Bacteria | 3757 |
| 619 | Ga0307408_100205491 | 3300031548 | Bacteria | 1597 |
| 620 | Ga0265313_10003770 | 3300031595 | Bacteria | 12027 |
| 621 | Ga0265313_10025133 | 3300031595 | Bacteria | 3165 |
| 622 | Ga0265313_10026353 | 3300031595 | Bacteria | 3063 |
| 623 | Ga0265313_10079360 | 3300031595 | Bacteria | 1494 |
| 624 | Ga0307508_10000008 | 3300031616 | Bacteria | 265023 |
| 625 | Ga0307508_10055649 | 3300031616 | Bacteria | 3504 |
| 626 | Ga0307508_10212708 | 3300031616 | Bacteria | 1533 |
| 627 | Ga0265314_10006006 | 3300031711 | Bacteria | 10823 |
| 628 | Ga0265314_10023216 | 3300031711 | Bacteria | 4736 |
| 629 | Ga0265314_10038356 | 3300031711 | Bacteria | 3462 |
| 630 | Ga0265314_10040806 | 3300031711 | Bacteria | 3327 |
| 631 | Ga0265342_10000548 | 3300031712 | Bacteria | 39664 |
| 632 | Ga0265342_10011621 | 3300031712 | Bacteria | 6010 |
| 633 | Ga0307406_10057596 | 3300031901 | Bacteria | 2493 |
| 634 | Ga0307406_10161200 | 3300031901 | Bacteria | 1612 |
| 635 | Ga0307415_100129931 | 3300032126 | Bacteria | 1905 |
| 636 | Ga0307510_10200982 | 3300033180 | Bacteria | 1528 |
| 637 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 638 | Ga0373937_0005496 | 3300036401 | Bacteria | 10861 |
| 639 | Ga0373925_0210419 | 3300037068 | Bacteria | 1549 |
| 640 | Ga0395900_0001040 | 3300037418 | Bacteria | 35567 |
| 641 | Ga0395900_0035092 | 3300037418 | Bacteria | 5166 |
| 642 | Ga0395900_0174078 | 3300037418 | Bacteria | 2190 |
| 643 | Ga0436364_0053055 | 3300037853 | Bacteria | 1495 |
| 644 | Ga0395901_0157312 | 3300038443 | Bacteria | 2387 |
| 645 | Ga0436365_1081029 | 3300039437 | Bacteria | 1501 |
| 646 | Ga0436365_1440709 | 3300039437 | Bacteria | 5223 |
| 647 | Ga0436360_0084371 | 3300039438 | Bacteria | 7058 |
| 648 | Ga0436363_1162359 | 3300039450 | Bacteria | 1311 |
| 649 | Ga0436363_1274559 | 3300039450 | Bacteria | 1387 |
| 650 | Ga0466966_0016947 | 3300044684 | Bacteria | 4816 |
| 651 | Ga0466961_0000060 | 3300044693 | Bacteria | 65360 |
| 652 | Ga0466961_0223603 | 3300044693 | Bacteria | 1160 |
| 653 | Ga0466957_0019803 | 3300044842 | Bacteria | 3961 |
| 654 | Ga0466959_0010444 | 3300045049 | Bacteria | 6640 |
| 655 | Ga0466959_0053246 | 3300045049 | Bacteria | 2959 |
| 656 | Ga0466958_0049650 | 3300045836 | Bacteria | 2539 |
| 657 | Ga0495631_0079938 | 3300046518 | Bacteria | 1411 |
| 658 | Ga0495634_0153783 | 3300046642 | Bacteria | 1453 |
| 659 | Ga0496100_0006810 | 3300048903 | Bacteria | 6262 |
| 660 | Ga0496103_0039032 | 3300048906 | Bacteria | 2917 |
| 661 | Ga0496103_0163568 | 3300048906 | Bacteria | 1428 |
| 662 | Ga0496104_0022151 | 3300048907 | Bacteria | 5838 |
| 663 | Ga0496104_0148088 | 3300048907 | Bacteria | 2254 |
| 664 | Ga0496105_0000017 | 3300048908 | Bacteria | 210323 |
| 665 | Ga0496105_0085676 | 3300048908 | Bacteria | 2603 |
| 666 | Ga0496105_0192068 | 3300048908 | Bacteria | 1669 |
| 667 | Ga0496106_0089703 | 3300048909 | Bacteria | 2371 |
| 668 | Ga0496107_0076514 | 3300048910 | Bacteria | 2437 |
| 669 | Ga0496108_0018798 | 3300048911 | Bacteria | 5664 |
| 670 | Ga0496109_0208804 | 3300048912 | Bacteria | 1836 |
| 671 | Ga0496110_0065486 | 3300048913 | Bacteria | 3213 |
| 672 | Ga0496110_0194986 | 3300048913 | Bacteria | 1839 |
| 673 | Ga0496111_0013938 | 3300048914 | Bacteria | 5482 |
| 674 | Ga0496111_0122499 | 3300048914 | Bacteria | 1921 |
| 675 | Ga0496112_0032501 | 3300048915 | Bacteria | 5067 |
| 676 | Ga0496112_0194903 | 3300048915 | Bacteria | 1987 |
| 677 | Ga0496113_0138101 | 3300048916 | Bacteria | 1916 |
| 678 | Ga0496115_0147101 | 3300048918 | Bacteria | 1945 |
| 679 | Ga0496116_0077993 | 3300048919 | Bacteria | 2068 |
| 680 | Ga0496119_0001093 | 3300048922 | Bacteria | 34137 |
| 681 | Ga0496121_0010429 | 3300048924 | Bacteria | 10482 |
| 682 | Ga0496121_0080989 | 3300048924 | Bacteria | 2571 |
| 683 | Ga0496125_0057353 | 3300048928 | Bacteria | 3154 |
| 684 | Ga0496126_0025003 | 3300048929 | Bacteria | 5756 |
| 685 | Ga0496126_0169680 | 3300048929 | Bacteria | 1860 |
| 686 | Ga0496126_0283259 | 3300048929 | Bacteria | 1372 |
| 687 | Ga0501031_0012876 | 3300049568 | Bacteria | 5464 |
| 688 | Ga0501031_0019462 | 3300049568 | Bacteria | 4423 |
| 689 | Ga0501032_0010837 | 3300049569 | Bacteria | 6561 |
| 690 | Ga0501032_0012413 | 3300049569 | Bacteria | 6087 |
| 691 | Ga0501033_0003732 | 3300049570 | Bacteria | 12392 |
| 692 | Ga0501033_0023364 | 3300049570 | Bacteria | 4662 |
| 693 | Ga0501034_0017043 | 3300049571 | Bacteria | 7449 |
| 694 | Ga0501034_0064192 | 3300049571 | Bacteria | 3686 |
| 695 | Ga0501036_0168935 | 3300049572 | Bacteria | 1843 |
| 696 | Ga0501036_0170742 | 3300049572 | Bacteria | 1832 |
| 697 | Ga0501037_0005052 | 3300049573 | Bacteria | 9600 |
| 698 | Ga0501037_0028345 | 3300049573 | Bacteria | 4136 |
| 699 | Ga0501037_0045419 | 3300049573 | Bacteria | 3225 |
| 700 | Ga0501038_0007440 | 3300049574 | Bacteria | 10106 |
| 701 | Ga0501038_0021514 | 3300049574 | Bacteria | 5787 |
| 702 | Ga0501038_0076643 | 3300049574 | Bacteria | 2824 |
| 703 | Ga0501038_0078114 | 3300049574 | Bacteria | 2793 |
| 704 | Ga0501039_0065023 | 3300049575 | Bacteria | 2828 |
| 705 | Ga0501039_0075724 | 3300049575 | Bacteria | 2616 |
| 706 | Ga0501039_0145914 | 3300049575 | Bacteria | 1859 |
| 707 | Ga0501041_0043287 | 3300049577 | Bacteria | 2737 |
| 708 | Ga0501042_0064150 | 3300049578 | Bacteria | 2625 |
| 709 | Ga0501042_0118757 | 3300049578 | Bacteria | 1903 |
| 710 | Ga0501043_0000251 | 3300049579 | Bacteria | 48637 |
| 711 | Ga0501043_0003880 | 3300049579 | Bacteria | 12273 |
| 712 | Ga0501043_0045584 | 3300049579 | Bacteria | 3448 |
| 713 | Ga0501046_0129748 | 3300049580 | Bacteria | 1912 |
| 714 | Ga0501047_0000480 | 3300049581 | Bacteria | 43454 |
| 715 | Ga0501047_0009581 | 3300049581 | Bacteria | 9154 |
| 716 | Ga0501047_0192811 | 3300049581 | Bacteria | 1900 |
| 717 | Ga0501047_0245663 | 3300049581 | Bacteria | 1639 |
| 718 | Ga0501048_0020437 | 3300049582 | Bacteria | 4852 |
| 719 | Ga0501048_0078033 | 3300049582 | Bacteria | 2337 |
| 720 | Ga0501067_0019535 | 3300049583 | Bacteria | 3752 |
| 721 | Ga0501067_0042504 | 3300049583 | Bacteria | 2523 |
| 722 | Ga0501069_0017721 | 3300049585 | Bacteria | 3838 |
| 723 | Ga0501069_0025858 | 3300049585 | Bacteria | 3211 |
| 724 | Ga0501069_0196547 | 3300049585 | Bacteria | 1168 |
| 725 | Ga0501070_0004158 | 3300049586 | Bacteria | 12451 |
| 726 | Ga0501070_0121407 | 3300049586 | Bacteria | 2159 |
| 727 | Ga0501072_0006969 | 3300049588 | Bacteria | 8577 |
| 728 | Ga0501072_0037706 | 3300049588 | Bacteria | 3791 |
| 729 | Ga0501072_0197017 | 3300049588 | Bacteria | 1606 |
| 730 | Ga0501073_0083717 | 3300049589 | Bacteria | 2219 |
| 731 | Ga0501073_0238014 | 3300049589 | Bacteria | 1257 |
| 732 | Ga0501075_0011798 | 3300049591 | Bacteria | 6196 |
| 733 | Ga0501076_0031681 | 3300049592 | Bacteria | 4126 |
| 734 | Ga0501079_0042540 | 3300049741 | Bacteria | 3507 |
| 735 | Ga0501080_0017082 | 3300049742 | Bacteria | 6702 |
| 736 | Ga0501080_0019518 | 3300049742 | Bacteria | 6279 |
| 737 | Ga0501080_0083287 | 3300049742 | Bacteria | 2971 |
| 738 | Ga0501080_0112835 | 3300049742 | Bacteria | 2519 |
| 739 | Ga0501080_0254928 | 3300049742 | Bacteria | 1599 |
| 740 | Ga0501083_0002317 | 3300049744 | Bacteria | 13009 |
| 741 | Ga0501083_0101074 | 3300049744 | Bacteria | 1901 |
| 742 | Ga0501035_0006501 | 3300049822 | Bacteria | 10980 |
| 743 | Ga0501035_0294088 | 3300049822 | Bacteria | 1370 |
| 744 | Ga0501044_0006151 | 3300049823 | Bacteria | 13258 |
| 745 | Ga0501044_0008552 | 3300049823 | Bacteria | 11218 |
| 746 | Ga0501044_0096551 | 3300049823 | Bacteria | 2977 |
| 747 | Ga0501044_0101218 | 3300049823 | Bacteria | 2899 |
| 748 | Ga0501044_0122361 | 3300049823 | Bacteria | 2601 |
| 749 | Ga0501044_0124729 | 3300049823 | Bacteria | 2573 |
| 750 | nmdc:mga03n38_14619_c1 | 3300050490 | Bacteria | 3013 |
| 751 | nmdc:mga00v17_34066_c1 | 3300050491 | Bacteria | 3022 |
| 752 | nmdc:mga0yw44_95952_c1 | 3300050492 | Bacteria | 1882 |
| 753 | nmdc:mga06z11_34133_c1 | 3300050494 | Bacteria | 2495 |
| 754 | nmdc:mga06z11_87944_c1 | 3300050494 | Bacteria | 1681 |
| 755 | nmdc:mga07m45_24279_c1 | 3300050496 | Bacteria | 3319 |
| 756 | nmdc:mga07m45_36837_c1 | 3300050496 | Bacteria | 2726 |
| 757 | nmdc:mga0n895_179615_c1 | 3300050512 | Bacteria | 2148 |
| 758 | nmdc:mga0n895_7911_c1 | 3300050512 | Bacteria | 9163 |
| 759 | nmdc:mga0n895_86222_c1 | 3300050512 | Bacteria | 3136 |
| 760 | Ga0495601_0047589 | 3300053077 | Bacteria | 2700 |
| 761 | Ga0495619_0103254 | 3300053085 | Bacteria | 1942 |
| 762 | Ga0500583_0079399 | 3300053092 | Bacteria | 1583 |
| 763 | Ga0500562_009706 | 3300053108 | Bacteria | 2434 |
| 764 | Ga0500572_000411 | 3300053111 | Bacteria | 15062 |
| 765 | Ga0500608_001603 | 3300053122 | Bacteria | 8120 |
| 766 | Ga0500559_0000644 | 3300053136 | Bacteria | 23534 |
| 767 | Ga0500559_0004658 | 3300053136 | Bacteria | 6462 |
| 768 | Ga0500577_0001900 | 3300053142 | Bacteria | 5354 |
| 769 | Ga0500630_001521 | 3300053159 | Bacteria | 11076 |
| 770 | Ga0500638_005425 | 3300053162 | Bacteria | 5076 |
| 771 | Ga0500639_000135 | 3300053163 | Bacteria | 35350 |
| 772 | Ga0500639_017812 | 3300053163 | Bacteria | 3749 |
| 773 | Ga0501084_0055145 | 3300054114 | Bacteria | 3325 |
| 774 | Ga0501084_0066139 | 3300054114 | Bacteria | 3024 |
| 775 | Ga0501084_0073128 | 3300054114 | Bacteria | 2871 |
| 776 | Ga0501082_0002026 | 3300060353 | Bacteria | 17822 |
| 777 | Ga0501082_0005794 | 3300060353 | Bacteria | 10725 |
| 778 | Ga0501082_0014291 | 3300060353 | Bacteria | 6832 |
| 779 | Ga0501082_0048340 | 3300060353 | Bacteria | 3666 |
| 780 | 2829748377 | 2829745981 | Bacteria | 5406054 |
| 781 | 2507507233 | 2507262055 | Bacteria | 8048963 |
| 782 | 2508541285 | 2508501009 | Bacteria | 7784016 |
| 783 | 2508693386 | 2508501042 | Bacteria | 8719808 |
| 784 | 2509080144 | 2508501114 | Bacteria | 7082538 |
| 785 | 2509148777 | 2508501128 | Bacteria | 8613869 |
| 786 | 2511395818 | 2511231028 | Bacteria | 8046582 |
| 787 | 2513592465 | 2513237087 | Bacteria | 5817514 |
| 788 | 2513626425 | 2513237092 | Bacteria | 8341956 |
| 789 | 2513652476 | 2513237095 | Bacteria | 8976980 |
| 790 | 2513657630 | 2513237096 | Bacteria | 8722461 |
| 791 | 2513677089 | 2513237098 | Bacteria | 9902361 |
| 792 | 2513693238 | 2513237101 | Bacteria | 7952346 |
| 793 | 2513705066 | 2513237102 | Bacteria | 7703324 |
| 794 | 2513862098 | 2513237137 | Bacteria | 9558895 |
| 795 | 2513876705 | 2513237139 | Bacteria | 8737671 |
| 796 | 2513919629 | 2513237145 | Bacteria | 8979722 |
| 797 | 2514012250 | 2513237161 | Bacteria | 8871253 |
| 798 | 2515628747 | 2515154112 | Bacteria | 8294334 |
| 799 | 2517104840 | 2517093001 | Bacteria | 9002274 |
| 800 | 2517895373 | 2517572143 | Bacteria | 9484767 |
| 801 | 2524440649 | 2524023205 | Bacteria | 8918781 |
| 802 | 2524467710 | 2524023210 | Bacteria | 9029266 |
| 803 | 2524540525 | 2524023228 | Bacteria | 10118060 |
| 804 | 2528853623 | 2528768022 | Bacteria | 10457665 |
| 805 | 2545676985 | 2545555834 | Bacteria | 8130841 |
| 806 | 2617347958 | 2617270735 | Bacteria | 9163226 |
| 807 | 2617377817 | 2617270741 | Bacteria | 8201522 |
| 808 | 2644168926 | 2643221629 | Bacteria | 5850260 |
| 809 | 2644289426 | 2643221651 | Bacteria | 4798932 |
| 810 | 2644347478 | 2643221662 | Bacteria | 5851492 |
| 811 | 2671120290 | 2667528175 | Bacteria | 7532676 |
| 812 | 2723848145 | 2721755755 | Bacteria | 8322773 |
| 813 | 2728750892 | 2728368998 | Bacteria | 8720350 |
| 814 | 2739350716 | 2738543031 | Bacteria | 5769731 |
| 815 | 2745077891 | 2744054633 | Bacteria | 8678936 |
| 816 | 2774872826 | 2773857925 | Bacteria | 6472445 |
| 817 | 2776261667 | 2775506901 | Bacteria | 9631051 |
| 818 | 2793069347 | 2791355197 | Bacteria | 8420563 |
| 819 | 2793078147 | |||
| 820 | 2805918685 | 2802429603 | Bacteria | 8777136 |
| 821 | 2818237023 | 2816332527 | Bacteria | 8933356 |
| 822 | 2835313252 | 2835312727 | Bacteria | 7413381 |
| 823 | 2861693706 | 2861691609 | Bacteria | 5628931 |
| 824 | 2882456927 | 2882456835 | Bacteria | 6863978 |
| 825 | 2894233923 | 2894232714 | Bacteria | 8834183 |
| 826 | 2904698712 | 2904690495 | Bacteria | 9412302 |
| 827 | 2932789418 | 2932784394 | Bacteria | 9704911 |
| 828 | 2932797758 | 2932794094 | Bacteria | 7915132 |
| 829 | 2932804276 | 2932801729 | Bacteria | 7987968 |
| 830 | 2932816467 | 2932809354 | Bacteria | 9135765 |
| 831 | 2932827195 | 2932818245 | Bacteria | 9955613 |
| 832 | 2932832025 | 2932828146 | Bacteria | 9745859 |
| 833 | 2933584761 | 2933577622 | Bacteria | 9116884 |
| 834 | 2935610389 | 2935608549 | Bacteria | 8203142 |
| 835 | 2935621964 | 2935616580 | Bacteria | 9032984 |
| 836 | 2935631109 | 2935630451 | Bacteria | 8169952 |
| 837 | 2935644026 | 2935638405 | Bacteria | 10015038 |
| 838 | 2935651365 | 2935648319 | Bacteria | 8801166 |
| 839 | 2935659545 | 2935656913 | Bacteria | 8965014 |
| 840 | 2935669059 | 2935665750 | Bacteria | 9571747 |
| 841 | 2935683383 | 2935675223 | Bacteria | 9928132 |
| 842 | 2935692323 | 2935684952 | Bacteria | 9590419 |
| 843 | 2935700505 | 2935694250 | Bacteria | 9291695 |
| 844 | 2935708866 | 2935703347 | Bacteria | 10242284 |
| 845 | 2935720439 | 2935713505 | Bacteria | 9608509 |
| 846 | 2935729720 | 2935722832 | Bacteria | 9608746 |
| 847 | 2935739298 | 2935732158 | Bacteria | 9706831 |
| 848 | 2935748161 | 2935741537 | Bacteria | 9707219 |
| 849 | 2935758364 | 2935750917 | Bacteria | 9590372 |
| 850 | 2935767442 | 2935760218 | Bacteria | 9817913 |
| 851 | 2935771077 | 2935769743 | Bacteria | 7878163 |
| 852 | 2935781245 | 2935777560 | Bacteria | 8077691 |
| 853 | 2935786222 | 2935785616 | Bacteria | 7962367 |
| 854 | 2935793981 | 2935793552 | Bacteria | 8012592 |
| 855 | 2935805775 | 2935801545 | Bacteria | 9301974 |
| 856 | 2935815667 | 2935810662 | Bacteria | 9401221 |
| 857 | 2935823550 | 2935819856 | Bacteria | 8261050 |
| 858 | 2935833278 | 2935827899 | Bacteria | 10038562 |
| 859 | 2935843146 | 2935837841 | Bacteria | 9454360 |
| 860 | 2935849075 | 2935847175 | Bacteria | 8228321 |
| 861 | 2935860211 | 2935855204 | Bacteria | 9035059 |
| 862 | 2935867608 | 2935864058 | Bacteria | 9784707 |
| 863 | 2935878582 | 2935873716 | Bacteria | 9632195 |
| 864 | 2935888302 | 2935883170 | Bacteria | 7964738 |
| 865 | 2935912836 | 2935908558 | Bacteria | 8568796 |
| 866 | 2935922845 | 2935916978 | Bacteria | 9113783 |
| 867 | 2935930270 | 2935926038 | Bacteria | 8601059 |
| 868 | 2935939171 | 2935934488 | Bacteria | 8602579 |
| 869 | 2935946118 | 2935942939 | Bacteria | 8599779 |
| 870 | 2935955455 | 2935951376 | Bacteria | 8602333 |
| 871 | 2935965282 | 2935959822 | Bacteria | 7869783 |
| 872 | 2935972174 | 2935967501 | Bacteria | 8603075 |
| 873 | 2935976099 | 2935975950 | Bacteria | 8347125 |
| 874 | 2935986407 | 2935984226 | Bacteria | 8302647 |
| 875 | 2935998141 | 2935992306 | Bacteria | 9802711 |
| 876 | 2936006841 | 2936002035 | Bacteria | 9362176 |
| 877 | 2936013960 | 2936011229 | Bacteria | 8801034 |
| 878 | 2936022516 | 2936019824 | Bacteria | 8804134 |
| 879 | 2936035565 | 2936028420 | Bacteria | 8965941 |
| 880 | 2936040905 | 2936037263 | Bacteria | 9446081 |
| 881 | 2936049066 | 2936046547 | Bacteria | 8903709 |
| 882 | 2936060356 | 2936055302 | Bacteria | 8785755 |
| 883 | 2940564268 | 2940556831 | Bacteria | 9590747 |
| 884 | 2941507761 | 2941507105 | Bacteria | 8166816 |
| 885 | 2941516187 | 2941515067 | Bacteria | 8166720 |
| 886 | 2941523104 | 2941523033 | Bacteria | 8169134 |
| 887 | 2941531654 | 2941531003 | Bacteria | 7653939 |
| 888 | 2941544692 | 2941538514 | Bacteria | 9402094 |
| 889 | 3003671840 | 3003665799 | Bacteria | 7279786 |
| 890 | 3005476965 | 3005474847 | Bacteria | 9259049 |
| 891 | 3005485650 | 3005483717 | Bacteria | 7877331 |
| 892 | 3005511591 | 3005506211 | Bacteria | 6943378 |
| 893 | 3005594474 | 3005587118 | Bacteria | 7794411 |
| 894 | 3005600821 | 3005594810 | Bacteria | 8716512 |
| 895 | 3005716233 | 3005710791 | Bacteria | 7622528 |
| 896 | 3005723611 | 3005718088 | Bacteria | 8283608 |
| 897 | 641641029 | 641522639 | Bacteria | 7737025 |
| 898 | 643599209 | 643348564 | Bacteria | 8839022 |
| 899 | 8001850309 | 8001845381 | Bacteria | 5804942 |
| 900 | 8006934455 | 8006933436 | Bacteria | 10410654 |
| 901 | 8006968920 | 8006964411 | Bacteria | 8966052 |
| 902 | 8006974425 | 8006973647 | Bacteria | 10679141 |
| 903 | 8006985199 | 8006984368 | Bacteria | 9651211 |
| 904 | 8007000890 | 8006994254 | Bacteria | 8309700 |
| 905 | 8016528055 | 8016522445 | Bacteria | 8156687 |
| 906 | 8016533177 | 8016530956 | Bacteria | 8155261 |
| 907 | 8016564061 | 8016557553 | Bacteria | 8154380 |
| 908 | 8016575751 | 8016575299 | Bacteria | 8154085 |
| 909 | 8016594940 | 8016583857 | Bacteria | 10421953 |
| 910 | 8016601769 | 8016595262 | Bacteria | 8149947 |
| 911 | 8016608485 | 8016603502 | Bacteria | 8731218 |
| 912 | 8016616385 | 8016613128 | Bacteria | 8794220 |
| 913 | 8016624751 | 8016622563 | Bacteria | 7999408 |
| 914 | 8017065412 | 8017057580 | Bacteria | 10023680 |
| 915 | 8019532975 | 8019530166 | Bacteria | 8155624 |
| 916 | 8019546873 | 8019538911 | Bacteria | 7872763 |
| 917 | 8019551792 | 8019547302 | Bacteria | 7996444 |
| 918 | 8019564228 | 8019555841 | Bacteria | 9642137 |
| 919 | 8019574308 | 8019565922 | Bacteria | 9639779 |
| 920 | 8019584805 | 8019576017 | Bacteria | 10049540 |
| 921 | 8019592752 | 8019586578 | Bacteria | 10212056 |
| 922 | 8019598693 | 8019597564 | Bacteria | 10041141 |
| 923 | 8019609677 | 8019608314 | Bacteria | 10042931 |
| 924 | 8019620269 | 8019619141 | Bacteria | 9218857 |
| 925 | 8019655595 | 8019648815 | Bacteria | 10014479 |
| 926 | 8019660692 | 8019659431 | Bacteria | 8577854 |
| 927 | 8019670106 | 8019668869 | Bacteria | 8791617 |
| 928 | 8019685988 | 8019678201 | Bacteria | 8863603 |
| 929 | 8019692148 | 8019687851 | Bacteria | 8712826 |
| 930 | 8055744603 | 8055742211 | Bacteria | 9226248 |
| 931 | 8056675952 | 8056673599 | Bacteria | 7871253 |
| 932 | 8056682207 | 8056681323 | Bacteria | 8472857 |
| 933 | 8056690359 | 8056689827 | Bacteria | 6712655 |
| 934 | 8056971886 | 8056967851 | Bacteria | 9038162 |
| 935 | ARSoilYngRDRAFT_c00262 | |||
| 936 | ARcpr5yngRDRAFT_c000410 | |||
| 937 | ARSoilOldRDRAFT_c000163 | |||
| 938 | ARSoilOldRDRAFT_c001504 | |||
| 939 | ARCol0yngRDRAFT_1000276 | |||
| 940 | JGI24739J22299_10000209 | |||
| 941 | JGI24737J22298_10008663 | |||
| 942 | JGI24737J22298_10028274 | |||
| 943 | JGI24743J22301_10005489 | |||
| 944 | JGI24748J21848_1003329 | |||
| 945 | JGI24738J21930_10000520 | |||
| 946 | JGI24744J21845_10001082 | |||
| 947 | JGI24034J26672_10000769 | |||
| 948 | JGI24742J22300_10001936 | |||
| 949 | JGI24742J22300_10007211 | |||
| 950 | JGI24751J29686_10016041 | |||
| 951 | JGI25406J46586_10014105 | |||
| 952 | JGI25153J46596_10004362 | |||
| 953 | JGI26129J50193_1001490 | |||
| 954 | Ga0055542_1003388 | |||
| 955 | Ga0055531_10001950 | |||
| 956 | JGI25405J52794_10001619 | |||
| 957 | Ga0065165_1001570 | |||
| 958 | Ga0065712_10078574 | |||
| 959 | Ga0065715_10005127 | |||
| 960 | Ga0065715_10093447 | |||
| 961 | Ga0070676_10003190 | |||
| 962 | Ga0070676_10011775 | |||
| 963 | Ga0070676_10086982 | |||
| 964 | Ga0070683_100009959 | |||
| 965 | Ga0070683_100018569 | |||
| 966 | Ga0070683_100120252 | |||
| 967 | Ga0070690_100021672 | |||
| 968 | Ga0070690_100043051 | |||
| 969 | Ga0070690_100072075 | |||
| 970 | Ga0070690_100104519 | |||
| 971 | Ga0070670_100008185 | |||
| 972 | Ga0070670_100081197 | |||
| 973 | Ga0070677_10000109 | |||
| 974 | Ga0068869_100000729 | |||
| 975 | Ga0068869_100083556 | |||
| 976 | Ga0070666_10010649 | |||
| 977 | Ga0070666_10012981 | |||
| 978 | Ga0070666_10112596 | |||
| 979 | Ga0070680_100076082 | |||
| 980 | Ga0070680_100146059 | |||
| 981 | Ga0070680_100265593 | |||
| 982 | Ga0070682_100000459 | |||
| 983 | Ga0070682_100021137 | |||
| 984 | Ga0068868_100000443 | |||
| 985 | Ga0068868_100017966 | |||
| 986 | Ga0068868_100084074 | |||
| 987 | Ga0070660_100001113 | |||
| 988 | Ga0070660_100009423 | |||
| 989 | Ga0070689_100000423 | |||
| 990 | Ga0070689_100074167 | |||
| 991 | Ga0070689_100195808 | |||
| 992 | Ga0070691_10001337 | |||
| 993 | Ga0070691_10013427 | |||
| 994 | Ga0070691_10046321 | |||
| 995 | Ga0070687_100000851 | |||
| 996 | Ga0070687_100025800 | |||
| 997 | Ga0070687_100038078 | |||
| 998 | Ga0070661_100003440 | |||
| 999 | Ga0070661_100018051 | |||
| 1000 | Ga0070692_10013172 | |||
| 1001 | Ga0070692_10013687 | |||
| 1002 | Ga0070668_100025701 | |||
| 1003 | Ga0070668_100201595 | |||
| 1004 | Ga0070668_100202098 | |||
| 1005 | Ga0070669_100001552 | |||
| 1006 | Ga0070669_100042432 | |||
| 1007 | Ga0070669_100050939 | |||
| 1008 | Ga0070669_100286396 | |||
| 1009 | Ga0070675_100011646 | |||
| 1010 | Ga0070675_100205049 | |||
| 1011 | Ga0070671_100000889 | |||
| 1012 | Ga0070671_100004731 | |||
| 1013 | Ga0070671_100117185 | |||
| 1014 | Ga0070671_100238220 | |||
| 1015 | Ga0070674_100001251 | |||
| 1016 | Ga0070674_100008867 | |||
| 1017 | Ga0070674_100012692 | |||
| 1018 | Ga0070673_100000050 | |||
| 1019 | Ga0070673_100141213 | |||
| 1020 | Ga0070688_100001813 | |||
| 1021 | Ga0070688_100004548 | |||
| 1022 | Ga0070688_100041335 | |||
| 1023 | Ga0070688_100043306 | |||
| 1024 | Ga0070688_100151520 | |||
| 1025 | Ga0070659_100011380 | |||
| 1026 | Ga0070659_100043607 | |||
| 1027 | Ga0070659_100136608 | |||
| 1028 | Ga0070667_100001872 | |||
| 1029 | Ga0070667_100038258 | |||
| 1030 | Ga0070667_100049643 | |||
| 1031 | Ga0070709_10000525 | |||
| 1032 | Ga0070709_10088719 | |||
| 1033 | Ga0070714_100039245 | |||
| 1034 | Ga0070714_100172671 | |||
| 1035 | Ga0070714_100186847 | |||
| 1036 | Ga0070713_100002218 | |||
| 1037 | Ga0070713_100006229 | |||
| 1038 | Ga0070713_100020864 | |||
| 1039 | Ga0070713_100075589 | |||
| 1040 | Ga0070713_100087367 | |||
| 1041 | Ga0070713_100104124 | |||
| 1042 | Ga0070713_100109412 | |||
| 1043 | Ga0070710_10000635 | |||
| 1044 | Ga0070710_10011579 | |||
| 1045 | Ga0070710_10037299 | |||
| 1046 | Ga0070710_10128956 | |||
| 1047 | Ga0070710_10152704 | |||
| 1048 | Ga0070701_10000093 | |||
| 1049 | Ga0070701_10045104 | |||
| 1050 | Ga0070701_10127992 | |||
| 1051 | Ga0070711_100004210 | |||
| 1052 | Ga0070711_100025068 | |||
| 1053 | Ga0070711_100036564 | |||
| 1054 | Ga0070711_100110943 | |||
| 1055 | Ga0070705_100003661 | |||
| 1056 | Ga0070700_100004285 | |||
| 1057 | Ga0070700_100058962 | |||
| 1058 | Ga0070700_100188668 | |||
| 1059 | Ga0070694_100004866 | |||
| 1060 | Ga0070694_100041729 | |||
| 1061 | Ga0070694_100064828 | |||
| 1062 | Ga0070663_100002633 | |||
| 1063 | Ga0070663_100047211 | |||
| 1064 | Ga0070663_100117061 | |||
| 1065 | Ga0070663_100120842 | |||
| 1066 | Ga0070663_100238191 | |||
| 1067 | Ga0070678_100010551 | |||
| 1068 | Ga0070678_100020541 | |||
| 1069 | Ga0070678_100062839 | |||
| 1070 | Ga0070678_100120174 | |||
| 1071 | Ga0070678_100149033 | |||
| 1072 | Ga0070678_100149391 | |||
| 1073 | Ga0070662_100021063 | |||
| 1074 | Ga0070662_100044031 | |||
| 1075 | Ga0070662_100161953 | |||
| 1076 | Ga0070681_10001623 | |||
| 1077 | Ga0070681_10065290 | |||
| 1078 | Ga0068867_100001138 | |||
| 1079 | Ga0068867_100013132 | |||
| 1080 | Ga0068867_100147037 | |||
| 1081 | Ga0068867_100169018 | |||
| 1082 | Ga0070685_10001254 | |||
| 1083 | Ga0070685_10024925 | |||
| 1084 | Ga0070685_10032155 | |||
| 1085 | Ga0070685_10164042 | |||
| 1086 | Ga0070707_100111151 | |||
| 1087 | Ga0070679_100055033 | |||
| 1088 | Ga0070679_100065552 | |||
| 1089 | Ga0070679_100144536 | |||
| 1090 | Ga0070679_100177560 | |||
| 1091 | Ga0070684_100011442 | |||
| 1092 | Ga0070684_100030528 | |||
| 1093 | Ga0070684_100050160 | |||
| 1094 | Ga0070684_100318971 | |||
| 1095 | Ga0068853_100009153 | |||
| 1096 | Ga0068853_100077959 | |||
| 1097 | Ga0070672_100155583 | |||
| 1098 | Ga0070686_100001868 | |||
| 1099 | Ga0070686_100002806 | |||
| 1100 | Ga0070686_100016931 | |||
| 1101 | Ga0070686_100032561 | |||
| 1102 | Ga0070686_100121068 | |||
| 1103 | Ga0070695_100018566 | |||
| 1104 | Ga0070695_100034489 | |||
| 1105 | Ga0070695_100109198 | |||
| 1106 | Ga0070696_100018921 | |||
| 1107 | Ga0070696_100021024 | |||
| 1108 | Ga0070696_100025251 | |||
| 1109 | Ga0070696_100067689 | |||
| 1110 | Ga0070693_100025096 | |||
| 1111 | Ga0070665_100009621 | |||
| 1112 | Ga0070665_100032380 | |||
| 1113 | Ga0070665_100053068 | |||
| 1114 | Ga0070665_100131953 | |||
| 1115 | Ga0070704_100000970 | |||
| 1116 | Ga0070704_100079559 | |||
| 1117 | Ga0068855_100009019 | |||
| 1118 | Ga0068855_100081242 | |||
| 1119 | Ga0068855_100084736 | |||
| 1120 | Ga0068855_100134563 | |||
| 1121 | Ga0068855_100161011 | |||
| 1122 | Ga0070664_100013823 | |||
| 1123 | Ga0070664_100022104 | |||
| 1124 | Ga0070664_100211796 | |||
| 1125 | Ga0070664_100412190 | |||
| 1126 | Ga0068857_100025388 | |||
| 1127 | Ga0068857_100036560 | |||
| 1128 | Ga0068857_100052885 | |||
| 1129 | Ga0068857_100114218 | |||
| 1130 | Ga0068854_100023018 | |||
| 1131 | Ga0068854_100136141 | |||
| 1132 | Ga0068856_100003821 | |||
| 1133 | Ga0068856_100070183 | |||
| 1134 | Ga0068856_100144726 | |||
| 1135 | Ga0068856_100156405 | |||
| 1136 | Ga0068856_100172012 | |||
| 1137 | Ga0068856_100371798 | |||
| 1138 | Ga0070702_100000497 | |||
| 1139 | Ga0070702_100065933 | |||
| 1140 | Ga0070702_100108090 | |||
| 1141 | Ga0068852_100001222 | |||
| 1142 | Ga0068852_100043163 | |||
| 1143 | Ga0068852_100047920 | |||
| 1144 | Ga0068859_100009942 | |||
| 1145 | Ga0068859_100014942 | |||
| 1146 | Ga0068864_100008385 | |||
| 1147 | Ga0068866_10007896 | |||
| 1148 | Ga0068866_10026422 | |||
| 1149 | Ga0068866_10038874 | |||
| 1150 | Ga0068866_10131713 | |||
| 1151 | Ga0068861_100048566 | |||
| 1152 | Ga0068861_100170931 | |||
| 1153 | Ga0068861_100222418 | |||
| 1154 | Ga0068861_100225740 | |||
| 1155 | Ga0068870_10000051 | |||
| 1156 | Ga0068870_10030865 | |||
| 1157 | Ga0068870_10069194 | |||
| 1158 | Ga0068863_100005913 | |||
| 1159 | Ga0068863_100020698 | |||
| 1160 | Ga0068858_100007984 | |||
| 1161 | Ga0068858_100023725 | |||
| 1162 | Ga0068858_100135051 | |||
| 1163 | Ga0068858_100207925 | |||
| 1164 | Ga0068860_100021096 | |||
| 1165 | Ga0068860_100031898 | |||
| 1166 | Ga0068860_100172660 | |||
| 1167 | Ga0068860_100298602 | |||
| 1168 | Ga0068860_100329578 | |||
| 1169 | Ga0068862_100212012 | |||
| 1170 | Ga0081455_10000081 | |||
| 1171 | Ga0081455_10006845 | |||
| 1172 | Ga0081455_10008003 | |||
| 1173 | Ga0081455_10010270 | |||
| 1174 | Ga0081455_10034931 | |||
| 1175 | Ga0081455_10035553 | |||
| 1176 | Ga0081455_10042591 | |||
| 1177 | Ga0081538_10033224 | |||
| 1178 | Ga0081538_10035779 | |||
| 1179 | Ga0081540_1003048 | |||
| 1180 | Ga0081540_1004585 | |||
| 1181 | Ga0081540_1011726 | |||
| 1182 | Ga0081540_1036983 | |||
| 1183 | Ga0081540_1054345 | |||
| 1184 | Ga0081540_1091720 | |||
| 1185 | Ga0081539_10000003 | |||
| 1186 | Ga0081539_10000306 | |||
| 1187 | Ga0081539_10002527 | |||
| 1188 | Ga0081539_10023760 | |||
| 1189 | Ga0070717_10020052 | |||
| 1190 | Ga0070717_10033974 | |||
| 1191 | Ga0070717_10111478 | |||
| 1192 | Ga0070717_10137306 | |||
| 1193 | Ga0075365_10048156 | |||
| 1194 | Ga0075365_10098902 | |||
| 1195 | Ga0075365_10202259 | |||
| 1196 | Ga0075363_100006875 | |||
| 1197 | Ga0075363_100048854 | |||
| 1198 | Ga0075363_100064238 | |||
| 1199 | Ga0075363_100130261 | |||
| 1200 | Ga0075364_10046435 | |||
| 1201 | Ga0075364_10108963 | |||
| 1202 | Ga0075364_10152018 | |||
| 1203 | Ga0075364_10178925 | |||
| 1204 | Ga0075432_10025053 | |||
| 1205 | Ga0070715_10002070 | |||
| 1206 | Ga0070715_10009060 | |||
| 1207 | Ga0070715_10046025 | |||
| 1208 | Ga0070716_100069879 | |||
| 1209 | Ga0070716_100089258 | |||
| 1210 | Ga0070712_100020258 | |||
| 1211 | Ga0070712_100058109 | |||
| 1212 | Ga0070712_100125157 | |||
| 1213 | Ga0070712_100214678 | |||
| 1214 | Ga0075362_10004304 | |||
| 1215 | Ga0075362_10085689 | |||
| 1216 | Ga0075367_10048054 | |||
| 1217 | Ga0075367_10056191 | |||
| 1218 | Ga0075367_10064177 | |||
| 1219 | Ga0075366_10011174 | |||
| 1220 | Ga0075366_10101753 | |||
| 1221 | Ga0075366_10160938 | |||
| 1222 | Ga0097621_100004220 | |||
| 1223 | Ga0075370_10010077 | |||
| 1224 | Ga0068871_100000576 | |||
| 1225 | Ga0068871_100025203 | |||
| 1226 | Ga0068871_100319663 | |||
| 1227 | Ga0075428_100003920 | |||
| 1228 | Ga0075428_100031029 | |||
| 1229 | Ga0075428_100142622 | |||
| 1230 | Ga0075428_100231714 | |||
| 1231 | Ga0075428_100415260 | |||
| 1232 | Ga0075430_100001133 | |||
| 1233 | Ga0075431_100003810 | |||
| 1234 | Ga0075431_100156439 | |||
| 1235 | Ga0075431_100171226 | |||
| 1236 | Ga0075433_10000012 | |||
| 1237 | Ga0075434_100000310 | |||
| 1238 | Ga0075434_100001837 | |||
| 1239 | Ga0075434_100026003 | |||
| 1240 | Ga0075434_100093858 | |||
| 1241 | Ga0075434_100361430 | |||
| 1242 | Ga0075434_100470295 | |||
| 1243 | Ga0075429_100000098 | |||
| 1244 | Ga0068865_100027909 | |||
| 1245 | Ga0068865_100037048 | |||
| 1246 | Ga0068865_100048077 | |||
| 1247 | Ga0075436_100023283 | |||
| 1248 | Ga0075436_100074113 | |||
| 1249 | Ga0097620_100009942 | |||
| 1250 | Ga0097620_100014943 | |||
| 1251 | Ga0099824_1039060 | |||
| 1252 | Ga0075435_100008925 | |||
| 1253 | Ga0075435_100034077 | |||
| 1254 | Ga0099795_10031576 | |||
| 1255 | Ga0105243_10197405 | |||
| 1256 | Ga0105238_10161699 | |||
| 1257 | Ga0105239_10228911 | |||
| 1258 | Ga0157372_10160573 | |||
| 1259 | Ga0163163_10064912 | |||
| 1260 | Ga0157379_10061381 | |||
| 1261 | Ga0182005_1011719 | |||
| 1262 | Ga0214544_1000136 | |||
| 1263 | Ga0214544_1018524 | |||
| 1264 | Ga0214542_1000127 | |||
| 1265 | Ga0214542_1018644 | |||
| 1266 | Ga0214545_1000063 | |||
| 1267 | Ga0214545_1019592 | |||
| 1268 | Ga0214543_1000238 | |||
| 1269 | Ga0213872_10023985 | |||
| 1270 | Ga0224572_1001293 | |||
| 1271 | Ga0228598_1012243 | |||
| 1272 | Ga0209148_1000529 | |||
| 1273 | Ga0209233_1001938 | |||
| 1274 | Ga0209233_1004282 | |||
| 1275 | Ga0207666_1000294 | |||
| 1276 | Ga0209455_1002870 | |||
| 1277 | Ga0209455_1007449 | |||
| 1278 | Ga0207673_1002060 | |||
| 1279 | Ga0209025_1043885 | |||
| 1280 | Ga0209564_1001218 | |||
| 1281 | Ga0209564_1005756 | |||
| 1282 | Ga0209564_1007436 | |||
| 1283 | Ga0209758_1000011 | |||
| 1284 | Ga0209758_1001693 | |||
| 1285 | Ga0209758_1003535 | |||
| 1286 | Ga0209758_1008617 | |||
| 1287 | Ga0209758_1013315 | |||
| 1288 | Ga0209256_1003503 | |||
| 1289 | Ga0207426_1000669 | |||
| 1290 | Ga0207426_1001272 | |||
| 1291 | Ga0207697_10000883 | |||
| 1292 | Ga0207653_10000546 | |||
| 1293 | Ga0207682_10000072 | |||
| 1294 | Ga0207682_10001384 | |||
| 1295 | Ga0207682_10037916 | |||
| 1296 | Ga0207692_10003747 | |||
| 1297 | Ga0207692_10021564 | |||
| 1298 | Ga0207692_10027919 | |||
| 1299 | Ga0207692_10045881 | |||
| 1300 | Ga0207692_10102421 | |||
| 1301 | Ga0207642_10069634 | |||
| 1302 | Ga0207710_10000558 | |||
| 1303 | Ga0207710_10005750 | |||
| 1304 | Ga0207710_10038320 | |||
| 1305 | Ga0207710_10053989 | |||
| 1306 | Ga0207688_10000329 | |||
| 1307 | Ga0207688_10131982 | |||
| 1308 | Ga0207680_10006444 | |||
| 1309 | Ga0207680_10009603 | |||
| 1310 | Ga0207680_10167041 | |||
| 1311 | Ga0207647_10015267 | |||
| 1312 | Ga0207647_10031280 | |||
| 1313 | Ga0207647_10123830 | |||
| 1314 | Ga0207685_10015324 | |||
| 1315 | Ga0207685_10030348 | |||
| 1316 | Ga0207699_10000365 | |||
| 1317 | Ga0207699_10013113 | |||
| 1318 | Ga0207699_10040973 | |||
| 1319 | Ga0207699_10057605 | |||
| 1320 | Ga0207699_10228019 | |||
| 1321 | Ga0207645_10001534 | |||
| 1322 | Ga0207645_10004741 | |||
| 1323 | Ga0207645_10007080 | |||
| 1324 | Ga0207645_10062196 | |||
| 1325 | Ga0207645_10127541 | |||
| 1326 | Ga0207643_10000004 | |||
| 1327 | Ga0207643_10019880 | |||
| 1328 | Ga0207643_10022650 | |||
| 1329 | Ga0207705_10080762 | |||
| 1330 | Ga0207705_10081108 | |||
| 1331 | Ga0207705_10092910 | |||
| 1332 | Ga0207684_10144485 | |||
| 1333 | Ga0207654_10000955 | |||
| 1334 | Ga0207654_10082892 | |||
| 1335 | Ga0207707_10010417 | |||
| 1336 | Ga0207707_10010719 | |||
| 1337 | Ga0207707_10015930 | |||
| 1338 | Ga0207707_10146806 | |||
| 1339 | Ga0207695_10000503 | |||
| 1340 | Ga0207695_10004855 | |||
| 1341 | Ga0207695_10064111 | |||
| 1342 | Ga0207695_10107255 | |||
| 1343 | Ga0207695_10248230 | |||
| 1344 | Ga0207671_10034616 | |||
| 1345 | Ga0207671_10226531 | |||
| 1346 | Ga0207671_10298324 | |||
| 1347 | Ga0207693_10002261 | |||
| 1348 | Ga0207693_10002741 | |||
| 1349 | Ga0207693_10007535 | |||
| 1350 | Ga0207693_10026950 | |||
| 1351 | Ga0207693_10030079 | |||
| 1352 | Ga0207693_10041528 | |||
| 1353 | Ga0207663_10000475 | |||
| 1354 | Ga0207663_10035092 | |||
| 1355 | Ga0207663_10116096 | |||
| 1356 | Ga0207660_10000648 | |||
| 1357 | Ga0207660_10010766 | |||
| 1358 | Ga0207662_10000456 | |||
| 1359 | Ga0207662_10002036 | |||
| 1360 | Ga0207662_10105458 | |||
| 1361 | Ga0207662_10159625 | |||
| 1362 | Ga0207657_10006593 | |||
| 1363 | Ga0207657_10053057 | |||
| 1364 | Ga0207657_10055350 | |||
| 1365 | Ga0207657_10079802 | |||
| 1366 | Ga0207657_10089683 | |||
| 1367 | Ga0207649_10000262 | |||
| 1368 | Ga0207652_10015412 | |||
| 1369 | Ga0207652_10033984 | |||
| 1370 | Ga0207652_10192779 | |||
| 1371 | Ga0207652_10296856 | |||
| 1372 | Ga0207681_10011215 | |||
| 1373 | Ga0207681_10058168 | |||
| 1374 | Ga0207681_10139073 | |||
| 1375 | Ga0207694_10000212 | |||
| 1376 | Ga0207694_10048000 | |||
| 1377 | Ga0207694_10070063 | |||
| 1378 | Ga0207694_10205909 | |||
| 1379 | Ga0207694_10250255 | |||
| 1380 | Ga0207650_10001947 | |||
| 1381 | Ga0207650_10004313 | |||
| 1382 | Ga0207650_10044435 | |||
| 1383 | Ga0207650_10060788 | |||
| 1384 | Ga0207650_10104966 | |||
| 1385 | Ga0207650_10150120 | |||
| 1386 | Ga0207650_10190838 | |||
| 1387 | Ga0207650_10202118 | |||
| 1388 | Ga0207659_10024061 | |||
| 1389 | Ga0207659_10271542 | |||
| 1390 | Ga0207687_10001501 | |||
| 1391 | Ga0207687_10045360 | |||
| 1392 | Ga0207687_10347868 | |||
| 1393 | Ga0207700_10008558 | |||
| 1394 | Ga0207700_10075285 | |||
| 1395 | Ga0207700_10102193 | |||
| 1396 | Ga0207700_10137441 | |||
| 1397 | Ga0207700_10185057 | |||
| 1398 | Ga0207700_10356952 | |||
| 1399 | Ga0207664_10112106 | |||
| 1400 | Ga0207664_10228326 | |||
| 1401 | Ga0207664_10233159 | |||
| 1402 | Ga0207644_10000467 | |||
| 1403 | Ga0207644_10006439 | |||
| 1404 | Ga0207644_10028393 | |||
| 1405 | Ga0207644_10077145 | |||
| 1406 | Ga0207644_10226352 | |||
| 1407 | Ga0207690_10001228 | |||
| 1408 | Ga0207690_10045739 | |||
| 1409 | Ga0207690_10050277 | |||
| 1410 | Ga0207690_10228713 | |||
| 1411 | Ga0207690_10228871 | |||
| 1412 | Ga0207706_10002789 | |||
| 1413 | Ga0207706_10019343 | |||
| 1414 | Ga0207706_10022888 | |||
| 1415 | Ga0207706_10048120 | |||
| 1416 | Ga0207686_10004704 | |||
| 1417 | Ga0207686_10013214 | |||
| 1418 | Ga0207686_10065671 | |||
| 1419 | Ga0207709_10026810 | |||
| 1420 | Ga0207709_10054126 | |||
| 1421 | Ga0207709_10061406 | |||
| 1422 | Ga0207670_10001648 | |||
| 1423 | Ga0207670_10009649 | |||
| 1424 | Ga0207670_10083388 | |||
| 1425 | Ga0207669_10002049 | |||
| 1426 | Ga0207669_10004490 | |||
| 1427 | Ga0207704_10008504 | |||
| 1428 | Ga0207704_10165715 | |||
| 1429 | Ga0207704_10179743 | |||
| 1430 | Ga0207665_10000090 | |||
| 1431 | Ga0207665_10001035 | |||
| 1432 | Ga0207665_10006306 | |||
| 1433 | Ga0207665_10102671 | |||
| 1434 | Ga0207665_10107032 | |||
| 1435 | Ga0207665_10109983 | |||
| 1436 | Ga0207691_10002658 | |||
| 1437 | Ga0207691_10003654 | |||
| 1438 | Ga0207691_10178715 | |||
| 1439 | Ga0207711_10031583 | |||
| 1440 | Ga0207711_10110870 | |||
| 1441 | Ga0207711_10126796 | |||
| 1442 | Ga0207689_10000203 | |||
| 1443 | Ga0207689_10003505 | |||
| 1444 | Ga0207689_10049085 | |||
| 1445 | Ga0207661_10013912 | |||
| 1446 | Ga0207661_10104692 | |||
| 1447 | Ga0207661_10231752 | |||
| 1448 | Ga0207679_10000157 | |||
| 1449 | Ga0207679_10038719 | |||
| 1450 | Ga0207679_10046306 | |||
| 1451 | Ga0207679_10347724 | |||
| 1452 | Ga0207667_10013999 | |||
| 1453 | Ga0207667_10049063 | |||
| 1454 | Ga0207667_10212568 | |||
| 1455 | Ga0207667_10480259 | |||
| 1456 | Ga0207651_10013916 | |||
| 1457 | Ga0207651_10022606 | |||
| 1458 | Ga0207712_10065223 | |||
| 1459 | Ga0207668_10025801 | |||
| 1460 | Ga0207668_10071074 | |||
| 1461 | Ga0207640_10003255 | |||
| 1462 | Ga0207640_10240971 | |||
| 1463 | Ga0207658_10055835 | |||
| 1464 | Ga0207658_10084461 | |||
| 1465 | Ga0207658_10120018 | |||
| 1466 | Ga0207677_10062746 | |||
| 1467 | Ga0207677_10117118 | |||
| 1468 | Ga0207677_10212642 | |||
| 1469 | Ga0207677_10248932 | |||
| 1470 | Ga0207703_10001346 | |||
| 1471 | Ga0207703_10006480 | |||
| 1472 | Ga0207703_10291949 | |||
| 1473 | Ga0207639_10006466 | |||
| 1474 | Ga0207639_10048698 | |||
| 1475 | Ga0207639_10062377 | |||
| 1476 | Ga0207639_10196447 | |||
| 1477 | Ga0207678_10002498 | |||
| 1478 | Ga0207678_10012062 | |||
| 1479 | Ga0207678_10088787 | |||
| 1480 | Ga0207678_10155535 | |||
| 1481 | Ga0207708_10000784 | |||
| 1482 | Ga0207708_10001393 | |||
| 1483 | Ga0207702_10000003 | |||
| 1484 | Ga0207702_10003404 | |||
| 1485 | Ga0207702_10086432 | |||
| 1486 | Ga0207702_10342313 | |||
| 1487 | Ga0207641_10006340 | |||
| 1488 | Ga0207641_10013359 | |||
| 1489 | Ga0207648_10001783 | |||
| 1490 | Ga0207648_10002310 | |||
| 1491 | Ga0207648_10011313 | |||
| 1492 | Ga0207648_10318318 | |||
| 1493 | Ga0207676_10000990 | |||
| 1494 | Ga0207676_10029007 | |||
| 1495 | Ga0207674_10002887 | |||
| 1496 | Ga0207674_10040792 | |||
| 1497 | Ga0207674_10059413 | |||
| 1498 | Ga0207675_100001741 | |||
| 1499 | Ga0207675_100002594 | |||
| 1500 | Ga0207683_10000824 | |||
| 1501 | Ga0207683_10001176 | |||
| 1502 | Ga0207683_10008180 | |||
| 1503 | Ga0207683_10010994 | |||
| 1504 | Ga0207683_10034926 | |||
| 1505 | Ga0207683_10176200 | |||
| 1506 | Ga0207683_10193163 | |||
| 1507 | Ga0207698_10013372 | |||
| 1508 | Ga0207698_10065776 | |||
| 1509 | Ga0209389_1000088 | |||
| 1510 | Ga0209589_1000007 | |||
| 1511 | Ga0209589_1000189 | |||
| 1512 | Ga0209489_100008 | |||
| 1513 | Ga0209489_100085 | |||
| 1514 | Ga0209700_100009 | |||
| 1515 | Ga0209998_10003384 | |||
| 1516 | Ga0207428_10000137 | |||
| 1517 | Ga0207428_10011738 | |||
| 1518 | Ga0268266_10001075 | |||
| 1519 | Ga0268266_10002267 | |||
| 1520 | Ga0268266_10014909 | |||
| 1521 | Ga0268266_10036292 | |||
| 1522 | Ga0268266_10046433 | |||
| 1523 | Ga0268266_10183323 | |||
| 1524 | Ga0268265_10002187 | |||
| 1525 | Ga0268265_10093297 | |||
| 1526 | Ga0268264_10000168 | |||
| 1527 | Ga0268264_10020190 | |||
| 1528 | Ga0268264_10266604 | |||
| 1529 | Ga0265337_1018093 | |||
| 1530 | Ga0265319_1026647 | |||
| 1531 | Ga0265318_10014356 | |||
| 1532 | Ga0265323_10004923 | |||
| 1533 | Ga0265336_10000865 | |||
| 1534 | Ga0307517_10000071 | |||
| 1535 | Ga0265338_10000085 | |||
| 1536 | Ga0265338_10117922 | |||
| 1537 | Ga0307511_10053640 | |||
| 1538 | Ga0265330_10037886 | |||
| 1539 | Ga0265328_10000982 | |||
| 1540 | Ga0265325_10000073 | |||
| 1541 | Ga0265325_10000234 | |||
| 1542 | Ga0265325_10012865 | |||
| 1543 | Ga0265325_10047437 | |||
| 1544 | Ga0265340_10013164 | |||
| 1545 | Ga0265340_10041090 | |||
| 1546 | Ga0265339_10002865 | |||
| 1547 | Ga0265339_10004523 | |||
| 1548 | Ga0265339_10016161 | |||
| 1549 | Ga0265339_10057944 | |||
| 1550 | Ga0265339_10069736 | |||
| 1551 | Ga0265327_10035869 | |||
| 1552 | Ga0265316_10040075 | |||
| 1553 | Ga0307408_100205491 | |||
| 1554 | Ga0265313_10003770 | |||
| 1555 | Ga0265313_10025133 | |||
| 1556 | Ga0265313_10026353 | |||
| 1557 | Ga0265313_10079360 | |||
| 1558 | Ga0307508_10000008 | |||
| 1559 | Ga0307508_10055649 | |||
| 1560 | Ga0307508_10212708 | |||
| 1561 | Ga0265314_10006006 | |||
| 1562 | Ga0265314_10023216 | |||
| 1563 | Ga0265314_10038356 | |||
| 1564 | Ga0265314_10040806 | |||
| 1565 | Ga0265342_10000548 | |||
| 1566 | Ga0265342_10011621 | |||
| 1567 | Ga0307406_10057596 | |||
| 1568 | Ga0307406_10161200 | |||
| 1569 | Ga0307415_100129931 | |||
| 1570 | Ga0307510_10200982 | |||
| 1571 | Ga0315911_1000004 | |||
| 1572 | Ga0373937_0005496 | |||
| 1573 | Ga0373925_0210419 | |||
| 1574 | Ga0395900_0001040 | |||
| 1575 | Ga0395900_0035092 | |||
| 1576 | Ga0395900_0174078 | |||
| 1577 | Ga0436364_0053055 | |||
| 1578 | Ga0395901_0157312 | |||
| 1579 | Ga0436365_1081029 | |||
| 1580 | Ga0436365_1440709 | |||
| 1581 | Ga0436360_0084371 | |||
| 1582 | Ga0436363_1162359 | |||
| 1583 | Ga0436363_1274559 | |||
| 1584 | Ga0466966_0016947 | |||
| 1585 | Ga0466961_0000060 | |||
| 1586 | Ga0466961_0223603 | |||
| 1587 | Ga0466957_0019803 | |||
| 1588 | Ga0466959_0010444 | |||
| 1589 | Ga0466959_0053246 | |||
| 1590 | Ga0466958_0049650 | |||
| 1591 | Ga0495631_0079938 | |||
| 1592 | Ga0495634_0153783 | |||
| 1593 | Ga0496100_0006810 | |||
| 1594 | Ga0496103_0039032 | |||
| 1595 | Ga0496103_0163568 | |||
| 1596 | Ga0496104_0022151 | |||
| 1597 | Ga0496104_0148088 | |||
| 1598 | Ga0496105_0000017 | |||
| 1599 | Ga0496105_0085676 | |||
| 1600 | Ga0496105_0192068 | |||
| 1601 | Ga0496106_0089703 | |||
| 1602 | Ga0496107_0076514 | |||
| 1603 | Ga0496108_0018798 | |||
| 1604 | Ga0496109_0208804 | |||
| 1605 | Ga0496110_0065486 | |||
| 1606 | Ga0496110_0194986 | |||
| 1607 | Ga0496111_0013938 | |||
| 1608 | Ga0496111_0122499 | |||
| 1609 | Ga0496112_0032501 | |||
| 1610 | Ga0496112_0194903 | |||
| 1611 | Ga0496113_0138101 | |||
| 1612 | Ga0496115_0147101 | |||
| 1613 | Ga0496116_0077993 | |||
| 1614 | Ga0496119_0001093 | |||
| 1615 | Ga0496121_0010429 | |||
| 1616 | Ga0496121_0080989 | |||
| 1617 | Ga0496125_0057353 | |||
| 1618 | Ga0496126_0025003 | |||
| 1619 | Ga0496126_0169680 | |||
| 1620 | Ga0496126_0283259 | |||
| 1621 | Ga0501031_0012876 | |||
| 1622 | Ga0501031_0019462 | |||
| 1623 | Ga0501032_0010837 | |||
| 1624 | Ga0501032_0012413 | |||
| 1625 | Ga0501033_0003732 | |||
| 1626 | Ga0501033_0023364 | |||
| 1627 | Ga0501034_0017043 | |||
| 1628 | Ga0501034_0064192 | |||
| 1629 | Ga0501036_0168935 | |||
| 1630 | Ga0501036_0170742 | |||
| 1631 | Ga0501037_0005052 | |||
| 1632 | Ga0501037_0028345 | |||
| 1633 | Ga0501037_0045419 | |||
| 1634 | Ga0501038_0007440 | |||
| 1635 | Ga0501038_0021514 | |||
| 1636 | Ga0501038_0076643 | |||
| 1637 | Ga0501038_0078114 | |||
| 1638 | Ga0501039_0065023 | |||
| 1639 | Ga0501039_0075724 | |||
| 1640 | Ga0501039_0145914 | |||
| 1641 | Ga0501041_0043287 | |||
| 1642 | Ga0501042_0064150 | |||
| 1643 | Ga0501042_0118757 | |||
| 1644 | Ga0501043_0000251 | |||
| 1645 | Ga0501043_0003880 | |||
| 1646 | Ga0501043_0045584 | |||
| 1647 | Ga0501046_0129748 | |||
| 1648 | Ga0501047_0000480 | |||
| 1649 | Ga0501047_0009581 | |||
| 1650 | Ga0501047_0192811 | |||
| 1651 | Ga0501047_0245663 | |||
| 1652 | Ga0501048_0020437 | |||
| 1653 | Ga0501048_0078033 | |||
| 1654 | Ga0501067_0019535 | |||
| 1655 | Ga0501067_0042504 | |||
| 1656 | Ga0501069_0017721 | |||
| 1657 | Ga0501069_0025858 | |||
| 1658 | Ga0501069_0196547 | |||
| 1659 | Ga0501070_0004158 | |||
| 1660 | Ga0501070_0121407 | |||
| 1661 | Ga0501072_0006969 | |||
| 1662 | Ga0501072_0037706 | |||
| 1663 | Ga0501072_0197017 | |||
| 1664 | Ga0501073_0083717 | |||
| 1665 | Ga0501073_0238014 | |||
| 1666 | Ga0501075_0011798 | |||
| 1667 | Ga0501076_0031681 | |||
| 1668 | Ga0501079_0042540 | |||
| 1669 | Ga0501080_0017082 | |||
| 1670 | Ga0501080_0019518 | |||
| 1671 | Ga0501080_0083287 | |||
| 1672 | Ga0501080_0112835 | |||
| 1673 | Ga0501080_0254928 | |||
| 1674 | Ga0501083_0002317 | |||
| 1675 | Ga0501083_0101074 | |||
| 1676 | Ga0501035_0006501 | |||
| 1677 | Ga0501035_0294088 | |||
| 1678 | Ga0501044_0006151 | |||
| 1679 | Ga0501044_0008552 | |||
| 1680 | Ga0501044_0096551 | |||
| 1681 | Ga0501044_0101218 | |||
| 1682 | Ga0501044_0122361 | |||
| 1683 | Ga0501044_0124729 | |||
| 1684 | nmdc:mga03n38_14619_c1 | |||
| 1685 | nmdc:mga00v17_34066_c1 | |||
| 1686 | nmdc:mga0yw44_95952_c1 | |||
| 1687 | nmdc:mga06z11_34133_c1 | |||
| 1688 | nmdc:mga06z11_87944_c1 | |||
| 1689 | nmdc:mga07m45_24279_c1 | |||
| 1690 | nmdc:mga07m45_36837_c1 | |||
| 1691 | nmdc:mga0n895_179615_c1 | |||
| 1692 | nmdc:mga0n895_7911_c1 | |||
| 1693 | nmdc:mga0n895_86222_c1 | |||
| 1694 | Ga0495601_0047589 | |||
| 1695 | Ga0495619_0103254 | |||
| 1696 | Ga0500583_0079399 | |||
| 1697 | Ga0500562_009706 | |||
| 1698 | Ga0500572_000411 | |||
| 1699 | Ga0500608_001603 | |||
| 1700 | Ga0500559_0000644 | |||
| 1701 | Ga0500559_0004658 | |||
| 1702 | Ga0500577_0001900 | |||
| 1703 | Ga0500630_001521 | |||
| 1704 | Ga0500638_005425 | |||
| 1705 | Ga0500639_000135 | |||
| 1706 | Ga0500639_017812 | |||
| 1707 | Ga0501084_0055145 | |||
| 1708 | Ga0501084_0066139 | |||
| 1709 | Ga0501084_0073128 | |||
| 1710 | Ga0501082_0002026 | |||
| 1711 | Ga0501082_0005794 | |||
| 1712 | Ga0501082_0014291 | |||
| 1713 | Ga0501082_0048340 | |||
| 1714 | 2829748377 | |||
| 1715 | 2507507233 | |||
| 1716 | 2508541285 | |||
| 1717 | 2508693386 | |||
| 1718 | 2509080144 | |||
| 1719 | 2509148777 | |||
| 1720 | 2511395818 | |||
| 1721 | 2513592465 | |||
| 1722 | 2513626425 | |||
| 1723 | 2513652476 | |||
| 1724 | 2513657630 | |||
| 1725 | 2513677089 | |||
| 1726 | 2513693238 | |||
| 1727 | 2513705066 | |||
| 1728 | 2513862098 | |||
| 1729 | 2513876705 | |||
| 1730 | 2513919629 | |||
| 1731 | 2514012250 | |||
| 1732 | 2515628747 | |||
| 1733 | 2517104840 | |||
| 1734 | 2517895373 | |||
| 1735 | 2524440649 | |||
| 1736 | 2524467710 | |||
| 1737 | 2524540525 | |||
| 1738 | 2528853623 | |||
| 1739 | 2545676985 | |||
| 1740 | 2617347958 | |||
| 1741 | 2617377817 | |||
| 1742 | 2644168926 | |||
| 1743 | 2644289426 | |||
| 1744 | 2644347478 | |||
| 1745 | 2671120290 | |||
| 1746 | 2723848145 | |||
| 1747 | 2728750892 | |||
| 1748 | 2739350716 | |||
| 1749 | 2745077891 | |||
| 1750 | 2774872826 | |||
| 1751 | 2776261667 | |||
| 1752 | 2793069347 | |||
| 1753 | 2793078147 | |||
| 1754 | 2805918685 | |||
| 1755 | 2818237023 | |||
| 1756 | 2835313252 | |||
| 1757 | 2861693706 | |||
| 1758 | 2882456927 | |||
| 1759 | 2894233923 | |||
| 1760 | 2904698712 | |||
| 1761 | 2932789418 | |||
| 1762 | 2932797758 | |||
| 1763 | 2932804276 | |||
| 1764 | 2932816467 | |||
| 1765 | 2932827195 | |||
| 1766 | 2932832025 | |||
| 1767 | 2933584761 | |||
| 1768 | 2935610389 | |||
| 1769 | 2935621964 | |||
| 1770 | 2935631109 | |||
| 1771 | 2935644026 | |||
| 1772 | 2935651365 | |||
| 1773 | 2935659545 | |||
| 1774 | 2935669059 | |||
| 1775 | 2935683383 | |||
| 1776 | 2935692323 | |||
| 1777 | 2935700505 | |||
| 1778 | 2935708866 | |||
| 1779 | 2935720439 | |||
| 1780 | 2935729720 | |||
| 1781 | 2935739298 | |||
| 1782 | 2935748161 | |||
| 1783 | 2935758364 | |||
| 1784 | 2935767442 | |||
| 1785 | 2935771077 | |||
| 1786 | 2935781245 | |||
| 1787 | 2935786222 | |||
| 1788 | 2935793981 | |||
| 1789 | 2935805775 | |||
| 1790 | 2935815667 | |||
| 1791 | 2935823550 | |||
| 1792 | 2935833278 | |||
| 1793 | 2935843146 | |||
| 1794 | 2935849075 | |||
| 1795 | 2935860211 | |||
| 1796 | 2935867608 | |||
| 1797 | 2935878582 | |||
| 1798 | 2935888302 | |||
| 1799 | 2935912836 | |||
| 1800 | 2935922845 | |||
| 1801 | 2935930270 | |||
| 1802 | 2935939171 | |||
| 1803 | 2935946118 | |||
| 1804 | 2935955455 | |||
| 1805 | 2935965282 | |||
| 1806 | 2935972174 | |||
| 1807 | 2935976099 | |||
| 1808 | 2935986407 | |||
| 1809 | 2935998141 | |||
| 1810 | 2936006841 | |||
| 1811 | 2936013960 | |||
| 1812 | 2936022516 | |||
| 1813 | 2936035565 | |||
| 1814 | 2936040905 | |||
| 1815 | 2936049066 | |||
| 1816 | 2936060356 | |||
| 1817 | 2940564268 | |||
| 1818 | 2941507761 | |||
| 1819 | 2941516187 | |||
| 1820 | 2941523104 | |||
| 1821 | 2941531654 | |||
| 1822 | 2941544692 | |||
| 1823 | 3003671840 | |||
| 1824 | 3005476965 | |||
| 1825 | 3005485650 | |||
| 1826 | 3005511591 | |||
| 1827 | 3005594474 | |||
| 1828 | 3005600821 | |||
| 1829 | 3005716233 | |||
| 1830 | 3005723611 | |||
| 1831 | 641641029 | |||
| 1832 | 643599209 | |||
| 1833 | 8001850309 | |||
| 1834 | 8006934455 | |||
| 1835 | 8006968920 | |||
| 1836 | 8006974425 | |||
| 1837 | 8006985199 | |||
| 1838 | 8007000890 | |||
| 1839 | 8016528055 | |||
| 1840 | 8016533177 | |||
| 1841 | 8016564061 | |||
| 1842 | 8016575751 | |||
| 1843 | 8016594940 | |||
| 1844 | 8016601769 | |||
| 1845 | 8016608485 | |||
| 1846 | 8016616385 | |||
| 1847 | 8016624751 | |||
| 1848 | 8017065412 | |||
| 1849 | 8019532975 | |||
| 1850 | 8019546873 | |||
| 1851 | 8019551792 | |||
| 1852 | 8019564228 | |||
| 1853 | 8019574308 | |||
| 1854 | 8019584805 | |||
| 1855 | 8019592752 | |||
| 1856 | 8019598693 | |||
| 1857 | 8019609677 | |||
| 1858 | 8019620269 | |||
| 1859 | 8019655595 | |||
| 1860 | 8019660692 | |||
| 1861 | 8019670106 | |||
| 1862 | 8019685988 | |||
| 1863 | 8019692148 | |||
| 1864 | 8055744603 | |||
| 1865 | 8056675952 | |||
| 1866 | 8056682207 | |||
| 1867 | 8056690359 | |||
| 1868 | 8056971886 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8s9n-assembly1.cif.gz_A-2 | dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - c2 crystal form | 0.8579 | 24 | 271 |
| 8s9o-assembly1.cif.gz_A | dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form | 0.8483 | 24 | 271 |
| 5hek-assembly2.cif.gz_C | crystal structure of m1.hpyavi | 0.8469 | 23 | 267 |
| 1g60-assembly1.cif.gz_B | crystal structure of methyltransferase mboiia (moraxella bovis) | 0.8455 | 24 | 269 |
| 5hfj-assembly3.cif.gz_D | crystal structure of m1.hpyavi-sam complex | 0.8442 | 23 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1g60B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8455 | 24 | 269 | 3.40.50.150 |
| af_Q4E4W2_8_255_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8432 | 221 | 266 | 3.40.50.150 |
| 3tm4B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8356 | 26 | 158 | 3.40.50.150 |
| 1g60B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8243 | 24 | 269 | 3.40.50.150 |
| 3tmaA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.822 | 26 | 158 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A850NR23-F1-model_v4 | RAMA domain-containing protein | 0.9727 | 292 | 374 |
|
| AF-A0A2N3C8Q8-F1-model_v4 | Modification methylase | 0.9628 | 287 | 376 |
GO:0008168
GO:0032259 |
| AF-A0A435UNH2-F1-model_v4 | Modification methylase | 0.9601 | 292 | 379 |
GO:0008168
GO:0032259 |
| AF-A0A435UNH2-F1-model_v4 | Modification methylase | 0.9394 | 292 | 379 |
GO:0008168
GO:0032259 |
| AF-A0A5A7NKG5-F1-model_v4 | RAMA domain-containing protein | 0.9355 | 297 | 375 |
|